F485204

General Info

Members Datasets Scaffolds Average Seq Length
902 355 1804 108

Family's Representative Sequence

Representative Sequence 3300012482|Ga0157318_1020908|Ga0157318_10209082
Length 121
Sequence MGINIRDLLVTYHRSVTDDDRVFRALADPTRRHLLDRLFERDGRTLTELESELEMTRFGVMKHLRVLEDAGLVVTERQGREKLHYLNPVPIRLIHDRWIDKYTEHRVSALAELKTRLEEPA

Samples

Sample ID Description Type Environment
1 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
100 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
101 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
214 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
217 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
220 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
221 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
247 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
248 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
256 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
283 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
284 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
285 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
288 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
321 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
325 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
326 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
327 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
328 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
329 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
330 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
333 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 9.2
Rhizosphere 89.8
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157318_1020908 3300012482 Bacteria 581
2 JGI24747J21853_1041561 3300001978 Bacteria 546
3 Ga0065715_11166478 3300005293 Bacteria 505
4 Ga0065707_10114997 3300005295 Bacteria 2281
5 Ga0070658_10006612 3300005327 Bacteria 9398
6 Ga0070658_10442861 3300005327 Bacteria 1119
7 Ga0070658_11160833 3300005327 Bacteria 671
8 Ga0070683_100019179 3300005329 Bacteria 6072
9 Ga0070683_100116390 3300005329 Bacteria 2524
10 Ga0070677_10014097 3300005333 Bacteria 2807
11 Ga0068869_101270559 3300005334 Bacteria 649
12 Ga0070666_10636043 3300005335 Bacteria 780
13 Ga0070666_10721288 3300005335 Bacteria 732
14 Ga0070680_100192334 3300005336 Bacteria 1719
15 Ga0070680_100360452 3300005336 Bacteria 1237
16 Ga0070680_100389747 3300005336 Bacteria 1187
17 Ga0070680_100525603 3300005336 Bacteria 1013
18 Ga0070682_100012531 3300005337 Bacteria 4863
19 Ga0070682_100195406 3300005337 Bacteria 1423
20 Ga0070682_100402386 3300005337 Bacteria 1036
21 Ga0070682_100503978 3300005337 Bacteria 938
22 Ga0068868_100824116 3300005338 Bacteria 839
23 Ga0068868_100945621 3300005338 Bacteria 786
24 Ga0070660_100000845 3300005339 Bacteria 20392
25 Ga0070660_100071047 3300005339 Bacteria 2717
26 Ga0070660_100094695 3300005339 Bacteria 2359
27 Ga0070660_100145211 3300005339 Bacteria 1905
28 Ga0070660_100218554 3300005339 Bacteria 1548
29 Ga0070660_100919796 3300005339 Bacteria 738
30 Ga0070687_100082425 3300005343 Bacteria 1759
31 Ga0070687_100243655 3300005343 Bacteria 1113
32 Ga0070661_100008820 3300005344 Bacteria 6977
33 Ga0070661_100242294 3300005344 Bacteria 1389
34 Ga0070661_100617509 3300005344 Bacteria 878
35 Ga0070668_101740992 3300005347 Bacteria 572
36 Ga0070669_101098823 3300005353 Bacteria 685
37 Ga0070675_100520075 3300005354 Bacteria 1074
38 Ga0070671_100020998 3300005355 Bacteria 5328
39 Ga0070671_100075838 3300005355 Bacteria 2809
40 Ga0070671_101195932 3300005355 Bacteria 669
41 Ga0070671_101241315 3300005355 Bacteria 656
42 Ga0070671_101247803 3300005355 Bacteria 655
43 Ga0070674_100395408 3300005356 Bacteria 1128
44 Ga0070688_100302471 3300005365 Bacteria 1157
45 Ga0070659_100108056 3300005366 Bacteria 2244
46 Ga0070659_100215699 3300005366 Bacteria 1583
47 Ga0070659_100294259 3300005366 Bacteria 1352
48 Ga0070667_100545349 3300005367 Bacteria 1066
49 Ga0070709_10007139 3300005434 Bacteria 6116
50 Ga0070709_10033722 3300005434 Bacteria 3099
51 Ga0070709_10070694 3300005434 Bacteria 2250
52 Ga0070709_10105729 3300005434 Bacteria 1883
53 Ga0070709_10407341 3300005434 Bacteria 1017
54 Ga0070714_100147470 3300005435 Bacteria 2117
55 Ga0070714_100304990 3300005435 Bacteria 1485
56 Ga0070714_100779128 3300005435 Bacteria 925
57 Ga0070714_101436292 3300005435 Bacteria 674
58 Ga0070714_101752462 3300005435 Bacteria 606
59 Ga0070714_101768210 3300005435 Bacteria 604
60 Ga0070713_100011491 3300005436 Bacteria 6450
61 Ga0070713_100017869 3300005436 Bacteria 5378
62 Ga0070713_100027721 3300005436 Bacteria 4463
63 Ga0070710_10001541 3300005437 Bacteria 10892
64 Ga0070710_10139904 3300005437 Bacteria 1483
65 Ga0070710_10183210 3300005437 Bacteria 1312
66 Ga0070701_10084634 3300005438 Bacteria 1725
67 Ga0070701_10329604 3300005438 Bacteria 947
68 Ga0070701_10408576 3300005438 Bacteria 862
69 Ga0070711_100040213 3300005439 Bacteria 3152
70 Ga0070711_100061173 3300005439 Bacteria 2621
71 Ga0070711_100091316 3300005439 Bacteria 2195
72 Ga0070711_100196335 3300005439 Bacteria 1554
73 Ga0070711_101894372 3300005439 Bacteria 524
74 Ga0070705_100051622 3300005440 Bacteria 2399
75 Ga0070705_101535389 3300005440 Bacteria 559
76 Ga0070694_100140091 3300005444 Bacteria 1756
77 Ga0070694_100167409 3300005444 Bacteria 1617
78 Ga0070694_101242209 3300005444 Bacteria 625
79 Ga0070708_100003239 3300005445 Bacteria 12701
80 Ga0070663_100090609 3300005455 Bacteria 2265
81 Ga0070663_100436429 3300005455 Bacteria 1077
82 Ga0070663_100730869 3300005455 Bacteria 844
83 Ga0070678_100067677 3300005456 Bacteria 2659
84 Ga0070681_10002222 3300005458 Bacteria 17679
85 Ga0070681_10038733 3300005458 Bacteria 4779
86 Ga0070681_10069515 3300005458 Bacteria 3487
87 Ga0070681_10082372 3300005458 Bacteria 3173
88 Ga0070681_10263363 3300005458 Bacteria 1636
89 Ga0070681_10365303 3300005458 Bacteria 1354
90 Ga0070681_10544854 3300005458 Bacteria 1074
91 Ga0070681_10677000 3300005458 Bacteria 947
92 Ga0070681_10918777 3300005458 Bacteria 794
93 Ga0070707_100042774 3300005468 Bacteria 4337
94 Ga0070707_100063486 3300005468 Bacteria 3544
95 Ga0070707_100064931 3300005468 Bacteria 3506
96 Ga0070707_100372381 3300005468 Bacteria 1388
97 Ga0070707_100404209 3300005468 Bacteria 1326
98 Ga0070698_100037166 3300005471 Bacteria 5022
99 Ga0070698_100081971 3300005471 Bacteria 3219
100 Ga0070699_100173377 3300005518 Bacteria 1912
101 Ga0070699_100860897 3300005518 Bacteria 830
102 Ga0070679_100010278 3300005530 Bacteria 8872
103 Ga0070679_100042124 3300005530 Bacteria 4547
104 Ga0070679_100051918 3300005530 Bacteria 4085
105 Ga0070679_100058346 3300005530 Bacteria 3846
106 Ga0070679_100662889 3300005530 Bacteria 986
107 Ga0070679_100895774 3300005530 Bacteria 831
108 Ga0070679_101058679 3300005530 Bacteria 756
109 Ga0070679_101165231 3300005530 Bacteria 716
110 Ga0070684_100250686 3300005535 Bacteria 1618
111 Ga0070684_100404129 3300005535 Bacteria 1259
112 Ga0070684_101200244 3300005535 Bacteria 714
113 Ga0070684_101569209 3300005535 Bacteria 621
114 Ga0070697_100164982 3300005536 Bacteria 1873
115 Ga0070697_100859381 3300005536 Bacteria 804
116 Ga0070697_101247096 3300005536 Bacteria 663
117 Ga0068853_100201009 3300005539 Bacteria 1814
118 Ga0068853_102280449 3300005539 Bacteria 525
119 Ga0070672_100160878 3300005543 Bacteria 1863
120 Ga0070686_100218193 3300005544 Bacteria 1377
121 Ga0070696_100025401 3300005546 Bacteria 4028
122 Ga0070693_100022549 3300005547 Bacteria 3350
123 Ga0070693_101470162 3300005547 Bacteria 532
124 Ga0070665_100060497 3300005548 Bacteria 3796
125 Ga0070665_100142437 3300005548 Bacteria 2400
126 Ga0070704_100003204 3300005549 Bacteria 9358
127 Ga0068855_100058515 3300005563 Bacteria 4512
128 Ga0068855_100086304 3300005563 Bacteria 3629
129 Ga0068855_100113647 3300005563 Bacteria 3106
130 Ga0068855_100114191 3300005563 Bacteria 3097
131 Ga0068855_100215964 3300005563 Bacteria 2153
132 Ga0068855_100298165 3300005563 Bacteria 1786
133 Ga0070664_100288939 3300005564 Bacteria 1480
134 Ga0070664_100790550 3300005564 Bacteria 887
135 Ga0068857_100186875 3300005577 Bacteria 1887
136 Ga0068857_101025622 3300005577 Bacteria 795
137 Ga0068854_100499535 3300005578 Bacteria 1024
138 Ga0068856_100017429 3300005614 Bacteria 6959
139 Ga0068856_100037784 3300005614 Bacteria 4738
140 Ga0068856_100100280 3300005614 Bacteria 2888
141 Ga0068856_100148579 3300005614 Bacteria 2351
142 Ga0068856_100357205 3300005614 Bacteria 1480
143 Ga0068856_100387687 3300005614 Bacteria 1417
144 Ga0068856_101411706 3300005614 Bacteria 711
145 Ga0070702_100280559 3300005615 Bacteria 1144
146 Ga0070702_101268893 3300005615 Bacteria 597
147 Ga0068852_100123223 3300005616 Bacteria 2377
148 Ga0068852_100587049 3300005616 Bacteria 1117
149 Ga0068852_100607139 3300005616 Bacteria 1099
150 Ga0068852_100856126 3300005616 Bacteria 925
151 Ga0068852_101547530 3300005616 Bacteria 685
152 Ga0068859_100111247 3300005617 Bacteria 2801
153 Ga0068864_100105670 3300005618 Bacteria 2502
154 Ga0068861_101246886 3300005719 Bacteria 721
155 Ga0068851_10035819 3300005834 Bacteria 2483
156 Ga0068863_100089826 3300005841 Bacteria 2913
157 Ga0068863_100142403 3300005841 Bacteria 2292
158 Ga0068858_100211006 3300005842 Bacteria 1837
159 Ga0068858_100956294 3300005842 Bacteria 839
160 Ga0068862_100185680 3300005844 Bacteria 1868
161 Ga0081455_10326457 3300005937 Bacteria 1091
162 Ga0081455_10857349 3300005937 Bacteria 567
163 Ga0081538_10014190 3300005981 Bacteria 6258
164 Ga0081538_10047689 3300005981 Bacteria 2624
165 Ga0081540_1037480 3300005983 Bacteria 2569
166 Ga0070717_10232183 3300006028 Bacteria 1624
167 Ga0070717_10883692 3300006028 Bacteria 813
168 Ga0075364_10006466 3300006051 Bacteria 6884
169 Ga0075432_10381697 3300006058 Bacteria 604
170 Ga0070715_10000969 3300006163 Bacteria 8004
171 Ga0070715_10023547 3300006163 Bacteria 2414
172 Ga0070715_10083497 3300006163 Bacteria 1455
173 Ga0070715_10192086 3300006163 Unclassified 1031
174 Ga0070716_100001514 3300006173 Bacteria 10391
175 Ga0070716_100004482 3300006173 Bacteria 6680
176 Ga0070716_100014496 3300006173 Bacteria 4037
177 Ga0070712_100074279 3300006175 Bacteria 2442
178 Ga0070712_100226950 3300006175 Bacteria 1481
179 Ga0070712_101933119 3300006175 Bacteria 517
180 Ga0097621_100005462 3300006237 Bacteria 8948
181 Ga0097621_100404620 3300006237 Bacteria 1222
182 Ga0097621_101068966 3300006237 Bacteria 757
183 Ga0068871_100013653 3300006358 Bacteria 6033
184 Ga0075428_100001095 3300006844 Bacteria 28841
185 Ga0075428_100129386 3300006844 Bacteria 2747
186 Ga0075428_100164548 3300006844 Bacteria 2406
187 Ga0075428_100318640 3300006844 Bacteria 1671
188 Ga0075428_102525011 3300006844 Bacteria 526
189 Ga0075430_100002287 3300006846 Bacteria 15872
190 Ga0075430_100572017 3300006846 Bacteria 932
191 Ga0075431_100003671 3300006847 Bacteria 14896
192 Ga0075431_100094282 3300006847 Bacteria 3089
193 Ga0075431_100149285 3300006847 Bacteria 2407
194 Ga0075431_100445112 3300006847 Bacteria 1292
195 Ga0075431_101215883 3300006847 Bacteria 716
196 Ga0075431_101644503 3300006847 Bacteria 599
197 Ga0075433_10121604 3300006852 Bacteria 2318
198 Ga0075433_10431498 3300006852 Bacteria 1162
199 Ga0075434_100328660 3300006871 Bacteria 1549
200 Ga0075434_100355042 3300006871 Bacteria 1487
201 Ga0075434_100560999 3300006871 Bacteria 1161
202 Ga0075429_100000709 3300006880 Bacteria 26067
203 Ga0075429_101848661 3300006880 Bacteria 524
204 Ga0068865_100033461 3300006881 Bacteria 3441
205 Ga0075436_100362575 3300006914 Bacteria 1046
206 Ga0075436_100805247 3300006914 Bacteria 700
207 Ga0075436_101476079 3300006914 Unclassified 516
208 Ga0097620_100111250 3300006931 Bacteria 2801
209 Ga0075435_100066255 3300007076 Bacteria 2938
210 Ga0075435_100087048 3300007076 Bacteria 2573
211 Ga0075435_100092201 3300007076 Bacteria 2501
212 Ga0099794_10021063 3300007265 Bacteria 2959
213 Ga0099794_10034273 3300007265 Unclassified 2391
214 Ga0099795_10369031 3300007788 Bacteria 646
215 Ga0105240_10315938 3300009093 Bacteria 1782
216 Ga0105240_10714499 3300009093 Bacteria 1093
217 Ga0105240_10757168 3300009093 Bacteria 1055
218 Ga0105240_11214092 3300009093 Bacteria 798
219 Ga0111539_10005499 3300009094 Bacteria 16396
220 Ga0105247_10140665 3300009101 Bacteria 1581
221 Ga0114129_10226391 3300009147 Bacteria 2520
222 Ga0114129_10475348 3300009147 Bacteria 1636
223 Ga0114129_10601500 3300009147 Bacteria 1424
224 Ga0114129_10757482 3300009147 Bacteria 1242
225 Ga0105243_10580398 3300009148 Bacteria 1076
226 Ga0105241_10030949 3300009174 Bacteria 4003
227 Ga0105241_10454607 3300009174 Bacteria 1133
228 Ga0105241_10496522 3300009174 Bacteria 1087
229 Ga0105241_10943897 3300009174 Bacteria 804
230 Ga0105241_11062272 3300009174 Bacteria 760
231 Ga0105241_11932295 3300009174 Bacteria 579
232 Ga0105242_10048454 3300009176 Bacteria 3453
233 Ga0105242_10162152 3300009176 Bacteria 1958
234 Ga0105242_10363995 3300009176 Bacteria 1339
235 Ga0105248_10066494 3300009177 Bacteria 4048
236 Ga0105248_12199346 3300009177 Bacteria 628
237 Ga0105237_10010559 3300009545 Bacteria 9813
238 Ga0105237_10054969 3300009545 Bacteria 3988
239 Ga0105237_11023805 3300009545 Bacteria 833
240 Ga0105238_10010847 3300009551 Bacteria 9158
241 Ga0105238_10107225 3300009551 Bacteria 2775
242 Ga0105238_10316122 3300009551 Bacteria 1547
243 Ga0105238_10506995 3300009551 Bacteria 1208
244 Ga0105238_10890828 3300009551 Bacteria 908
245 Ga0105249_10082487 3300009553 Bacteria 2991
246 Ga0105239_10069035 3300010375 Bacteria 3883
247 Ga0105239_10423492 3300010375 Bacteria 1508
248 Ga0105239_12027416 3300010375 Bacteria 668
249 Ga0105246_10128813 3300011119 Bacteria 1887
250 Ga0105246_11492072 3300011119 Bacteria 635
251 Ga0157347_1016904 3300012502 Bacteria 825
252 Ga0157339_1047724 3300012505 Bacteria 557
253 Ga0157327_1061780 3300012512 Bacteria 560
254 Ga0157373_10086126 3300013100 Bacteria 2214
255 Ga0157373_10610619 3300013100 Bacteria 794
256 Ga0157373_10961935 3300013100 Bacteria 636
257 Ga0157371_10396342 3300013102 Bacteria 1009
258 Ga0157370_10089264 3300013104 Bacteria 2896
259 Ga0157370_10106604 3300013104 Bacteria 2622
260 Ga0157370_10842433 3300013104 Bacteria 833
261 Ga0157369_10030900 3300013105 Bacteria 5903
262 Ga0157369_10140493 3300013105 Bacteria 2556
263 Ga0157369_10583168 3300013105 Bacteria 1155
264 Ga0157374_10096924 3300013296 Bacteria 2821
265 Ga0157374_10280126 3300013296 Bacteria 1646
266 Ga0157374_10304125 3300013296 Bacteria 1578
267 Ga0157374_10594525 3300013296 Bacteria 1116
268 Ga0157378_10415994 3300013297 Bacteria 1328
269 Ga0157378_12067710 3300013297 Bacteria 620
270 Ga0163162_10128953 3300013306 Bacteria 2637
271 Ga0163162_10546309 3300013306 Bacteria 1287
272 Ga0157372_10022053 3300013307 Bacteria 6886
273 Ga0157372_10083879 3300013307 Bacteria 3610
274 Ga0157372_10114949 3300013307 Bacteria 3085
275 Ga0157372_10673334 3300013307 Bacteria 1204
276 Ga0157372_10766416 3300013307 Bacteria 1122
277 Ga0157372_10842309 3300013307 Bacteria 1065
278 Ga0157372_11147898 3300013307 Bacteria 898
279 Ga0157375_10205093 3300013308 Bacteria 2128
280 Ga0157375_10281319 3300013308 Unclassified 1827
281 Ga0157375_10796592 3300013308 Bacteria 1094
282 Ga0157380_10055047 3300014326 Bacteria 3158
283 Ga0157380_10087842 3300014326 Bacteria 2557
284 Ga0157380_10247967 3300014326 Bacteria 1610
285 Ga0157380_10842355 3300014326 Bacteria 938
286 Ga0182008_10072939 3300014497 Bacteria 1689
287 Ga0182008_10416045 3300014497 Bacteria 725
288 Ga0157377_11092328 3300014745 Bacteria 610
289 Ga0157379_10305093 3300014968 Bacteria 1451
290 Ga0157379_10755990 3300014968 Bacteria 915
291 Ga0157379_12135795 3300014968 Bacteria 555
292 Ga0157379_12439219 3300014968 Bacteria 522
293 Ga0157376_10002936 3300014969 Bacteria 11703
294 Ga0157376_10102177 3300014969 Bacteria 2507
295 Ga0157376_10184534 3300014969 Bacteria 1909
296 Ga0157376_11281824 3300014969 Bacteria 762
297 Ga0157376_11660308 3300014969 Bacteria 674
298 Ga0157376_12238159 3300014969 Bacteria 586
299 Ga0163161_10194514 3300017792 Bacteria 1560
300 Ga0163161_11894027 3300017792 Bacteria 531
301 Ga0197907_10117703 3300020069 Bacteria 1261
302 Ga0197907_10265434 3300020069 Bacteria 607
303 Ga0206356_10681064 3300020070 Bacteria 2770
304 Ga0206356_10964136 3300020070 Bacteria 1490
305 Ga0206356_11774256 3300020070 Bacteria 3272
306 Ga0206354_10360016 3300020081 Bacteria 1924
307 Ga0206354_11256277 3300020081 Bacteria 767
308 Ga0206353_10104596 3300020082 Bacteria 1412
309 Ga0206353_10453214 3300020082 Bacteria 5367
310 Ga0213876_10009317 3300021384 Bacteria 5288
311 Ga0213876_10231716 3300021384 Bacteria 982
312 Ga0207656_10147601 3300025321 Bacteria 1112
313 Ga0207682_10172280 3300025893 Bacteria 985
314 Ga0207692_10004268 3300025898 Bacteria 5650
315 Ga0207692_10114791 3300025898 Bacteria 1499
316 Ga0207692_10214459 3300025898 Bacteria 1138
317 Ga0207692_10808771 3300025898 Bacteria 613
318 Ga0207680_10771602 3300025903 Bacteria 689
319 Ga0207685_10006238 3300025905 Bacteria 3229
320 Ga0207685_10050701 3300025905 Bacteria 1600
321 Ga0207685_10248674 3300025905 Bacteria 859
322 Ga0207685_10274174 3300025905 Unclassified 825
323 Ga0207699_10009410 3300025906 Bacteria 4864
324 Ga0207699_10106642 3300025906 Bacteria 1788
325 Ga0207699_10110129 3300025906 Bacteria 1763
326 Ga0207699_10186861 3300025906 Bacteria 1396
327 Ga0207699_10299450 3300025906 Bacteria 1122
328 Ga0207699_10964205 3300025906 Bacteria 630
329 Ga0207643_10428014 3300025908 Bacteria 840
330 Ga0207705_10151920 3300025909 Bacteria 1735
331 Ga0207705_10414565 3300025909 Bacteria 1042
332 Ga0207705_10517591 3300025909 Bacteria 927
333 Ga0207654_10099637 3300025911 Bacteria 1788
334 Ga0207654_10338346 3300025911 Bacteria 1033
335 Ga0207707_10030395 3300025912 Bacteria 4726
336 Ga0207707_10103395 3300025912 Bacteria 2490
337 Ga0207707_10115266 3300025912 Bacteria 2348
338 Ga0207707_10235937 3300025912 Bacteria 1591
339 Ga0207707_10853802 3300025912 Bacteria 755
340 Ga0207695_10205171 3300025913 Bacteria 1884
341 Ga0207695_10742703 3300025913 Bacteria 862
342 Ga0207671_10389426 3300025914 Bacteria 1108
343 Ga0207671_10863594 3300025914 Bacteria 716
344 Ga0207693_10002469 3300025915 Bacteria 16070
345 Ga0207693_10003280 3300025915 Bacteria 13857
346 Ga0207693_10006088 3300025915 Bacteria 9990
347 Ga0207693_10087591 3300025915 Bacteria 2440
348 Ga0207693_10493398 3300025915 Unclassified 956
349 Ga0207663_10001265 3300025916 Bacteria 11722
350 Ga0207663_10007997 3300025916 Bacteria 5514
351 Ga0207663_10034393 3300025916 Bacteria 3030
352 Ga0207663_10055973 3300025916 Bacteria 2477
353 Ga0207660_10139616 3300025917 Bacteria 1852
354 Ga0207660_10226075 3300025917 Bacteria 1470
355 Ga0207660_10249696 3300025917 Bacteria 1400
356 Ga0207660_10294066 3300025917 Bacteria 1292
357 Ga0207657_10000718 3300025919 Bacteria 35150
358 Ga0207657_10001953 3300025919 Bacteria 22262
359 Ga0207657_10003402 3300025919 Bacteria 17000
360 Ga0207649_10023166 3300025920 Bacteria 3593
361 Ga0207649_10336251 3300025920 Bacteria 1114
362 Ga0207649_10518545 3300025920 Bacteria 908
363 Ga0207652_10039250 3300025921 Bacteria 4018
364 Ga0207652_10054129 3300025921 Bacteria 3449
365 Ga0207652_10109640 3300025921 Bacteria 2447
366 Ga0207652_10126727 3300025921 Bacteria 2275
367 Ga0207652_10297969 3300025921 Bacteria 1455
368 Ga0207652_10389857 3300025921 Bacteria 1257
369 Ga0207652_10394119 3300025921 Bacteria 1249
370 Ga0207652_11089511 3300025921 Bacteria 699
371 Ga0207646_10007981 3300025922 Bacteria 10675
372 Ga0207646_10033302 3300025922 Bacteria 4662
373 Ga0207646_10851975 3300025922 Bacteria 810
374 Ga0207694_10143922 3300025924 Bacteria 1918
375 Ga0207694_10291058 3300025924 Bacteria 1343
376 Ga0207694_11022826 3300025924 Bacteria 699
377 Ga0207659_11800881 3300025926 Bacteria 520
378 Ga0207700_10013406 3300025928 Bacteria 5332
379 Ga0207700_10090896 3300025928 Bacteria 2410
380 Ga0207700_10256520 3300025928 Bacteria 1495
381 Ga0207700_10326498 3300025928 Bacteria 1331
382 Ga0207700_10391366 3300025928 Bacteria 1217
383 Ga0207700_11777861 3300025928 Bacteria 542
384 Ga0207664_10012867 3300025929 Bacteria 5995
385 Ga0207664_10019903 3300025929 Bacteria 4968
386 Ga0207664_10032924 3300025929 Bacteria 3978
387 Ga0207664_10061057 3300025929 Bacteria 3006
388 Ga0207644_10090461 3300025931 Bacteria 2280
389 Ga0207644_10676436 3300025931 Bacteria 860
390 Ga0207644_11078127 3300025931 Bacteria 675
391 Ga0207690_10036702 3300025932 Bacteria 3175
392 Ga0207690_10046631 3300025932 Bacteria 2871
393 Ga0207690_10192286 3300025932 Bacteria 1544
394 Ga0207690_10232090 3300025932 Bacteria 1417
395 Ga0207690_10626002 3300025932 Bacteria 880
396 Ga0207706_10356044 3300025933 Bacteria 1272
397 Ga0207686_10398280 3300025934 Bacteria 1048
398 Ga0207709_10110325 3300025935 Bacteria 1838
399 Ga0207670_10471221 3300025936 Bacteria 1015
400 Ga0207669_10070672 3300025937 Bacteria 2190
401 Ga0207704_10400013 3300025938 Bacteria 1083
402 Ga0207665_10000544 3300025939 Bacteria 25404
403 Ga0207665_10000671 3300025939 Bacteria 23062
404 Ga0207665_10002296 3300025939 Bacteria 12914
405 Ga0207691_10349324 3300025940 Bacteria 1265
406 Ga0207691_10444518 3300025940 Bacteria 1104
407 Ga0207691_10896780 3300025940 Bacteria 742
408 Ga0207711_10348789 3300025941 Bacteria 1370
409 Ga0207711_10673143 3300025941 Bacteria 965
410 Ga0207711_11180430 3300025941 Bacteria 707
411 Ga0207689_11763503 3300025942 Bacteria 512
412 Ga0207661_10054259 3300025944 Bacteria 3211
413 Ga0207661_10152431 3300025944 Bacteria 1999
414 Ga0207661_10643145 3300025944 Bacteria 974
415 Ga0207661_11471181 3300025944 Bacteria 624
416 Ga0207679_10549900 3300025945 Bacteria 1036
417 Ga0207667_10065234 3300025949 Bacteria 3798
418 Ga0207667_10099773 3300025949 Bacteria 2996
419 Ga0207667_10386288 3300025949 Bacteria 1426
420 Ga0207667_10702977 3300025949 Bacteria 1013
421 Ga0207712_10976034 3300025961 Bacteria 751
422 Ga0207640_10160238 3300025981 Bacteria 1664
423 Ga0207658_10374481 3300025986 Bacteria 1246
424 Ga0207658_10522475 3300025986 Bacteria 1059
425 Ga0207677_10819417 3300026023 Bacteria 834
426 Ga0207703_10051653 3300026035 Bacteria 3333
427 Ga0207703_11377330 3300026035 Bacteria 678
428 Ga0207639_10121201 3300026041 Bacteria 2149
429 Ga0207639_10128794 3300026041 Bacteria 2092
430 Ga0207639_10385615 3300026041 Bacteria 1259
431 Ga0207639_11217791 3300026041 Bacteria 707
432 Ga0207678_10091061 3300026067 Bacteria 2606
433 Ga0207678_10497754 3300026067 Bacteria 1062
434 Ga0207678_10531034 3300026067 Bacteria 1027
435 Ga0207678_11197349 3300026067 Bacteria 673
436 Ga0207708_10018852 3300026075 Bacteria 5197
437 Ga0207708_11129888 3300026075 Bacteria 684
438 Ga0207702_10001273 3300026078 Bacteria 25311
439 Ga0207702_10004243 3300026078 Bacteria 12798
440 Ga0207702_10212410 3300026078 Bacteria 1799
441 Ga0207702_10264174 3300026078 Bacteria 1621
442 Ga0207702_10740394 3300026078 Bacteria 970
443 Ga0207641_10487925 3300026088 Bacteria 1195
444 Ga0207641_11034327 3300026088 Bacteria 819
445 Ga0207648_10180740 3300026089 Bacteria 1867
446 Ga0207648_10506854 3300026089 Bacteria 1105
447 Ga0207676_10060819 3300026095 Bacteria 2989
448 Ga0207674_10049026 3300026116 Bacteria 4320
449 Ga0207674_10079304 3300026116 Bacteria 3288
450 Ga0207674_10102962 3300026116 Bacteria 2834
451 Ga0207674_11204588 3300026116 Bacteria 727
452 Ga0207675_100182797 3300026118 Bacteria 2008
453 Ga0207683_10003107 3300026121 Bacteria 14508
454 Ga0207698_11977380 3300026142 Bacteria 597
455 Ga0207698_12445020 3300026142 Bacteria 533
456 Ga0268266_10167266 3300028379 Bacteria 1993
457 Ga0268266_10222553 3300028379 Bacteria 1735
458 Ga0268266_11564331 3300028379 Bacteria 635
459 Ga0268265_10806482 3300028380 Bacteria 915
460 Ga0265331_10359524 3300031250 Bacteria 652
461 Ga0265342_10308479 3300031712 Unclassified 832
462 Ga0307405_10001550 3300031731 Bacteria 9745
463 Ga0307405_10226699 3300031731 Bacteria 1375
464 Ga0307405_11544099 3300031731 Bacteria 584
465 Ga0307413_10012591 3300031824 Bacteria 4215
466 Ga0307410_10001984 3300031852 Bacteria 9630
467 Ga0307410_10017623 3300031852 Bacteria 4295
468 Ga0307406_10130831 3300031901 Bacteria 1761
469 Ga0307406_10477616 3300031901 Bacteria 1006
470 Ga0307406_11050014 3300031901 Bacteria 701
471 Ga0307407_10033550 3300031903 Bacteria 2802
472 Ga0307407_10458362 3300031903 Bacteria 927
473 Ga0307412_10122332 3300031911 Bacteria 1876
474 Ga0307409_100000843 3300031995 Bacteria 14123
475 Ga0307409_101390844 3300031995 Bacteria 728
476 Ga0307416_100019861 3300032002 Bacteria 4775
477 Ga0307416_101113100 3300032002 Bacteria 894
478 Ga0307416_102575336 3300032002 Bacteria 607
479 Ga0307415_100000059 3300032126 Bacteria 46229
480 Ga0307415_100247196 3300032126 Bacteria 1447
481 Ga0307415_102005917 3300032126 Bacteria 563
482 Ga0373948_0023888 3300034817 Bacteria 1189
483 Ga0373958_0029798 3300034819 Bacteria 1064
484 Ga0373959_0013678 3300034820 Bacteria 1467
485 Ga0373928_0265705 3300035084 Bacteria 516
486 Ga0373940_0185687 3300035088 Bacteria 678
487 Ga0373949_0019608 3300035090 Bacteria 1542
488 Ga0373952_0059512 3300035092 Bacteria 930
489 Ga0373932_0074604 3300035112 Bacteria 1059
490 Ga0373939_0033887 3300035114 Bacteria 1495
491 Ga0373954_0163363 3300035118 Bacteria 1090
492 Ga0373960_0057655 3300035121 Bacteria 1170
493 Ga0373943_0209077 3300035170 Bacteria 1083
494 Ga0373961_0036484 3300035241 Bacteria 1400
495 Ga0373962_0019823 3300035242 Bacteria 1762
496 Ga0373931_0027407 3300035691 Bacteria 2908
497 Ga0373931_0396016 3300035691 Bacteria 873
498 Ga0395899_0088373 3300037312 Bacteria 2248
499 Ga0395899_0664570 3300037312 Bacteria 657
500 Ga0395900_0049253 3300037418 Bacteria 4340
501 Ga0395900_0426464 3300037418 Bacteria 1286
502 Ga0395900_0523992 3300037418 Bacteria 1133
503 Ga0395900_1127556 3300037418 Unclassified 701
504 Ga0395900_1240754 3300037418 Bacteria 660
505 Ga0395900_1448138 3300037418 Bacteria 599
506 Ga0395898_0018899 3300037466 Bacteria 7021
507 Ga0395898_0043081 3300037466 Bacteria 4449
508 Ga0395898_0079845 3300037466 Bacteria 3155
509 Ga0395898_0425808 3300037466 Bacteria 1265
510 Ga0395898_1511639 3300037466 Bacteria 597
511 Ga0395905_0088809 3300037471 Bacteria 2897
512 Ga0395905_0343883 3300037471 Bacteria 1383
513 Ga0395905_0438209 3300037471 Bacteria 1204
514 Ga0395905_1739545 3300037471 Bacteria 529
515 Ga0436364_0700422 3300037853 Bacteria 573
516 Ga0436364_0702862 3300037853 Bacteria 1788
517 Ga0395901_0008091 3300038443 Bacteria 10621
518 Ga0395901_0480610 3300038443 Bacteria 1267
519 Ga0395901_1632307 3300038443 Bacteria 597
520 Ga0436365_0466916 3300039437 Bacteria 814
521 Ga0436365_0480563 3300039437 Bacteria 8437
522 Ga0436363_1246730 3300039450 Bacteria 680
523 Ga0436362_0052015 3300039453 Bacteria 548
524 Ga0436362_0275944 3300039453 Unclassified 701
525 Ga0436362_1049344 3300039453 Bacteria 815
526 Ga0436362_1177533 3300039453 Bacteria 575
527 Ga0451802_1956103 3300041460 Bacteria 1006
528 Ga0451804_0300085 3300041463 Bacteria 515
529 Ga0439448_0004172 3300042005 Bacteria 4068
530 Ga0439448_0257357 3300042005 Bacteria 616
531 Ga0439451_072066 3300042009 Bacteria 692
532 Ga0439463_011323 3300042016 Bacteria 2190
533 Ga0439463_197982 3300042016 Bacteria 522
534 Ga0439460_0291951 3300042461 Bacteria 569
535 Ga0450893_0050464 3300042532 Bacteria 779
536 Ga0439440_0028936 3300042993 Bacteria 1296
537 Ga0439440_0117494 3300042993 Bacteria 737
538 Ga0439440_0219399 3300042993 Bacteria 570
539 Ga0439440_0257983 3300042993 Bacteria 533
540 Ga0453683_0951429 3300044673 Bacteria 569
541 Ga0466966_0000305 3300044684 Bacteria 32089
542 Ga0466966_0016924 3300044684 Bacteria 4820
543 Ga0466966_0034742 3300044684 Bacteria 3259
544 Ga0466961_0032493 3300044693 Bacteria 3354
545 Ga0466961_0049514 3300044693 Bacteria 2685
546 Ga0466961_0134037 3300044693 Bacteria 1552
547 Ga0466961_0345409 3300044693 Bacteria 906
548 Ga0466963_0000814 3300044694 Bacteria 15586
549 Ga0466963_0001910 3300044694 Bacteria 11404
550 Ga0466963_0002399 3300044694 Bacteria 10475
551 Ga0466963_0189437 3300044694 Bacteria 1437
552 Ga0466963_0561306 3300044694 Bacteria 806
553 Ga0466964_0112455 3300044706 Bacteria 1216
554 Ga0466964_0263218 3300044706 Bacteria 855
555 Ga0466971_0250694 3300044719 Bacteria 843
556 Ga0466968_0014362 3300044735 Bacteria 3129
557 Ga0466968_0046182 3300044735 Bacteria 1850
558 Ga0466957_0009156 3300044842 Bacteria 5648
559 Ga0466957_0883066 3300044842 Bacteria 638
560 Ga0466960_0462564 3300044901 Bacteria 739
561 Ga0466959_0002417 3300045049 Bacteria 11926
562 Ga0466959_0010616 3300045049 Bacteria 6594
563 Ga0466959_0035378 3300045049 Bacteria 3694
564 Ga0466959_0774241 3300045049 Bacteria 642
565 Ga0451576_0006272 3300045051 Bacteria 14631
566 Ga0451576_0362180 3300045051 Bacteria 1519
567 Ga0466958_0009274 3300045836 Bacteria 5479
568 Ga0466958_0034288 3300045836 Bacteria 3027
569 Ga0466958_0646776 3300045836 Bacteria 688
570 Ga0466967_0002685 3300045976 Bacteria 11235
571 Ga0466967_0043599 3300045976 Bacteria 3885
572 Ga0466967_0080368 3300045976 Bacteria 2941
573 Ga0466967_0268803 3300045976 Bacteria 1633
574 Ga0466967_0571958 3300045976 Bacteria 1113
575 Ga0466967_0916011 3300045976 Bacteria 872
576 Ga0495592_0079957 3300046454 Bacteria 2366
577 Ga0495603_0018969 3300046455 Bacteria 4163
578 Ga0495629_0971200 3300046459 Bacteria 554
579 Ga0495638_0619789 3300046460 Bacteria 529
580 Ga0495641_0065320 3300046461 Bacteria 1638
581 Ga0495641_0119065 3300046461 Bacteria 1178
582 Ga0495641_0253021 3300046461 Bacteria 792
583 Ga0495651_0328435 3300046462 Bacteria 1017
584 Ga0495653_0067423 3300046463 Bacteria 2688
585 Ga0495653_0372577 3300046463 Bacteria 913
586 Ga0495605_0155809 3300046474 Bacteria 1016
587 Ga0495662_0552981 3300046476 Bacteria 564
588 Ga0495664_0046928 3300046477 Bacteria 2563
589 Ga0495664_0364393 3300046477 Bacteria 870
590 Ga0495664_0595746 3300046477 Bacteria 657
591 Ga0495584_0144702 3300046491 Bacteria 1207
592 Ga0495594_0865639 3300046499 Bacteria 508
593 Ga0495596_0120329 3300046500 Bacteria 1019
594 Ga0495607_0100791 3300046501 Bacteria 1547
595 Ga0495583_0139315 3300046506 Bacteria 1011
596 Ga0495608_0032884 3300046511 Bacteria 3507
597 Ga0495608_0215015 3300046511 Bacteria 1208
598 Ga0495620_0171403 3300046515 Bacteria 841
599 Ga0495620_0193402 3300046515 Bacteria 784
600 Ga0495628_0029102 3300046516 Bacteria 4483
601 Ga0495628_0152707 3300046516 Bacteria 1758
602 Ga0495630_0049161 3300046517 Bacteria 3156
603 Ga0495631_0193846 3300046518 Bacteria 869
604 Ga0495644_0083874 3300046523 Bacteria 1201
605 Ga0495663_0115614 3300046525 Bacteria 894
606 Ga0495642_0137681 3300046528 Bacteria 1053
607 Ga0495642_0343572 3300046528 Bacteria 656
608 Ga0495652_0069347 3300046529 Bacteria 2952
609 Ga0495640_0013066 3300046533 Bacteria 6324
610 Ga0495640_0715848 3300046533 Bacteria 600
611 Ga0495598_0370202 3300046537 Bacteria 555
612 Ga0495609_0095005 3300046538 Bacteria 1294
613 Ga0495621_0198590 3300046539 Bacteria 806
614 Ga0495667_0250980 3300046559 Bacteria 1126
615 Ga0495667_0408680 3300046559 Bacteria 855
616 Ga0495656_0249881 3300046615 Bacteria 895
617 Ga0495656_0431705 3300046615 Bacteria 692
618 Ga0495634_0023453 3300046642 Bacteria 4338
619 Ga0495634_0237177 3300046642 Bacteria 1120
620 Ga0495611_0228857 3300046648 Bacteria 864
621 Ga0495635_0071157 3300046663 Bacteria 2384
622 Ga0495635_0802040 3300046663 Bacteria 607
623 Ga0495659_0131058 3300046664 Bacteria 994
624 Ga0495661_0222255 3300046665 Bacteria 978
625 Ga0495657_0034709 3300046675 Bacteria 3501
626 Ga0495657_0141290 3300046675 Bacteria 1501
627 Ga0495657_0192818 3300046675 Bacteria 1245
628 Ga0495646_0182318 3300046680 Bacteria 1152
629 Ga0495646_0238345 3300046680 Bacteria 978
630 Ga0495647_0313084 3300046681 Bacteria 709
631 Ga0495613_0247103 3300046689 Bacteria 1246
632 Ga0495671_0191066 3300046692 Bacteria 994
633 Ga0495589_0195145 3300046794 Bacteria 957
634 Ga0495589_0218683 3300046794 Bacteria 895
635 Ga0495660_0169643 3300046810 Bacteria 1064
636 Ga0495581_0203260 3300047315 Bacteria 1159
637 Ga0495604_0198658 3300047317 Bacteria 1393
638 Ga0495604_0448733 3300047317 Bacteria 843
639 Ga0495636_0160920 3300047318 Bacteria 1011
640 Ga0495674_0015228 3300047319 Bacteria 7193
641 Ga0495674_0053438 3300047319 Bacteria 3551
642 Ga0495676_0193161 3300047321 Bacteria 1419
643 Ga0495680_0039139 3300047322 Bacteria 3784
644 Ga0495680_0078226 3300047322 Bacteria 2503
645 Ga0495683_0234884 3300047323 Bacteria 811
646 Ga0495675_0122999 3300047444 Bacteria 1615
647 Ga0495675_0373871 3300047444 Bacteria 835
648 Ga0495677_0096472 3300047445 Bacteria 1117
649 Ga0495679_154920 3300047446 Bacteria 614
650 Ga0495684_0291628 3300047471 Bacteria 1174
651 Ga0495614_0436852 3300048089 Bacteria 618
652 Ga0495615_0135662 3300048090 Bacteria 723
653 Ga0496100_0001249 3300048903 Bacteria 12387
654 Ga0496100_0057712 3300048903 Bacteria 2543
655 Ga0496100_0149865 3300048903 Bacteria 1662
656 Ga0496100_0255268 3300048903 Bacteria 1298
657 Ga0496101_0003908 3300048904 Bacteria 9312
658 Ga0496101_0018246 3300048904 Bacteria 4768
659 Ga0496101_0043005 3300048904 Bacteria 3226
660 Ga0496101_0343768 3300048904 Bacteria 1172
661 Ga0496101_0385409 3300048904 Bacteria 1103
662 Ga0496101_1522231 3300048904 Bacteria 520
663 Ga0496102_0001864 3300048905 Bacteria 18168
664 Ga0496102_0009357 3300048905 Bacteria 8418
665 Ga0496102_0030802 3300048905 Bacteria 4804
666 Ga0496102_0819711 3300048905 Bacteria 853
667 Ga0496102_1428669 3300048905 Bacteria 611
668 Ga0496103_0028430 3300048906 Bacteria 3392
669 Ga0496103_0046534 3300048906 Bacteria 2679
670 Ga0496103_0507897 3300048906 Bacteria 771
671 Ga0496104_0000288 3300048907 Bacteria 44366
672 Ga0496104_0063165 3300048907 Bacteria 3512
673 Ga0496104_0070017 3300048907 Bacteria 3334
674 Ga0496104_0216131 3300048907 Bacteria 1829
675 Ga0496104_0325695 3300048907 Bacteria 1449
676 Ga0496104_0990249 3300048907 Bacteria 745
677 Ga0496104_1733598 3300048907 Bacteria 527
678 Ga0496105_0000133 3300048908 Bacteria 49866
679 Ga0496105_0005062 3300048908 Bacteria 9984
680 Ga0496105_0109300 3300048908 Unclassified 2283
681 Ga0496105_0154772 3300048908 Bacteria 1883
682 Ga0496105_0236231 3300048908 Bacteria 1484
683 Ga0496105_1105081 3300048908 Bacteria 588
684 Ga0496105_1157880 3300048908 Bacteria 571
685 Ga0496106_0000903 3300048909 Bacteria 21668
686 Ga0496106_0015684 3300048909 Bacteria 5605
687 Ga0496106_0028124 3300048909 Bacteria 4187
688 Ga0496106_0170758 3300048909 Bacteria 1723
689 Ga0496107_0037665 3300048910 Bacteria 3470
690 Ga0496107_0180889 3300048910 Bacteria 1565
691 Ga0496107_0825997 3300048910 Bacteria 678
692 Ga0496108_0025744 3300048911 Bacteria 4851
693 Ga0496108_0234352 3300048911 Bacteria 1596
694 Ga0496108_0520748 3300048911 Bacteria 1038
695 Ga0496108_0822250 3300048911 Bacteria 801
696 Ga0496108_1556507 3300048911 Bacteria 548
697 Ga0496109_0020759 3300048912 Bacteria 5801
698 Ga0496109_0041153 3300048912 Bacteria 4187
699 Ga0496109_0189420 3300048912 Bacteria 1933
700 Ga0496109_0191444 3300048912 Bacteria 1922
701 Ga0496109_0256675 3300048912 Bacteria 1646
702 Ga0496109_0680439 3300048912 Bacteria 966
703 Ga0496109_1180753 3300048912 Bacteria 702
704 Ga0496109_1682275 3300048912 Bacteria 568
705 Ga0496110_0002795 3300048913 Bacteria 13174
706 Ga0496110_0036927 3300048913 Bacteria 4245
707 Ga0496110_0067869 3300048913 Bacteria 3156
708 Ga0496110_0404459 3300048913 Bacteria 1244
709 Ga0496111_0085212 3300048914 Bacteria 2310
710 Ga0496111_0565308 3300048914 Bacteria 834
711 Ga0496111_0606417 3300048914 Bacteria 801
712 Ga0496112_0025833 3300048915 Bacteria 5643
713 Ga0496112_0149704 3300048915 Bacteria 2301
714 Ga0496112_0247334 3300048915 Bacteria 1735
715 Ga0496112_0453148 3300048915 Bacteria 1220
716 Ga0496112_0530605 3300048915 Bacteria 1111
717 Ga0496112_1310705 3300048915 Bacteria 640
718 Ga0496112_1431882 3300048915 Bacteria 605
719 Ga0496113_0079606 3300048916 Bacteria 2509
720 Ga0496113_0142047 3300048916 Bacteria 1889
721 Ga0496113_0863400 3300048916 Bacteria 717
722 Ga0496113_1457061 3300048916 Bacteria 529
723 Ga0496114_0007644 3300048917 Bacteria 8548
724 Ga0496114_0155909 3300048917 Bacteria 1983
725 Ga0496114_0283245 3300048917 Bacteria 1461
726 Ga0496114_0362811 3300048917 Bacteria 1281
727 Ga0496114_0543803 3300048917 Bacteria 1026
728 Ga0496114_0636208 3300048917 Bacteria 939
729 Ga0496114_0750504 3300048917 Bacteria 853
730 Ga0496114_1546445 3300048917 Bacteria 551
731 Ga0496115_0000494 3300048918 Bacteria 31060
732 Ga0496115_0153726 3300048918 Bacteria 1900
733 Ga0496115_0181122 3300048918 Bacteria 1741
734 Ga0501031_0000080 3300049568 Bacteria 50609
735 Ga0501031_0044813 3300049568 Bacteria 2886
736 Ga0501031_0190997 3300049568 Bacteria 1337
737 Ga0501031_0461481 3300049568 Bacteria 820
738 Ga0501032_0000140 3300049569 Bacteria 59076
739 Ga0501032_0199028 3300049569 Bacteria 1308
740 Ga0501032_0274931 3300049569 Bacteria 1091
741 Ga0501033_0000268 3300049570 Bacteria 50147
742 Ga0501033_0037837 3300049570 Bacteria 3610
743 Ga0501033_0073289 3300049570 Bacteria 2514
744 Ga0501033_0492183 3300049570 Bacteria 849
745 Ga0501036_0000535 3300049572 Bacteria 27224
746 Ga0501036_0018233 3300049572 Bacteria 5878
747 Ga0501036_0018334 3300049572 Bacteria 5861
748 Ga0501036_0027417 3300049572 Bacteria 4813
749 Ga0501036_0628774 3300049572 Bacteria 889
750 Ga0501037_0000071 3300049573 Bacteria 94548
751 Ga0501038_0000356 3300049574 Bacteria 39305
752 Ga0501038_0018537 3300049574 Bacteria 6285
753 Ga0501038_0296434 3300049574 Bacteria 1270
754 Ga0501039_0000112 3300049575 Bacteria 55239
755 Ga0501039_0075891 3300049575 Bacteria 2613
756 Ga0501039_0085767 3300049575 Bacteria 2452
757 Ga0501039_0220392 3300049575 Bacteria 1491
758 Ga0501039_0713061 3300049575 Bacteria 784
759 Ga0501040_0000346 3300049576 Bacteria 27211
760 Ga0501040_0002290 3300049576 Bacteria 12301
761 Ga0501040_0015701 3300049576 Bacteria 5006
762 Ga0501040_0227239 3300049576 Bacteria 1329
763 Ga0501040_0279562 3300049576 Bacteria 1192
764 Ga0501041_0000033 3300049577 Bacteria 44702
765 Ga0501041_0020824 3300049577 Bacteria 3924
766 Ga0501041_0039391 3300049577 Bacteria 2868
767 Ga0501041_0446937 3300049577 Bacteria 820
768 Ga0501041_0462149 3300049577 Bacteria 806
769 Ga0501042_0000220 3300049578 Bacteria 27211
770 Ga0501042_0000668 3300049578 Bacteria 18449
771 Ga0501042_0087592 3300049578 Bacteria 2234
772 Ga0501043_0000603 3300049579 Bacteria 31748
773 Ga0501043_0361328 3300049579 Bacteria 1102
774 Ga0501043_0371567 3300049579 Bacteria 1084
775 Ga0501046_0001101 3300049580 Bacteria 26446
776 Ga0501046_0012467 3300049580 Bacteria 7236
777 Ga0501047_0003071 3300049581 Bacteria 15835
778 Ga0501048_0000079 3300049582 Bacteria 50897
779 Ga0501048_0002010 3300049582 Bacteria 15453
780 Ga0501048_0099596 3300049582 Bacteria 2050
781 Ga0501048_0149990 3300049582 Bacteria 1649
782 Ga0501067_0005117 3300049583 Bacteria 7286
783 Ga0501067_0156757 3300049583 Bacteria 1269
784 Ga0501067_0299955 3300049583 Bacteria 894
785 Ga0501068_0000086 3300049584 Bacteria 38742
786 Ga0501068_0090907 3300049584 Bacteria 1883
787 Ga0501069_0000194 3300049585 Bacteria 26894
788 Ga0501069_0028891 3300049585 Bacteria 3042
789 Ga0501069_0072402 3300049585 Bacteria 1932
790 Ga0501069_0138435 3300049585 Bacteria 1396
791 Ga0501069_0600269 3300049585 Bacteria 661
792 Ga0501069_0648426 3300049585 Bacteria 635
793 Ga0501070_0003025 3300049586 Bacteria 14639
794 Ga0501070_0015940 3300049586 Bacteria 6318
795 Ga0501070_0138359 3300049586 Bacteria 2011
796 Ga0501070_0427854 3300049586 Bacteria 1069
797 Ga0501070_0795270 3300049586 Bacteria 743
798 Ga0501071_0000055 3300049587 Bacteria 38176
799 Ga0501071_0096479 3300049587 Bacteria 2176
800 Ga0501071_0098353 3300049587 Bacteria 2155
801 Ga0501071_0109734 3300049587 Bacteria 2038
802 Ga0501071_0348134 3300049587 Bacteria 1127
803 Ga0501072_0000221 3300049588 Bacteria 41756
804 Ga0501072_0000258 3300049588 Bacteria 38870
805 Ga0501072_0079599 3300049588 Bacteria 2595
806 Ga0501072_0184337 3300049588 Bacteria 1665
807 Ga0501072_0185618 3300049588 Bacteria 1659
808 Ga0501073_0434691 3300049589 Bacteria 907
809 Ga0501074_0000112 3300049590 Bacteria 40367
810 Ga0501074_0047332 3300049590 Bacteria 3109
811 Ga0501074_0139677 3300049590 Bacteria 1733
812 Ga0501074_0306960 3300049590 Bacteria 1127
813 Ga0501074_0349505 3300049590 Bacteria 1049
814 Ga0501074_0474634 3300049590 Bacteria 887
815 Ga0501074_0972084 3300049590 Bacteria 597
816 Ga0501075_0000105 3300049591 Bacteria 39518
817 Ga0501075_0002018 3300049591 Bacteria 13415
818 Ga0501075_0009429 3300049591 Bacteria 6827
819 Ga0501075_0041485 3300049591 Bacteria 3449
820 Ga0501075_0053710 3300049591 Bacteria 3030
821 Ga0501075_0451146 3300049591 Bacteria 981
822 Ga0501075_1078317 3300049591 Bacteria 610
823 Ga0501076_0000147 3300049592 Bacteria 39999
824 Ga0501076_0001572 3300049592 Bacteria 15325
825 Ga0501076_0001664 3300049592 Bacteria 15023
826 Ga0501076_0146158 3300049592 Bacteria 1922
827 Ga0501076_0637209 3300049592 Bacteria 879
828 Ga0501077_0000133 3300049593 Bacteria 40681
829 Ga0501077_0007093 3300049593 Bacteria 6910
830 Ga0501077_0016659 3300049593 Bacteria 4632
831 Ga0501077_0221258 3300049593 Bacteria 1203
832 Ga0501079_0000144 3300049741 Bacteria 39333
833 Ga0501079_0000158 3300049741 Bacteria 37267
834 Ga0501079_0025816 3300049741 Bacteria 4506
835 Ga0501079_0944219 3300049741 Bacteria 679
836 Ga0501080_0000650 3300049742 Bacteria 27559
837 Ga0501080_0002437 3300049742 Bacteria 16255
838 Ga0501080_0440473 3300049742 Bacteria 1169
839 Ga0501080_0473729 3300049742 Bacteria 1121
840 Ga0501080_0860697 3300049742 Bacteria 792
841 Ga0501081_0000013 3300049743 Bacteria 62283
842 Ga0501081_0001276 3300049743 Bacteria 15307
843 Ga0501081_0014976 3300049743 Bacteria 5117
844 Ga0501081_0015918 3300049743 Bacteria 4966
845 Ga0501083_0000640 3300049744 Bacteria 22642
846 Ga0501083_0072234 3300049744 Bacteria 2294
847 Ga0501083_0696559 3300049744 Bacteria 661
848 Ga0501035_0001508 3300049822 Bacteria 23823
849 Ga0501035_0020329 3300049822 Bacteria 6096
850 Ga0501035_0443985 3300049822 Bacteria 1074
851 Ga0501044_0004117 3300049823 Bacteria 16311
852 Ga0501045_0000529 3300049824 Bacteria 23825
853 Ga0501045_0001352 3300049824 Bacteria 16279
854 Ga0501045_0008805 3300049824 Bacteria 7046
855 nmdc:mga03n38_905828_c1 3300050490 Bacteria 518
856 nmdc:mga05p37_40073_c1 3300050507 Bacteria 5753
857 nmdc:mga05p37_806050_c1 3300050507 Bacteria 1027
858 nmdc:mga05p37_888566_c1 3300050507 Bacteria 962
859 nmdc:mga09592_160256_c1 3300050508 Bacteria 1943
860 nmdc:mga0qj67_204795_c1 3300050509 Bacteria 1603
861 nmdc:mga0qj67_75114_c1 3300050509 Bacteria 2701
862 nmdc:mga0qj67_800101_c1 3300050509 Bacteria 746
863 nmdc:mga06r32_1269229_c1 3300050510 Bacteria 681
864 nmdc:mga06r32_144614_c1 3300050510 Bacteria 2355
865 nmdc:mga06r32_2485_c1 3300050510 Bacteria 14337
866 nmdc:mga06r32_4967_c1 3300050510 Bacteria 11987
867 nmdc:mga06r32_74297_c1 3300050510 Bacteria 3296
868 nmdc:mga0n895_183290_c1 3300050512 Bacteria 2125
869 nmdc:mga0n895_518473_c1 3300050512 Bacteria 1200
870 nmdc:mga0rr50_115995_c1 3300050513 Bacteria 2126
871 nmdc:mga0rr50_188091_c1 3300050513 Bacteria 1691
872 nmdc:mga08x19_1101402_c1 3300050514 Bacteria 564
873 nmdc:mga08x19_527101_c1 3300050514 Bacteria 835
874 nmdc:mga08x19_54920_c1 3300050514 Bacteria 2565
875 nmdc:mga0a205_335965_c1 3300050515 Bacteria 1380
876 Ga0495601_0086904 3300053077 Bacteria 2010
877 Ga0495655_0269525 3300053083 Bacteria 577
878 Ga0495595_0263489 3300053084 Bacteria 864
879 Ga0495619_0027064 3300053085 Bacteria 3693
880 Ga0495619_0167622 3300053085 Bacteria 1518
881 Ga0501084_0000072 3300054114 Bacteria 75958
882 Ga0501084_0003639 3300054114 Bacteria 12516
883 Ga0501084_0066855 3300054114 Bacteria 3008
884 Ga0501084_0497159 3300054114 Bacteria 1030
885 Ga0587080_169130 3300059503 Bacteria 517
886 Ga0587072_131186 3300059643 Bacteria 590
887 Ga0501082_0000412 3300060353 Bacteria 37853
888 Ga0501082_0001954 3300060353 Bacteria 18144
889 Ga0501082_0103245 3300060353 Bacteria 2466
890 Ga0501082_0173383 3300060353 Bacteria 1876
891 Ga0501082_0403208 3300060353 Bacteria 1193
892 Ga0466962_0023054 3300061719 Bacteria 2993
893 Ga0466962_0048322 3300061719 Bacteria 2033
894 Ga0466962_0170494 3300061719 Bacteria 1060
895 Ga0530510_0000032 3300061734 Bacteria 62901
896 Ga0530510_0005717 3300061734 Bacteria 8615
897 Ga0530510_0041721 3300061734 Bacteria 3313
898 Ga0530510_0273596 3300061734 Bacteria 1260
899 Ga0530510_0304606 3300061734 Bacteria 1193
900 Ga0530510_0436335 3300061734 Bacteria 989
901 Ga0530510_1003928 3300061734 Bacteria 639
902 Ga0530510_1263464 3300061734 Bacteria 566
903 Ga0157318_1020908
904 JGI24747J21853_1041561
905 Ga0065715_11166478
906 Ga0065707_10114997
907 Ga0070658_10006612
908 Ga0070658_10442861
909 Ga0070658_11160833
910 Ga0070683_100019179
911 Ga0070683_100116390
912 Ga0070677_10014097
913 Ga0068869_101270559
914 Ga0070666_10636043
915 Ga0070666_10721288
916 Ga0070680_100192334
917 Ga0070680_100360452
918 Ga0070680_100389747
919 Ga0070680_100525603
920 Ga0070682_100012531
921 Ga0070682_100195406
922 Ga0070682_100402386
923 Ga0070682_100503978
924 Ga0068868_100824116
925 Ga0068868_100945621
926 Ga0070660_100000845
927 Ga0070660_100071047
928 Ga0070660_100094695
929 Ga0070660_100145211
930 Ga0070660_100218554
931 Ga0070660_100919796
932 Ga0070687_100082425
933 Ga0070687_100243655
934 Ga0070661_100008820
935 Ga0070661_100242294
936 Ga0070661_100617509
937 Ga0070668_101740992
938 Ga0070669_101098823
939 Ga0070675_100520075
940 Ga0070671_100020998
941 Ga0070671_100075838
942 Ga0070671_101195932
943 Ga0070671_101241315
944 Ga0070671_101247803
945 Ga0070674_100395408
946 Ga0070688_100302471
947 Ga0070659_100108056
948 Ga0070659_100215699
949 Ga0070659_100294259
950 Ga0070667_100545349
951 Ga0070709_10007139
952 Ga0070709_10033722
953 Ga0070709_10070694
954 Ga0070709_10105729
955 Ga0070709_10407341
956 Ga0070714_100147470
957 Ga0070714_100304990
958 Ga0070714_100779128
959 Ga0070714_101436292
960 Ga0070714_101752462
961 Ga0070714_101768210
962 Ga0070713_100011491
963 Ga0070713_100017869
964 Ga0070713_100027721
965 Ga0070710_10001541
966 Ga0070710_10139904
967 Ga0070710_10183210
968 Ga0070701_10084634
969 Ga0070701_10329604
970 Ga0070701_10408576
971 Ga0070711_100040213
972 Ga0070711_100061173
973 Ga0070711_100091316
974 Ga0070711_100196335
975 Ga0070711_101894372
976 Ga0070705_100051622
977 Ga0070705_101535389
978 Ga0070694_100140091
979 Ga0070694_100167409
980 Ga0070694_101242209
981 Ga0070708_100003239
982 Ga0070663_100090609
983 Ga0070663_100436429
984 Ga0070663_100730869
985 Ga0070678_100067677
986 Ga0070681_10002222
987 Ga0070681_10038733
988 Ga0070681_10069515
989 Ga0070681_10082372
990 Ga0070681_10263363
991 Ga0070681_10365303
992 Ga0070681_10544854
993 Ga0070681_10677000
994 Ga0070681_10918777
995 Ga0070707_100042774
996 Ga0070707_100063486
997 Ga0070707_100064931
998 Ga0070707_100372381
999 Ga0070707_100404209
1000 Ga0070698_100037166
1001 Ga0070698_100081971
1002 Ga0070699_100173377
1003 Ga0070699_100860897
1004 Ga0070679_100010278
1005 Ga0070679_100042124
1006 Ga0070679_100051918
1007 Ga0070679_100058346
1008 Ga0070679_100662889
1009 Ga0070679_100895774
1010 Ga0070679_101058679
1011 Ga0070679_101165231
1012 Ga0070684_100250686
1013 Ga0070684_100404129
1014 Ga0070684_101200244
1015 Ga0070684_101569209
1016 Ga0070697_100164982
1017 Ga0070697_100859381
1018 Ga0070697_101247096
1019 Ga0068853_100201009
1020 Ga0068853_102280449
1021 Ga0070672_100160878
1022 Ga0070686_100218193
1023 Ga0070696_100025401
1024 Ga0070693_100022549
1025 Ga0070693_101470162
1026 Ga0070665_100060497
1027 Ga0070665_100142437
1028 Ga0070704_100003204
1029 Ga0068855_100058515
1030 Ga0068855_100086304
1031 Ga0068855_100113647
1032 Ga0068855_100114191
1033 Ga0068855_100215964
1034 Ga0068855_100298165
1035 Ga0070664_100288939
1036 Ga0070664_100790550
1037 Ga0068857_100186875
1038 Ga0068857_101025622
1039 Ga0068854_100499535
1040 Ga0068856_100017429
1041 Ga0068856_100037784
1042 Ga0068856_100100280
1043 Ga0068856_100148579
1044 Ga0068856_100357205
1045 Ga0068856_100387687
1046 Ga0068856_101411706
1047 Ga0070702_100280559
1048 Ga0070702_101268893
1049 Ga0068852_100123223
1050 Ga0068852_100587049
1051 Ga0068852_100607139
1052 Ga0068852_100856126
1053 Ga0068852_101547530
1054 Ga0068859_100111247
1055 Ga0068864_100105670
1056 Ga0068861_101246886
1057 Ga0068851_10035819
1058 Ga0068863_100089826
1059 Ga0068863_100142403
1060 Ga0068858_100211006
1061 Ga0068858_100956294
1062 Ga0068862_100185680
1063 Ga0081455_10326457
1064 Ga0081455_10857349
1065 Ga0081538_10014190
1066 Ga0081538_10047689
1067 Ga0081540_1037480
1068 Ga0070717_10232183
1069 Ga0070717_10883692
1070 Ga0075364_10006466
1071 Ga0075432_10381697
1072 Ga0070715_10000969
1073 Ga0070715_10023547
1074 Ga0070715_10083497
1075 Ga0070715_10192086
1076 Ga0070716_100001514
1077 Ga0070716_100004482
1078 Ga0070716_100014496
1079 Ga0070712_100074279
1080 Ga0070712_100226950
1081 Ga0070712_101933119
1082 Ga0097621_100005462
1083 Ga0097621_100404620
1084 Ga0097621_101068966
1085 Ga0068871_100013653
1086 Ga0075428_100001095
1087 Ga0075428_100129386
1088 Ga0075428_100164548
1089 Ga0075428_100318640
1090 Ga0075428_102525011
1091 Ga0075430_100002287
1092 Ga0075430_100572017
1093 Ga0075431_100003671
1094 Ga0075431_100094282
1095 Ga0075431_100149285
1096 Ga0075431_100445112
1097 Ga0075431_101215883
1098 Ga0075431_101644503
1099 Ga0075433_10121604
1100 Ga0075433_10431498
1101 Ga0075434_100328660
1102 Ga0075434_100355042
1103 Ga0075434_100560999
1104 Ga0075429_100000709
1105 Ga0075429_101848661
1106 Ga0068865_100033461
1107 Ga0075436_100362575
1108 Ga0075436_100805247
1109 Ga0075436_101476079
1110 Ga0097620_100111250
1111 Ga0075435_100066255
1112 Ga0075435_100087048
1113 Ga0075435_100092201
1114 Ga0099794_10021063
1115 Ga0099794_10034273
1116 Ga0099795_10369031
1117 Ga0105240_10315938
1118 Ga0105240_10714499
1119 Ga0105240_10757168
1120 Ga0105240_11214092
1121 Ga0111539_10005499
1122 Ga0105247_10140665
1123 Ga0114129_10226391
1124 Ga0114129_10475348
1125 Ga0114129_10601500
1126 Ga0114129_10757482
1127 Ga0105243_10580398
1128 Ga0105241_10030949
1129 Ga0105241_10454607
1130 Ga0105241_10496522
1131 Ga0105241_10943897
1132 Ga0105241_11062272
1133 Ga0105241_11932295
1134 Ga0105242_10048454
1135 Ga0105242_10162152
1136 Ga0105242_10363995
1137 Ga0105248_10066494
1138 Ga0105248_12199346
1139 Ga0105237_10010559
1140 Ga0105237_10054969
1141 Ga0105237_11023805
1142 Ga0105238_10010847
1143 Ga0105238_10107225
1144 Ga0105238_10316122
1145 Ga0105238_10506995
1146 Ga0105238_10890828
1147 Ga0105249_10082487
1148 Ga0105239_10069035
1149 Ga0105239_10423492
1150 Ga0105239_12027416
1151 Ga0105246_10128813
1152 Ga0105246_11492072
1153 Ga0157347_1016904
1154 Ga0157339_1047724
1155 Ga0157327_1061780
1156 Ga0157373_10086126
1157 Ga0157373_10610619
1158 Ga0157373_10961935
1159 Ga0157371_10396342
1160 Ga0157370_10089264
1161 Ga0157370_10106604
1162 Ga0157370_10842433
1163 Ga0157369_10030900
1164 Ga0157369_10140493
1165 Ga0157369_10583168
1166 Ga0157374_10096924
1167 Ga0157374_10280126
1168 Ga0157374_10304125
1169 Ga0157374_10594525
1170 Ga0157378_10415994
1171 Ga0157378_12067710
1172 Ga0163162_10128953
1173 Ga0163162_10546309
1174 Ga0157372_10022053
1175 Ga0157372_10083879
1176 Ga0157372_10114949
1177 Ga0157372_10673334
1178 Ga0157372_10766416
1179 Ga0157372_10842309
1180 Ga0157372_11147898
1181 Ga0157375_10205093
1182 Ga0157375_10281319
1183 Ga0157375_10796592
1184 Ga0157380_10055047
1185 Ga0157380_10087842
1186 Ga0157380_10247967
1187 Ga0157380_10842355
1188 Ga0182008_10072939
1189 Ga0182008_10416045
1190 Ga0157377_11092328
1191 Ga0157379_10305093
1192 Ga0157379_10755990
1193 Ga0157379_12135795
1194 Ga0157379_12439219
1195 Ga0157376_10002936
1196 Ga0157376_10102177
1197 Ga0157376_10184534
1198 Ga0157376_11281824
1199 Ga0157376_11660308
1200 Ga0157376_12238159
1201 Ga0163161_10194514
1202 Ga0163161_11894027
1203 Ga0197907_10117703
1204 Ga0197907_10265434
1205 Ga0206356_10681064
1206 Ga0206356_10964136
1207 Ga0206356_11774256
1208 Ga0206354_10360016
1209 Ga0206354_11256277
1210 Ga0206353_10104596
1211 Ga0206353_10453214
1212 Ga0213876_10009317
1213 Ga0213876_10231716
1214 Ga0207656_10147601
1215 Ga0207682_10172280
1216 Ga0207692_10004268
1217 Ga0207692_10114791
1218 Ga0207692_10214459
1219 Ga0207692_10808771
1220 Ga0207680_10771602
1221 Ga0207685_10006238
1222 Ga0207685_10050701
1223 Ga0207685_10248674
1224 Ga0207685_10274174
1225 Ga0207699_10009410
1226 Ga0207699_10106642
1227 Ga0207699_10110129
1228 Ga0207699_10186861
1229 Ga0207699_10299450
1230 Ga0207699_10964205
1231 Ga0207643_10428014
1232 Ga0207705_10151920
1233 Ga0207705_10414565
1234 Ga0207705_10517591
1235 Ga0207654_10099637
1236 Ga0207654_10338346
1237 Ga0207707_10030395
1238 Ga0207707_10103395
1239 Ga0207707_10115266
1240 Ga0207707_10235937
1241 Ga0207707_10853802
1242 Ga0207695_10205171
1243 Ga0207695_10742703
1244 Ga0207671_10389426
1245 Ga0207671_10863594
1246 Ga0207693_10002469
1247 Ga0207693_10003280
1248 Ga0207693_10006088
1249 Ga0207693_10087591
1250 Ga0207693_10493398
1251 Ga0207663_10001265
1252 Ga0207663_10007997
1253 Ga0207663_10034393
1254 Ga0207663_10055973
1255 Ga0207660_10139616
1256 Ga0207660_10226075
1257 Ga0207660_10249696
1258 Ga0207660_10294066
1259 Ga0207657_10000718
1260 Ga0207657_10001953
1261 Ga0207657_10003402
1262 Ga0207649_10023166
1263 Ga0207649_10336251
1264 Ga0207649_10518545
1265 Ga0207652_10039250
1266 Ga0207652_10054129
1267 Ga0207652_10109640
1268 Ga0207652_10126727
1269 Ga0207652_10297969
1270 Ga0207652_10389857
1271 Ga0207652_10394119
1272 Ga0207652_11089511
1273 Ga0207646_10007981
1274 Ga0207646_10033302
1275 Ga0207646_10851975
1276 Ga0207694_10143922
1277 Ga0207694_10291058
1278 Ga0207694_11022826
1279 Ga0207659_11800881
1280 Ga0207700_10013406
1281 Ga0207700_10090896
1282 Ga0207700_10256520
1283 Ga0207700_10326498
1284 Ga0207700_10391366
1285 Ga0207700_11777861
1286 Ga0207664_10012867
1287 Ga0207664_10019903
1288 Ga0207664_10032924
1289 Ga0207664_10061057
1290 Ga0207644_10090461
1291 Ga0207644_10676436
1292 Ga0207644_11078127
1293 Ga0207690_10036702
1294 Ga0207690_10046631
1295 Ga0207690_10192286
1296 Ga0207690_10232090
1297 Ga0207690_10626002
1298 Ga0207706_10356044
1299 Ga0207686_10398280
1300 Ga0207709_10110325
1301 Ga0207670_10471221
1302 Ga0207669_10070672
1303 Ga0207704_10400013
1304 Ga0207665_10000544
1305 Ga0207665_10000671
1306 Ga0207665_10002296
1307 Ga0207691_10349324
1308 Ga0207691_10444518
1309 Ga0207691_10896780
1310 Ga0207711_10348789
1311 Ga0207711_10673143
1312 Ga0207711_11180430
1313 Ga0207689_11763503
1314 Ga0207661_10054259
1315 Ga0207661_10152431
1316 Ga0207661_10643145
1317 Ga0207661_11471181
1318 Ga0207679_10549900
1319 Ga0207667_10065234
1320 Ga0207667_10099773
1321 Ga0207667_10386288
1322 Ga0207667_10702977
1323 Ga0207712_10976034
1324 Ga0207640_10160238
1325 Ga0207658_10374481
1326 Ga0207658_10522475
1327 Ga0207677_10819417
1328 Ga0207703_10051653
1329 Ga0207703_11377330
1330 Ga0207639_10121201
1331 Ga0207639_10128794
1332 Ga0207639_10385615
1333 Ga0207639_11217791
1334 Ga0207678_10091061
1335 Ga0207678_10497754
1336 Ga0207678_10531034
1337 Ga0207678_11197349
1338 Ga0207708_10018852
1339 Ga0207708_11129888
1340 Ga0207702_10001273
1341 Ga0207702_10004243
1342 Ga0207702_10212410
1343 Ga0207702_10264174
1344 Ga0207702_10740394
1345 Ga0207641_10487925
1346 Ga0207641_11034327
1347 Ga0207648_10180740
1348 Ga0207648_10506854
1349 Ga0207676_10060819
1350 Ga0207674_10049026
1351 Ga0207674_10079304
1352 Ga0207674_10102962
1353 Ga0207674_11204588
1354 Ga0207675_100182797
1355 Ga0207683_10003107
1356 Ga0207698_11977380
1357 Ga0207698_12445020
1358 Ga0268266_10167266
1359 Ga0268266_10222553
1360 Ga0268266_11564331
1361 Ga0268265_10806482
1362 Ga0265331_10359524
1363 Ga0265342_10308479
1364 Ga0307405_10001550
1365 Ga0307405_10226699
1366 Ga0307405_11544099
1367 Ga0307413_10012591
1368 Ga0307410_10001984
1369 Ga0307410_10017623
1370 Ga0307406_10130831
1371 Ga0307406_10477616
1372 Ga0307406_11050014
1373 Ga0307407_10033550
1374 Ga0307407_10458362
1375 Ga0307412_10122332
1376 Ga0307409_100000843
1377 Ga0307409_101390844
1378 Ga0307416_100019861
1379 Ga0307416_101113100
1380 Ga0307416_102575336
1381 Ga0307415_100000059
1382 Ga0307415_100247196
1383 Ga0307415_102005917
1384 Ga0373948_0023888
1385 Ga0373958_0029798
1386 Ga0373959_0013678
1387 Ga0373928_0265705
1388 Ga0373940_0185687
1389 Ga0373949_0019608
1390 Ga0373952_0059512
1391 Ga0373932_0074604
1392 Ga0373939_0033887
1393 Ga0373954_0163363
1394 Ga0373960_0057655
1395 Ga0373943_0209077
1396 Ga0373961_0036484
1397 Ga0373962_0019823
1398 Ga0373931_0027407
1399 Ga0373931_0396016
1400 Ga0395899_0088373
1401 Ga0395899_0664570
1402 Ga0395900_0049253
1403 Ga0395900_0426464
1404 Ga0395900_0523992
1405 Ga0395900_1127556
1406 Ga0395900_1240754
1407 Ga0395900_1448138
1408 Ga0395898_0018899
1409 Ga0395898_0043081
1410 Ga0395898_0079845
1411 Ga0395898_0425808
1412 Ga0395898_1511639
1413 Ga0395905_0088809
1414 Ga0395905_0343883
1415 Ga0395905_0438209
1416 Ga0395905_1739545
1417 Ga0436364_0700422
1418 Ga0436364_0702862
1419 Ga0395901_0008091
1420 Ga0395901_0480610
1421 Ga0395901_1632307
1422 Ga0436365_0466916
1423 Ga0436365_0480563
1424 Ga0436363_1246730
1425 Ga0436362_0052015
1426 Ga0436362_0275944
1427 Ga0436362_1049344
1428 Ga0436362_1177533
1429 Ga0451802_1956103
1430 Ga0451804_0300085
1431 Ga0439448_0004172
1432 Ga0439448_0257357
1433 Ga0439451_072066
1434 Ga0439463_011323
1435 Ga0439463_197982
1436 Ga0439460_0291951
1437 Ga0450893_0050464
1438 Ga0439440_0028936
1439 Ga0439440_0117494
1440 Ga0439440_0219399
1441 Ga0439440_0257983
1442 Ga0453683_0951429
1443 Ga0466966_0000305
1444 Ga0466966_0016924
1445 Ga0466966_0034742
1446 Ga0466961_0032493
1447 Ga0466961_0049514
1448 Ga0466961_0134037
1449 Ga0466961_0345409
1450 Ga0466963_0000814
1451 Ga0466963_0001910
1452 Ga0466963_0002399
1453 Ga0466963_0189437
1454 Ga0466963_0561306
1455 Ga0466964_0112455
1456 Ga0466964_0263218
1457 Ga0466971_0250694
1458 Ga0466968_0014362
1459 Ga0466968_0046182
1460 Ga0466957_0009156
1461 Ga0466957_0883066
1462 Ga0466960_0462564
1463 Ga0466959_0002417
1464 Ga0466959_0010616
1465 Ga0466959_0035378
1466 Ga0466959_0774241
1467 Ga0451576_0006272
1468 Ga0451576_0362180
1469 Ga0466958_0009274
1470 Ga0466958_0034288
1471 Ga0466958_0646776
1472 Ga0466967_0002685
1473 Ga0466967_0043599
1474 Ga0466967_0080368
1475 Ga0466967_0268803
1476 Ga0466967_0571958
1477 Ga0466967_0916011
1478 Ga0495592_0079957
1479 Ga0495603_0018969
1480 Ga0495629_0971200
1481 Ga0495638_0619789
1482 Ga0495641_0065320
1483 Ga0495641_0119065
1484 Ga0495641_0253021
1485 Ga0495651_0328435
1486 Ga0495653_0067423
1487 Ga0495653_0372577
1488 Ga0495605_0155809
1489 Ga0495662_0552981
1490 Ga0495664_0046928
1491 Ga0495664_0364393
1492 Ga0495664_0595746
1493 Ga0495584_0144702
1494 Ga0495594_0865639
1495 Ga0495596_0120329
1496 Ga0495607_0100791
1497 Ga0495583_0139315
1498 Ga0495608_0032884
1499 Ga0495608_0215015
1500 Ga0495620_0171403
1501 Ga0495620_0193402
1502 Ga0495628_0029102
1503 Ga0495628_0152707
1504 Ga0495630_0049161
1505 Ga0495631_0193846
1506 Ga0495644_0083874
1507 Ga0495663_0115614
1508 Ga0495642_0137681
1509 Ga0495642_0343572
1510 Ga0495652_0069347
1511 Ga0495640_0013066
1512 Ga0495640_0715848
1513 Ga0495598_0370202
1514 Ga0495609_0095005
1515 Ga0495621_0198590
1516 Ga0495667_0250980
1517 Ga0495667_0408680
1518 Ga0495656_0249881
1519 Ga0495656_0431705
1520 Ga0495634_0023453
1521 Ga0495634_0237177
1522 Ga0495611_0228857
1523 Ga0495635_0071157
1524 Ga0495635_0802040
1525 Ga0495659_0131058
1526 Ga0495661_0222255
1527 Ga0495657_0034709
1528 Ga0495657_0141290
1529 Ga0495657_0192818
1530 Ga0495646_0182318
1531 Ga0495646_0238345
1532 Ga0495647_0313084
1533 Ga0495613_0247103
1534 Ga0495671_0191066
1535 Ga0495589_0195145
1536 Ga0495589_0218683
1537 Ga0495660_0169643
1538 Ga0495581_0203260
1539 Ga0495604_0198658
1540 Ga0495604_0448733
1541 Ga0495636_0160920
1542 Ga0495674_0015228
1543 Ga0495674_0053438
1544 Ga0495676_0193161
1545 Ga0495680_0039139
1546 Ga0495680_0078226
1547 Ga0495683_0234884
1548 Ga0495675_0122999
1549 Ga0495675_0373871
1550 Ga0495677_0096472
1551 Ga0495679_154920
1552 Ga0495684_0291628
1553 Ga0495614_0436852
1554 Ga0495615_0135662
1555 Ga0496100_0001249
1556 Ga0496100_0057712
1557 Ga0496100_0149865
1558 Ga0496100_0255268
1559 Ga0496101_0003908
1560 Ga0496101_0018246
1561 Ga0496101_0043005
1562 Ga0496101_0343768
1563 Ga0496101_0385409
1564 Ga0496101_1522231
1565 Ga0496102_0001864
1566 Ga0496102_0009357
1567 Ga0496102_0030802
1568 Ga0496102_0819711
1569 Ga0496102_1428669
1570 Ga0496103_0028430
1571 Ga0496103_0046534
1572 Ga0496103_0507897
1573 Ga0496104_0000288
1574 Ga0496104_0063165
1575 Ga0496104_0070017
1576 Ga0496104_0216131
1577 Ga0496104_0325695
1578 Ga0496104_0990249
1579 Ga0496104_1733598
1580 Ga0496105_0000133
1581 Ga0496105_0005062
1582 Ga0496105_0109300
1583 Ga0496105_0154772
1584 Ga0496105_0236231
1585 Ga0496105_1105081
1586 Ga0496105_1157880
1587 Ga0496106_0000903
1588 Ga0496106_0015684
1589 Ga0496106_0028124
1590 Ga0496106_0170758
1591 Ga0496107_0037665
1592 Ga0496107_0180889
1593 Ga0496107_0825997
1594 Ga0496108_0025744
1595 Ga0496108_0234352
1596 Ga0496108_0520748
1597 Ga0496108_0822250
1598 Ga0496108_1556507
1599 Ga0496109_0020759
1600 Ga0496109_0041153
1601 Ga0496109_0189420
1602 Ga0496109_0191444
1603 Ga0496109_0256675
1604 Ga0496109_0680439
1605 Ga0496109_1180753
1606 Ga0496109_1682275
1607 Ga0496110_0002795
1608 Ga0496110_0036927
1609 Ga0496110_0067869
1610 Ga0496110_0404459
1611 Ga0496111_0085212
1612 Ga0496111_0565308
1613 Ga0496111_0606417
1614 Ga0496112_0025833
1615 Ga0496112_0149704
1616 Ga0496112_0247334
1617 Ga0496112_0453148
1618 Ga0496112_0530605
1619 Ga0496112_1310705
1620 Ga0496112_1431882
1621 Ga0496113_0079606
1622 Ga0496113_0142047
1623 Ga0496113_0863400
1624 Ga0496113_1457061
1625 Ga0496114_0007644
1626 Ga0496114_0155909
1627 Ga0496114_0283245
1628 Ga0496114_0362811
1629 Ga0496114_0543803
1630 Ga0496114_0636208
1631 Ga0496114_0750504
1632 Ga0496114_1546445
1633 Ga0496115_0000494
1634 Ga0496115_0153726
1635 Ga0496115_0181122
1636 Ga0501031_0000080
1637 Ga0501031_0044813
1638 Ga0501031_0190997
1639 Ga0501031_0461481
1640 Ga0501032_0000140
1641 Ga0501032_0199028
1642 Ga0501032_0274931
1643 Ga0501033_0000268
1644 Ga0501033_0037837
1645 Ga0501033_0073289
1646 Ga0501033_0492183
1647 Ga0501036_0000535
1648 Ga0501036_0018233
1649 Ga0501036_0018334
1650 Ga0501036_0027417
1651 Ga0501036_0628774
1652 Ga0501037_0000071
1653 Ga0501038_0000356
1654 Ga0501038_0018537
1655 Ga0501038_0296434
1656 Ga0501039_0000112
1657 Ga0501039_0075891
1658 Ga0501039_0085767
1659 Ga0501039_0220392
1660 Ga0501039_0713061
1661 Ga0501040_0000346
1662 Ga0501040_0002290
1663 Ga0501040_0015701
1664 Ga0501040_0227239
1665 Ga0501040_0279562
1666 Ga0501041_0000033
1667 Ga0501041_0020824
1668 Ga0501041_0039391
1669 Ga0501041_0446937
1670 Ga0501041_0462149
1671 Ga0501042_0000220
1672 Ga0501042_0000668
1673 Ga0501042_0087592
1674 Ga0501043_0000603
1675 Ga0501043_0361328
1676 Ga0501043_0371567
1677 Ga0501046_0001101
1678 Ga0501046_0012467
1679 Ga0501047_0003071
1680 Ga0501048_0000079
1681 Ga0501048_0002010
1682 Ga0501048_0099596
1683 Ga0501048_0149990
1684 Ga0501067_0005117
1685 Ga0501067_0156757
1686 Ga0501067_0299955
1687 Ga0501068_0000086
1688 Ga0501068_0090907
1689 Ga0501069_0000194
1690 Ga0501069_0028891
1691 Ga0501069_0072402
1692 Ga0501069_0138435
1693 Ga0501069_0600269
1694 Ga0501069_0648426
1695 Ga0501070_0003025
1696 Ga0501070_0015940
1697 Ga0501070_0138359
1698 Ga0501070_0427854
1699 Ga0501070_0795270
1700 Ga0501071_0000055
1701 Ga0501071_0096479
1702 Ga0501071_0098353
1703 Ga0501071_0109734
1704 Ga0501071_0348134
1705 Ga0501072_0000221
1706 Ga0501072_0000258
1707 Ga0501072_0079599
1708 Ga0501072_0184337
1709 Ga0501072_0185618
1710 Ga0501073_0434691
1711 Ga0501074_0000112
1712 Ga0501074_0047332
1713 Ga0501074_0139677
1714 Ga0501074_0306960
1715 Ga0501074_0349505
1716 Ga0501074_0474634
1717 Ga0501074_0972084
1718 Ga0501075_0000105
1719 Ga0501075_0002018
1720 Ga0501075_0009429
1721 Ga0501075_0041485
1722 Ga0501075_0053710
1723 Ga0501075_0451146
1724 Ga0501075_1078317
1725 Ga0501076_0000147
1726 Ga0501076_0001572
1727 Ga0501076_0001664
1728 Ga0501076_0146158
1729 Ga0501076_0637209
1730 Ga0501077_0000133
1731 Ga0501077_0007093
1732 Ga0501077_0016659
1733 Ga0501077_0221258
1734 Ga0501079_0000144
1735 Ga0501079_0000158
1736 Ga0501079_0025816
1737 Ga0501079_0944219
1738 Ga0501080_0000650
1739 Ga0501080_0002437
1740 Ga0501080_0440473
1741 Ga0501080_0473729
1742 Ga0501080_0860697
1743 Ga0501081_0000013
1744 Ga0501081_0001276
1745 Ga0501081_0014976
1746 Ga0501081_0015918
1747 Ga0501083_0000640
1748 Ga0501083_0072234
1749 Ga0501083_0696559
1750 Ga0501035_0001508
1751 Ga0501035_0020329
1752 Ga0501035_0443985
1753 Ga0501044_0004117
1754 Ga0501045_0000529
1755 Ga0501045_0001352
1756 Ga0501045_0008805
1757 nmdc:mga03n38_905828_c1
1758 nmdc:mga05p37_40073_c1
1759 nmdc:mga05p37_806050_c1
1760 nmdc:mga05p37_888566_c1
1761 nmdc:mga09592_160256_c1
1762 nmdc:mga0qj67_204795_c1
1763 nmdc:mga0qj67_75114_c1
1764 nmdc:mga0qj67_800101_c1
1765 nmdc:mga06r32_1269229_c1
1766 nmdc:mga06r32_144614_c1
1767 nmdc:mga06r32_2485_c1
1768 nmdc:mga06r32_4967_c1
1769 nmdc:mga06r32_74297_c1
1770 nmdc:mga0n895_183290_c1
1771 nmdc:mga0n895_518473_c1
1772 nmdc:mga0rr50_115995_c1
1773 nmdc:mga0rr50_188091_c1
1774 nmdc:mga08x19_1101402_c1
1775 nmdc:mga08x19_527101_c1
1776 nmdc:mga08x19_54920_c1
1777 nmdc:mga0a205_335965_c1
1778 Ga0495601_0086904
1779 Ga0495655_0269525
1780 Ga0495595_0263489
1781 Ga0495619_0027064
1782 Ga0495619_0167622
1783 Ga0501084_0000072
1784 Ga0501084_0003639
1785 Ga0501084_0066855
1786 Ga0501084_0497159
1787 Ga0587080_169130
1788 Ga0587072_131186
1789 Ga0501082_0000412
1790 Ga0501082_0001954
1791 Ga0501082_0103245
1792 Ga0501082_0173383
1793 Ga0501082_0403208
1794 Ga0466962_0023054
1795 Ga0466962_0048322
1796 Ga0466962_0170494
1797 Ga0530510_0000032
1798 Ga0530510_0005717
1799 Ga0530510_0041721
1800 Ga0530510_0273596
1801 Ga0530510_0304606
1802 Ga0530510_0436335
1803 Ga0530510_1003928
1804 Ga0530510_1263464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

28

75

0.97

PF12840

HTH_20

Helix-turn-helix domain

26

76

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9492 18 75
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9455 18 66
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.945 19 74
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9408 19 75
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9331 19 75
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9819 16 73 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9722 12 74 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9627 6 81 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9603 16 76 1.10.10.10
af_P64638_1_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.954 19 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A659UVB0-F1-model_v4 ArsR family transcriptional regulator 0.9972 8 79 GO:0003700
AF-A0A538GBV1-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9869 8 86 GO:0003700
AF-A0A345WP68-F1-model_v4 Transcriptional regulator 0.9802 8 79 GO:0003700
AF-A0A6J4R5D0-F1-model_v4 HTH arsR-type domain-containing protein 0.9772 2 75 GO:0003700
AF-A0A6J4UPW9-F1-model_v4 HTH arsR-type domain-containing protein 0.9764 6 79 GO:0003700

Map