F485181
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 901 | 395 | 1802 | 336 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_0633995|Ga0436360_0633995_857_1921 |
| Length | 354 |
| Sequence | VQGPEGPAFLGEDRSMRSWKLLVAAIVAGGVAAVAPLHESAAQSPAKIRLAWVVQVANWVSILPEKPDLLQHQGKSYVLEPVRFQGTPPMISAMAINDLEIGNLAYSSFSLAVENANLSDLRIIADEFQDGVPGYYSDEFFVAKDSPIKTVEDLKGKVLATNAVGSAVDIAMRAMLRKHNMQDKRDVTIIEAAFPNMPAMLAEHKVDAFPGVLPFSVNPAIRGATRTLFSQKEAVGTTQMIVWAARAGFIQKNRAALVDFMEDMLRAERWFLAPANHKDAVAIAAKVSKQPEANFDSWLFTKQDYYRDPDAKPNLDAFQANVDLQKELGFLKAGFDVKKFADLSIVDDAAKRLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 15 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 134 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 135 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 224 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 225 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 246 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 253 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 261 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 265 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 266 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 350 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 351 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 352 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 376 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 377 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 378 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 392 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 393 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 394 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.55 |
| Nodule | 0 |
| Rhizoplane | 6.22 |
| Rhizosphere | 91.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436360_0633995 | 3300039438 | Bacteria | 2088 |
| 2 | 2214884102 | 2209111006 | Bacteria | 1487 |
| 3 | ARcpr5oldR_c000321 | 3300000041 | Bacteria | 6866 |
| 4 | ARcpr5oldR_c003388 | 3300000041 | Bacteria | 1419 |
| 5 | ARSoilYngRDRAFT_c00231 | 3300000042 | Bacteria | 8934 |
| 6 | ARcpr5yngRDRAFT_c000416 | 3300000043 | Bacteria | 5603 |
| 7 | ARSoilOldRDRAFT_c000416 | 3300000044 | Bacteria | 5163 |
| 8 | ARSoilOldRDRAFT_c001840 | 3300000044 | Bacteria | 1946 |
| 9 | ARCol0oldRDRAFT_c00633 | 3300000045 | Bacteria | 3090 |
| 10 | ARCol0yngRDRAFT_1000060 | 3300000652 | Bacteria | 19698 |
| 11 | JGI24739J22299_10006512 | 3300001989 | Bacteria | 4402 |
| 12 | JGI24737J22298_10002394 | 3300001990 | Bacteria | 6691 |
| 13 | JGI24750J21931_1000574 | 3300002070 | Bacteria | 5637 |
| 14 | JGI24748J21848_1001596 | 3300002074 | Bacteria | 2523 |
| 15 | JGI24749J21850_1000589 | 3300002076 | Bacteria | 5297 |
| 16 | JGI24035J26624_1000525 | 3300002126 | Bacteria | 3569 |
| 17 | JGI24033J26618_1002159 | 3300002155 | Bacteria | 1987 |
| 18 | JGI25153J46596_10018707 | 3300003215 | Bacteria | 2679 |
| 19 | JGI25405J52794_10007742 | 3300003911 | Bacteria | 1989 |
| 20 | Ga0065717_1002190 | 3300005276 | Bacteria | 2540 |
| 21 | Ga0065704_10084523 | 3300005289 | Bacteria | 3326 |
| 22 | Ga0065712_10001151 | 3300005290 | Bacteria | 7296 |
| 23 | Ga0065712_10095860 | 3300005290 | Bacteria | 2201 |
| 24 | Ga0065715_10097198 | 3300005293 | Bacteria | 3713 |
| 25 | Ga0070658_10022977 | 3300005327 | Bacteria | 5006 |
| 26 | Ga0070658_10054799 | 3300005327 | Bacteria | 3238 |
| 27 | Ga0070676_10003946 | 3300005328 | Bacteria | 7787 |
| 28 | Ga0070676_10021880 | 3300005328 | Bacteria | 3582 |
| 29 | Ga0070676_10038660 | 3300005328 | Bacteria | 2757 |
| 30 | Ga0070683_100003103 | 3300005329 | Bacteria | 13382 |
| 31 | Ga0070683_100150832 | 3300005329 | Unclassified | 2204 |
| 32 | Ga0070683_100183263 | 3300005329 | Bacteria | 1987 |
| 33 | Ga0070683_100202216 | 3300005329 | Bacteria | 1886 |
| 34 | Ga0070683_100548241 | 3300005329 | Bacteria | 1106 |
| 35 | Ga0070690_100001658 | 3300005330 | Bacteria | 11711 |
| 36 | Ga0070690_100010704 | 3300005330 | Bacteria | 5346 |
| 37 | Ga0070690_100019237 | 3300005330 | Bacteria | 4140 |
| 38 | Ga0070670_100005908 | 3300005331 | Bacteria | 10347 |
| 39 | Ga0070670_100036096 | 3300005331 | Bacteria | 4255 |
| 40 | Ga0070670_100077577 | 3300005331 | Bacteria | 2854 |
| 41 | Ga0070677_10002586 | 3300005333 | Bacteria | 5795 |
| 42 | Ga0068869_100003321 | 3300005334 | Bacteria | 9826 |
| 43 | Ga0070666_10010072 | 3300005335 | Bacteria | 5900 |
| 44 | Ga0070666_10197839 | 3300005335 | Bacteria | 1413 |
| 45 | Ga0070666_10270656 | 3300005335 | Bacteria | 1206 |
| 46 | Ga0070680_100004657 | 3300005336 | Bacteria | 10314 |
| 47 | Ga0070680_100004754 | 3300005336 | Bacteria | 10222 |
| 48 | Ga0070680_100005234 | 3300005336 | Bacteria | 9816 |
| 49 | Ga0070680_100047356 | 3300005336 | Bacteria | 3500 |
| 50 | Ga0070680_100052654 | 3300005336 | Bacteria | 3322 |
| 51 | Ga0070682_100002520 | 3300005337 | Bacteria | 10107 |
| 52 | Ga0070682_100004239 | 3300005337 | Bacteria | 7959 |
| 53 | Ga0068868_100009819 | 3300005338 | Bacteria | 6907 |
| 54 | Ga0068868_100015151 | 3300005338 | Bacteria | 5696 |
| 55 | Ga0070660_100001332 | 3300005339 | Bacteria | 16783 |
| 56 | Ga0070660_100061560 | 3300005339 | Bacteria | 2914 |
| 57 | Ga0070660_100148071 | 3300005339 | Bacteria | 1887 |
| 58 | Ga0070660_100294015 | 3300005339 | Bacteria | 1330 |
| 59 | Ga0070689_100010863 | 3300005340 | Bacteria | 6508 |
| 60 | Ga0070689_100058814 | 3300005340 | Bacteria | 2986 |
| 61 | Ga0070689_100068889 | 3300005340 | Bacteria | 2760 |
| 62 | Ga0070691_10002586 | 3300005341 | Bacteria | 8070 |
| 63 | Ga0070691_10096316 | 3300005341 | Unclassified | 1465 |
| 64 | Ga0070687_100001160 | 3300005343 | Bacteria | 9117 |
| 65 | Ga0070687_100008437 | 3300005343 | Bacteria | 4365 |
| 66 | Ga0070687_100052129 | 3300005343 | Unclassified | 2122 |
| 67 | Ga0070661_100002370 | 3300005344 | Bacteria | 12928 |
| 68 | Ga0070692_10000841 | 3300005345 | Bacteria | 10313 |
| 69 | Ga0070668_100006877 | 3300005347 | Bacteria | 8430 |
| 70 | Ga0070669_100213189 | 3300005353 | Bacteria | 1524 |
| 71 | Ga0070675_100036372 | 3300005354 | Bacteria | 4007 |
| 72 | Ga0070671_100005218 | 3300005355 | Bacteria | 10352 |
| 73 | Ga0070671_100244547 | 3300005355 | Bacteria | 1523 |
| 74 | Ga0070674_100006788 | 3300005356 | Bacteria | 6705 |
| 75 | Ga0070674_100069203 | 3300005356 | Bacteria | 2489 |
| 76 | Ga0070673_100000418 | 3300005364 | Bacteria | 22446 |
| 77 | Ga0070673_100013146 | 3300005364 | Bacteria | 5715 |
| 78 | Ga0070673_100258586 | 3300005364 | Unclassified | 1520 |
| 79 | Ga0070673_100307896 | 3300005364 | Bacteria | 1396 |
| 80 | Ga0070688_100000906 | 3300005365 | Bacteria | 14793 |
| 81 | Ga0070688_100005689 | 3300005365 | Bacteria | 6585 |
| 82 | Ga0070688_100126679 | 3300005365 | Bacteria | 1717 |
| 83 | Ga0070659_100003550 | 3300005366 | Bacteria | 11108 |
| 84 | Ga0070659_100037101 | 3300005366 | Bacteria | 3799 |
| 85 | Ga0070667_100007947 | 3300005367 | Bacteria | 8797 |
| 86 | Ga0070667_100038093 | 3300005367 | Bacteria | 4031 |
| 87 | Ga0070709_10011874 | 3300005434 | Bacteria | 4863 |
| 88 | Ga0070709_10091488 | 3300005434 | Bacteria | 2008 |
| 89 | Ga0070714_100003463 | 3300005435 | Bacteria | 11765 |
| 90 | Ga0070714_100046239 | 3300005435 | Bacteria | 3691 |
| 91 | Ga0070714_100078401 | 3300005435 | Bacteria | 2871 |
| 92 | Ga0070714_100128333 | 3300005435 | Bacteria | 2264 |
| 93 | Ga0070713_100000526 | 3300005436 | Bacteria | 24268 |
| 94 | Ga0070713_100024541 | 3300005436 | Bacteria | 4698 |
| 95 | Ga0070713_100090366 | 3300005436 | Bacteria | 2632 |
| 96 | Ga0070713_100268898 | 3300005436 | Bacteria | 1560 |
| 97 | Ga0070710_10002488 | 3300005437 | Bacteria | 8729 |
| 98 | Ga0070710_10008974 | 3300005437 | Bacteria | 4884 |
| 99 | Ga0070710_10067235 | 3300005437 | Bacteria | 2056 |
| 100 | Ga0070710_10074467 | 3300005437 | Bacteria | 1965 |
| 101 | Ga0070710_10124236 | 3300005437 | Bacteria | 1566 |
| 102 | Ga0070701_10000664 | 3300005438 | Bacteria | 12083 |
| 103 | Ga0070701_10001792 | 3300005438 | Bacteria | 8107 |
| 104 | Ga0070701_10011452 | 3300005438 | Bacteria | 3966 |
| 105 | Ga0070711_100135525 | 3300005439 | Bacteria | 1840 |
| 106 | Ga0070711_100173906 | 3300005439 | Bacteria | 1643 |
| 107 | Ga0070711_100266547 | 3300005439 | Bacteria | 1350 |
| 108 | Ga0070711_100320364 | 3300005439 | Bacteria | 1238 |
| 109 | Ga0070705_100001611 | 3300005440 | Bacteria | 11832 |
| 110 | Ga0070705_100003104 | 3300005440 | Bacteria | 8170 |
| 111 | Ga0070705_100027365 | 3300005440 | Bacteria | 3113 |
| 112 | Ga0070700_100002145 | 3300005441 | Bacteria | 10006 |
| 113 | Ga0070700_100019655 | 3300005441 | Bacteria | 3902 |
| 114 | Ga0070700_100177925 | 3300005441 | Bacteria | 1478 |
| 115 | Ga0070694_100002530 | 3300005444 | Bacteria | 10796 |
| 116 | Ga0070694_100014569 | 3300005444 | Bacteria | 4922 |
| 117 | Ga0070708_100033405 | 3300005445 | Bacteria | 4469 |
| 118 | Ga0070663_100002896 | 3300005455 | Bacteria | 9759 |
| 119 | Ga0070663_100043990 | 3300005455 | Unclassified | 3145 |
| 120 | Ga0070663_100092124 | 3300005455 | Unclassified | 2247 |
| 121 | Ga0070663_100094739 | 3300005455 | Bacteria | 2218 |
| 122 | Ga0070663_100224446 | 3300005455 | Bacteria | 1476 |
| 123 | Ga0070678_100001494 | 3300005456 | Bacteria | 12493 |
| 124 | Ga0070678_100005419 | 3300005456 | Bacteria | 7367 |
| 125 | Ga0070678_100365183 | 3300005456 | Unclassified | 1245 |
| 126 | Ga0070662_100018866 | 3300005457 | Bacteria | 4673 |
| 127 | Ga0070662_100024993 | 3300005457 | Bacteria | 4121 |
| 128 | Ga0070681_10008649 | 3300005458 | Bacteria | 9982 |
| 129 | Ga0070681_10008829 | 3300005458 | Bacteria | 9898 |
| 130 | Ga0070681_10058275 | 3300005458 | Bacteria | 3842 |
| 131 | Ga0070681_10124675 | 3300005458 | Bacteria | 2508 |
| 132 | Ga0068867_100003064 | 3300005459 | Bacteria | 11775 |
| 133 | Ga0068867_100021369 | 3300005459 | Bacteria | 4618 |
| 134 | Ga0068867_100026593 | 3300005459 | Bacteria | 4156 |
| 135 | Ga0068867_100058714 | 3300005459 | Bacteria | 2851 |
| 136 | Ga0070685_10006922 | 3300005466 | Bacteria | 5788 |
| 137 | Ga0070685_10012087 | 3300005466 | Bacteria | 4527 |
| 138 | Ga0070685_10016861 | 3300005466 | Bacteria | 3899 |
| 139 | Ga0070707_100237240 | 3300005468 | Unclassified | 1775 |
| 140 | Ga0070699_100316301 | 3300005518 | Bacteria | 1402 |
| 141 | Ga0070699_100474102 | 3300005518 | Bacteria | 1136 |
| 142 | Ga0070679_100018279 | 3300005530 | Bacteria | 6799 |
| 143 | Ga0070679_100174232 | 3300005530 | Bacteria | 2124 |
| 144 | Ga0070679_100227935 | 3300005530 | Unclassified | 1823 |
| 145 | Ga0070684_100001969 | 3300005535 | Bacteria | 15093 |
| 146 | Ga0070684_100017395 | 3300005535 | Bacteria | 5900 |
| 147 | Ga0070684_100043609 | 3300005535 | Bacteria | 3874 |
| 148 | Ga0070684_100044181 | 3300005535 | Bacteria | 3852 |
| 149 | Ga0070697_100044335 | 3300005536 | Bacteria | 3602 |
| 150 | Ga0068853_100004522 | 3300005539 | Bacteria | 10792 |
| 151 | Ga0068853_100030662 | 3300005539 | Bacteria | 4543 |
| 152 | Ga0068853_100041332 | 3300005539 | Bacteria | 3937 |
| 153 | Ga0068853_100081940 | 3300005539 | Bacteria | 2825 |
| 154 | Ga0068853_100217590 | 3300005539 | Unclassified | 1743 |
| 155 | Ga0070672_100006625 | 3300005543 | Bacteria | 7801 |
| 156 | Ga0070672_100075679 | 3300005543 | Bacteria | 2688 |
| 157 | Ga0070686_100002237 | 3300005544 | Bacteria | 10673 |
| 158 | Ga0070686_100003181 | 3300005544 | Bacteria | 8988 |
| 159 | Ga0070695_100000331 | 3300005545 | Bacteria | 24300 |
| 160 | Ga0070695_100002841 | 3300005545 | Bacteria | 10066 |
| 161 | Ga0070695_100024431 | 3300005545 | Bacteria | 3722 |
| 162 | Ga0070695_100029355 | 3300005545 | Unclassified | 3416 |
| 163 | Ga0070696_100000690 | 3300005546 | Bacteria | 21595 |
| 164 | Ga0070696_100003720 | 3300005546 | Bacteria | 10178 |
| 165 | Ga0070693_100001170 | 3300005547 | Bacteria | 11794 |
| 166 | Ga0070693_100008368 | 3300005547 | Bacteria | 5096 |
| 167 | Ga0070693_100040681 | 3300005547 | Bacteria | 2611 |
| 168 | Ga0070693_100120443 | 3300005547 | Unclassified | 1627 |
| 169 | Ga0070693_100165113 | 3300005547 | Bacteria | 1413 |
| 170 | Ga0070665_100027334 | 3300005548 | Bacteria | 5747 |
| 171 | Ga0070665_100136974 | 3300005548 | Bacteria | 2451 |
| 172 | Ga0070665_100256547 | 3300005548 | Bacteria | 1749 |
| 173 | Ga0070665_100501575 | 3300005548 | Bacteria | 1225 |
| 174 | Ga0070704_100013589 | 3300005549 | Bacteria | 5058 |
| 175 | Ga0070704_100184237 | 3300005549 | Bacteria | 1673 |
| 176 | Ga0068855_100010841 | 3300005563 | Bacteria | 11004 |
| 177 | Ga0068855_100011516 | 3300005563 | Bacteria | 10688 |
| 178 | Ga0068855_100013983 | 3300005563 | Bacteria | 9676 |
| 179 | Ga0068855_100041680 | 3300005563 | Bacteria | 5440 |
| 180 | Ga0068855_100146561 | 3300005563 | Bacteria | 2687 |
| 181 | Ga0068855_100149640 | 3300005563 | Bacteria | 2654 |
| 182 | Ga0068855_100360041 | 3300005563 | Bacteria | 1601 |
| 183 | Ga0070664_100086864 | 3300005564 | Bacteria | 2702 |
| 184 | Ga0070664_100121014 | 3300005564 | Bacteria | 2292 |
| 185 | Ga0070664_100134427 | 3300005564 | Bacteria | 2174 |
| 186 | Ga0068857_100002282 | 3300005577 | Bacteria | 15594 |
| 187 | Ga0068857_100006348 | 3300005577 | Bacteria | 10122 |
| 188 | Ga0068857_100218123 | 3300005577 | Bacteria | 1742 |
| 189 | Ga0068854_100011480 | 3300005578 | Bacteria | 5770 |
| 190 | Ga0068854_100130580 | 3300005578 | Unclassified | 1918 |
| 191 | Ga0068856_100002597 | 3300005614 | Bacteria | 18595 |
| 192 | Ga0068856_100047110 | 3300005614 | Bacteria | 4246 |
| 193 | Ga0068856_100102557 | 3300005614 | Bacteria | 2855 |
| 194 | Ga0068856_100277102 | 3300005614 | Bacteria | 1694 |
| 195 | Ga0068856_100331219 | 3300005614 | Bacteria | 1540 |
| 196 | Ga0068856_100469161 | 3300005614 | Bacteria | 1279 |
| 197 | Ga0070702_100077459 | 3300005615 | Bacteria | 1982 |
| 198 | Ga0068852_100006066 | 3300005616 | Bacteria | 8706 |
| 199 | Ga0068852_100008161 | 3300005616 | Bacteria | 7690 |
| 200 | Ga0068852_100065934 | 3300005616 | Bacteria | 3160 |
| 201 | Ga0068852_100271543 | 3300005616 | Bacteria | 1632 |
| 202 | Ga0068859_100000988 | 3300005617 | Bacteria | 29125 |
| 203 | Ga0068859_100005044 | 3300005617 | Bacteria | 13403 |
| 204 | Ga0068859_100029475 | 3300005617 | Bacteria | 5506 |
| 205 | Ga0068859_100065542 | 3300005617 | Bacteria | 3666 |
| 206 | Ga0068864_100003691 | 3300005618 | Bacteria | 12643 |
| 207 | Ga0068866_10000899 | 3300005718 | Bacteria | 13114 |
| 208 | Ga0068866_10033966 | 3300005718 | Bacteria | 2480 |
| 209 | Ga0068861_100243087 | 3300005719 | Bacteria | 1532 |
| 210 | Ga0068861_100393533 | 3300005719 | Bacteria | 1228 |
| 211 | Ga0068870_10000555 | 3300005840 | Bacteria | 14125 |
| 212 | Ga0068863_100185610 | 3300005841 | Bacteria | 1997 |
| 213 | Ga0068863_100443015 | 3300005841 | Bacteria | 1274 |
| 214 | Ga0068858_100013722 | 3300005842 | Bacteria | 7647 |
| 215 | Ga0068858_100015828 | 3300005842 | Bacteria | 7089 |
| 216 | Ga0068858_100054078 | 3300005842 | Bacteria | 3713 |
| 217 | Ga0068858_100093821 | 3300005842 | Bacteria | 2794 |
| 218 | Ga0068860_100038447 | 3300005843 | Bacteria | 4577 |
| 219 | Ga0068860_100039551 | 3300005843 | Bacteria | 4511 |
| 220 | Ga0068860_100047902 | 3300005843 | Bacteria | 4073 |
| 221 | Ga0068860_100099497 | 3300005843 | Bacteria | 2773 |
| 222 | Ga0068862_100002130 | 3300005844 | Bacteria | 17832 |
| 223 | Ga0068862_100003011 | 3300005844 | Bacteria | 14700 |
| 224 | Ga0068862_100042347 | 3300005844 | Bacteria | 3879 |
| 225 | Ga0068862_100191316 | 3300005844 | Bacteria | 1841 |
| 226 | Ga0081455_10000108 | 3300005937 | Bacteria | 93068 |
| 227 | Ga0081455_10000673 | 3300005937 | Bacteria | 44258 |
| 228 | Ga0081455_10001313 | 3300005937 | Bacteria | 30820 |
| 229 | Ga0081455_10032768 | 3300005937 | Bacteria | 4678 |
| 230 | Ga0081455_10050046 | 3300005937 | Bacteria | 3596 |
| 231 | Ga0081538_10026138 | 3300005981 | Bacteria | 4092 |
| 232 | Ga0081538_10029934 | 3300005981 | Bacteria | 3707 |
| 233 | Ga0081540_1000017 | 3300005983 | Bacteria | 164991 |
| 234 | Ga0081540_1000085 | 3300005983 | Bacteria | 99716 |
| 235 | Ga0081540_1000257 | 3300005983 | Bacteria | 55989 |
| 236 | Ga0081540_1001987 | 3300005983 | Bacteria | 17059 |
| 237 | Ga0081540_1010138 | 3300005983 | Bacteria | 6413 |
| 238 | Ga0081540_1036026 | 3300005983 | Bacteria | 2645 |
| 239 | Ga0070717_10000425 | 3300006028 | Bacteria | 27019 |
| 240 | Ga0075365_10002135 | 3300006038 | Bacteria | 9492 |
| 241 | Ga0075365_10036375 | 3300006038 | Bacteria | 3190 |
| 242 | Ga0075365_10057796 | 3300006038 | Bacteria | 2581 |
| 243 | Ga0075365_10065457 | 3300006038 | Bacteria | 2436 |
| 244 | Ga0075363_100020300 | 3300006048 | Bacteria | 3331 |
| 245 | Ga0075364_10095831 | 3300006051 | Unclassified | 1973 |
| 246 | Ga0070715_10003130 | 3300006163 | Bacteria | 5200 |
| 247 | Ga0070715_10063526 | 3300006163 | Bacteria | 1628 |
| 248 | Ga0070715_10073427 | 3300006163 | Bacteria | 1534 |
| 249 | Ga0070716_100012172 | 3300006173 | Bacteria | 4354 |
| 250 | Ga0070716_100076753 | 3300006173 | Bacteria | 1981 |
| 251 | Ga0070712_100111407 | 3300006175 | Bacteria | 2043 |
| 252 | Ga0075367_10032274 | 3300006178 | Bacteria | 3012 |
| 253 | Ga0075367_10088985 | 3300006178 | Bacteria | 1877 |
| 254 | Ga0075367_10128489 | 3300006178 | Bacteria | 1565 |
| 255 | Ga0075369_10006001 | 3300006186 | Bacteria | 4573 |
| 256 | Ga0075366_10047359 | 3300006195 | Bacteria | 2548 |
| 257 | Ga0097621_100036961 | 3300006237 | Bacteria | 3909 |
| 258 | Ga0097621_100212652 | 3300006237 | Bacteria | 1682 |
| 259 | Ga0068871_100018198 | 3300006358 | Bacteria | 5335 |
| 260 | Ga0068871_100034440 | 3300006358 | Bacteria | 4018 |
| 261 | Ga0075428_100013854 | 3300006844 | Bacteria | 8979 |
| 262 | Ga0075428_100027887 | 3300006844 | Bacteria | 6248 |
| 263 | Ga0075428_100092925 | 3300006844 | Bacteria | 3289 |
| 264 | Ga0075428_100571170 | 3300006844 | Bacteria | 1208 |
| 265 | Ga0075430_100000140 | 3300006846 | Bacteria | 46272 |
| 266 | Ga0075430_100034989 | 3300006846 | Bacteria | 4264 |
| 267 | Ga0075431_100001318 | 3300006847 | Bacteria | 22699 |
| 268 | Ga0075431_100080552 | 3300006847 | Bacteria | 3362 |
| 269 | Ga0075431_100155060 | 3300006847 | Bacteria | 2356 |
| 270 | Ga0075431_100178555 | 3300006847 | Bacteria | 2179 |
| 271 | Ga0075431_100269069 | 3300006847 | Bacteria | 1728 |
| 272 | Ga0075431_100333870 | 3300006847 | Bacteria | 1526 |
| 273 | Ga0075433_10000050 | 3300006852 | Bacteria | 50089 |
| 274 | Ga0075433_10005076 | 3300006852 | Bacteria | 10322 |
| 275 | Ga0075433_10421905 | 3300006852 | Bacteria | 1176 |
| 276 | Ga0075434_100000179 | 3300006871 | Bacteria | 41085 |
| 277 | Ga0075434_100062927 | 3300006871 | Bacteria | 3693 |
| 278 | Ga0075434_100117009 | 3300006871 | Bacteria | 2679 |
| 279 | Ga0075434_100145575 | 3300006871 | Bacteria | 2390 |
| 280 | Ga0075434_100459460 | 3300006871 | Bacteria | 1294 |
| 281 | Ga0075429_100009748 | 3300006880 | Bacteria | 8325 |
| 282 | Ga0068865_100040353 | 3300006881 | Bacteria | 3171 |
| 283 | Ga0075436_100120638 | 3300006914 | Bacteria | 1834 |
| 284 | Ga0097620_100000988 | 3300006931 | Bacteria | 29125 |
| 285 | Ga0097620_100005044 | 3300006931 | Bacteria | 13403 |
| 286 | Ga0097620_100029475 | 3300006931 | Bacteria | 5506 |
| 287 | Ga0097620_100065543 | 3300006931 | Bacteria | 3666 |
| 288 | Ga0075435_100014515 | 3300007076 | Bacteria | 5891 |
| 289 | Ga0075435_100137990 | 3300007076 | Unclassified | 2044 |
| 290 | Ga0075435_100278603 | 3300007076 | Bacteria | 1427 |
| 291 | Ga0099794_10005856 | 3300007265 | Bacteria | 4957 |
| 292 | Ga0105240_10046314 | 3300009093 | Bacteria | 5511 |
| 293 | Ga0111539_10000565 | 3300009094 | Bacteria | 47399 |
| 294 | Ga0111539_10003400 | 3300009094 | Bacteria | 20958 |
| 295 | Ga0111539_10042933 | 3300009094 | Bacteria | 5425 |
| 296 | Ga0105245_10006794 | 3300009098 | Bacteria | 10033 |
| 297 | Ga0105247_10123992 | 3300009101 | Bacteria | 1677 |
| 298 | Ga0105247_10158718 | 3300009101 | Bacteria | 1496 |
| 299 | Ga0114129_10007851 | 3300009147 | Bacteria | 15181 |
| 300 | Ga0114129_10008234 | 3300009147 | Bacteria | 14864 |
| 301 | Ga0114129_10015156 | 3300009147 | Bacteria | 10973 |
| 302 | Ga0114129_10109135 | 3300009147 | Unclassified | 3820 |
| 303 | Ga0114129_10180245 | 3300009147 | Bacteria | 2875 |
| 304 | Ga0114129_10372363 | 3300009147 | Bacteria | 1887 |
| 305 | Ga0105243_10007504 | 3300009148 | Bacteria | 8380 |
| 306 | Ga0105243_10029989 | 3300009148 | Bacteria | 4186 |
| 307 | Ga0105243_10041228 | 3300009148 | Bacteria | 3610 |
| 308 | Ga0105241_10002961 | 3300009174 | Bacteria | 12676 |
| 309 | Ga0105241_10040953 | 3300009174 | Bacteria | 3498 |
| 310 | Ga0105242_10004894 | 3300009176 | Bacteria | 10369 |
| 311 | Ga0105242_10045591 | 3300009176 | Bacteria | 3553 |
| 312 | Ga0105248_10005301 | 3300009177 | Bacteria | 14193 |
| 313 | Ga0105248_10005481 | 3300009177 | Bacteria | 13935 |
| 314 | Ga0105248_10018400 | 3300009177 | Bacteria | 7720 |
| 315 | Ga0105237_10059796 | 3300009545 | Bacteria | 3812 |
| 316 | Ga0105237_10074472 | 3300009545 | Bacteria | 3387 |
| 317 | Ga0105238_10036945 | 3300009551 | Bacteria | 4966 |
| 318 | Ga0105238_10052948 | 3300009551 | Bacteria | 4079 |
| 319 | Ga0105238_10078842 | 3300009551 | Bacteria | 3284 |
| 320 | Ga0105238_10265733 | 3300009551 | Bacteria | 1696 |
| 321 | Ga0105249_10000531 | 3300009553 | Bacteria | 35092 |
| 322 | Ga0105249_10095713 | 3300009553 | Bacteria | 2784 |
| 323 | Ga0105249_10169954 | 3300009553 | Unclassified | 2113 |
| 324 | Ga0105249_10318044 | 3300009553 | Bacteria | 1567 |
| 325 | Ga0105249_10667114 | 3300009553 | Bacteria | 1098 |
| 326 | Ga0105239_10124604 | 3300010375 | Bacteria | 2863 |
| 327 | Ga0105239_10482075 | 3300010375 | Bacteria | 1409 |
| 328 | Ga0105239_10570133 | 3300010375 | Bacteria | 1290 |
| 329 | Ga0105246_10006621 | 3300011119 | Bacteria | 7082 |
| 330 | Ga0105246_10029891 | 3300011119 | Bacteria | 3593 |
| 331 | Ga0105246_10066351 | 3300011119 | Bacteria | 2526 |
| 332 | Ga0157343_1001347 | 3300012488 | Bacteria | 1184 |
| 333 | Ga0157342_1000839 | 3300012507 | Unclassified | 2075 |
| 334 | Ga0157315_1001031 | 3300012508 | Bacteria | 1453 |
| 335 | Ga0157373_10019862 | 3300013100 | Bacteria | 4888 |
| 336 | Ga0157371_10018413 | 3300013102 | Bacteria | 5164 |
| 337 | Ga0157371_10219875 | 3300013102 | Bacteria | 1364 |
| 338 | Ga0157371_10289242 | 3300013102 | Bacteria | 1185 |
| 339 | Ga0157370_10180038 | 3300013104 | Bacteria | 1964 |
| 340 | Ga0157369_10382926 | 3300013105 | Bacteria | 1460 |
| 341 | Ga0157374_10005394 | 3300013296 | Bacteria | 10745 |
| 342 | Ga0157374_10018860 | 3300013296 | Bacteria | 6098 |
| 343 | Ga0157374_10226477 | 3300013296 | Bacteria | 1836 |
| 344 | Ga0157378_10045505 | 3300013297 | Bacteria | 3900 |
| 345 | Ga0157378_10409725 | 3300013297 | Bacteria | 1338 |
| 346 | Ga0163162_10011299 | 3300013306 | Bacteria | 8707 |
| 347 | Ga0163162_10143035 | 3300013306 | Bacteria | 2506 |
| 348 | Ga0163162_10216647 | 3300013306 | Bacteria | 2044 |
| 349 | Ga0163162_10241792 | 3300013306 | Bacteria | 1936 |
| 350 | Ga0157372_10005559 | 3300013307 | Bacteria | 13400 |
| 351 | Ga0157372_10108815 | 3300013307 | Bacteria | 3173 |
| 352 | Ga0157372_10285147 | 3300013307 | Bacteria | 1920 |
| 353 | Ga0157375_10004143 | 3300013308 | Bacteria | 12581 |
| 354 | Ga0157375_10020331 | 3300013308 | Bacteria | 6062 |
| 355 | Ga0163163_10004364 | 3300014325 | Bacteria | 12051 |
| 356 | Ga0163163_10049663 | 3300014325 | Bacteria | 4129 |
| 357 | Ga0163163_10129414 | 3300014325 | Bacteria | 2564 |
| 358 | Ga0163163_10161390 | 3300014325 | Bacteria | 2287 |
| 359 | Ga0157380_10004080 | 3300014326 | Bacteria | 10082 |
| 360 | Ga0157380_10060111 | 3300014326 | Bacteria | 3035 |
| 361 | Ga0182008_10109857 | 3300014497 | Bacteria | 1366 |
| 362 | Ga0157377_10002281 | 3300014745 | Bacteria | 8431 |
| 363 | Ga0157377_10083267 | 3300014745 | Bacteria | 1874 |
| 364 | Ga0157377_10147068 | 3300014745 | Bacteria | 1453 |
| 365 | Ga0157379_10003623 | 3300014968 | Bacteria | 13109 |
| 366 | Ga0157379_10029224 | 3300014968 | Bacteria | 4902 |
| 367 | Ga0157376_10008998 | 3300014969 | Bacteria | 7232 |
| 368 | Ga0163161_10088615 | 3300017792 | Bacteria | 2287 |
| 369 | Ga0209758_1000308 | 3300025297 | Bacteria | 94851 |
| 370 | Ga0207653_10000791 | 3300025885 | Bacteria | 10670 |
| 371 | Ga0207692_10006112 | 3300025898 | Bacteria | 4872 |
| 372 | Ga0207692_10069886 | 3300025898 | Bacteria | 1846 |
| 373 | Ga0207710_10002302 | 3300025900 | Bacteria | 8939 |
| 374 | Ga0207688_10006874 | 3300025901 | Bacteria | 6189 |
| 375 | Ga0207680_10004647 | 3300025903 | Bacteria | 6521 |
| 376 | Ga0207647_10042579 | 3300025904 | Bacteria | 2848 |
| 377 | Ga0207685_10000850 | 3300025905 | Bacteria | 5728 |
| 378 | Ga0207685_10016122 | 3300025905 | Bacteria | 2384 |
| 379 | Ga0207699_10090195 | 3300025906 | Bacteria | 1923 |
| 380 | Ga0207645_10078744 | 3300025907 | Bacteria | 2112 |
| 381 | Ga0207643_10001619 | 3300025908 | Bacteria | 12690 |
| 382 | Ga0207705_10048931 | 3300025909 | Bacteria | 3042 |
| 383 | Ga0207705_10105343 | 3300025909 | Bacteria | 2079 |
| 384 | Ga0207684_10064081 | 3300025910 | Bacteria | 3120 |
| 385 | Ga0207654_10056704 | 3300025911 | Bacteria | 2274 |
| 386 | Ga0207654_10206629 | 3300025911 | Bacteria | 1296 |
| 387 | Ga0207707_10036975 | 3300025912 | Bacteria | 4266 |
| 388 | Ga0207707_10153436 | 3300025912 | Unclassified | 2013 |
| 389 | Ga0207707_10478543 | 3300025912 | Bacteria | 1064 |
| 390 | Ga0207695_10186309 | 3300025913 | Bacteria | 1994 |
| 391 | Ga0207693_10003582 | 3300025915 | Bacteria | 13276 |
| 392 | Ga0207693_10004297 | 3300025915 | Bacteria | 12071 |
| 393 | Ga0207693_10011119 | 3300025915 | Bacteria | 7292 |
| 394 | Ga0207693_10066437 | 3300025915 | Bacteria | 2823 |
| 395 | Ga0207693_10235572 | 3300025915 | Bacteria | 1437 |
| 396 | Ga0207663_10037590 | 3300025916 | Bacteria | 2919 |
| 397 | Ga0207660_10008494 | 3300025917 | Bacteria | 6642 |
| 398 | Ga0207662_10144639 | 3300025918 | Bacteria | 1508 |
| 399 | Ga0207657_10021001 | 3300025919 | Bacteria | 6156 |
| 400 | Ga0207657_10056355 | 3300025919 | Bacteria | 3391 |
| 401 | Ga0207649_10062321 | 3300025920 | Bacteria | 2351 |
| 402 | Ga0207649_10084314 | 3300025920 | Bacteria | 2065 |
| 403 | Ga0207652_10036684 | 3300025921 | Bacteria | 4145 |
| 404 | Ga0207652_10126082 | 3300025921 | Bacteria | 2280 |
| 405 | Ga0207646_10143226 | 3300025922 | Bacteria | 2153 |
| 406 | Ga0207681_10079568 | 3300025923 | Bacteria | 2310 |
| 407 | Ga0207694_10052546 | 3300025924 | Bacteria | 3159 |
| 408 | Ga0207694_10069989 | 3300025924 | Bacteria | 2741 |
| 409 | Ga0207687_10008332 | 3300025927 | Bacteria | 6784 |
| 410 | Ga0207687_10211519 | 3300025927 | Bacteria | 1522 |
| 411 | Ga0207700_10000797 | 3300025928 | Bacteria | 18209 |
| 412 | Ga0207700_10021555 | 3300025928 | Bacteria | 4402 |
| 413 | Ga0207700_10039638 | 3300025928 | Bacteria | 3431 |
| 414 | Ga0207700_10166203 | 3300025928 | Bacteria | 1836 |
| 415 | Ga0207664_10003862 | 3300025929 | Bacteria | 10070 |
| 416 | Ga0207664_10080404 | 3300025929 | Bacteria | 2649 |
| 417 | Ga0207664_10108284 | 3300025929 | Bacteria | 2307 |
| 418 | Ga0207664_10139142 | 3300025929 | Bacteria | 2051 |
| 419 | Ga0207664_10219099 | 3300025929 | Bacteria | 1650 |
| 420 | Ga0207644_10014433 | 3300025931 | Bacteria | 5283 |
| 421 | Ga0207644_10068745 | 3300025931 | Bacteria | 2585 |
| 422 | Ga0207690_10054948 | 3300025932 | Bacteria | 2680 |
| 423 | Ga0207706_10142666 | 3300025933 | Unclassified | 2107 |
| 424 | Ga0207706_10155344 | 3300025933 | Bacteria | 2012 |
| 425 | Ga0207686_10064276 | 3300025934 | Bacteria | 2336 |
| 426 | Ga0207709_10183717 | 3300025935 | Bacteria | 1479 |
| 427 | Ga0207670_10048586 | 3300025936 | Bacteria | 2833 |
| 428 | Ga0207669_10266954 | 3300025937 | Bacteria | 1283 |
| 429 | Ga0207704_10164637 | 3300025938 | Bacteria | 1582 |
| 430 | Ga0207665_10002407 | 3300025939 | Bacteria | 12653 |
| 431 | Ga0207665_10034875 | 3300025939 | Bacteria | 3339 |
| 432 | Ga0207665_10056924 | 3300025939 | Bacteria | 2640 |
| 433 | Ga0207691_10000812 | 3300025940 | Bacteria | 31085 |
| 434 | Ga0207711_10003275 | 3300025941 | Bacteria | 14083 |
| 435 | Ga0207689_10032416 | 3300025942 | Bacteria | 4347 |
| 436 | Ga0207667_10007621 | 3300025949 | Bacteria | 12970 |
| 437 | Ga0207667_10054610 | 3300025949 | Bacteria | 4201 |
| 438 | Ga0207667_10110152 | 3300025949 | Bacteria | 2840 |
| 439 | Ga0207667_10369527 | 3300025949 | Bacteria | 1462 |
| 440 | Ga0207712_10015865 | 3300025961 | Bacteria | 4867 |
| 441 | Ga0207712_10066990 | 3300025961 | Bacteria | 2568 |
| 442 | Ga0207712_10275417 | 3300025961 | Bacteria | 1371 |
| 443 | Ga0207640_10231040 | 3300025981 | Bacteria | 1423 |
| 444 | Ga0207640_10285440 | 3300025981 | Bacteria | 1299 |
| 445 | Ga0207658_10011971 | 3300025986 | Bacteria | 5916 |
| 446 | Ga0207658_10172115 | 3300025986 | Bacteria | 1785 |
| 447 | Ga0207703_10031287 | 3300026035 | Bacteria | 4206 |
| 448 | Ga0207678_10008906 | 3300026067 | Bacteria | 8834 |
| 449 | Ga0207678_10014273 | 3300026067 | Bacteria | 6985 |
| 450 | Ga0207678_10082159 | 3300026067 | Bacteria | 2757 |
| 451 | Ga0207708_10002674 | 3300026075 | Bacteria | 13095 |
| 452 | Ga0207702_10062360 | 3300026078 | Bacteria | 3183 |
| 453 | Ga0207702_10156669 | 3300026078 | Bacteria | 2077 |
| 454 | Ga0207702_10284434 | 3300026078 | Bacteria | 1564 |
| 455 | Ga0207641_10050229 | 3300026088 | Bacteria | 3528 |
| 456 | Ga0207648_10024827 | 3300026089 | Bacteria | 5346 |
| 457 | Ga0207648_10094677 | 3300026089 | Bacteria | 2612 |
| 458 | Ga0207676_10008714 | 3300026095 | Bacteria | 7213 |
| 459 | Ga0207676_10053940 | 3300026095 | Unclassified | 3148 |
| 460 | Ga0207674_10010838 | 3300026116 | Bacteria | 10277 |
| 461 | Ga0207674_10365316 | 3300026116 | Bacteria | 1395 |
| 462 | Ga0207675_100003315 | 3300026118 | Bacteria | 15757 |
| 463 | Ga0207675_100106246 | 3300026118 | Unclassified | 2647 |
| 464 | Ga0207675_100300430 | 3300026118 | Bacteria | 1563 |
| 465 | Ga0207683_10157349 | 3300026121 | Bacteria | 2053 |
| 466 | Ga0207698_10004492 | 3300026142 | Bacteria | 8513 |
| 467 | Ga0207698_10040340 | 3300026142 | Bacteria | 3468 |
| 468 | Ga0207698_10296525 | 3300026142 | Bacteria | 1503 |
| 469 | Ga0207428_10000485 | 3300027907 | Bacteria | 47761 |
| 470 | Ga0207428_10171599 | 3300027907 | Bacteria | 1642 |
| 471 | Ga0268266_10010491 | 3300028379 | Bacteria | 8097 |
| 472 | Ga0268265_10001669 | 3300028380 | Bacteria | 18128 |
| 473 | Ga0268264_10002104 | 3300028381 | Bacteria | 17759 |
| 474 | Ga0268264_10055219 | 3300028381 | Bacteria | 3318 |
| 475 | Ga0268264_10101602 | 3300028381 | Bacteria | 2500 |
| 476 | Ga0268264_10274352 | 3300028381 | Bacteria | 1577 |
| 477 | Ga0265337_1000693 | 3300028556 | Bacteria | 17780 |
| 478 | Ga0265338_10104900 | 3300028800 | Bacteria | 2292 |
| 479 | Ga0265330_10026048 | 3300031235 | Bacteria | 2649 |
| 480 | Ga0265320_10043119 | 3300031240 | Bacteria | 2232 |
| 481 | Ga0265325_10000036 | 3300031241 | Bacteria | 96858 |
| 482 | Ga0265325_10000613 | 3300031241 | Bacteria | 26022 |
| 483 | Ga0265325_10000660 | 3300031241 | Bacteria | 25191 |
| 484 | Ga0265325_10002455 | 3300031241 | Bacteria | 12516 |
| 485 | Ga0265340_10023895 | 3300031247 | Bacteria | 3110 |
| 486 | Ga0265339_10006516 | 3300031249 | Bacteria | 7652 |
| 487 | Ga0265331_10042388 | 3300031250 | Bacteria | 2208 |
| 488 | Ga0265316_10078067 | 3300031344 | Bacteria | 2542 |
| 489 | Ga0265316_10083872 | 3300031344 | Bacteria | 2441 |
| 490 | Ga0265313_10001282 | 3300031595 | Bacteria | 23786 |
| 491 | Ga0265313_10021309 | 3300031595 | Bacteria | 3548 |
| 492 | Ga0265313_10040519 | 3300031595 | Unclassified | 2302 |
| 493 | Ga0265342_10004065 | 3300031712 | Bacteria | 11667 |
| 494 | Ga0265342_10009777 | 3300031712 | Bacteria | 6713 |
| 495 | Ga0316583_10000944 | 3300032133 | Bacteria | 9350 |
| 496 | Ga0373958_0000095 | 3300034819 | Bacteria | 9272 |
| 497 | Ga0373959_0001784 | 3300034820 | Bacteria | 3433 |
| 498 | Ga0373938_0000332 | 3300034957 | Bacteria | 7475 |
| 499 | Ga0373926_0006116 | 3300035083 | Bacteria | 3988 |
| 500 | Ga0373926_0077209 | 3300035083 | Bacteria | 1229 |
| 501 | Ga0373928_0000109 | 3300035084 | Bacteria | 14956 |
| 502 | Ga0373929_0000097 | 3300035085 | Bacteria | 14514 |
| 503 | Ga0373934_0070290 | 3300035086 | Bacteria | 1400 |
| 504 | Ga0373940_0001510 | 3300035088 | Bacteria | 4236 |
| 505 | Ga0373944_0091787 | 3300035089 | Bacteria | 1016 |
| 506 | Ga0373949_0000836 | 3300035090 | Bacteria | 9822 |
| 507 | Ga0373951_0000383 | 3300035091 | Bacteria | 13184 |
| 508 | Ga0373951_0019169 | 3300035091 | Bacteria | 1558 |
| 509 | Ga0373952_0004519 | 3300035092 | Unclassified | 2525 |
| 510 | Ga0373952_0009381 | 3300035092 | Bacteria | 1872 |
| 511 | Ga0373923_0014571 | 3300035111 | Bacteria | 2956 |
| 512 | Ga0373932_0000087 | 3300035112 | Bacteria | 24305 |
| 513 | Ga0373932_0044395 | 3300035112 | Bacteria | 1296 |
| 514 | Ga0373936_0009325 | 3300035113 | Bacteria | 3698 |
| 515 | Ga0373936_0017545 | 3300035113 | Bacteria | 2757 |
| 516 | Ga0373936_0017717 | 3300035113 | Unclassified | 2744 |
| 517 | Ga0373936_0024360 | 3300035113 | Bacteria | 2362 |
| 518 | Ga0373939_0002562 | 3300035114 | Bacteria | 4274 |
| 519 | Ga0373939_0004051 | 3300035114 | Bacteria | 3451 |
| 520 | Ga0373941_0000112 | 3300035115 | Bacteria | 13841 |
| 521 | Ga0373941_0021173 | 3300035115 | Bacteria | 1831 |
| 522 | Ga0373945_0009092 | 3300035116 | Bacteria | 3247 |
| 523 | Ga0373945_0010395 | 3300035116 | Bacteria | 3063 |
| 524 | Ga0373953_0002373 | 3300035117 | Bacteria | 5683 |
| 525 | Ga0373953_0007577 | 3300035117 | Bacteria | 3643 |
| 526 | Ga0373954_0005350 | 3300035118 | Bacteria | 5545 |
| 527 | Ga0373954_0009365 | 3300035118 | Bacteria | 4308 |
| 528 | Ga0373956_0064733 | 3300035119 | Bacteria | 1660 |
| 529 | Ga0373957_0011402 | 3300035120 | Bacteria | 2967 |
| 530 | Ga0373960_0000239 | 3300035121 | Bacteria | 10237 |
| 531 | Ga0373960_0003396 | 3300035121 | Bacteria | 3605 |
| 532 | Ga0373943_0002096 | 3300035170 | Bacteria | 9058 |
| 533 | Ga0373943_0006168 | 3300035170 | Bacteria | 5380 |
| 534 | Ga0373943_0026880 | 3300035170 | Bacteria | 2699 |
| 535 | Ga0373943_0057260 | 3300035170 | Bacteria | 1936 |
| 536 | Ga0373946_0000806 | 3300035171 | Bacteria | 10701 |
| 537 | Ga0373946_0005380 | 3300035171 | Bacteria | 4614 |
| 538 | Ga0373946_0007986 | 3300035171 | Bacteria | 3887 |
| 539 | Ga0373946_0008754 | 3300035171 | Bacteria | 3715 |
| 540 | Ga0373946_0044461 | 3300035171 | Bacteria | 1834 |
| 541 | Ga0373946_0067252 | 3300035171 | Bacteria | 1538 |
| 542 | Ga0373946_0117392 | 3300035171 | Unclassified | 1211 |
| 543 | Ga0373955_0004005 | 3300035172 | Bacteria | 6504 |
| 544 | Ga0373955_0172666 | 3300035172 | Bacteria | 1280 |
| 545 | Ga0373942_0000514 | 3300035207 | Bacteria | 10887 |
| 546 | Ga0373942_0024526 | 3300035207 | Bacteria | 1547 |
| 547 | Ga0373961_0000165 | 3300035241 | Bacteria | 32291 |
| 548 | Ga0373961_0005516 | 3300035241 | Bacteria | 3040 |
| 549 | Ga0373962_0000237 | 3300035242 | Bacteria | 11646 |
| 550 | Ga0373924_0015017 | 3300035410 | Bacteria | 2935 |
| 551 | Ga0373924_0029636 | 3300035410 | Bacteria | 2188 |
| 552 | Ga0373931_0002125 | 3300035691 | Bacteria | 8726 |
| 553 | Ga0373931_0059898 | 3300035691 | Unclassified | 2048 |
| 554 | Ga0373931_0074095 | 3300035691 | Bacteria | 1864 |
| 555 | Ga0373935_0002709 | 3300035692 | Bacteria | 10194 |
| 556 | Ga0373935_0003209 | 3300035692 | Bacteria | 9436 |
| 557 | Ga0373935_0011961 | 3300035692 | Bacteria | 5214 |
| 558 | Ga0373935_0024417 | 3300035692 | Bacteria | 3721 |
| 559 | Ga0373935_0042990 | 3300035692 | Bacteria | 2842 |
| 560 | Ga0373935_0100678 | 3300035692 | Bacteria | 1904 |
| 561 | Ga0373927_0002024 | 3300035695 | Bacteria | 14930 |
| 562 | Ga0373927_0002281 | 3300035695 | Bacteria | 14045 |
| 563 | Ga0373927_0018744 | 3300035695 | Bacteria | 4540 |
| 564 | Ga0373927_0025712 | 3300035695 | Bacteria | 3848 |
| 565 | Ga0373927_0071620 | 3300035695 | Bacteria | 2243 |
| 566 | Ga0373927_0096181 | 3300035695 | Bacteria | 1925 |
| 567 | Ga0373927_0153721 | 3300035695 | Unclassified | 1506 |
| 568 | Ga0373933_0002064 | 3300035724 | Bacteria | 11545 |
| 569 | Ga0373933_0009980 | 3300035724 | Bacteria | 5199 |
| 570 | Ga0373933_0031564 | 3300035724 | Bacteria | 3073 |
| 571 | Ga0373947_0000337 | 3300035725 | Bacteria | 26475 |
| 572 | Ga0373947_0008046 | 3300035725 | Bacteria | 6082 |
| 573 | Ga0373947_0008938 | 3300035725 | Bacteria | 5758 |
| 574 | Ga0373947_0026591 | 3300035725 | Bacteria | 3384 |
| 575 | Ga0373937_0001397 | 3300036401 | Bacteria | 20152 |
| 576 | Ga0373937_0010357 | 3300036401 | Bacteria | 8141 |
| 577 | Ga0373937_0044711 | 3300036401 | Bacteria | 4045 |
| 578 | Ga0373937_0056393 | 3300036401 | Bacteria | 3608 |
| 579 | Ga0373937_0075347 | 3300036401 | Bacteria | 3115 |
| 580 | Ga0316582_0186243 | 3300036647 | Bacteria | 1413 |
| 581 | Ga0373925_0001463 | 3300037068 | Bacteria | 20381 |
| 582 | Ga0373925_0010168 | 3300037068 | Bacteria | 6832 |
| 583 | Ga0373925_0115576 | 3300037068 | Bacteria | 2077 |
| 584 | Ga0373925_0153552 | 3300037068 | Unclassified | 1809 |
| 585 | Ga0373925_0161216 | 3300037068 | Bacteria | 1766 |
| 586 | Ga0395898_0048808 | 3300037466 | Unclassified | 4149 |
| 587 | Ga0395898_0132144 | 3300037466 | Bacteria | 2390 |
| 588 | Ga0395901_0121390 | 3300038443 | Bacteria | 2746 |
| 589 | Ga0242420_014311 | 3300038996 | Bacteria | 1360 |
| 590 | Ga0436360_0451215 | 3300039438 | Unclassified | 3564 |
| 591 | Ga0436361_0042376 | 3300039447 | Bacteria | 3380 |
| 592 | Ga0436361_0708897 | 3300039447 | Bacteria | 3833 |
| 593 | Ga0466971_0051866 | 3300044719 | Bacteria | 1847 |
| 594 | Ga0451576_0010805 | 3300045051 | Bacteria | 10448 |
| 595 | Ga0466958_0067913 | 3300045836 | Bacteria | 2178 |
| 596 | Ga0466967_0461687 | 3300045976 | Unclassified | 1242 |
| 597 | Ga0495617_005734 | 3300046452 | Bacteria | 4384 |
| 598 | Ga0495627_060925 | 3300046453 | Bacteria | 1117 |
| 599 | Ga0495592_0020683 | 3300046454 | Bacteria | 5007 |
| 600 | Ga0495592_0181705 | 3300046454 | Bacteria | 1432 |
| 601 | Ga0495592_0229540 | 3300046454 | Bacteria | 1236 |
| 602 | Ga0495603_0001421 | 3300046455 | Bacteria | 13936 |
| 603 | Ga0495603_0007341 | 3300046455 | Bacteria | 6628 |
| 604 | Ga0495603_0142053 | 3300046455 | Bacteria | 1396 |
| 605 | Ga0495590_0074617 | 3300046457 | Bacteria | 1193 |
| 606 | Ga0495629_0001742 | 3300046459 | Bacteria | 17062 |
| 607 | Ga0495641_0014778 | 3300046461 | Bacteria | 4209 |
| 608 | Ga0495641_0018265 | 3300046461 | Bacteria | 3622 |
| 609 | Ga0495641_0070758 | 3300046461 | Bacteria | 1566 |
| 610 | Ga0495651_0003967 | 3300046462 | Bacteria | 11315 |
| 611 | Ga0495651_0005894 | 3300046462 | Bacteria | 9347 |
| 612 | Ga0495651_0184493 | 3300046462 | Unclassified | 1474 |
| 613 | Ga0495653_0002617 | 3300046463 | Bacteria | 14317 |
| 614 | Ga0495653_0008661 | 3300046463 | Bacteria | 8340 |
| 615 | Ga0495580_0009323 | 3300046472 | Bacteria | 7724 |
| 616 | Ga0495580_0189545 | 3300046472 | Bacteria | 1418 |
| 617 | Ga0495582_0005451 | 3300046473 | Bacteria | 7094 |
| 618 | Ga0495582_0070539 | 3300046473 | Bacteria | 1933 |
| 619 | Ga0495639_0001541 | 3300046475 | Bacteria | 10280 |
| 620 | Ga0495639_0002862 | 3300046475 | Bacteria | 7508 |
| 621 | Ga0495639_0011982 | 3300046475 | Bacteria | 3739 |
| 622 | Ga0495639_0025847 | 3300046475 | Unclassified | 2591 |
| 623 | Ga0495639_0063239 | 3300046475 | Bacteria | 1699 |
| 624 | Ga0495662_0001109 | 3300046476 | Bacteria | 13249 |
| 625 | Ga0495662_0015048 | 3300046476 | Bacteria | 3758 |
| 626 | Ga0495662_0024413 | 3300046476 | Bacteria | 2917 |
| 627 | Ga0495664_0000510 | 3300046477 | Bacteria | 19398 |
| 628 | Ga0495584_0005702 | 3300046491 | Bacteria | 6574 |
| 629 | Ga0495584_0093031 | 3300046491 | Bacteria | 1521 |
| 630 | Ga0495585_0003676 | 3300046492 | Bacteria | 10256 |
| 631 | Ga0495585_0017566 | 3300046492 | Bacteria | 4133 |
| 632 | Ga0495585_0063900 | 3300046492 | Bacteria | 2019 |
| 633 | Ga0495594_0017133 | 3300046499 | Bacteria | 3824 |
| 634 | Ga0495596_0044366 | 3300046500 | Bacteria | 1750 |
| 635 | Ga0495607_0009728 | 3300046501 | Bacteria | 6490 |
| 636 | Ga0495608_0006100 | 3300046511 | Bacteria | 8550 |
| 637 | Ga0495608_0059729 | 3300046511 | Bacteria | 2511 |
| 638 | Ga0495608_0183858 | 3300046511 | Bacteria | 1322 |
| 639 | Ga0495618_0020575 | 3300046514 | Bacteria | 4062 |
| 640 | Ga0495618_0033878 | 3300046514 | Bacteria | 3202 |
| 641 | Ga0495628_0105709 | 3300046516 | Bacteria | 2169 |
| 642 | Ga0495628_0107672 | 3300046516 | Unclassified | 2146 |
| 643 | Ga0495628_0131207 | 3300046516 | Bacteria | 1916 |
| 644 | Ga0495628_0215300 | 3300046516 | Bacteria | 1444 |
| 645 | Ga0495630_0015854 | 3300046517 | Bacteria | 5506 |
| 646 | Ga0495630_0094603 | 3300046517 | Unclassified | 2258 |
| 647 | Ga0495630_0110907 | 3300046517 | Bacteria | 2078 |
| 648 | Ga0495631_0025806 | 3300046518 | Bacteria | 2703 |
| 649 | Ga0495632_0141286 | 3300046519 | Bacteria | 1117 |
| 650 | Ga0495637_0018273 | 3300046520 | Bacteria | 3254 |
| 651 | Ga0495637_0065024 | 3300046520 | Bacteria | 1486 |
| 652 | Ga0495644_0029737 | 3300046523 | Bacteria | 2063 |
| 653 | Ga0495663_0019919 | 3300046525 | Bacteria | 1923 |
| 654 | Ga0495666_0035319 | 3300046526 | Bacteria | 2437 |
| 655 | Ga0495666_0050434 | 3300046526 | Bacteria | 2000 |
| 656 | Ga0495652_0015920 | 3300046529 | Bacteria | 6730 |
| 657 | Ga0495652_0051751 | 3300046529 | Bacteria | 3505 |
| 658 | Ga0495665_0002284 | 3300046531 | Bacteria | 10356 |
| 659 | Ga0495665_0019106 | 3300046531 | Bacteria | 3683 |
| 660 | Ga0495665_0070738 | 3300046531 | Bacteria | 1838 |
| 661 | Ga0495640_0002882 | 3300046533 | Bacteria | 13859 |
| 662 | Ga0495640_0101767 | 3300046533 | Bacteria | 1885 |
| 663 | Ga0495640_0109782 | 3300046533 | Bacteria | 1803 |
| 664 | Ga0495640_0136128 | 3300046533 | Bacteria | 1586 |
| 665 | Ga0495586_0019415 | 3300046535 | Bacteria | 3618 |
| 666 | Ga0495587_0001485 | 3300046536 | Bacteria | 15621 |
| 667 | Ga0495587_0010534 | 3300046536 | Bacteria | 5881 |
| 668 | Ga0495587_0010972 | 3300046536 | Bacteria | 5747 |
| 669 | Ga0495598_0000140 | 3300046537 | Bacteria | 12324 |
| 670 | Ga0495598_0002282 | 3300046537 | Bacteria | 3950 |
| 671 | Ga0495598_0006516 | 3300046537 | Bacteria | 2640 |
| 672 | Ga0495621_0029892 | 3300046539 | Bacteria | 1860 |
| 673 | Ga0495645_0002547 | 3300046543 | Bacteria | 12366 |
| 674 | Ga0495645_0003754 | 3300046543 | Bacteria | 10316 |
| 675 | Ga0495645_0041228 | 3300046543 | Bacteria | 3366 |
| 676 | Ga0495622_0036486 | 3300046557 | Unclassified | 2292 |
| 677 | Ga0495633_0013142 | 3300046558 | Bacteria | 4376 |
| 678 | Ga0495667_0007578 | 3300046559 | Bacteria | 7365 |
| 679 | Ga0495667_0020590 | 3300046559 | Bacteria | 4450 |
| 680 | Ga0495667_0055252 | 3300046559 | Bacteria | 2611 |
| 681 | Ga0495656_0001097 | 3300046615 | Bacteria | 8777 |
| 682 | Ga0495634_0020779 | 3300046642 | Bacteria | 4650 |
| 683 | Ga0495634_0043898 | 3300046642 | Unclassified | 3028 |
| 684 | Ga0495634_0108124 | 3300046642 | Unclassified | 1790 |
| 685 | Ga0495634_0121683 | 3300046642 | Bacteria | 1670 |
| 686 | Ga0495635_0000662 | 3300046663 | Bacteria | 22123 |
| 687 | Ga0495635_0003035 | 3300046663 | Bacteria | 11532 |
| 688 | Ga0495635_0007370 | 3300046663 | Bacteria | 7676 |
| 689 | Ga0495635_0010431 | 3300046663 | Bacteria | 6499 |
| 690 | Ga0495635_0060262 | 3300046663 | Bacteria | 2609 |
| 691 | Ga0495659_0001233 | 3300046664 | Bacteria | 8851 |
| 692 | Ga0495659_0017682 | 3300046664 | Bacteria | 2367 |
| 693 | Ga0495659_0051289 | 3300046664 | Bacteria | 1502 |
| 694 | Ga0495661_0033872 | 3300046665 | Bacteria | 3219 |
| 695 | Ga0495657_0006498 | 3300046675 | Bacteria | 9139 |
| 696 | Ga0495657_0023801 | 3300046675 | Bacteria | 4372 |
| 697 | Ga0495657_0212620 | 3300046675 | Bacteria | 1175 |
| 698 | Ga0495599_0023928 | 3300046678 | Bacteria | 3819 |
| 699 | Ga0495623_0014481 | 3300046679 | Bacteria | 5104 |
| 700 | Ga0495646_0024804 | 3300046680 | Bacteria | 3775 |
| 701 | Ga0495646_0039442 | 3300046680 | Bacteria | 2911 |
| 702 | Ga0495647_0007367 | 3300046681 | Bacteria | 3682 |
| 703 | Ga0495647_0009683 | 3300046681 | Bacteria | 3268 |
| 704 | Ga0495647_0059643 | 3300046681 | Bacteria | 1503 |
| 705 | Ga0495658_0000231 | 3300046683 | Bacteria | 31949 |
| 706 | Ga0495658_0003159 | 3300046683 | Bacteria | 8212 |
| 707 | Ga0495658_0003902 | 3300046683 | Bacteria | 7376 |
| 708 | Ga0495658_0107501 | 3300046683 | Bacteria | 1673 |
| 709 | Ga0495669_0087449 | 3300046684 | Bacteria | 1436 |
| 710 | Ga0495669_0097515 | 3300046684 | Bacteria | 1363 |
| 711 | Ga0495613_0012961 | 3300046689 | Bacteria | 6194 |
| 712 | Ga0495613_0036851 | 3300046689 | Bacteria | 3626 |
| 713 | Ga0495613_0102260 | 3300046689 | Bacteria | 2069 |
| 714 | Ga0495613_0102776 | 3300046689 | Unclassified | 2063 |
| 715 | Ga0495613_0105302 | 3300046689 | Bacteria | 2036 |
| 716 | Ga0495624_0004671 | 3300046690 | Bacteria | 9974 |
| 717 | Ga0495624_0005449 | 3300046690 | Bacteria | 9169 |
| 718 | Ga0495624_0010346 | 3300046690 | Bacteria | 6425 |
| 719 | Ga0495624_0029199 | 3300046690 | Bacteria | 3599 |
| 720 | Ga0495670_0020527 | 3300046691 | Bacteria | 3258 |
| 721 | Ga0495649_0044597 | 3300046694 | Bacteria | 2421 |
| 722 | Ga0495600_0002443 | 3300046809 | Bacteria | 10655 |
| 723 | Ga0495600_0023851 | 3300046809 | Bacteria | 3936 |
| 724 | Ga0495581_0010107 | 3300047315 | Bacteria | 5461 |
| 725 | Ga0495581_0037680 | 3300047315 | Bacteria | 2799 |
| 726 | Ga0495581_0074410 | 3300047315 | Bacteria | 1965 |
| 727 | Ga0495604_0002660 | 3300047317 | Bacteria | 14340 |
| 728 | Ga0495604_0004875 | 3300047317 | Bacteria | 10629 |
| 729 | Ga0495604_0035531 | 3300047317 | Bacteria | 3936 |
| 730 | Ga0495604_0295873 | 3300047317 | Bacteria | 1089 |
| 731 | Ga0495674_0000138 | 3300047319 | Bacteria | 55916 |
| 732 | Ga0495674_0012742 | 3300047319 | Bacteria | 7921 |
| 733 | Ga0495674_0057468 | 3300047319 | Bacteria | 3404 |
| 734 | Ga0495674_0078906 | 3300047319 | Bacteria | 2828 |
| 735 | Ga0495674_0104861 | 3300047319 | Bacteria | 2403 |
| 736 | Ga0495674_0159197 | 3300047319 | Bacteria | 1890 |
| 737 | Ga0495674_0182666 | 3300047319 | Bacteria | 1746 |
| 738 | Ga0495676_0005696 | 3300047321 | Bacteria | 11422 |
| 739 | Ga0495676_0048159 | 3300047321 | Bacteria | 3439 |
| 740 | Ga0495676_0058061 | 3300047321 | Bacteria | 3047 |
| 741 | Ga0495680_0007757 | 3300047322 | Bacteria | 9802 |
| 742 | Ga0495680_0018968 | 3300047322 | Bacteria | 5825 |
| 743 | Ga0495680_0026697 | 3300047322 | Bacteria | 4755 |
| 744 | Ga0495680_0098297 | 3300047322 | Bacteria | 2184 |
| 745 | Ga0495675_0000984 | 3300047444 | Bacteria | 17289 |
| 746 | Ga0495679_010187 | 3300047446 | Bacteria | 3708 |
| 747 | Ga0495673_0112808 | 3300047469 | Bacteria | 1084 |
| 748 | Ga0495684_0002820 | 3300047471 | Bacteria | 13704 |
| 749 | Ga0495684_0006309 | 3300047471 | Bacteria | 9215 |
| 750 | Ga0495684_0011874 | 3300047471 | Bacteria | 6719 |
| 751 | Ga0495684_0018121 | 3300047471 | Bacteria | 5427 |
| 752 | Ga0495684_0142096 | 3300047471 | Bacteria | 1799 |
| 753 | Ga0495593_0001477 | 3300047673 | Bacteria | 13808 |
| 754 | Ga0495593_0023241 | 3300047673 | Bacteria | 3448 |
| 755 | Ga0495602_0003678 | 3300048088 | Bacteria | 15899 |
| 756 | Ga0495602_0044296 | 3300048088 | Bacteria | 4038 |
| 757 | Ga0495614_0015002 | 3300048089 | Bacteria | 3382 |
| 758 | Ga0495614_0049003 | 3300048089 | Unclassified | 1811 |
| 759 | Ga0496100_0013484 | 3300048903 | Bacteria | 4715 |
| 760 | Ga0496101_0031991 | 3300048904 | Bacteria | 3700 |
| 761 | Ga0496102_0001843 | 3300048905 | Bacteria | 18300 |
| 762 | Ga0496102_0003813 | 3300048905 | Bacteria | 12750 |
| 763 | Ga0496102_0030629 | 3300048905 | Bacteria | 4816 |
| 764 | Ga0496102_0051728 | 3300048905 | Bacteria | 3742 |
| 765 | Ga0496102_0077144 | 3300048905 | Bacteria | 3066 |
| 766 | Ga0496103_0058098 | 3300048906 | Bacteria | 2403 |
| 767 | Ga0496103_0080037 | 3300048906 | Bacteria | 2054 |
| 768 | Ga0496104_0026471 | 3300048907 | Bacteria | 5356 |
| 769 | Ga0496104_0056788 | 3300048907 | Bacteria | 3703 |
| 770 | Ga0496104_0087477 | 3300048907 | Bacteria | 2976 |
| 771 | Ga0496104_0097246 | 3300048907 | Bacteria | 2817 |
| 772 | Ga0496104_0163788 | 3300048907 | Bacteria | 2132 |
| 773 | Ga0496104_0331522 | 3300048907 | Unclassified | 1435 |
| 774 | Ga0496105_0000402 | 3300048908 | Bacteria | 28437 |
| 775 | Ga0496105_0028168 | 3300048908 | Bacteria | 4594 |
| 776 | Ga0496105_0041366 | 3300048908 | Bacteria | 3798 |
| 777 | Ga0496105_0076299 | 3300048908 | Bacteria | 2768 |
| 778 | Ga0496105_0087663 | 3300048908 | Bacteria | 2571 |
| 779 | Ga0496105_0103782 | 3300048908 | Bacteria | 2348 |
| 780 | Ga0496106_0000335 | 3300048909 | Bacteria | 33078 |
| 781 | Ga0496106_0002077 | 3300048909 | Bacteria | 15005 |
| 782 | Ga0496106_0025146 | 3300048909 | Bacteria | 4429 |
| 783 | Ga0496106_0037782 | 3300048909 | Bacteria | 3612 |
| 784 | Ga0496106_0065120 | 3300048909 | Bacteria | 2774 |
| 785 | Ga0496106_0109606 | 3300048909 | Bacteria | 2148 |
| 786 | Ga0496106_0320536 | 3300048909 | Bacteria | 1244 |
| 787 | Ga0496107_0007535 | 3300048910 | Bacteria | 7510 |
| 788 | Ga0496107_0017976 | 3300048910 | Bacteria | 4975 |
| 789 | Ga0496107_0046826 | 3300048910 | Bacteria | 3112 |
| 790 | Ga0496107_0053258 | 3300048910 | Bacteria | 2919 |
| 791 | Ga0496107_0118106 | 3300048910 | Bacteria | 1953 |
| 792 | Ga0496108_0009527 | 3300048911 | Bacteria | 7871 |
| 793 | Ga0496108_0018150 | 3300048911 | Bacteria | 5757 |
| 794 | Ga0496109_0001112 | 3300048912 | Bacteria | 22310 |
| 795 | Ga0496109_0089799 | 3300048912 | Bacteria | 2841 |
| 796 | Ga0496110_0001899 | 3300048913 | Bacteria | 15448 |
| 797 | Ga0496110_0047740 | 3300048913 | Bacteria | 3751 |
| 798 | Ga0496111_0001319 | 3300048914 | Bacteria | 13938 |
| 799 | Ga0496111_0006751 | 3300048914 | Bacteria | 7475 |
| 800 | Ga0496111_0029229 | 3300048914 | Bacteria | 3913 |
| 801 | Ga0496112_0030691 | 3300048915 | Bacteria | 5205 |
| 802 | Ga0496112_0034047 | 3300048915 | Bacteria | 4956 |
| 803 | Ga0496112_0043154 | 3300048915 | Bacteria | 4414 |
| 804 | Ga0496113_0000266 | 3300048916 | Bacteria | 24721 |
| 805 | Ga0496113_0133503 | 3300048916 | Bacteria | 1949 |
| 806 | Ga0496113_0175339 | 3300048916 | Bacteria | 1699 |
| 807 | Ga0496114_0051199 | 3300048917 | Bacteria | 3438 |
| 808 | Ga0496114_0078985 | 3300048917 | Bacteria | 2777 |
| 809 | Ga0496114_0178501 | 3300048917 | Bacteria | 1853 |
| 810 | Ga0496114_0192133 | 3300048917 | Bacteria | 1786 |
| 811 | Ga0496115_0016093 | 3300048918 | Bacteria | 5688 |
| 812 | Ga0496115_0051907 | 3300048918 | Bacteria | 3288 |
| 813 | Ga0496115_0061732 | 3300048918 | Bacteria | 3022 |
| 814 | Ga0496115_0196777 | 3300048918 | Bacteria | 1665 |
| 815 | Ga0501031_0007374 | 3300049568 | Bacteria | 7169 |
| 816 | Ga0501032_0019130 | 3300049569 | Bacteria | 4791 |
| 817 | Ga0501033_0007639 | 3300049570 | Bacteria | 8404 |
| 818 | Ga0501036_0007513 | 3300049572 | Bacteria | 8893 |
| 819 | Ga0501036_0126425 | 3300049572 | Bacteria | 2159 |
| 820 | Ga0501037_0003786 | 3300049573 | Bacteria | 10976 |
| 821 | Ga0501037_0026174 | 3300049573 | Bacteria | 4311 |
| 822 | Ga0501038_0005967 | 3300049574 | Bacteria | 11266 |
| 823 | Ga0501039_0065878 | 3300049575 | Unclassified | 2811 |
| 824 | Ga0501046_0029673 | 3300049580 | Bacteria | 4445 |
| 825 | Ga0501047_0008734 | 3300049581 | Bacteria | 9561 |
| 826 | Ga0501068_0002319 | 3300049584 | Bacteria | 10147 |
| 827 | Ga0501069_0075657 | 3300049585 | Bacteria | 1891 |
| 828 | Ga0501070_0008236 | 3300049586 | Bacteria | 8813 |
| 829 | Ga0501070_0076661 | 3300049586 | Bacteria | 2767 |
| 830 | Ga0501073_0165159 | 3300049589 | Unclassified | 1533 |
| 831 | Ga0501076_0270714 | 3300049592 | Bacteria | 1391 |
| 832 | Ga0501079_0049670 | 3300049741 | Bacteria | 3238 |
| 833 | Ga0501080_0028428 | 3300049742 | Bacteria | 5201 |
| 834 | Ga0501080_0319550 | 3300049742 | Bacteria | 1406 |
| 835 | Ga0501083_0040133 | 3300049744 | Bacteria | 3178 |
| 836 | Ga0501083_0266583 | 3300049744 | Bacteria | 1114 |
| 837 | Ga0501035_0033181 | 3300049822 | Bacteria | 4695 |
| 838 | Ga0501044_0028392 | 3300049823 | Bacteria | 5906 |
| 839 | Ga0501045_0239490 | 3300049824 | Bacteria | 1351 |
| 840 | nmdc:mga03n38_93649_c1 | 3300050490 | Bacteria | 1435 |
| 841 | nmdc:mga0yw44_20458_c1 | 3300050492 | Bacteria | 3672 |
| 842 | nmdc:mga0yw44_22137_c1 | 3300050492 | Bacteria | 3558 |
| 843 | nmdc:mga0yw44_26051_c1 | 3300050492 | Bacteria | 3335 |
| 844 | nmdc:mga0k408_6575_c1 | 3300050493 | Bacteria | 6194 |
| 845 | nmdc:mga0k408_67153_c1 | 3300050493 | Bacteria | 2090 |
| 846 | nmdc:mga05p37_219_c1 | 3300050507 | Bacteria | 57577 |
| 847 | nmdc:mga05p37_2721_c1 | 3300050507 | Bacteria | 20539 |
| 848 | nmdc:mga05p37_47936_c1 | 3300050507 | Bacteria | 5254 |
| 849 | nmdc:mga05p37_55107_c1 | 3300050507 | Bacteria | 4892 |
| 850 | nmdc:mga05p37_7502_c1 | 3300050507 | Bacteria | 12858 |
| 851 | nmdc:mga09592_2153_c1 | 3300050508 | Bacteria | 15903 |
| 852 | nmdc:mga09592_347708_c1 | 3300050508 | Bacteria | 1283 |
| 853 | nmdc:mga09592_371445_c1 | 3300050508 | Bacteria | 1237 |
| 854 | nmdc:mga0qj67_1123_c1 | 3300050509 | Bacteria | 18547 |
| 855 | nmdc:mga0qj67_264186_c1 | 3300050509 | Bacteria | 1396 |
| 856 | nmdc:mga0qj67_57343_c1 | 3300050509 | Bacteria | 3087 |
| 857 | nmdc:mga06r32_2657_c1 | 3300050510 | Bacteria | 15975 |
| 858 | nmdc:mga06r32_274_c1 | 3300050510 | Bacteria | 42858 |
| 859 | nmdc:mga06r32_312597_c1 | 3300050510 | Bacteria | 1557 |
| 860 | nmdc:mga08y16_161224_c1 | 3300050511 | Bacteria | 2330 |
| 861 | nmdc:mga08y16_25664_c1 | 3300050511 | Bacteria | 6218 |
| 862 | nmdc:mga08y16_389045_c1 | 3300050511 | Bacteria | 1429 |
| 863 | nmdc:mga08y16_7375_c1 | 3300050511 | Bacteria | 11526 |
| 864 | nmdc:mga0n895_124_c1 | 3300050512 | Bacteria | 45833 |
| 865 | nmdc:mga0n895_126689_c1 | 3300050512 | Bacteria | 2577 |
| 866 | nmdc:mga0n895_44058_c1 | 3300050512 | Bacteria | 4352 |
| 867 | nmdc:mga0n895_7901_c1 | 3300050512 | Bacteria | 9171 |
| 868 | nmdc:mga0rr50_1076_c1 | 3300050513 | Bacteria | 14869 |
| 869 | nmdc:mga0rr50_120094_c1 | 3300050513 | Bacteria | 2091 |
| 870 | nmdc:mga0rr50_148456_c1 | 3300050513 | Unclassified | 1892 |
| 871 | nmdc:mga08x19_10905_c1 | 3300050514 | Bacteria | 5465 |
| 872 | nmdc:mga08x19_65523_c1 | 3300050514 | Bacteria | 2359 |
| 873 | nmdc:mga0a205_207680_c1 | 3300050515 | Bacteria | 1847 |
| 874 | nmdc:mga0a205_95251_c1 | 3300050515 | Bacteria | 2875 |
| 875 | nmdc:mga0a205_97_c1 | 3300050515 | Bacteria | 49530 |
| 876 | Ga0495601_0001064 | 3300053077 | Bacteria | 15049 |
| 877 | Ga0495601_0007427 | 3300053077 | Bacteria | 6425 |
| 878 | Ga0495601_0009051 | 3300053077 | Bacteria | 5880 |
| 879 | Ga0495601_0011407 | 3300053077 | Bacteria | 5313 |
| 880 | Ga0495601_0034393 | 3300053077 | Bacteria | 3161 |
| 881 | Ga0495601_0068849 | 3300053077 | Bacteria | 2256 |
| 882 | Ga0495601_0087547 | 3300053077 | Bacteria | 2002 |
| 883 | Ga0495601_0172624 | 3300053077 | Bacteria | 1413 |
| 884 | Ga0495612_0002279 | 3300053078 | Bacteria | 7893 |
| 885 | Ga0495612_0065721 | 3300053078 | Bacteria | 1507 |
| 886 | Ga0495612_0080670 | 3300053078 | Unclassified | 1367 |
| 887 | Ga0495595_0002059 | 3300053084 | Bacteria | 7824 |
| 888 | Ga0495595_0028977 | 3300053084 | Bacteria | 2474 |
| 889 | Ga0495619_0000145 | 3300053085 | Bacteria | 52248 |
| 890 | Ga0495619_0001114 | 3300053085 | Bacteria | 17646 |
| 891 | Ga0495619_0001312 | 3300053085 | Bacteria | 16329 |
| 892 | Ga0495619_0007717 | 3300053085 | Bacteria | 6810 |
| 893 | Ga0495619_0008464 | 3300053085 | Bacteria | 6505 |
| 894 | Ga0495619_0011423 | 3300053085 | Bacteria | 5593 |
| 895 | Ga0495619_0018253 | 3300053085 | Bacteria | 4450 |
| 896 | Ga0495619_0100373 | 3300053085 | Unclassified | 1969 |
| 897 | Ga0500651_0000483 | 3300053093 | Bacteria | 20822 |
| 898 | Ga0500562_013205 | 3300053108 | Bacteria | 2107 |
| 899 | Ga0500652_044825 | 3300053131 | Bacteria | 1791 |
| 900 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 901 | Ga0530510_0029224 | 3300061734 | Bacteria | 3955 |
| 902 | Ga0436360_0633995 | |||
| 903 | 2214884102 | |||
| 904 | ARcpr5oldR_c000321 | |||
| 905 | ARcpr5oldR_c003388 | |||
| 906 | ARSoilYngRDRAFT_c00231 | |||
| 907 | ARcpr5yngRDRAFT_c000416 | |||
| 908 | ARSoilOldRDRAFT_c000416 | |||
| 909 | ARSoilOldRDRAFT_c001840 | |||
| 910 | ARCol0oldRDRAFT_c00633 | |||
| 911 | ARCol0yngRDRAFT_1000060 | |||
| 912 | JGI24739J22299_10006512 | |||
| 913 | JGI24737J22298_10002394 | |||
| 914 | JGI24750J21931_1000574 | |||
| 915 | JGI24748J21848_1001596 | |||
| 916 | JGI24749J21850_1000589 | |||
| 917 | JGI24035J26624_1000525 | |||
| 918 | JGI24033J26618_1002159 | |||
| 919 | JGI25153J46596_10018707 | |||
| 920 | JGI25405J52794_10007742 | |||
| 921 | Ga0065717_1002190 | |||
| 922 | Ga0065704_10084523 | |||
| 923 | Ga0065712_10001151 | |||
| 924 | Ga0065712_10095860 | |||
| 925 | Ga0065715_10097198 | |||
| 926 | Ga0070658_10022977 | |||
| 927 | Ga0070658_10054799 | |||
| 928 | Ga0070676_10003946 | |||
| 929 | Ga0070676_10021880 | |||
| 930 | Ga0070676_10038660 | |||
| 931 | Ga0070683_100003103 | |||
| 932 | Ga0070683_100150832 | |||
| 933 | Ga0070683_100183263 | |||
| 934 | Ga0070683_100202216 | |||
| 935 | Ga0070683_100548241 | |||
| 936 | Ga0070690_100001658 | |||
| 937 | Ga0070690_100010704 | |||
| 938 | Ga0070690_100019237 | |||
| 939 | Ga0070670_100005908 | |||
| 940 | Ga0070670_100036096 | |||
| 941 | Ga0070670_100077577 | |||
| 942 | Ga0070677_10002586 | |||
| 943 | Ga0068869_100003321 | |||
| 944 | Ga0070666_10010072 | |||
| 945 | Ga0070666_10197839 | |||
| 946 | Ga0070666_10270656 | |||
| 947 | Ga0070680_100004657 | |||
| 948 | Ga0070680_100004754 | |||
| 949 | Ga0070680_100005234 | |||
| 950 | Ga0070680_100047356 | |||
| 951 | Ga0070680_100052654 | |||
| 952 | Ga0070682_100002520 | |||
| 953 | Ga0070682_100004239 | |||
| 954 | Ga0068868_100009819 | |||
| 955 | Ga0068868_100015151 | |||
| 956 | Ga0070660_100001332 | |||
| 957 | Ga0070660_100061560 | |||
| 958 | Ga0070660_100148071 | |||
| 959 | Ga0070660_100294015 | |||
| 960 | Ga0070689_100010863 | |||
| 961 | Ga0070689_100058814 | |||
| 962 | Ga0070689_100068889 | |||
| 963 | Ga0070691_10002586 | |||
| 964 | Ga0070691_10096316 | |||
| 965 | Ga0070687_100001160 | |||
| 966 | Ga0070687_100008437 | |||
| 967 | Ga0070687_100052129 | |||
| 968 | Ga0070661_100002370 | |||
| 969 | Ga0070692_10000841 | |||
| 970 | Ga0070668_100006877 | |||
| 971 | Ga0070669_100213189 | |||
| 972 | Ga0070675_100036372 | |||
| 973 | Ga0070671_100005218 | |||
| 974 | Ga0070671_100244547 | |||
| 975 | Ga0070674_100006788 | |||
| 976 | Ga0070674_100069203 | |||
| 977 | Ga0070673_100000418 | |||
| 978 | Ga0070673_100013146 | |||
| 979 | Ga0070673_100258586 | |||
| 980 | Ga0070673_100307896 | |||
| 981 | Ga0070688_100000906 | |||
| 982 | Ga0070688_100005689 | |||
| 983 | Ga0070688_100126679 | |||
| 984 | Ga0070659_100003550 | |||
| 985 | Ga0070659_100037101 | |||
| 986 | Ga0070667_100007947 | |||
| 987 | Ga0070667_100038093 | |||
| 988 | Ga0070709_10011874 | |||
| 989 | Ga0070709_10091488 | |||
| 990 | Ga0070714_100003463 | |||
| 991 | Ga0070714_100046239 | |||
| 992 | Ga0070714_100078401 | |||
| 993 | Ga0070714_100128333 | |||
| 994 | Ga0070713_100000526 | |||
| 995 | Ga0070713_100024541 | |||
| 996 | Ga0070713_100090366 | |||
| 997 | Ga0070713_100268898 | |||
| 998 | Ga0070710_10002488 | |||
| 999 | Ga0070710_10008974 | |||
| 1000 | Ga0070710_10067235 | |||
| 1001 | Ga0070710_10074467 | |||
| 1002 | Ga0070710_10124236 | |||
| 1003 | Ga0070701_10000664 | |||
| 1004 | Ga0070701_10001792 | |||
| 1005 | Ga0070701_10011452 | |||
| 1006 | Ga0070711_100135525 | |||
| 1007 | Ga0070711_100173906 | |||
| 1008 | Ga0070711_100266547 | |||
| 1009 | Ga0070711_100320364 | |||
| 1010 | Ga0070705_100001611 | |||
| 1011 | Ga0070705_100003104 | |||
| 1012 | Ga0070705_100027365 | |||
| 1013 | Ga0070700_100002145 | |||
| 1014 | Ga0070700_100019655 | |||
| 1015 | Ga0070700_100177925 | |||
| 1016 | Ga0070694_100002530 | |||
| 1017 | Ga0070694_100014569 | |||
| 1018 | Ga0070708_100033405 | |||
| 1019 | Ga0070663_100002896 | |||
| 1020 | Ga0070663_100043990 | |||
| 1021 | Ga0070663_100092124 | |||
| 1022 | Ga0070663_100094739 | |||
| 1023 | Ga0070663_100224446 | |||
| 1024 | Ga0070678_100001494 | |||
| 1025 | Ga0070678_100005419 | |||
| 1026 | Ga0070678_100365183 | |||
| 1027 | Ga0070662_100018866 | |||
| 1028 | Ga0070662_100024993 | |||
| 1029 | Ga0070681_10008649 | |||
| 1030 | Ga0070681_10008829 | |||
| 1031 | Ga0070681_10058275 | |||
| 1032 | Ga0070681_10124675 | |||
| 1033 | Ga0068867_100003064 | |||
| 1034 | Ga0068867_100021369 | |||
| 1035 | Ga0068867_100026593 | |||
| 1036 | Ga0068867_100058714 | |||
| 1037 | Ga0070685_10006922 | |||
| 1038 | Ga0070685_10012087 | |||
| 1039 | Ga0070685_10016861 | |||
| 1040 | Ga0070707_100237240 | |||
| 1041 | Ga0070699_100316301 | |||
| 1042 | Ga0070699_100474102 | |||
| 1043 | Ga0070679_100018279 | |||
| 1044 | Ga0070679_100174232 | |||
| 1045 | Ga0070679_100227935 | |||
| 1046 | Ga0070684_100001969 | |||
| 1047 | Ga0070684_100017395 | |||
| 1048 | Ga0070684_100043609 | |||
| 1049 | Ga0070684_100044181 | |||
| 1050 | Ga0070697_100044335 | |||
| 1051 | Ga0068853_100004522 | |||
| 1052 | Ga0068853_100030662 | |||
| 1053 | Ga0068853_100041332 | |||
| 1054 | Ga0068853_100081940 | |||
| 1055 | Ga0068853_100217590 | |||
| 1056 | Ga0070672_100006625 | |||
| 1057 | Ga0070672_100075679 | |||
| 1058 | Ga0070686_100002237 | |||
| 1059 | Ga0070686_100003181 | |||
| 1060 | Ga0070695_100000331 | |||
| 1061 | Ga0070695_100002841 | |||
| 1062 | Ga0070695_100024431 | |||
| 1063 | Ga0070695_100029355 | |||
| 1064 | Ga0070696_100000690 | |||
| 1065 | Ga0070696_100003720 | |||
| 1066 | Ga0070693_100001170 | |||
| 1067 | Ga0070693_100008368 | |||
| 1068 | Ga0070693_100040681 | |||
| 1069 | Ga0070693_100120443 | |||
| 1070 | Ga0070693_100165113 | |||
| 1071 | Ga0070665_100027334 | |||
| 1072 | Ga0070665_100136974 | |||
| 1073 | Ga0070665_100256547 | |||
| 1074 | Ga0070665_100501575 | |||
| 1075 | Ga0070704_100013589 | |||
| 1076 | Ga0070704_100184237 | |||
| 1077 | Ga0068855_100010841 | |||
| 1078 | Ga0068855_100011516 | |||
| 1079 | Ga0068855_100013983 | |||
| 1080 | Ga0068855_100041680 | |||
| 1081 | Ga0068855_100146561 | |||
| 1082 | Ga0068855_100149640 | |||
| 1083 | Ga0068855_100360041 | |||
| 1084 | Ga0070664_100086864 | |||
| 1085 | Ga0070664_100121014 | |||
| 1086 | Ga0070664_100134427 | |||
| 1087 | Ga0068857_100002282 | |||
| 1088 | Ga0068857_100006348 | |||
| 1089 | Ga0068857_100218123 | |||
| 1090 | Ga0068854_100011480 | |||
| 1091 | Ga0068854_100130580 | |||
| 1092 | Ga0068856_100002597 | |||
| 1093 | Ga0068856_100047110 | |||
| 1094 | Ga0068856_100102557 | |||
| 1095 | Ga0068856_100277102 | |||
| 1096 | Ga0068856_100331219 | |||
| 1097 | Ga0068856_100469161 | |||
| 1098 | Ga0070702_100077459 | |||
| 1099 | Ga0068852_100006066 | |||
| 1100 | Ga0068852_100008161 | |||
| 1101 | Ga0068852_100065934 | |||
| 1102 | Ga0068852_100271543 | |||
| 1103 | Ga0068859_100000988 | |||
| 1104 | Ga0068859_100005044 | |||
| 1105 | Ga0068859_100029475 | |||
| 1106 | Ga0068859_100065542 | |||
| 1107 | Ga0068864_100003691 | |||
| 1108 | Ga0068866_10000899 | |||
| 1109 | Ga0068866_10033966 | |||
| 1110 | Ga0068861_100243087 | |||
| 1111 | Ga0068861_100393533 | |||
| 1112 | Ga0068870_10000555 | |||
| 1113 | Ga0068863_100185610 | |||
| 1114 | Ga0068863_100443015 | |||
| 1115 | Ga0068858_100013722 | |||
| 1116 | Ga0068858_100015828 | |||
| 1117 | Ga0068858_100054078 | |||
| 1118 | Ga0068858_100093821 | |||
| 1119 | Ga0068860_100038447 | |||
| 1120 | Ga0068860_100039551 | |||
| 1121 | Ga0068860_100047902 | |||
| 1122 | Ga0068860_100099497 | |||
| 1123 | Ga0068862_100002130 | |||
| 1124 | Ga0068862_100003011 | |||
| 1125 | Ga0068862_100042347 | |||
| 1126 | Ga0068862_100191316 | |||
| 1127 | Ga0081455_10000108 | |||
| 1128 | Ga0081455_10000673 | |||
| 1129 | Ga0081455_10001313 | |||
| 1130 | Ga0081455_10032768 | |||
| 1131 | Ga0081455_10050046 | |||
| 1132 | Ga0081538_10026138 | |||
| 1133 | Ga0081538_10029934 | |||
| 1134 | Ga0081540_1000017 | |||
| 1135 | Ga0081540_1000085 | |||
| 1136 | Ga0081540_1000257 | |||
| 1137 | Ga0081540_1001987 | |||
| 1138 | Ga0081540_1010138 | |||
| 1139 | Ga0081540_1036026 | |||
| 1140 | Ga0070717_10000425 | |||
| 1141 | Ga0075365_10002135 | |||
| 1142 | Ga0075365_10036375 | |||
| 1143 | Ga0075365_10057796 | |||
| 1144 | Ga0075365_10065457 | |||
| 1145 | Ga0075363_100020300 | |||
| 1146 | Ga0075364_10095831 | |||
| 1147 | Ga0070715_10003130 | |||
| 1148 | Ga0070715_10063526 | |||
| 1149 | Ga0070715_10073427 | |||
| 1150 | Ga0070716_100012172 | |||
| 1151 | Ga0070716_100076753 | |||
| 1152 | Ga0070712_100111407 | |||
| 1153 | Ga0075367_10032274 | |||
| 1154 | Ga0075367_10088985 | |||
| 1155 | Ga0075367_10128489 | |||
| 1156 | Ga0075369_10006001 | |||
| 1157 | Ga0075366_10047359 | |||
| 1158 | Ga0097621_100036961 | |||
| 1159 | Ga0097621_100212652 | |||
| 1160 | Ga0068871_100018198 | |||
| 1161 | Ga0068871_100034440 | |||
| 1162 | Ga0075428_100013854 | |||
| 1163 | Ga0075428_100027887 | |||
| 1164 | Ga0075428_100092925 | |||
| 1165 | Ga0075428_100571170 | |||
| 1166 | Ga0075430_100000140 | |||
| 1167 | Ga0075430_100034989 | |||
| 1168 | Ga0075431_100001318 | |||
| 1169 | Ga0075431_100080552 | |||
| 1170 | Ga0075431_100155060 | |||
| 1171 | Ga0075431_100178555 | |||
| 1172 | Ga0075431_100269069 | |||
| 1173 | Ga0075431_100333870 | |||
| 1174 | Ga0075433_10000050 | |||
| 1175 | Ga0075433_10005076 | |||
| 1176 | Ga0075433_10421905 | |||
| 1177 | Ga0075434_100000179 | |||
| 1178 | Ga0075434_100062927 | |||
| 1179 | Ga0075434_100117009 | |||
| 1180 | Ga0075434_100145575 | |||
| 1181 | Ga0075434_100459460 | |||
| 1182 | Ga0075429_100009748 | |||
| 1183 | Ga0068865_100040353 | |||
| 1184 | Ga0075436_100120638 | |||
| 1185 | Ga0097620_100000988 | |||
| 1186 | Ga0097620_100005044 | |||
| 1187 | Ga0097620_100029475 | |||
| 1188 | Ga0097620_100065543 | |||
| 1189 | Ga0075435_100014515 | |||
| 1190 | Ga0075435_100137990 | |||
| 1191 | Ga0075435_100278603 | |||
| 1192 | Ga0099794_10005856 | |||
| 1193 | Ga0105240_10046314 | |||
| 1194 | Ga0111539_10000565 | |||
| 1195 | Ga0111539_10003400 | |||
| 1196 | Ga0111539_10042933 | |||
| 1197 | Ga0105245_10006794 | |||
| 1198 | Ga0105247_10123992 | |||
| 1199 | Ga0105247_10158718 | |||
| 1200 | Ga0114129_10007851 | |||
| 1201 | Ga0114129_10008234 | |||
| 1202 | Ga0114129_10015156 | |||
| 1203 | Ga0114129_10109135 | |||
| 1204 | Ga0114129_10180245 | |||
| 1205 | Ga0114129_10372363 | |||
| 1206 | Ga0105243_10007504 | |||
| 1207 | Ga0105243_10029989 | |||
| 1208 | Ga0105243_10041228 | |||
| 1209 | Ga0105241_10002961 | |||
| 1210 | Ga0105241_10040953 | |||
| 1211 | Ga0105242_10004894 | |||
| 1212 | Ga0105242_10045591 | |||
| 1213 | Ga0105248_10005301 | |||
| 1214 | Ga0105248_10005481 | |||
| 1215 | Ga0105248_10018400 | |||
| 1216 | Ga0105237_10059796 | |||
| 1217 | Ga0105237_10074472 | |||
| 1218 | Ga0105238_10036945 | |||
| 1219 | Ga0105238_10052948 | |||
| 1220 | Ga0105238_10078842 | |||
| 1221 | Ga0105238_10265733 | |||
| 1222 | Ga0105249_10000531 | |||
| 1223 | Ga0105249_10095713 | |||
| 1224 | Ga0105249_10169954 | |||
| 1225 | Ga0105249_10318044 | |||
| 1226 | Ga0105249_10667114 | |||
| 1227 | Ga0105239_10124604 | |||
| 1228 | Ga0105239_10482075 | |||
| 1229 | Ga0105239_10570133 | |||
| 1230 | Ga0105246_10006621 | |||
| 1231 | Ga0105246_10029891 | |||
| 1232 | Ga0105246_10066351 | |||
| 1233 | Ga0157343_1001347 | |||
| 1234 | Ga0157342_1000839 | |||
| 1235 | Ga0157315_1001031 | |||
| 1236 | Ga0157373_10019862 | |||
| 1237 | Ga0157371_10018413 | |||
| 1238 | Ga0157371_10219875 | |||
| 1239 | Ga0157371_10289242 | |||
| 1240 | Ga0157370_10180038 | |||
| 1241 | Ga0157369_10382926 | |||
| 1242 | Ga0157374_10005394 | |||
| 1243 | Ga0157374_10018860 | |||
| 1244 | Ga0157374_10226477 | |||
| 1245 | Ga0157378_10045505 | |||
| 1246 | Ga0157378_10409725 | |||
| 1247 | Ga0163162_10011299 | |||
| 1248 | Ga0163162_10143035 | |||
| 1249 | Ga0163162_10216647 | |||
| 1250 | Ga0163162_10241792 | |||
| 1251 | Ga0157372_10005559 | |||
| 1252 | Ga0157372_10108815 | |||
| 1253 | Ga0157372_10285147 | |||
| 1254 | Ga0157375_10004143 | |||
| 1255 | Ga0157375_10020331 | |||
| 1256 | Ga0163163_10004364 | |||
| 1257 | Ga0163163_10049663 | |||
| 1258 | Ga0163163_10129414 | |||
| 1259 | Ga0163163_10161390 | |||
| 1260 | Ga0157380_10004080 | |||
| 1261 | Ga0157380_10060111 | |||
| 1262 | Ga0182008_10109857 | |||
| 1263 | Ga0157377_10002281 | |||
| 1264 | Ga0157377_10083267 | |||
| 1265 | Ga0157377_10147068 | |||
| 1266 | Ga0157379_10003623 | |||
| 1267 | Ga0157379_10029224 | |||
| 1268 | Ga0157376_10008998 | |||
| 1269 | Ga0163161_10088615 | |||
| 1270 | Ga0209758_1000308 | |||
| 1271 | Ga0207653_10000791 | |||
| 1272 | Ga0207692_10006112 | |||
| 1273 | Ga0207692_10069886 | |||
| 1274 | Ga0207710_10002302 | |||
| 1275 | Ga0207688_10006874 | |||
| 1276 | Ga0207680_10004647 | |||
| 1277 | Ga0207647_10042579 | |||
| 1278 | Ga0207685_10000850 | |||
| 1279 | Ga0207685_10016122 | |||
| 1280 | Ga0207699_10090195 | |||
| 1281 | Ga0207645_10078744 | |||
| 1282 | Ga0207643_10001619 | |||
| 1283 | Ga0207705_10048931 | |||
| 1284 | Ga0207705_10105343 | |||
| 1285 | Ga0207684_10064081 | |||
| 1286 | Ga0207654_10056704 | |||
| 1287 | Ga0207654_10206629 | |||
| 1288 | Ga0207707_10036975 | |||
| 1289 | Ga0207707_10153436 | |||
| 1290 | Ga0207707_10478543 | |||
| 1291 | Ga0207695_10186309 | |||
| 1292 | Ga0207693_10003582 | |||
| 1293 | Ga0207693_10004297 | |||
| 1294 | Ga0207693_10011119 | |||
| 1295 | Ga0207693_10066437 | |||
| 1296 | Ga0207693_10235572 | |||
| 1297 | Ga0207663_10037590 | |||
| 1298 | Ga0207660_10008494 | |||
| 1299 | Ga0207662_10144639 | |||
| 1300 | Ga0207657_10021001 | |||
| 1301 | Ga0207657_10056355 | |||
| 1302 | Ga0207649_10062321 | |||
| 1303 | Ga0207649_10084314 | |||
| 1304 | Ga0207652_10036684 | |||
| 1305 | Ga0207652_10126082 | |||
| 1306 | Ga0207646_10143226 | |||
| 1307 | Ga0207681_10079568 | |||
| 1308 | Ga0207694_10052546 | |||
| 1309 | Ga0207694_10069989 | |||
| 1310 | Ga0207687_10008332 | |||
| 1311 | Ga0207687_10211519 | |||
| 1312 | Ga0207700_10000797 | |||
| 1313 | Ga0207700_10021555 | |||
| 1314 | Ga0207700_10039638 | |||
| 1315 | Ga0207700_10166203 | |||
| 1316 | Ga0207664_10003862 | |||
| 1317 | Ga0207664_10080404 | |||
| 1318 | Ga0207664_10108284 | |||
| 1319 | Ga0207664_10139142 | |||
| 1320 | Ga0207664_10219099 | |||
| 1321 | Ga0207644_10014433 | |||
| 1322 | Ga0207644_10068745 | |||
| 1323 | Ga0207690_10054948 | |||
| 1324 | Ga0207706_10142666 | |||
| 1325 | Ga0207706_10155344 | |||
| 1326 | Ga0207686_10064276 | |||
| 1327 | Ga0207709_10183717 | |||
| 1328 | Ga0207670_10048586 | |||
| 1329 | Ga0207669_10266954 | |||
| 1330 | Ga0207704_10164637 | |||
| 1331 | Ga0207665_10002407 | |||
| 1332 | Ga0207665_10034875 | |||
| 1333 | Ga0207665_10056924 | |||
| 1334 | Ga0207691_10000812 | |||
| 1335 | Ga0207711_10003275 | |||
| 1336 | Ga0207689_10032416 | |||
| 1337 | Ga0207667_10007621 | |||
| 1338 | Ga0207667_10054610 | |||
| 1339 | Ga0207667_10110152 | |||
| 1340 | Ga0207667_10369527 | |||
| 1341 | Ga0207712_10015865 | |||
| 1342 | Ga0207712_10066990 | |||
| 1343 | Ga0207712_10275417 | |||
| 1344 | Ga0207640_10231040 | |||
| 1345 | Ga0207640_10285440 | |||
| 1346 | Ga0207658_10011971 | |||
| 1347 | Ga0207658_10172115 | |||
| 1348 | Ga0207703_10031287 | |||
| 1349 | Ga0207678_10008906 | |||
| 1350 | Ga0207678_10014273 | |||
| 1351 | Ga0207678_10082159 | |||
| 1352 | Ga0207708_10002674 | |||
| 1353 | Ga0207702_10062360 | |||
| 1354 | Ga0207702_10156669 | |||
| 1355 | Ga0207702_10284434 | |||
| 1356 | Ga0207641_10050229 | |||
| 1357 | Ga0207648_10024827 | |||
| 1358 | Ga0207648_10094677 | |||
| 1359 | Ga0207676_10008714 | |||
| 1360 | Ga0207676_10053940 | |||
| 1361 | Ga0207674_10010838 | |||
| 1362 | Ga0207674_10365316 | |||
| 1363 | Ga0207675_100003315 | |||
| 1364 | Ga0207675_100106246 | |||
| 1365 | Ga0207675_100300430 | |||
| 1366 | Ga0207683_10157349 | |||
| 1367 | Ga0207698_10004492 | |||
| 1368 | Ga0207698_10040340 | |||
| 1369 | Ga0207698_10296525 | |||
| 1370 | Ga0207428_10000485 | |||
| 1371 | Ga0207428_10171599 | |||
| 1372 | Ga0268266_10010491 | |||
| 1373 | Ga0268265_10001669 | |||
| 1374 | Ga0268264_10002104 | |||
| 1375 | Ga0268264_10055219 | |||
| 1376 | Ga0268264_10101602 | |||
| 1377 | Ga0268264_10274352 | |||
| 1378 | Ga0265337_1000693 | |||
| 1379 | Ga0265338_10104900 | |||
| 1380 | Ga0265330_10026048 | |||
| 1381 | Ga0265320_10043119 | |||
| 1382 | Ga0265325_10000036 | |||
| 1383 | Ga0265325_10000613 | |||
| 1384 | Ga0265325_10000660 | |||
| 1385 | Ga0265325_10002455 | |||
| 1386 | Ga0265340_10023895 | |||
| 1387 | Ga0265339_10006516 | |||
| 1388 | Ga0265331_10042388 | |||
| 1389 | Ga0265316_10078067 | |||
| 1390 | Ga0265316_10083872 | |||
| 1391 | Ga0265313_10001282 | |||
| 1392 | Ga0265313_10021309 | |||
| 1393 | Ga0265313_10040519 | |||
| 1394 | Ga0265342_10004065 | |||
| 1395 | Ga0265342_10009777 | |||
| 1396 | Ga0316583_10000944 | |||
| 1397 | Ga0373958_0000095 | |||
| 1398 | Ga0373959_0001784 | |||
| 1399 | Ga0373938_0000332 | |||
| 1400 | Ga0373926_0006116 | |||
| 1401 | Ga0373926_0077209 | |||
| 1402 | Ga0373928_0000109 | |||
| 1403 | Ga0373929_0000097 | |||
| 1404 | Ga0373934_0070290 | |||
| 1405 | Ga0373940_0001510 | |||
| 1406 | Ga0373944_0091787 | |||
| 1407 | Ga0373949_0000836 | |||
| 1408 | Ga0373951_0000383 | |||
| 1409 | Ga0373951_0019169 | |||
| 1410 | Ga0373952_0004519 | |||
| 1411 | Ga0373952_0009381 | |||
| 1412 | Ga0373923_0014571 | |||
| 1413 | Ga0373932_0000087 | |||
| 1414 | Ga0373932_0044395 | |||
| 1415 | Ga0373936_0009325 | |||
| 1416 | Ga0373936_0017545 | |||
| 1417 | Ga0373936_0017717 | |||
| 1418 | Ga0373936_0024360 | |||
| 1419 | Ga0373939_0002562 | |||
| 1420 | Ga0373939_0004051 | |||
| 1421 | Ga0373941_0000112 | |||
| 1422 | Ga0373941_0021173 | |||
| 1423 | Ga0373945_0009092 | |||
| 1424 | Ga0373945_0010395 | |||
| 1425 | Ga0373953_0002373 | |||
| 1426 | Ga0373953_0007577 | |||
| 1427 | Ga0373954_0005350 | |||
| 1428 | Ga0373954_0009365 | |||
| 1429 | Ga0373956_0064733 | |||
| 1430 | Ga0373957_0011402 | |||
| 1431 | Ga0373960_0000239 | |||
| 1432 | Ga0373960_0003396 | |||
| 1433 | Ga0373943_0002096 | |||
| 1434 | Ga0373943_0006168 | |||
| 1435 | Ga0373943_0026880 | |||
| 1436 | Ga0373943_0057260 | |||
| 1437 | Ga0373946_0000806 | |||
| 1438 | Ga0373946_0005380 | |||
| 1439 | Ga0373946_0007986 | |||
| 1440 | Ga0373946_0008754 | |||
| 1441 | Ga0373946_0044461 | |||
| 1442 | Ga0373946_0067252 | |||
| 1443 | Ga0373946_0117392 | |||
| 1444 | Ga0373955_0004005 | |||
| 1445 | Ga0373955_0172666 | |||
| 1446 | Ga0373942_0000514 | |||
| 1447 | Ga0373942_0024526 | |||
| 1448 | Ga0373961_0000165 | |||
| 1449 | Ga0373961_0005516 | |||
| 1450 | Ga0373962_0000237 | |||
| 1451 | Ga0373924_0015017 | |||
| 1452 | Ga0373924_0029636 | |||
| 1453 | Ga0373931_0002125 | |||
| 1454 | Ga0373931_0059898 | |||
| 1455 | Ga0373931_0074095 | |||
| 1456 | Ga0373935_0002709 | |||
| 1457 | Ga0373935_0003209 | |||
| 1458 | Ga0373935_0011961 | |||
| 1459 | Ga0373935_0024417 | |||
| 1460 | Ga0373935_0042990 | |||
| 1461 | Ga0373935_0100678 | |||
| 1462 | Ga0373927_0002024 | |||
| 1463 | Ga0373927_0002281 | |||
| 1464 | Ga0373927_0018744 | |||
| 1465 | Ga0373927_0025712 | |||
| 1466 | Ga0373927_0071620 | |||
| 1467 | Ga0373927_0096181 | |||
| 1468 | Ga0373927_0153721 | |||
| 1469 | Ga0373933_0002064 | |||
| 1470 | Ga0373933_0009980 | |||
| 1471 | Ga0373933_0031564 | |||
| 1472 | Ga0373947_0000337 | |||
| 1473 | Ga0373947_0008046 | |||
| 1474 | Ga0373947_0008938 | |||
| 1475 | Ga0373947_0026591 | |||
| 1476 | Ga0373937_0001397 | |||
| 1477 | Ga0373937_0010357 | |||
| 1478 | Ga0373937_0044711 | |||
| 1479 | Ga0373937_0056393 | |||
| 1480 | Ga0373937_0075347 | |||
| 1481 | Ga0316582_0186243 | |||
| 1482 | Ga0373925_0001463 | |||
| 1483 | Ga0373925_0010168 | |||
| 1484 | Ga0373925_0115576 | |||
| 1485 | Ga0373925_0153552 | |||
| 1486 | Ga0373925_0161216 | |||
| 1487 | Ga0395898_0048808 | |||
| 1488 | Ga0395898_0132144 | |||
| 1489 | Ga0395901_0121390 | |||
| 1490 | Ga0242420_014311 | |||
| 1491 | Ga0436360_0451215 | |||
| 1492 | Ga0436361_0042376 | |||
| 1493 | Ga0436361_0708897 | |||
| 1494 | Ga0466971_0051866 | |||
| 1495 | Ga0451576_0010805 | |||
| 1496 | Ga0466958_0067913 | |||
| 1497 | Ga0466967_0461687 | |||
| 1498 | Ga0495617_005734 | |||
| 1499 | Ga0495627_060925 | |||
| 1500 | Ga0495592_0020683 | |||
| 1501 | Ga0495592_0181705 | |||
| 1502 | Ga0495592_0229540 | |||
| 1503 | Ga0495603_0001421 | |||
| 1504 | Ga0495603_0007341 | |||
| 1505 | Ga0495603_0142053 | |||
| 1506 | Ga0495590_0074617 | |||
| 1507 | Ga0495629_0001742 | |||
| 1508 | Ga0495641_0014778 | |||
| 1509 | Ga0495641_0018265 | |||
| 1510 | Ga0495641_0070758 | |||
| 1511 | Ga0495651_0003967 | |||
| 1512 | Ga0495651_0005894 | |||
| 1513 | Ga0495651_0184493 | |||
| 1514 | Ga0495653_0002617 | |||
| 1515 | Ga0495653_0008661 | |||
| 1516 | Ga0495580_0009323 | |||
| 1517 | Ga0495580_0189545 | |||
| 1518 | Ga0495582_0005451 | |||
| 1519 | Ga0495582_0070539 | |||
| 1520 | Ga0495639_0001541 | |||
| 1521 | Ga0495639_0002862 | |||
| 1522 | Ga0495639_0011982 | |||
| 1523 | Ga0495639_0025847 | |||
| 1524 | Ga0495639_0063239 | |||
| 1525 | Ga0495662_0001109 | |||
| 1526 | Ga0495662_0015048 | |||
| 1527 | Ga0495662_0024413 | |||
| 1528 | Ga0495664_0000510 | |||
| 1529 | Ga0495584_0005702 | |||
| 1530 | Ga0495584_0093031 | |||
| 1531 | Ga0495585_0003676 | |||
| 1532 | Ga0495585_0017566 | |||
| 1533 | Ga0495585_0063900 | |||
| 1534 | Ga0495594_0017133 | |||
| 1535 | Ga0495596_0044366 | |||
| 1536 | Ga0495607_0009728 | |||
| 1537 | Ga0495608_0006100 | |||
| 1538 | Ga0495608_0059729 | |||
| 1539 | Ga0495608_0183858 | |||
| 1540 | Ga0495618_0020575 | |||
| 1541 | Ga0495618_0033878 | |||
| 1542 | Ga0495628_0105709 | |||
| 1543 | Ga0495628_0107672 | |||
| 1544 | Ga0495628_0131207 | |||
| 1545 | Ga0495628_0215300 | |||
| 1546 | Ga0495630_0015854 | |||
| 1547 | Ga0495630_0094603 | |||
| 1548 | Ga0495630_0110907 | |||
| 1549 | Ga0495631_0025806 | |||
| 1550 | Ga0495632_0141286 | |||
| 1551 | Ga0495637_0018273 | |||
| 1552 | Ga0495637_0065024 | |||
| 1553 | Ga0495644_0029737 | |||
| 1554 | Ga0495663_0019919 | |||
| 1555 | Ga0495666_0035319 | |||
| 1556 | Ga0495666_0050434 | |||
| 1557 | Ga0495652_0015920 | |||
| 1558 | Ga0495652_0051751 | |||
| 1559 | Ga0495665_0002284 | |||
| 1560 | Ga0495665_0019106 | |||
| 1561 | Ga0495665_0070738 | |||
| 1562 | Ga0495640_0002882 | |||
| 1563 | Ga0495640_0101767 | |||
| 1564 | Ga0495640_0109782 | |||
| 1565 | Ga0495640_0136128 | |||
| 1566 | Ga0495586_0019415 | |||
| 1567 | Ga0495587_0001485 | |||
| 1568 | Ga0495587_0010534 | |||
| 1569 | Ga0495587_0010972 | |||
| 1570 | Ga0495598_0000140 | |||
| 1571 | Ga0495598_0002282 | |||
| 1572 | Ga0495598_0006516 | |||
| 1573 | Ga0495621_0029892 | |||
| 1574 | Ga0495645_0002547 | |||
| 1575 | Ga0495645_0003754 | |||
| 1576 | Ga0495645_0041228 | |||
| 1577 | Ga0495622_0036486 | |||
| 1578 | Ga0495633_0013142 | |||
| 1579 | Ga0495667_0007578 | |||
| 1580 | Ga0495667_0020590 | |||
| 1581 | Ga0495667_0055252 | |||
| 1582 | Ga0495656_0001097 | |||
| 1583 | Ga0495634_0020779 | |||
| 1584 | Ga0495634_0043898 | |||
| 1585 | Ga0495634_0108124 | |||
| 1586 | Ga0495634_0121683 | |||
| 1587 | Ga0495635_0000662 | |||
| 1588 | Ga0495635_0003035 | |||
| 1589 | Ga0495635_0007370 | |||
| 1590 | Ga0495635_0010431 | |||
| 1591 | Ga0495635_0060262 | |||
| 1592 | Ga0495659_0001233 | |||
| 1593 | Ga0495659_0017682 | |||
| 1594 | Ga0495659_0051289 | |||
| 1595 | Ga0495661_0033872 | |||
| 1596 | Ga0495657_0006498 | |||
| 1597 | Ga0495657_0023801 | |||
| 1598 | Ga0495657_0212620 | |||
| 1599 | Ga0495599_0023928 | |||
| 1600 | Ga0495623_0014481 | |||
| 1601 | Ga0495646_0024804 | |||
| 1602 | Ga0495646_0039442 | |||
| 1603 | Ga0495647_0007367 | |||
| 1604 | Ga0495647_0009683 | |||
| 1605 | Ga0495647_0059643 | |||
| 1606 | Ga0495658_0000231 | |||
| 1607 | Ga0495658_0003159 | |||
| 1608 | Ga0495658_0003902 | |||
| 1609 | Ga0495658_0107501 | |||
| 1610 | Ga0495669_0087449 | |||
| 1611 | Ga0495669_0097515 | |||
| 1612 | Ga0495613_0012961 | |||
| 1613 | Ga0495613_0036851 | |||
| 1614 | Ga0495613_0102260 | |||
| 1615 | Ga0495613_0102776 | |||
| 1616 | Ga0495613_0105302 | |||
| 1617 | Ga0495624_0004671 | |||
| 1618 | Ga0495624_0005449 | |||
| 1619 | Ga0495624_0010346 | |||
| 1620 | Ga0495624_0029199 | |||
| 1621 | Ga0495670_0020527 | |||
| 1622 | Ga0495649_0044597 | |||
| 1623 | Ga0495600_0002443 | |||
| 1624 | Ga0495600_0023851 | |||
| 1625 | Ga0495581_0010107 | |||
| 1626 | Ga0495581_0037680 | |||
| 1627 | Ga0495581_0074410 | |||
| 1628 | Ga0495604_0002660 | |||
| 1629 | Ga0495604_0004875 | |||
| 1630 | Ga0495604_0035531 | |||
| 1631 | Ga0495604_0295873 | |||
| 1632 | Ga0495674_0000138 | |||
| 1633 | Ga0495674_0012742 | |||
| 1634 | Ga0495674_0057468 | |||
| 1635 | Ga0495674_0078906 | |||
| 1636 | Ga0495674_0104861 | |||
| 1637 | Ga0495674_0159197 | |||
| 1638 | Ga0495674_0182666 | |||
| 1639 | Ga0495676_0005696 | |||
| 1640 | Ga0495676_0048159 | |||
| 1641 | Ga0495676_0058061 | |||
| 1642 | Ga0495680_0007757 | |||
| 1643 | Ga0495680_0018968 | |||
| 1644 | Ga0495680_0026697 | |||
| 1645 | Ga0495680_0098297 | |||
| 1646 | Ga0495675_0000984 | |||
| 1647 | Ga0495679_010187 | |||
| 1648 | Ga0495673_0112808 | |||
| 1649 | Ga0495684_0002820 | |||
| 1650 | Ga0495684_0006309 | |||
| 1651 | Ga0495684_0011874 | |||
| 1652 | Ga0495684_0018121 | |||
| 1653 | Ga0495684_0142096 | |||
| 1654 | Ga0495593_0001477 | |||
| 1655 | Ga0495593_0023241 | |||
| 1656 | Ga0495602_0003678 | |||
| 1657 | Ga0495602_0044296 | |||
| 1658 | Ga0495614_0015002 | |||
| 1659 | Ga0495614_0049003 | |||
| 1660 | Ga0496100_0013484 | |||
| 1661 | Ga0496101_0031991 | |||
| 1662 | Ga0496102_0001843 | |||
| 1663 | Ga0496102_0003813 | |||
| 1664 | Ga0496102_0030629 | |||
| 1665 | Ga0496102_0051728 | |||
| 1666 | Ga0496102_0077144 | |||
| 1667 | Ga0496103_0058098 | |||
| 1668 | Ga0496103_0080037 | |||
| 1669 | Ga0496104_0026471 | |||
| 1670 | Ga0496104_0056788 | |||
| 1671 | Ga0496104_0087477 | |||
| 1672 | Ga0496104_0097246 | |||
| 1673 | Ga0496104_0163788 | |||
| 1674 | Ga0496104_0331522 | |||
| 1675 | Ga0496105_0000402 | |||
| 1676 | Ga0496105_0028168 | |||
| 1677 | Ga0496105_0041366 | |||
| 1678 | Ga0496105_0076299 | |||
| 1679 | Ga0496105_0087663 | |||
| 1680 | Ga0496105_0103782 | |||
| 1681 | Ga0496106_0000335 | |||
| 1682 | Ga0496106_0002077 | |||
| 1683 | Ga0496106_0025146 | |||
| 1684 | Ga0496106_0037782 | |||
| 1685 | Ga0496106_0065120 | |||
| 1686 | Ga0496106_0109606 | |||
| 1687 | Ga0496106_0320536 | |||
| 1688 | Ga0496107_0007535 | |||
| 1689 | Ga0496107_0017976 | |||
| 1690 | Ga0496107_0046826 | |||
| 1691 | Ga0496107_0053258 | |||
| 1692 | Ga0496107_0118106 | |||
| 1693 | Ga0496108_0009527 | |||
| 1694 | Ga0496108_0018150 | |||
| 1695 | Ga0496109_0001112 | |||
| 1696 | Ga0496109_0089799 | |||
| 1697 | Ga0496110_0001899 | |||
| 1698 | Ga0496110_0047740 | |||
| 1699 | Ga0496111_0001319 | |||
| 1700 | Ga0496111_0006751 | |||
| 1701 | Ga0496111_0029229 | |||
| 1702 | Ga0496112_0030691 | |||
| 1703 | Ga0496112_0034047 | |||
| 1704 | Ga0496112_0043154 | |||
| 1705 | Ga0496113_0000266 | |||
| 1706 | Ga0496113_0133503 | |||
| 1707 | Ga0496113_0175339 | |||
| 1708 | Ga0496114_0051199 | |||
| 1709 | Ga0496114_0078985 | |||
| 1710 | Ga0496114_0178501 | |||
| 1711 | Ga0496114_0192133 | |||
| 1712 | Ga0496115_0016093 | |||
| 1713 | Ga0496115_0051907 | |||
| 1714 | Ga0496115_0061732 | |||
| 1715 | Ga0496115_0196777 | |||
| 1716 | Ga0501031_0007374 | |||
| 1717 | Ga0501032_0019130 | |||
| 1718 | Ga0501033_0007639 | |||
| 1719 | Ga0501036_0007513 | |||
| 1720 | Ga0501036_0126425 | |||
| 1721 | Ga0501037_0003786 | |||
| 1722 | Ga0501037_0026174 | |||
| 1723 | Ga0501038_0005967 | |||
| 1724 | Ga0501039_0065878 | |||
| 1725 | Ga0501046_0029673 | |||
| 1726 | Ga0501047_0008734 | |||
| 1727 | Ga0501068_0002319 | |||
| 1728 | Ga0501069_0075657 | |||
| 1729 | Ga0501070_0008236 | |||
| 1730 | Ga0501070_0076661 | |||
| 1731 | Ga0501073_0165159 | |||
| 1732 | Ga0501076_0270714 | |||
| 1733 | Ga0501079_0049670 | |||
| 1734 | Ga0501080_0028428 | |||
| 1735 | Ga0501080_0319550 | |||
| 1736 | Ga0501083_0040133 | |||
| 1737 | Ga0501083_0266583 | |||
| 1738 | Ga0501035_0033181 | |||
| 1739 | Ga0501044_0028392 | |||
| 1740 | Ga0501045_0239490 | |||
| 1741 | nmdc:mga03n38_93649_c1 | |||
| 1742 | nmdc:mga0yw44_20458_c1 | |||
| 1743 | nmdc:mga0yw44_22137_c1 | |||
| 1744 | nmdc:mga0yw44_26051_c1 | |||
| 1745 | nmdc:mga0k408_6575_c1 | |||
| 1746 | nmdc:mga0k408_67153_c1 | |||
| 1747 | nmdc:mga05p37_219_c1 | |||
| 1748 | nmdc:mga05p37_2721_c1 | |||
| 1749 | nmdc:mga05p37_47936_c1 | |||
| 1750 | nmdc:mga05p37_55107_c1 | |||
| 1751 | nmdc:mga05p37_7502_c1 | |||
| 1752 | nmdc:mga09592_2153_c1 | |||
| 1753 | nmdc:mga09592_347708_c1 | |||
| 1754 | nmdc:mga09592_371445_c1 | |||
| 1755 | nmdc:mga0qj67_1123_c1 | |||
| 1756 | nmdc:mga0qj67_264186_c1 | |||
| 1757 | nmdc:mga0qj67_57343_c1 | |||
| 1758 | nmdc:mga06r32_2657_c1 | |||
| 1759 | nmdc:mga06r32_274_c1 | |||
| 1760 | nmdc:mga06r32_312597_c1 | |||
| 1761 | nmdc:mga08y16_161224_c1 | |||
| 1762 | nmdc:mga08y16_25664_c1 | |||
| 1763 | nmdc:mga08y16_389045_c1 | |||
| 1764 | nmdc:mga08y16_7375_c1 | |||
| 1765 | nmdc:mga0n895_124_c1 | |||
| 1766 | nmdc:mga0n895_126689_c1 | |||
| 1767 | nmdc:mga0n895_44058_c1 | |||
| 1768 | nmdc:mga0n895_7901_c1 | |||
| 1769 | nmdc:mga0rr50_1076_c1 | |||
| 1770 | nmdc:mga0rr50_120094_c1 | |||
| 1771 | nmdc:mga0rr50_148456_c1 | |||
| 1772 | nmdc:mga08x19_10905_c1 | |||
| 1773 | nmdc:mga08x19_65523_c1 | |||
| 1774 | nmdc:mga0a205_207680_c1 | |||
| 1775 | nmdc:mga0a205_95251_c1 | |||
| 1776 | nmdc:mga0a205_97_c1 | |||
| 1777 | Ga0495601_0001064 | |||
| 1778 | Ga0495601_0007427 | |||
| 1779 | Ga0495601_0009051 | |||
| 1780 | Ga0495601_0011407 | |||
| 1781 | Ga0495601_0034393 | |||
| 1782 | Ga0495601_0068849 | |||
| 1783 | Ga0495601_0087547 | |||
| 1784 | Ga0495601_0172624 | |||
| 1785 | Ga0495612_0002279 | |||
| 1786 | Ga0495612_0065721 | |||
| 1787 | Ga0495612_0080670 | |||
| 1788 | Ga0495595_0002059 | |||
| 1789 | Ga0495595_0028977 | |||
| 1790 | Ga0495619_0000145 | |||
| 1791 | Ga0495619_0001114 | |||
| 1792 | Ga0495619_0001312 | |||
| 1793 | Ga0495619_0007717 | |||
| 1794 | Ga0495619_0008464 | |||
| 1795 | Ga0495619_0011423 | |||
| 1796 | Ga0495619_0018253 | |||
| 1797 | Ga0495619_0100373 | |||
| 1798 | Ga0500651_0000483 | |||
| 1799 | Ga0500562_013205 | |||
| 1800 | Ga0500652_044825 | |||
| 1801 | Ga0500616_0000006 | |||
| 1802 | Ga0530510_0029224 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF12974
Phosphonate-bd
ABC transporter, phosphonate, periplasmic substrate-binding protein
76
208
0.85
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2x26-assembly2.cif.gz_B | crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli | 0.8048 | 26 | 328 |
| 2x26-assembly2.cif.gz_B | crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli | 0.7999 | 26 | 328 |
| 1zbm-assembly1.cif.gz_A | x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. | 0.7947 | 29 | 312 |
| 3ksx-assembly1.cif.gz_A | the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops | 0.7926 | 25 | 324 |
| 2x26-assembly1.cif.gz_A | crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli | 0.7883 | 26 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wedA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8585 | 61 | 83 | 3.40.190.10 |
| af_Q2G1L7_145_252_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8518 | 118 | 212 | 3.40.190.10 |
| 3uifA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8464 | 119 | 216 | 3.40.190.10 |
| 3ksxA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8427 | 117 | 213 | 3.40.190.10 |
| 3qslB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8294 | 120 | 209 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A090MGL9-F1-model_v4 | Uncultured bacterium genome assembly Metasoil_fosmids_resub | 0.9725 | 124 | 334 |
|
| AF-A0A090MGL9-F1-model_v4 | Uncultured bacterium genome assembly Metasoil_fosmids_resub | 0.9335 | 124 | 334 |
|
| AF-A0A3Q8Z045-F1-model_v4 | deleted | 0.9279 | 1 | 335 |
|
| AF-A0A3Q8Z045-F1-model_v4 | deleted | 0.9252 | 1 | 335 |
|
| AF-A0A1F7TNB6-F1-model_v4 | Solute-binding protein family 3/N-terminal domain-containing protein | 0.916 | 4 | 334 |
|