F485181

General Info

Members Datasets Scaffolds Average Seq Length
901 395 1802 336

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0633995|Ga0436360_0633995_857_1921
Length 354
Sequence VQGPEGPAFLGEDRSMRSWKLLVAAIVAGGVAAVAPLHESAAQSPAKIRLAWVVQVANWVSILPEKPDLLQHQGKSYVLEPVRFQGTPPMISAMAINDLEIGNLAYSSFSLAVENANLSDLRIIADEFQDGVPGYYSDEFFVAKDSPIKTVEDLKGKVLATNAVGSAVDIAMRAMLRKHNMQDKRDVTIIEAAFPNMPAMLAEHKVDAFPGVLPFSVNPAIRGATRTLFSQKEAVGTTQMIVWAARAGFIQKNRAALVDFMEDMLRAERWFLAPANHKDAVAIAAKVSKQPEANFDSWLFTKQDYYRDPDAKPNLDAFQANVDLQKELGFLKAGFDVKKFADLSIVDDAAKRLK

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
134 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
135 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
215 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
224 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
225 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
226 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
229 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
230 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
231 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
234 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
235 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
238 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
241 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
242 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
243 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
244 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
245 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
246 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
247 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
248 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
251 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
265 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
266 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
271 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
277 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
280 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
281 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
282 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
302 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
305 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
316 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
317 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
318 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
334 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
338 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
366 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
367 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
368 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
375 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
376 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
380 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
381 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
382 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
383 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
384 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
385 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
386 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
387 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
388 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
389 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
392 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
393 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
394 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0
Rhizoplane 6.22
Rhizosphere 91.23
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0633995 3300039438 Bacteria 2088
2 2214884102 2209111006 Bacteria 1487
3 ARcpr5oldR_c000321 3300000041 Bacteria 6866
4 ARcpr5oldR_c003388 3300000041 Bacteria 1419
5 ARSoilYngRDRAFT_c00231 3300000042 Bacteria 8934
6 ARcpr5yngRDRAFT_c000416 3300000043 Bacteria 5603
7 ARSoilOldRDRAFT_c000416 3300000044 Bacteria 5163
8 ARSoilOldRDRAFT_c001840 3300000044 Bacteria 1946
9 ARCol0oldRDRAFT_c00633 3300000045 Bacteria 3090
10 ARCol0yngRDRAFT_1000060 3300000652 Bacteria 19698
11 JGI24739J22299_10006512 3300001989 Bacteria 4402
12 JGI24737J22298_10002394 3300001990 Bacteria 6691
13 JGI24750J21931_1000574 3300002070 Bacteria 5637
14 JGI24748J21848_1001596 3300002074 Bacteria 2523
15 JGI24749J21850_1000589 3300002076 Bacteria 5297
16 JGI24035J26624_1000525 3300002126 Bacteria 3569
17 JGI24033J26618_1002159 3300002155 Bacteria 1987
18 JGI25153J46596_10018707 3300003215 Bacteria 2679
19 JGI25405J52794_10007742 3300003911 Bacteria 1989
20 Ga0065717_1002190 3300005276 Bacteria 2540
21 Ga0065704_10084523 3300005289 Bacteria 3326
22 Ga0065712_10001151 3300005290 Bacteria 7296
23 Ga0065712_10095860 3300005290 Bacteria 2201
24 Ga0065715_10097198 3300005293 Bacteria 3713
25 Ga0070658_10022977 3300005327 Bacteria 5006
26 Ga0070658_10054799 3300005327 Bacteria 3238
27 Ga0070676_10003946 3300005328 Bacteria 7787
28 Ga0070676_10021880 3300005328 Bacteria 3582
29 Ga0070676_10038660 3300005328 Bacteria 2757
30 Ga0070683_100003103 3300005329 Bacteria 13382
31 Ga0070683_100150832 3300005329 Unclassified 2204
32 Ga0070683_100183263 3300005329 Bacteria 1987
33 Ga0070683_100202216 3300005329 Bacteria 1886
34 Ga0070683_100548241 3300005329 Bacteria 1106
35 Ga0070690_100001658 3300005330 Bacteria 11711
36 Ga0070690_100010704 3300005330 Bacteria 5346
37 Ga0070690_100019237 3300005330 Bacteria 4140
38 Ga0070670_100005908 3300005331 Bacteria 10347
39 Ga0070670_100036096 3300005331 Bacteria 4255
40 Ga0070670_100077577 3300005331 Bacteria 2854
41 Ga0070677_10002586 3300005333 Bacteria 5795
42 Ga0068869_100003321 3300005334 Bacteria 9826
43 Ga0070666_10010072 3300005335 Bacteria 5900
44 Ga0070666_10197839 3300005335 Bacteria 1413
45 Ga0070666_10270656 3300005335 Bacteria 1206
46 Ga0070680_100004657 3300005336 Bacteria 10314
47 Ga0070680_100004754 3300005336 Bacteria 10222
48 Ga0070680_100005234 3300005336 Bacteria 9816
49 Ga0070680_100047356 3300005336 Bacteria 3500
50 Ga0070680_100052654 3300005336 Bacteria 3322
51 Ga0070682_100002520 3300005337 Bacteria 10107
52 Ga0070682_100004239 3300005337 Bacteria 7959
53 Ga0068868_100009819 3300005338 Bacteria 6907
54 Ga0068868_100015151 3300005338 Bacteria 5696
55 Ga0070660_100001332 3300005339 Bacteria 16783
56 Ga0070660_100061560 3300005339 Bacteria 2914
57 Ga0070660_100148071 3300005339 Bacteria 1887
58 Ga0070660_100294015 3300005339 Bacteria 1330
59 Ga0070689_100010863 3300005340 Bacteria 6508
60 Ga0070689_100058814 3300005340 Bacteria 2986
61 Ga0070689_100068889 3300005340 Bacteria 2760
62 Ga0070691_10002586 3300005341 Bacteria 8070
63 Ga0070691_10096316 3300005341 Unclassified 1465
64 Ga0070687_100001160 3300005343 Bacteria 9117
65 Ga0070687_100008437 3300005343 Bacteria 4365
66 Ga0070687_100052129 3300005343 Unclassified 2122
67 Ga0070661_100002370 3300005344 Bacteria 12928
68 Ga0070692_10000841 3300005345 Bacteria 10313
69 Ga0070668_100006877 3300005347 Bacteria 8430
70 Ga0070669_100213189 3300005353 Bacteria 1524
71 Ga0070675_100036372 3300005354 Bacteria 4007
72 Ga0070671_100005218 3300005355 Bacteria 10352
73 Ga0070671_100244547 3300005355 Bacteria 1523
74 Ga0070674_100006788 3300005356 Bacteria 6705
75 Ga0070674_100069203 3300005356 Bacteria 2489
76 Ga0070673_100000418 3300005364 Bacteria 22446
77 Ga0070673_100013146 3300005364 Bacteria 5715
78 Ga0070673_100258586 3300005364 Unclassified 1520
79 Ga0070673_100307896 3300005364 Bacteria 1396
80 Ga0070688_100000906 3300005365 Bacteria 14793
81 Ga0070688_100005689 3300005365 Bacteria 6585
82 Ga0070688_100126679 3300005365 Bacteria 1717
83 Ga0070659_100003550 3300005366 Bacteria 11108
84 Ga0070659_100037101 3300005366 Bacteria 3799
85 Ga0070667_100007947 3300005367 Bacteria 8797
86 Ga0070667_100038093 3300005367 Bacteria 4031
87 Ga0070709_10011874 3300005434 Bacteria 4863
88 Ga0070709_10091488 3300005434 Bacteria 2008
89 Ga0070714_100003463 3300005435 Bacteria 11765
90 Ga0070714_100046239 3300005435 Bacteria 3691
91 Ga0070714_100078401 3300005435 Bacteria 2871
92 Ga0070714_100128333 3300005435 Bacteria 2264
93 Ga0070713_100000526 3300005436 Bacteria 24268
94 Ga0070713_100024541 3300005436 Bacteria 4698
95 Ga0070713_100090366 3300005436 Bacteria 2632
96 Ga0070713_100268898 3300005436 Bacteria 1560
97 Ga0070710_10002488 3300005437 Bacteria 8729
98 Ga0070710_10008974 3300005437 Bacteria 4884
99 Ga0070710_10067235 3300005437 Bacteria 2056
100 Ga0070710_10074467 3300005437 Bacteria 1965
101 Ga0070710_10124236 3300005437 Bacteria 1566
102 Ga0070701_10000664 3300005438 Bacteria 12083
103 Ga0070701_10001792 3300005438 Bacteria 8107
104 Ga0070701_10011452 3300005438 Bacteria 3966
105 Ga0070711_100135525 3300005439 Bacteria 1840
106 Ga0070711_100173906 3300005439 Bacteria 1643
107 Ga0070711_100266547 3300005439 Bacteria 1350
108 Ga0070711_100320364 3300005439 Bacteria 1238
109 Ga0070705_100001611 3300005440 Bacteria 11832
110 Ga0070705_100003104 3300005440 Bacteria 8170
111 Ga0070705_100027365 3300005440 Bacteria 3113
112 Ga0070700_100002145 3300005441 Bacteria 10006
113 Ga0070700_100019655 3300005441 Bacteria 3902
114 Ga0070700_100177925 3300005441 Bacteria 1478
115 Ga0070694_100002530 3300005444 Bacteria 10796
116 Ga0070694_100014569 3300005444 Bacteria 4922
117 Ga0070708_100033405 3300005445 Bacteria 4469
118 Ga0070663_100002896 3300005455 Bacteria 9759
119 Ga0070663_100043990 3300005455 Unclassified 3145
120 Ga0070663_100092124 3300005455 Unclassified 2247
121 Ga0070663_100094739 3300005455 Bacteria 2218
122 Ga0070663_100224446 3300005455 Bacteria 1476
123 Ga0070678_100001494 3300005456 Bacteria 12493
124 Ga0070678_100005419 3300005456 Bacteria 7367
125 Ga0070678_100365183 3300005456 Unclassified 1245
126 Ga0070662_100018866 3300005457 Bacteria 4673
127 Ga0070662_100024993 3300005457 Bacteria 4121
128 Ga0070681_10008649 3300005458 Bacteria 9982
129 Ga0070681_10008829 3300005458 Bacteria 9898
130 Ga0070681_10058275 3300005458 Bacteria 3842
131 Ga0070681_10124675 3300005458 Bacteria 2508
132 Ga0068867_100003064 3300005459 Bacteria 11775
133 Ga0068867_100021369 3300005459 Bacteria 4618
134 Ga0068867_100026593 3300005459 Bacteria 4156
135 Ga0068867_100058714 3300005459 Bacteria 2851
136 Ga0070685_10006922 3300005466 Bacteria 5788
137 Ga0070685_10012087 3300005466 Bacteria 4527
138 Ga0070685_10016861 3300005466 Bacteria 3899
139 Ga0070707_100237240 3300005468 Unclassified 1775
140 Ga0070699_100316301 3300005518 Bacteria 1402
141 Ga0070699_100474102 3300005518 Bacteria 1136
142 Ga0070679_100018279 3300005530 Bacteria 6799
143 Ga0070679_100174232 3300005530 Bacteria 2124
144 Ga0070679_100227935 3300005530 Unclassified 1823
145 Ga0070684_100001969 3300005535 Bacteria 15093
146 Ga0070684_100017395 3300005535 Bacteria 5900
147 Ga0070684_100043609 3300005535 Bacteria 3874
148 Ga0070684_100044181 3300005535 Bacteria 3852
149 Ga0070697_100044335 3300005536 Bacteria 3602
150 Ga0068853_100004522 3300005539 Bacteria 10792
151 Ga0068853_100030662 3300005539 Bacteria 4543
152 Ga0068853_100041332 3300005539 Bacteria 3937
153 Ga0068853_100081940 3300005539 Bacteria 2825
154 Ga0068853_100217590 3300005539 Unclassified 1743
155 Ga0070672_100006625 3300005543 Bacteria 7801
156 Ga0070672_100075679 3300005543 Bacteria 2688
157 Ga0070686_100002237 3300005544 Bacteria 10673
158 Ga0070686_100003181 3300005544 Bacteria 8988
159 Ga0070695_100000331 3300005545 Bacteria 24300
160 Ga0070695_100002841 3300005545 Bacteria 10066
161 Ga0070695_100024431 3300005545 Bacteria 3722
162 Ga0070695_100029355 3300005545 Unclassified 3416
163 Ga0070696_100000690 3300005546 Bacteria 21595
164 Ga0070696_100003720 3300005546 Bacteria 10178
165 Ga0070693_100001170 3300005547 Bacteria 11794
166 Ga0070693_100008368 3300005547 Bacteria 5096
167 Ga0070693_100040681 3300005547 Bacteria 2611
168 Ga0070693_100120443 3300005547 Unclassified 1627
169 Ga0070693_100165113 3300005547 Bacteria 1413
170 Ga0070665_100027334 3300005548 Bacteria 5747
171 Ga0070665_100136974 3300005548 Bacteria 2451
172 Ga0070665_100256547 3300005548 Bacteria 1749
173 Ga0070665_100501575 3300005548 Bacteria 1225
174 Ga0070704_100013589 3300005549 Bacteria 5058
175 Ga0070704_100184237 3300005549 Bacteria 1673
176 Ga0068855_100010841 3300005563 Bacteria 11004
177 Ga0068855_100011516 3300005563 Bacteria 10688
178 Ga0068855_100013983 3300005563 Bacteria 9676
179 Ga0068855_100041680 3300005563 Bacteria 5440
180 Ga0068855_100146561 3300005563 Bacteria 2687
181 Ga0068855_100149640 3300005563 Bacteria 2654
182 Ga0068855_100360041 3300005563 Bacteria 1601
183 Ga0070664_100086864 3300005564 Bacteria 2702
184 Ga0070664_100121014 3300005564 Bacteria 2292
185 Ga0070664_100134427 3300005564 Bacteria 2174
186 Ga0068857_100002282 3300005577 Bacteria 15594
187 Ga0068857_100006348 3300005577 Bacteria 10122
188 Ga0068857_100218123 3300005577 Bacteria 1742
189 Ga0068854_100011480 3300005578 Bacteria 5770
190 Ga0068854_100130580 3300005578 Unclassified 1918
191 Ga0068856_100002597 3300005614 Bacteria 18595
192 Ga0068856_100047110 3300005614 Bacteria 4246
193 Ga0068856_100102557 3300005614 Bacteria 2855
194 Ga0068856_100277102 3300005614 Bacteria 1694
195 Ga0068856_100331219 3300005614 Bacteria 1540
196 Ga0068856_100469161 3300005614 Bacteria 1279
197 Ga0070702_100077459 3300005615 Bacteria 1982
198 Ga0068852_100006066 3300005616 Bacteria 8706
199 Ga0068852_100008161 3300005616 Bacteria 7690
200 Ga0068852_100065934 3300005616 Bacteria 3160
201 Ga0068852_100271543 3300005616 Bacteria 1632
202 Ga0068859_100000988 3300005617 Bacteria 29125
203 Ga0068859_100005044 3300005617 Bacteria 13403
204 Ga0068859_100029475 3300005617 Bacteria 5506
205 Ga0068859_100065542 3300005617 Bacteria 3666
206 Ga0068864_100003691 3300005618 Bacteria 12643
207 Ga0068866_10000899 3300005718 Bacteria 13114
208 Ga0068866_10033966 3300005718 Bacteria 2480
209 Ga0068861_100243087 3300005719 Bacteria 1532
210 Ga0068861_100393533 3300005719 Bacteria 1228
211 Ga0068870_10000555 3300005840 Bacteria 14125
212 Ga0068863_100185610 3300005841 Bacteria 1997
213 Ga0068863_100443015 3300005841 Bacteria 1274
214 Ga0068858_100013722 3300005842 Bacteria 7647
215 Ga0068858_100015828 3300005842 Bacteria 7089
216 Ga0068858_100054078 3300005842 Bacteria 3713
217 Ga0068858_100093821 3300005842 Bacteria 2794
218 Ga0068860_100038447 3300005843 Bacteria 4577
219 Ga0068860_100039551 3300005843 Bacteria 4511
220 Ga0068860_100047902 3300005843 Bacteria 4073
221 Ga0068860_100099497 3300005843 Bacteria 2773
222 Ga0068862_100002130 3300005844 Bacteria 17832
223 Ga0068862_100003011 3300005844 Bacteria 14700
224 Ga0068862_100042347 3300005844 Bacteria 3879
225 Ga0068862_100191316 3300005844 Bacteria 1841
226 Ga0081455_10000108 3300005937 Bacteria 93068
227 Ga0081455_10000673 3300005937 Bacteria 44258
228 Ga0081455_10001313 3300005937 Bacteria 30820
229 Ga0081455_10032768 3300005937 Bacteria 4678
230 Ga0081455_10050046 3300005937 Bacteria 3596
231 Ga0081538_10026138 3300005981 Bacteria 4092
232 Ga0081538_10029934 3300005981 Bacteria 3707
233 Ga0081540_1000017 3300005983 Bacteria 164991
234 Ga0081540_1000085 3300005983 Bacteria 99716
235 Ga0081540_1000257 3300005983 Bacteria 55989
236 Ga0081540_1001987 3300005983 Bacteria 17059
237 Ga0081540_1010138 3300005983 Bacteria 6413
238 Ga0081540_1036026 3300005983 Bacteria 2645
239 Ga0070717_10000425 3300006028 Bacteria 27019
240 Ga0075365_10002135 3300006038 Bacteria 9492
241 Ga0075365_10036375 3300006038 Bacteria 3190
242 Ga0075365_10057796 3300006038 Bacteria 2581
243 Ga0075365_10065457 3300006038 Bacteria 2436
244 Ga0075363_100020300 3300006048 Bacteria 3331
245 Ga0075364_10095831 3300006051 Unclassified 1973
246 Ga0070715_10003130 3300006163 Bacteria 5200
247 Ga0070715_10063526 3300006163 Bacteria 1628
248 Ga0070715_10073427 3300006163 Bacteria 1534
249 Ga0070716_100012172 3300006173 Bacteria 4354
250 Ga0070716_100076753 3300006173 Bacteria 1981
251 Ga0070712_100111407 3300006175 Bacteria 2043
252 Ga0075367_10032274 3300006178 Bacteria 3012
253 Ga0075367_10088985 3300006178 Bacteria 1877
254 Ga0075367_10128489 3300006178 Bacteria 1565
255 Ga0075369_10006001 3300006186 Bacteria 4573
256 Ga0075366_10047359 3300006195 Bacteria 2548
257 Ga0097621_100036961 3300006237 Bacteria 3909
258 Ga0097621_100212652 3300006237 Bacteria 1682
259 Ga0068871_100018198 3300006358 Bacteria 5335
260 Ga0068871_100034440 3300006358 Bacteria 4018
261 Ga0075428_100013854 3300006844 Bacteria 8979
262 Ga0075428_100027887 3300006844 Bacteria 6248
263 Ga0075428_100092925 3300006844 Bacteria 3289
264 Ga0075428_100571170 3300006844 Bacteria 1208
265 Ga0075430_100000140 3300006846 Bacteria 46272
266 Ga0075430_100034989 3300006846 Bacteria 4264
267 Ga0075431_100001318 3300006847 Bacteria 22699
268 Ga0075431_100080552 3300006847 Bacteria 3362
269 Ga0075431_100155060 3300006847 Bacteria 2356
270 Ga0075431_100178555 3300006847 Bacteria 2179
271 Ga0075431_100269069 3300006847 Bacteria 1728
272 Ga0075431_100333870 3300006847 Bacteria 1526
273 Ga0075433_10000050 3300006852 Bacteria 50089
274 Ga0075433_10005076 3300006852 Bacteria 10322
275 Ga0075433_10421905 3300006852 Bacteria 1176
276 Ga0075434_100000179 3300006871 Bacteria 41085
277 Ga0075434_100062927 3300006871 Bacteria 3693
278 Ga0075434_100117009 3300006871 Bacteria 2679
279 Ga0075434_100145575 3300006871 Bacteria 2390
280 Ga0075434_100459460 3300006871 Bacteria 1294
281 Ga0075429_100009748 3300006880 Bacteria 8325
282 Ga0068865_100040353 3300006881 Bacteria 3171
283 Ga0075436_100120638 3300006914 Bacteria 1834
284 Ga0097620_100000988 3300006931 Bacteria 29125
285 Ga0097620_100005044 3300006931 Bacteria 13403
286 Ga0097620_100029475 3300006931 Bacteria 5506
287 Ga0097620_100065543 3300006931 Bacteria 3666
288 Ga0075435_100014515 3300007076 Bacteria 5891
289 Ga0075435_100137990 3300007076 Unclassified 2044
290 Ga0075435_100278603 3300007076 Bacteria 1427
291 Ga0099794_10005856 3300007265 Bacteria 4957
292 Ga0105240_10046314 3300009093 Bacteria 5511
293 Ga0111539_10000565 3300009094 Bacteria 47399
294 Ga0111539_10003400 3300009094 Bacteria 20958
295 Ga0111539_10042933 3300009094 Bacteria 5425
296 Ga0105245_10006794 3300009098 Bacteria 10033
297 Ga0105247_10123992 3300009101 Bacteria 1677
298 Ga0105247_10158718 3300009101 Bacteria 1496
299 Ga0114129_10007851 3300009147 Bacteria 15181
300 Ga0114129_10008234 3300009147 Bacteria 14864
301 Ga0114129_10015156 3300009147 Bacteria 10973
302 Ga0114129_10109135 3300009147 Unclassified 3820
303 Ga0114129_10180245 3300009147 Bacteria 2875
304 Ga0114129_10372363 3300009147 Bacteria 1887
305 Ga0105243_10007504 3300009148 Bacteria 8380
306 Ga0105243_10029989 3300009148 Bacteria 4186
307 Ga0105243_10041228 3300009148 Bacteria 3610
308 Ga0105241_10002961 3300009174 Bacteria 12676
309 Ga0105241_10040953 3300009174 Bacteria 3498
310 Ga0105242_10004894 3300009176 Bacteria 10369
311 Ga0105242_10045591 3300009176 Bacteria 3553
312 Ga0105248_10005301 3300009177 Bacteria 14193
313 Ga0105248_10005481 3300009177 Bacteria 13935
314 Ga0105248_10018400 3300009177 Bacteria 7720
315 Ga0105237_10059796 3300009545 Bacteria 3812
316 Ga0105237_10074472 3300009545 Bacteria 3387
317 Ga0105238_10036945 3300009551 Bacteria 4966
318 Ga0105238_10052948 3300009551 Bacteria 4079
319 Ga0105238_10078842 3300009551 Bacteria 3284
320 Ga0105238_10265733 3300009551 Bacteria 1696
321 Ga0105249_10000531 3300009553 Bacteria 35092
322 Ga0105249_10095713 3300009553 Bacteria 2784
323 Ga0105249_10169954 3300009553 Unclassified 2113
324 Ga0105249_10318044 3300009553 Bacteria 1567
325 Ga0105249_10667114 3300009553 Bacteria 1098
326 Ga0105239_10124604 3300010375 Bacteria 2863
327 Ga0105239_10482075 3300010375 Bacteria 1409
328 Ga0105239_10570133 3300010375 Bacteria 1290
329 Ga0105246_10006621 3300011119 Bacteria 7082
330 Ga0105246_10029891 3300011119 Bacteria 3593
331 Ga0105246_10066351 3300011119 Bacteria 2526
332 Ga0157343_1001347 3300012488 Bacteria 1184
333 Ga0157342_1000839 3300012507 Unclassified 2075
334 Ga0157315_1001031 3300012508 Bacteria 1453
335 Ga0157373_10019862 3300013100 Bacteria 4888
336 Ga0157371_10018413 3300013102 Bacteria 5164
337 Ga0157371_10219875 3300013102 Bacteria 1364
338 Ga0157371_10289242 3300013102 Bacteria 1185
339 Ga0157370_10180038 3300013104 Bacteria 1964
340 Ga0157369_10382926 3300013105 Bacteria 1460
341 Ga0157374_10005394 3300013296 Bacteria 10745
342 Ga0157374_10018860 3300013296 Bacteria 6098
343 Ga0157374_10226477 3300013296 Bacteria 1836
344 Ga0157378_10045505 3300013297 Bacteria 3900
345 Ga0157378_10409725 3300013297 Bacteria 1338
346 Ga0163162_10011299 3300013306 Bacteria 8707
347 Ga0163162_10143035 3300013306 Bacteria 2506
348 Ga0163162_10216647 3300013306 Bacteria 2044
349 Ga0163162_10241792 3300013306 Bacteria 1936
350 Ga0157372_10005559 3300013307 Bacteria 13400
351 Ga0157372_10108815 3300013307 Bacteria 3173
352 Ga0157372_10285147 3300013307 Bacteria 1920
353 Ga0157375_10004143 3300013308 Bacteria 12581
354 Ga0157375_10020331 3300013308 Bacteria 6062
355 Ga0163163_10004364 3300014325 Bacteria 12051
356 Ga0163163_10049663 3300014325 Bacteria 4129
357 Ga0163163_10129414 3300014325 Bacteria 2564
358 Ga0163163_10161390 3300014325 Bacteria 2287
359 Ga0157380_10004080 3300014326 Bacteria 10082
360 Ga0157380_10060111 3300014326 Bacteria 3035
361 Ga0182008_10109857 3300014497 Bacteria 1366
362 Ga0157377_10002281 3300014745 Bacteria 8431
363 Ga0157377_10083267 3300014745 Bacteria 1874
364 Ga0157377_10147068 3300014745 Bacteria 1453
365 Ga0157379_10003623 3300014968 Bacteria 13109
366 Ga0157379_10029224 3300014968 Bacteria 4902
367 Ga0157376_10008998 3300014969 Bacteria 7232
368 Ga0163161_10088615 3300017792 Bacteria 2287
369 Ga0209758_1000308 3300025297 Bacteria 94851
370 Ga0207653_10000791 3300025885 Bacteria 10670
371 Ga0207692_10006112 3300025898 Bacteria 4872
372 Ga0207692_10069886 3300025898 Bacteria 1846
373 Ga0207710_10002302 3300025900 Bacteria 8939
374 Ga0207688_10006874 3300025901 Bacteria 6189
375 Ga0207680_10004647 3300025903 Bacteria 6521
376 Ga0207647_10042579 3300025904 Bacteria 2848
377 Ga0207685_10000850 3300025905 Bacteria 5728
378 Ga0207685_10016122 3300025905 Bacteria 2384
379 Ga0207699_10090195 3300025906 Bacteria 1923
380 Ga0207645_10078744 3300025907 Bacteria 2112
381 Ga0207643_10001619 3300025908 Bacteria 12690
382 Ga0207705_10048931 3300025909 Bacteria 3042
383 Ga0207705_10105343 3300025909 Bacteria 2079
384 Ga0207684_10064081 3300025910 Bacteria 3120
385 Ga0207654_10056704 3300025911 Bacteria 2274
386 Ga0207654_10206629 3300025911 Bacteria 1296
387 Ga0207707_10036975 3300025912 Bacteria 4266
388 Ga0207707_10153436 3300025912 Unclassified 2013
389 Ga0207707_10478543 3300025912 Bacteria 1064
390 Ga0207695_10186309 3300025913 Bacteria 1994
391 Ga0207693_10003582 3300025915 Bacteria 13276
392 Ga0207693_10004297 3300025915 Bacteria 12071
393 Ga0207693_10011119 3300025915 Bacteria 7292
394 Ga0207693_10066437 3300025915 Bacteria 2823
395 Ga0207693_10235572 3300025915 Bacteria 1437
396 Ga0207663_10037590 3300025916 Bacteria 2919
397 Ga0207660_10008494 3300025917 Bacteria 6642
398 Ga0207662_10144639 3300025918 Bacteria 1508
399 Ga0207657_10021001 3300025919 Bacteria 6156
400 Ga0207657_10056355 3300025919 Bacteria 3391
401 Ga0207649_10062321 3300025920 Bacteria 2351
402 Ga0207649_10084314 3300025920 Bacteria 2065
403 Ga0207652_10036684 3300025921 Bacteria 4145
404 Ga0207652_10126082 3300025921 Bacteria 2280
405 Ga0207646_10143226 3300025922 Bacteria 2153
406 Ga0207681_10079568 3300025923 Bacteria 2310
407 Ga0207694_10052546 3300025924 Bacteria 3159
408 Ga0207694_10069989 3300025924 Bacteria 2741
409 Ga0207687_10008332 3300025927 Bacteria 6784
410 Ga0207687_10211519 3300025927 Bacteria 1522
411 Ga0207700_10000797 3300025928 Bacteria 18209
412 Ga0207700_10021555 3300025928 Bacteria 4402
413 Ga0207700_10039638 3300025928 Bacteria 3431
414 Ga0207700_10166203 3300025928 Bacteria 1836
415 Ga0207664_10003862 3300025929 Bacteria 10070
416 Ga0207664_10080404 3300025929 Bacteria 2649
417 Ga0207664_10108284 3300025929 Bacteria 2307
418 Ga0207664_10139142 3300025929 Bacteria 2051
419 Ga0207664_10219099 3300025929 Bacteria 1650
420 Ga0207644_10014433 3300025931 Bacteria 5283
421 Ga0207644_10068745 3300025931 Bacteria 2585
422 Ga0207690_10054948 3300025932 Bacteria 2680
423 Ga0207706_10142666 3300025933 Unclassified 2107
424 Ga0207706_10155344 3300025933 Bacteria 2012
425 Ga0207686_10064276 3300025934 Bacteria 2336
426 Ga0207709_10183717 3300025935 Bacteria 1479
427 Ga0207670_10048586 3300025936 Bacteria 2833
428 Ga0207669_10266954 3300025937 Bacteria 1283
429 Ga0207704_10164637 3300025938 Bacteria 1582
430 Ga0207665_10002407 3300025939 Bacteria 12653
431 Ga0207665_10034875 3300025939 Bacteria 3339
432 Ga0207665_10056924 3300025939 Bacteria 2640
433 Ga0207691_10000812 3300025940 Bacteria 31085
434 Ga0207711_10003275 3300025941 Bacteria 14083
435 Ga0207689_10032416 3300025942 Bacteria 4347
436 Ga0207667_10007621 3300025949 Bacteria 12970
437 Ga0207667_10054610 3300025949 Bacteria 4201
438 Ga0207667_10110152 3300025949 Bacteria 2840
439 Ga0207667_10369527 3300025949 Bacteria 1462
440 Ga0207712_10015865 3300025961 Bacteria 4867
441 Ga0207712_10066990 3300025961 Bacteria 2568
442 Ga0207712_10275417 3300025961 Bacteria 1371
443 Ga0207640_10231040 3300025981 Bacteria 1423
444 Ga0207640_10285440 3300025981 Bacteria 1299
445 Ga0207658_10011971 3300025986 Bacteria 5916
446 Ga0207658_10172115 3300025986 Bacteria 1785
447 Ga0207703_10031287 3300026035 Bacteria 4206
448 Ga0207678_10008906 3300026067 Bacteria 8834
449 Ga0207678_10014273 3300026067 Bacteria 6985
450 Ga0207678_10082159 3300026067 Bacteria 2757
451 Ga0207708_10002674 3300026075 Bacteria 13095
452 Ga0207702_10062360 3300026078 Bacteria 3183
453 Ga0207702_10156669 3300026078 Bacteria 2077
454 Ga0207702_10284434 3300026078 Bacteria 1564
455 Ga0207641_10050229 3300026088 Bacteria 3528
456 Ga0207648_10024827 3300026089 Bacteria 5346
457 Ga0207648_10094677 3300026089 Bacteria 2612
458 Ga0207676_10008714 3300026095 Bacteria 7213
459 Ga0207676_10053940 3300026095 Unclassified 3148
460 Ga0207674_10010838 3300026116 Bacteria 10277
461 Ga0207674_10365316 3300026116 Bacteria 1395
462 Ga0207675_100003315 3300026118 Bacteria 15757
463 Ga0207675_100106246 3300026118 Unclassified 2647
464 Ga0207675_100300430 3300026118 Bacteria 1563
465 Ga0207683_10157349 3300026121 Bacteria 2053
466 Ga0207698_10004492 3300026142 Bacteria 8513
467 Ga0207698_10040340 3300026142 Bacteria 3468
468 Ga0207698_10296525 3300026142 Bacteria 1503
469 Ga0207428_10000485 3300027907 Bacteria 47761
470 Ga0207428_10171599 3300027907 Bacteria 1642
471 Ga0268266_10010491 3300028379 Bacteria 8097
472 Ga0268265_10001669 3300028380 Bacteria 18128
473 Ga0268264_10002104 3300028381 Bacteria 17759
474 Ga0268264_10055219 3300028381 Bacteria 3318
475 Ga0268264_10101602 3300028381 Bacteria 2500
476 Ga0268264_10274352 3300028381 Bacteria 1577
477 Ga0265337_1000693 3300028556 Bacteria 17780
478 Ga0265338_10104900 3300028800 Bacteria 2292
479 Ga0265330_10026048 3300031235 Bacteria 2649
480 Ga0265320_10043119 3300031240 Bacteria 2232
481 Ga0265325_10000036 3300031241 Bacteria 96858
482 Ga0265325_10000613 3300031241 Bacteria 26022
483 Ga0265325_10000660 3300031241 Bacteria 25191
484 Ga0265325_10002455 3300031241 Bacteria 12516
485 Ga0265340_10023895 3300031247 Bacteria 3110
486 Ga0265339_10006516 3300031249 Bacteria 7652
487 Ga0265331_10042388 3300031250 Bacteria 2208
488 Ga0265316_10078067 3300031344 Bacteria 2542
489 Ga0265316_10083872 3300031344 Bacteria 2441
490 Ga0265313_10001282 3300031595 Bacteria 23786
491 Ga0265313_10021309 3300031595 Bacteria 3548
492 Ga0265313_10040519 3300031595 Unclassified 2302
493 Ga0265342_10004065 3300031712 Bacteria 11667
494 Ga0265342_10009777 3300031712 Bacteria 6713
495 Ga0316583_10000944 3300032133 Bacteria 9350
496 Ga0373958_0000095 3300034819 Bacteria 9272
497 Ga0373959_0001784 3300034820 Bacteria 3433
498 Ga0373938_0000332 3300034957 Bacteria 7475
499 Ga0373926_0006116 3300035083 Bacteria 3988
500 Ga0373926_0077209 3300035083 Bacteria 1229
501 Ga0373928_0000109 3300035084 Bacteria 14956
502 Ga0373929_0000097 3300035085 Bacteria 14514
503 Ga0373934_0070290 3300035086 Bacteria 1400
504 Ga0373940_0001510 3300035088 Bacteria 4236
505 Ga0373944_0091787 3300035089 Bacteria 1016
506 Ga0373949_0000836 3300035090 Bacteria 9822
507 Ga0373951_0000383 3300035091 Bacteria 13184
508 Ga0373951_0019169 3300035091 Bacteria 1558
509 Ga0373952_0004519 3300035092 Unclassified 2525
510 Ga0373952_0009381 3300035092 Bacteria 1872
511 Ga0373923_0014571 3300035111 Bacteria 2956
512 Ga0373932_0000087 3300035112 Bacteria 24305
513 Ga0373932_0044395 3300035112 Bacteria 1296
514 Ga0373936_0009325 3300035113 Bacteria 3698
515 Ga0373936_0017545 3300035113 Bacteria 2757
516 Ga0373936_0017717 3300035113 Unclassified 2744
517 Ga0373936_0024360 3300035113 Bacteria 2362
518 Ga0373939_0002562 3300035114 Bacteria 4274
519 Ga0373939_0004051 3300035114 Bacteria 3451
520 Ga0373941_0000112 3300035115 Bacteria 13841
521 Ga0373941_0021173 3300035115 Bacteria 1831
522 Ga0373945_0009092 3300035116 Bacteria 3247
523 Ga0373945_0010395 3300035116 Bacteria 3063
524 Ga0373953_0002373 3300035117 Bacteria 5683
525 Ga0373953_0007577 3300035117 Bacteria 3643
526 Ga0373954_0005350 3300035118 Bacteria 5545
527 Ga0373954_0009365 3300035118 Bacteria 4308
528 Ga0373956_0064733 3300035119 Bacteria 1660
529 Ga0373957_0011402 3300035120 Bacteria 2967
530 Ga0373960_0000239 3300035121 Bacteria 10237
531 Ga0373960_0003396 3300035121 Bacteria 3605
532 Ga0373943_0002096 3300035170 Bacteria 9058
533 Ga0373943_0006168 3300035170 Bacteria 5380
534 Ga0373943_0026880 3300035170 Bacteria 2699
535 Ga0373943_0057260 3300035170 Bacteria 1936
536 Ga0373946_0000806 3300035171 Bacteria 10701
537 Ga0373946_0005380 3300035171 Bacteria 4614
538 Ga0373946_0007986 3300035171 Bacteria 3887
539 Ga0373946_0008754 3300035171 Bacteria 3715
540 Ga0373946_0044461 3300035171 Bacteria 1834
541 Ga0373946_0067252 3300035171 Bacteria 1538
542 Ga0373946_0117392 3300035171 Unclassified 1211
543 Ga0373955_0004005 3300035172 Bacteria 6504
544 Ga0373955_0172666 3300035172 Bacteria 1280
545 Ga0373942_0000514 3300035207 Bacteria 10887
546 Ga0373942_0024526 3300035207 Bacteria 1547
547 Ga0373961_0000165 3300035241 Bacteria 32291
548 Ga0373961_0005516 3300035241 Bacteria 3040
549 Ga0373962_0000237 3300035242 Bacteria 11646
550 Ga0373924_0015017 3300035410 Bacteria 2935
551 Ga0373924_0029636 3300035410 Bacteria 2188
552 Ga0373931_0002125 3300035691 Bacteria 8726
553 Ga0373931_0059898 3300035691 Unclassified 2048
554 Ga0373931_0074095 3300035691 Bacteria 1864
555 Ga0373935_0002709 3300035692 Bacteria 10194
556 Ga0373935_0003209 3300035692 Bacteria 9436
557 Ga0373935_0011961 3300035692 Bacteria 5214
558 Ga0373935_0024417 3300035692 Bacteria 3721
559 Ga0373935_0042990 3300035692 Bacteria 2842
560 Ga0373935_0100678 3300035692 Bacteria 1904
561 Ga0373927_0002024 3300035695 Bacteria 14930
562 Ga0373927_0002281 3300035695 Bacteria 14045
563 Ga0373927_0018744 3300035695 Bacteria 4540
564 Ga0373927_0025712 3300035695 Bacteria 3848
565 Ga0373927_0071620 3300035695 Bacteria 2243
566 Ga0373927_0096181 3300035695 Bacteria 1925
567 Ga0373927_0153721 3300035695 Unclassified 1506
568 Ga0373933_0002064 3300035724 Bacteria 11545
569 Ga0373933_0009980 3300035724 Bacteria 5199
570 Ga0373933_0031564 3300035724 Bacteria 3073
571 Ga0373947_0000337 3300035725 Bacteria 26475
572 Ga0373947_0008046 3300035725 Bacteria 6082
573 Ga0373947_0008938 3300035725 Bacteria 5758
574 Ga0373947_0026591 3300035725 Bacteria 3384
575 Ga0373937_0001397 3300036401 Bacteria 20152
576 Ga0373937_0010357 3300036401 Bacteria 8141
577 Ga0373937_0044711 3300036401 Bacteria 4045
578 Ga0373937_0056393 3300036401 Bacteria 3608
579 Ga0373937_0075347 3300036401 Bacteria 3115
580 Ga0316582_0186243 3300036647 Bacteria 1413
581 Ga0373925_0001463 3300037068 Bacteria 20381
582 Ga0373925_0010168 3300037068 Bacteria 6832
583 Ga0373925_0115576 3300037068 Bacteria 2077
584 Ga0373925_0153552 3300037068 Unclassified 1809
585 Ga0373925_0161216 3300037068 Bacteria 1766
586 Ga0395898_0048808 3300037466 Unclassified 4149
587 Ga0395898_0132144 3300037466 Bacteria 2390
588 Ga0395901_0121390 3300038443 Bacteria 2746
589 Ga0242420_014311 3300038996 Bacteria 1360
590 Ga0436360_0451215 3300039438 Unclassified 3564
591 Ga0436361_0042376 3300039447 Bacteria 3380
592 Ga0436361_0708897 3300039447 Bacteria 3833
593 Ga0466971_0051866 3300044719 Bacteria 1847
594 Ga0451576_0010805 3300045051 Bacteria 10448
595 Ga0466958_0067913 3300045836 Bacteria 2178
596 Ga0466967_0461687 3300045976 Unclassified 1242
597 Ga0495617_005734 3300046452 Bacteria 4384
598 Ga0495627_060925 3300046453 Bacteria 1117
599 Ga0495592_0020683 3300046454 Bacteria 5007
600 Ga0495592_0181705 3300046454 Bacteria 1432
601 Ga0495592_0229540 3300046454 Bacteria 1236
602 Ga0495603_0001421 3300046455 Bacteria 13936
603 Ga0495603_0007341 3300046455 Bacteria 6628
604 Ga0495603_0142053 3300046455 Bacteria 1396
605 Ga0495590_0074617 3300046457 Bacteria 1193
606 Ga0495629_0001742 3300046459 Bacteria 17062
607 Ga0495641_0014778 3300046461 Bacteria 4209
608 Ga0495641_0018265 3300046461 Bacteria 3622
609 Ga0495641_0070758 3300046461 Bacteria 1566
610 Ga0495651_0003967 3300046462 Bacteria 11315
611 Ga0495651_0005894 3300046462 Bacteria 9347
612 Ga0495651_0184493 3300046462 Unclassified 1474
613 Ga0495653_0002617 3300046463 Bacteria 14317
614 Ga0495653_0008661 3300046463 Bacteria 8340
615 Ga0495580_0009323 3300046472 Bacteria 7724
616 Ga0495580_0189545 3300046472 Bacteria 1418
617 Ga0495582_0005451 3300046473 Bacteria 7094
618 Ga0495582_0070539 3300046473 Bacteria 1933
619 Ga0495639_0001541 3300046475 Bacteria 10280
620 Ga0495639_0002862 3300046475 Bacteria 7508
621 Ga0495639_0011982 3300046475 Bacteria 3739
622 Ga0495639_0025847 3300046475 Unclassified 2591
623 Ga0495639_0063239 3300046475 Bacteria 1699
624 Ga0495662_0001109 3300046476 Bacteria 13249
625 Ga0495662_0015048 3300046476 Bacteria 3758
626 Ga0495662_0024413 3300046476 Bacteria 2917
627 Ga0495664_0000510 3300046477 Bacteria 19398
628 Ga0495584_0005702 3300046491 Bacteria 6574
629 Ga0495584_0093031 3300046491 Bacteria 1521
630 Ga0495585_0003676 3300046492 Bacteria 10256
631 Ga0495585_0017566 3300046492 Bacteria 4133
632 Ga0495585_0063900 3300046492 Bacteria 2019
633 Ga0495594_0017133 3300046499 Bacteria 3824
634 Ga0495596_0044366 3300046500 Bacteria 1750
635 Ga0495607_0009728 3300046501 Bacteria 6490
636 Ga0495608_0006100 3300046511 Bacteria 8550
637 Ga0495608_0059729 3300046511 Bacteria 2511
638 Ga0495608_0183858 3300046511 Bacteria 1322
639 Ga0495618_0020575 3300046514 Bacteria 4062
640 Ga0495618_0033878 3300046514 Bacteria 3202
641 Ga0495628_0105709 3300046516 Bacteria 2169
642 Ga0495628_0107672 3300046516 Unclassified 2146
643 Ga0495628_0131207 3300046516 Bacteria 1916
644 Ga0495628_0215300 3300046516 Bacteria 1444
645 Ga0495630_0015854 3300046517 Bacteria 5506
646 Ga0495630_0094603 3300046517 Unclassified 2258
647 Ga0495630_0110907 3300046517 Bacteria 2078
648 Ga0495631_0025806 3300046518 Bacteria 2703
649 Ga0495632_0141286 3300046519 Bacteria 1117
650 Ga0495637_0018273 3300046520 Bacteria 3254
651 Ga0495637_0065024 3300046520 Bacteria 1486
652 Ga0495644_0029737 3300046523 Bacteria 2063
653 Ga0495663_0019919 3300046525 Bacteria 1923
654 Ga0495666_0035319 3300046526 Bacteria 2437
655 Ga0495666_0050434 3300046526 Bacteria 2000
656 Ga0495652_0015920 3300046529 Bacteria 6730
657 Ga0495652_0051751 3300046529 Bacteria 3505
658 Ga0495665_0002284 3300046531 Bacteria 10356
659 Ga0495665_0019106 3300046531 Bacteria 3683
660 Ga0495665_0070738 3300046531 Bacteria 1838
661 Ga0495640_0002882 3300046533 Bacteria 13859
662 Ga0495640_0101767 3300046533 Bacteria 1885
663 Ga0495640_0109782 3300046533 Bacteria 1803
664 Ga0495640_0136128 3300046533 Bacteria 1586
665 Ga0495586_0019415 3300046535 Bacteria 3618
666 Ga0495587_0001485 3300046536 Bacteria 15621
667 Ga0495587_0010534 3300046536 Bacteria 5881
668 Ga0495587_0010972 3300046536 Bacteria 5747
669 Ga0495598_0000140 3300046537 Bacteria 12324
670 Ga0495598_0002282 3300046537 Bacteria 3950
671 Ga0495598_0006516 3300046537 Bacteria 2640
672 Ga0495621_0029892 3300046539 Bacteria 1860
673 Ga0495645_0002547 3300046543 Bacteria 12366
674 Ga0495645_0003754 3300046543 Bacteria 10316
675 Ga0495645_0041228 3300046543 Bacteria 3366
676 Ga0495622_0036486 3300046557 Unclassified 2292
677 Ga0495633_0013142 3300046558 Bacteria 4376
678 Ga0495667_0007578 3300046559 Bacteria 7365
679 Ga0495667_0020590 3300046559 Bacteria 4450
680 Ga0495667_0055252 3300046559 Bacteria 2611
681 Ga0495656_0001097 3300046615 Bacteria 8777
682 Ga0495634_0020779 3300046642 Bacteria 4650
683 Ga0495634_0043898 3300046642 Unclassified 3028
684 Ga0495634_0108124 3300046642 Unclassified 1790
685 Ga0495634_0121683 3300046642 Bacteria 1670
686 Ga0495635_0000662 3300046663 Bacteria 22123
687 Ga0495635_0003035 3300046663 Bacteria 11532
688 Ga0495635_0007370 3300046663 Bacteria 7676
689 Ga0495635_0010431 3300046663 Bacteria 6499
690 Ga0495635_0060262 3300046663 Bacteria 2609
691 Ga0495659_0001233 3300046664 Bacteria 8851
692 Ga0495659_0017682 3300046664 Bacteria 2367
693 Ga0495659_0051289 3300046664 Bacteria 1502
694 Ga0495661_0033872 3300046665 Bacteria 3219
695 Ga0495657_0006498 3300046675 Bacteria 9139
696 Ga0495657_0023801 3300046675 Bacteria 4372
697 Ga0495657_0212620 3300046675 Bacteria 1175
698 Ga0495599_0023928 3300046678 Bacteria 3819
699 Ga0495623_0014481 3300046679 Bacteria 5104
700 Ga0495646_0024804 3300046680 Bacteria 3775
701 Ga0495646_0039442 3300046680 Bacteria 2911
702 Ga0495647_0007367 3300046681 Bacteria 3682
703 Ga0495647_0009683 3300046681 Bacteria 3268
704 Ga0495647_0059643 3300046681 Bacteria 1503
705 Ga0495658_0000231 3300046683 Bacteria 31949
706 Ga0495658_0003159 3300046683 Bacteria 8212
707 Ga0495658_0003902 3300046683 Bacteria 7376
708 Ga0495658_0107501 3300046683 Bacteria 1673
709 Ga0495669_0087449 3300046684 Bacteria 1436
710 Ga0495669_0097515 3300046684 Bacteria 1363
711 Ga0495613_0012961 3300046689 Bacteria 6194
712 Ga0495613_0036851 3300046689 Bacteria 3626
713 Ga0495613_0102260 3300046689 Bacteria 2069
714 Ga0495613_0102776 3300046689 Unclassified 2063
715 Ga0495613_0105302 3300046689 Bacteria 2036
716 Ga0495624_0004671 3300046690 Bacteria 9974
717 Ga0495624_0005449 3300046690 Bacteria 9169
718 Ga0495624_0010346 3300046690 Bacteria 6425
719 Ga0495624_0029199 3300046690 Bacteria 3599
720 Ga0495670_0020527 3300046691 Bacteria 3258
721 Ga0495649_0044597 3300046694 Bacteria 2421
722 Ga0495600_0002443 3300046809 Bacteria 10655
723 Ga0495600_0023851 3300046809 Bacteria 3936
724 Ga0495581_0010107 3300047315 Bacteria 5461
725 Ga0495581_0037680 3300047315 Bacteria 2799
726 Ga0495581_0074410 3300047315 Bacteria 1965
727 Ga0495604_0002660 3300047317 Bacteria 14340
728 Ga0495604_0004875 3300047317 Bacteria 10629
729 Ga0495604_0035531 3300047317 Bacteria 3936
730 Ga0495604_0295873 3300047317 Bacteria 1089
731 Ga0495674_0000138 3300047319 Bacteria 55916
732 Ga0495674_0012742 3300047319 Bacteria 7921
733 Ga0495674_0057468 3300047319 Bacteria 3404
734 Ga0495674_0078906 3300047319 Bacteria 2828
735 Ga0495674_0104861 3300047319 Bacteria 2403
736 Ga0495674_0159197 3300047319 Bacteria 1890
737 Ga0495674_0182666 3300047319 Bacteria 1746
738 Ga0495676_0005696 3300047321 Bacteria 11422
739 Ga0495676_0048159 3300047321 Bacteria 3439
740 Ga0495676_0058061 3300047321 Bacteria 3047
741 Ga0495680_0007757 3300047322 Bacteria 9802
742 Ga0495680_0018968 3300047322 Bacteria 5825
743 Ga0495680_0026697 3300047322 Bacteria 4755
744 Ga0495680_0098297 3300047322 Bacteria 2184
745 Ga0495675_0000984 3300047444 Bacteria 17289
746 Ga0495679_010187 3300047446 Bacteria 3708
747 Ga0495673_0112808 3300047469 Bacteria 1084
748 Ga0495684_0002820 3300047471 Bacteria 13704
749 Ga0495684_0006309 3300047471 Bacteria 9215
750 Ga0495684_0011874 3300047471 Bacteria 6719
751 Ga0495684_0018121 3300047471 Bacteria 5427
752 Ga0495684_0142096 3300047471 Bacteria 1799
753 Ga0495593_0001477 3300047673 Bacteria 13808
754 Ga0495593_0023241 3300047673 Bacteria 3448
755 Ga0495602_0003678 3300048088 Bacteria 15899
756 Ga0495602_0044296 3300048088 Bacteria 4038
757 Ga0495614_0015002 3300048089 Bacteria 3382
758 Ga0495614_0049003 3300048089 Unclassified 1811
759 Ga0496100_0013484 3300048903 Bacteria 4715
760 Ga0496101_0031991 3300048904 Bacteria 3700
761 Ga0496102_0001843 3300048905 Bacteria 18300
762 Ga0496102_0003813 3300048905 Bacteria 12750
763 Ga0496102_0030629 3300048905 Bacteria 4816
764 Ga0496102_0051728 3300048905 Bacteria 3742
765 Ga0496102_0077144 3300048905 Bacteria 3066
766 Ga0496103_0058098 3300048906 Bacteria 2403
767 Ga0496103_0080037 3300048906 Bacteria 2054
768 Ga0496104_0026471 3300048907 Bacteria 5356
769 Ga0496104_0056788 3300048907 Bacteria 3703
770 Ga0496104_0087477 3300048907 Bacteria 2976
771 Ga0496104_0097246 3300048907 Bacteria 2817
772 Ga0496104_0163788 3300048907 Bacteria 2132
773 Ga0496104_0331522 3300048907 Unclassified 1435
774 Ga0496105_0000402 3300048908 Bacteria 28437
775 Ga0496105_0028168 3300048908 Bacteria 4594
776 Ga0496105_0041366 3300048908 Bacteria 3798
777 Ga0496105_0076299 3300048908 Bacteria 2768
778 Ga0496105_0087663 3300048908 Bacteria 2571
779 Ga0496105_0103782 3300048908 Bacteria 2348
780 Ga0496106_0000335 3300048909 Bacteria 33078
781 Ga0496106_0002077 3300048909 Bacteria 15005
782 Ga0496106_0025146 3300048909 Bacteria 4429
783 Ga0496106_0037782 3300048909 Bacteria 3612
784 Ga0496106_0065120 3300048909 Bacteria 2774
785 Ga0496106_0109606 3300048909 Bacteria 2148
786 Ga0496106_0320536 3300048909 Bacteria 1244
787 Ga0496107_0007535 3300048910 Bacteria 7510
788 Ga0496107_0017976 3300048910 Bacteria 4975
789 Ga0496107_0046826 3300048910 Bacteria 3112
790 Ga0496107_0053258 3300048910 Bacteria 2919
791 Ga0496107_0118106 3300048910 Bacteria 1953
792 Ga0496108_0009527 3300048911 Bacteria 7871
793 Ga0496108_0018150 3300048911 Bacteria 5757
794 Ga0496109_0001112 3300048912 Bacteria 22310
795 Ga0496109_0089799 3300048912 Bacteria 2841
796 Ga0496110_0001899 3300048913 Bacteria 15448
797 Ga0496110_0047740 3300048913 Bacteria 3751
798 Ga0496111_0001319 3300048914 Bacteria 13938
799 Ga0496111_0006751 3300048914 Bacteria 7475
800 Ga0496111_0029229 3300048914 Bacteria 3913
801 Ga0496112_0030691 3300048915 Bacteria 5205
802 Ga0496112_0034047 3300048915 Bacteria 4956
803 Ga0496112_0043154 3300048915 Bacteria 4414
804 Ga0496113_0000266 3300048916 Bacteria 24721
805 Ga0496113_0133503 3300048916 Bacteria 1949
806 Ga0496113_0175339 3300048916 Bacteria 1699
807 Ga0496114_0051199 3300048917 Bacteria 3438
808 Ga0496114_0078985 3300048917 Bacteria 2777
809 Ga0496114_0178501 3300048917 Bacteria 1853
810 Ga0496114_0192133 3300048917 Bacteria 1786
811 Ga0496115_0016093 3300048918 Bacteria 5688
812 Ga0496115_0051907 3300048918 Bacteria 3288
813 Ga0496115_0061732 3300048918 Bacteria 3022
814 Ga0496115_0196777 3300048918 Bacteria 1665
815 Ga0501031_0007374 3300049568 Bacteria 7169
816 Ga0501032_0019130 3300049569 Bacteria 4791
817 Ga0501033_0007639 3300049570 Bacteria 8404
818 Ga0501036_0007513 3300049572 Bacteria 8893
819 Ga0501036_0126425 3300049572 Bacteria 2159
820 Ga0501037_0003786 3300049573 Bacteria 10976
821 Ga0501037_0026174 3300049573 Bacteria 4311
822 Ga0501038_0005967 3300049574 Bacteria 11266
823 Ga0501039_0065878 3300049575 Unclassified 2811
824 Ga0501046_0029673 3300049580 Bacteria 4445
825 Ga0501047_0008734 3300049581 Bacteria 9561
826 Ga0501068_0002319 3300049584 Bacteria 10147
827 Ga0501069_0075657 3300049585 Bacteria 1891
828 Ga0501070_0008236 3300049586 Bacteria 8813
829 Ga0501070_0076661 3300049586 Bacteria 2767
830 Ga0501073_0165159 3300049589 Unclassified 1533
831 Ga0501076_0270714 3300049592 Bacteria 1391
832 Ga0501079_0049670 3300049741 Bacteria 3238
833 Ga0501080_0028428 3300049742 Bacteria 5201
834 Ga0501080_0319550 3300049742 Bacteria 1406
835 Ga0501083_0040133 3300049744 Bacteria 3178
836 Ga0501083_0266583 3300049744 Bacteria 1114
837 Ga0501035_0033181 3300049822 Bacteria 4695
838 Ga0501044_0028392 3300049823 Bacteria 5906
839 Ga0501045_0239490 3300049824 Bacteria 1351
840 nmdc:mga03n38_93649_c1 3300050490 Bacteria 1435
841 nmdc:mga0yw44_20458_c1 3300050492 Bacteria 3672
842 nmdc:mga0yw44_22137_c1 3300050492 Bacteria 3558
843 nmdc:mga0yw44_26051_c1 3300050492 Bacteria 3335
844 nmdc:mga0k408_6575_c1 3300050493 Bacteria 6194
845 nmdc:mga0k408_67153_c1 3300050493 Bacteria 2090
846 nmdc:mga05p37_219_c1 3300050507 Bacteria 57577
847 nmdc:mga05p37_2721_c1 3300050507 Bacteria 20539
848 nmdc:mga05p37_47936_c1 3300050507 Bacteria 5254
849 nmdc:mga05p37_55107_c1 3300050507 Bacteria 4892
850 nmdc:mga05p37_7502_c1 3300050507 Bacteria 12858
851 nmdc:mga09592_2153_c1 3300050508 Bacteria 15903
852 nmdc:mga09592_347708_c1 3300050508 Bacteria 1283
853 nmdc:mga09592_371445_c1 3300050508 Bacteria 1237
854 nmdc:mga0qj67_1123_c1 3300050509 Bacteria 18547
855 nmdc:mga0qj67_264186_c1 3300050509 Bacteria 1396
856 nmdc:mga0qj67_57343_c1 3300050509 Bacteria 3087
857 nmdc:mga06r32_2657_c1 3300050510 Bacteria 15975
858 nmdc:mga06r32_274_c1 3300050510 Bacteria 42858
859 nmdc:mga06r32_312597_c1 3300050510 Bacteria 1557
860 nmdc:mga08y16_161224_c1 3300050511 Bacteria 2330
861 nmdc:mga08y16_25664_c1 3300050511 Bacteria 6218
862 nmdc:mga08y16_389045_c1 3300050511 Bacteria 1429
863 nmdc:mga08y16_7375_c1 3300050511 Bacteria 11526
864 nmdc:mga0n895_124_c1 3300050512 Bacteria 45833
865 nmdc:mga0n895_126689_c1 3300050512 Bacteria 2577
866 nmdc:mga0n895_44058_c1 3300050512 Bacteria 4352
867 nmdc:mga0n895_7901_c1 3300050512 Bacteria 9171
868 nmdc:mga0rr50_1076_c1 3300050513 Bacteria 14869
869 nmdc:mga0rr50_120094_c1 3300050513 Bacteria 2091
870 nmdc:mga0rr50_148456_c1 3300050513 Unclassified 1892
871 nmdc:mga08x19_10905_c1 3300050514 Bacteria 5465
872 nmdc:mga08x19_65523_c1 3300050514 Bacteria 2359
873 nmdc:mga0a205_207680_c1 3300050515 Bacteria 1847
874 nmdc:mga0a205_95251_c1 3300050515 Bacteria 2875
875 nmdc:mga0a205_97_c1 3300050515 Bacteria 49530
876 Ga0495601_0001064 3300053077 Bacteria 15049
877 Ga0495601_0007427 3300053077 Bacteria 6425
878 Ga0495601_0009051 3300053077 Bacteria 5880
879 Ga0495601_0011407 3300053077 Bacteria 5313
880 Ga0495601_0034393 3300053077 Bacteria 3161
881 Ga0495601_0068849 3300053077 Bacteria 2256
882 Ga0495601_0087547 3300053077 Bacteria 2002
883 Ga0495601_0172624 3300053077 Bacteria 1413
884 Ga0495612_0002279 3300053078 Bacteria 7893
885 Ga0495612_0065721 3300053078 Bacteria 1507
886 Ga0495612_0080670 3300053078 Unclassified 1367
887 Ga0495595_0002059 3300053084 Bacteria 7824
888 Ga0495595_0028977 3300053084 Bacteria 2474
889 Ga0495619_0000145 3300053085 Bacteria 52248
890 Ga0495619_0001114 3300053085 Bacteria 17646
891 Ga0495619_0001312 3300053085 Bacteria 16329
892 Ga0495619_0007717 3300053085 Bacteria 6810
893 Ga0495619_0008464 3300053085 Bacteria 6505
894 Ga0495619_0011423 3300053085 Bacteria 5593
895 Ga0495619_0018253 3300053085 Bacteria 4450
896 Ga0495619_0100373 3300053085 Unclassified 1969
897 Ga0500651_0000483 3300053093 Bacteria 20822
898 Ga0500562_013205 3300053108 Bacteria 2107
899 Ga0500652_044825 3300053131 Bacteria 1791
900 Ga0500616_0000006 3300053153 Bacteria 944738
901 Ga0530510_0029224 3300061734 Bacteria 3955
902 Ga0436360_0633995
903 2214884102
904 ARcpr5oldR_c000321
905 ARcpr5oldR_c003388
906 ARSoilYngRDRAFT_c00231
907 ARcpr5yngRDRAFT_c000416
908 ARSoilOldRDRAFT_c000416
909 ARSoilOldRDRAFT_c001840
910 ARCol0oldRDRAFT_c00633
911 ARCol0yngRDRAFT_1000060
912 JGI24739J22299_10006512
913 JGI24737J22298_10002394
914 JGI24750J21931_1000574
915 JGI24748J21848_1001596
916 JGI24749J21850_1000589
917 JGI24035J26624_1000525
918 JGI24033J26618_1002159
919 JGI25153J46596_10018707
920 JGI25405J52794_10007742
921 Ga0065717_1002190
922 Ga0065704_10084523
923 Ga0065712_10001151
924 Ga0065712_10095860
925 Ga0065715_10097198
926 Ga0070658_10022977
927 Ga0070658_10054799
928 Ga0070676_10003946
929 Ga0070676_10021880
930 Ga0070676_10038660
931 Ga0070683_100003103
932 Ga0070683_100150832
933 Ga0070683_100183263
934 Ga0070683_100202216
935 Ga0070683_100548241
936 Ga0070690_100001658
937 Ga0070690_100010704
938 Ga0070690_100019237
939 Ga0070670_100005908
940 Ga0070670_100036096
941 Ga0070670_100077577
942 Ga0070677_10002586
943 Ga0068869_100003321
944 Ga0070666_10010072
945 Ga0070666_10197839
946 Ga0070666_10270656
947 Ga0070680_100004657
948 Ga0070680_100004754
949 Ga0070680_100005234
950 Ga0070680_100047356
951 Ga0070680_100052654
952 Ga0070682_100002520
953 Ga0070682_100004239
954 Ga0068868_100009819
955 Ga0068868_100015151
956 Ga0070660_100001332
957 Ga0070660_100061560
958 Ga0070660_100148071
959 Ga0070660_100294015
960 Ga0070689_100010863
961 Ga0070689_100058814
962 Ga0070689_100068889
963 Ga0070691_10002586
964 Ga0070691_10096316
965 Ga0070687_100001160
966 Ga0070687_100008437
967 Ga0070687_100052129
968 Ga0070661_100002370
969 Ga0070692_10000841
970 Ga0070668_100006877
971 Ga0070669_100213189
972 Ga0070675_100036372
973 Ga0070671_100005218
974 Ga0070671_100244547
975 Ga0070674_100006788
976 Ga0070674_100069203
977 Ga0070673_100000418
978 Ga0070673_100013146
979 Ga0070673_100258586
980 Ga0070673_100307896
981 Ga0070688_100000906
982 Ga0070688_100005689
983 Ga0070688_100126679
984 Ga0070659_100003550
985 Ga0070659_100037101
986 Ga0070667_100007947
987 Ga0070667_100038093
988 Ga0070709_10011874
989 Ga0070709_10091488
990 Ga0070714_100003463
991 Ga0070714_100046239
992 Ga0070714_100078401
993 Ga0070714_100128333
994 Ga0070713_100000526
995 Ga0070713_100024541
996 Ga0070713_100090366
997 Ga0070713_100268898
998 Ga0070710_10002488
999 Ga0070710_10008974
1000 Ga0070710_10067235
1001 Ga0070710_10074467
1002 Ga0070710_10124236
1003 Ga0070701_10000664
1004 Ga0070701_10001792
1005 Ga0070701_10011452
1006 Ga0070711_100135525
1007 Ga0070711_100173906
1008 Ga0070711_100266547
1009 Ga0070711_100320364
1010 Ga0070705_100001611
1011 Ga0070705_100003104
1012 Ga0070705_100027365
1013 Ga0070700_100002145
1014 Ga0070700_100019655
1015 Ga0070700_100177925
1016 Ga0070694_100002530
1017 Ga0070694_100014569
1018 Ga0070708_100033405
1019 Ga0070663_100002896
1020 Ga0070663_100043990
1021 Ga0070663_100092124
1022 Ga0070663_100094739
1023 Ga0070663_100224446
1024 Ga0070678_100001494
1025 Ga0070678_100005419
1026 Ga0070678_100365183
1027 Ga0070662_100018866
1028 Ga0070662_100024993
1029 Ga0070681_10008649
1030 Ga0070681_10008829
1031 Ga0070681_10058275
1032 Ga0070681_10124675
1033 Ga0068867_100003064
1034 Ga0068867_100021369
1035 Ga0068867_100026593
1036 Ga0068867_100058714
1037 Ga0070685_10006922
1038 Ga0070685_10012087
1039 Ga0070685_10016861
1040 Ga0070707_100237240
1041 Ga0070699_100316301
1042 Ga0070699_100474102
1043 Ga0070679_100018279
1044 Ga0070679_100174232
1045 Ga0070679_100227935
1046 Ga0070684_100001969
1047 Ga0070684_100017395
1048 Ga0070684_100043609
1049 Ga0070684_100044181
1050 Ga0070697_100044335
1051 Ga0068853_100004522
1052 Ga0068853_100030662
1053 Ga0068853_100041332
1054 Ga0068853_100081940
1055 Ga0068853_100217590
1056 Ga0070672_100006625
1057 Ga0070672_100075679
1058 Ga0070686_100002237
1059 Ga0070686_100003181
1060 Ga0070695_100000331
1061 Ga0070695_100002841
1062 Ga0070695_100024431
1063 Ga0070695_100029355
1064 Ga0070696_100000690
1065 Ga0070696_100003720
1066 Ga0070693_100001170
1067 Ga0070693_100008368
1068 Ga0070693_100040681
1069 Ga0070693_100120443
1070 Ga0070693_100165113
1071 Ga0070665_100027334
1072 Ga0070665_100136974
1073 Ga0070665_100256547
1074 Ga0070665_100501575
1075 Ga0070704_100013589
1076 Ga0070704_100184237
1077 Ga0068855_100010841
1078 Ga0068855_100011516
1079 Ga0068855_100013983
1080 Ga0068855_100041680
1081 Ga0068855_100146561
1082 Ga0068855_100149640
1083 Ga0068855_100360041
1084 Ga0070664_100086864
1085 Ga0070664_100121014
1086 Ga0070664_100134427
1087 Ga0068857_100002282
1088 Ga0068857_100006348
1089 Ga0068857_100218123
1090 Ga0068854_100011480
1091 Ga0068854_100130580
1092 Ga0068856_100002597
1093 Ga0068856_100047110
1094 Ga0068856_100102557
1095 Ga0068856_100277102
1096 Ga0068856_100331219
1097 Ga0068856_100469161
1098 Ga0070702_100077459
1099 Ga0068852_100006066
1100 Ga0068852_100008161
1101 Ga0068852_100065934
1102 Ga0068852_100271543
1103 Ga0068859_100000988
1104 Ga0068859_100005044
1105 Ga0068859_100029475
1106 Ga0068859_100065542
1107 Ga0068864_100003691
1108 Ga0068866_10000899
1109 Ga0068866_10033966
1110 Ga0068861_100243087
1111 Ga0068861_100393533
1112 Ga0068870_10000555
1113 Ga0068863_100185610
1114 Ga0068863_100443015
1115 Ga0068858_100013722
1116 Ga0068858_100015828
1117 Ga0068858_100054078
1118 Ga0068858_100093821
1119 Ga0068860_100038447
1120 Ga0068860_100039551
1121 Ga0068860_100047902
1122 Ga0068860_100099497
1123 Ga0068862_100002130
1124 Ga0068862_100003011
1125 Ga0068862_100042347
1126 Ga0068862_100191316
1127 Ga0081455_10000108
1128 Ga0081455_10000673
1129 Ga0081455_10001313
1130 Ga0081455_10032768
1131 Ga0081455_10050046
1132 Ga0081538_10026138
1133 Ga0081538_10029934
1134 Ga0081540_1000017
1135 Ga0081540_1000085
1136 Ga0081540_1000257
1137 Ga0081540_1001987
1138 Ga0081540_1010138
1139 Ga0081540_1036026
1140 Ga0070717_10000425
1141 Ga0075365_10002135
1142 Ga0075365_10036375
1143 Ga0075365_10057796
1144 Ga0075365_10065457
1145 Ga0075363_100020300
1146 Ga0075364_10095831
1147 Ga0070715_10003130
1148 Ga0070715_10063526
1149 Ga0070715_10073427
1150 Ga0070716_100012172
1151 Ga0070716_100076753
1152 Ga0070712_100111407
1153 Ga0075367_10032274
1154 Ga0075367_10088985
1155 Ga0075367_10128489
1156 Ga0075369_10006001
1157 Ga0075366_10047359
1158 Ga0097621_100036961
1159 Ga0097621_100212652
1160 Ga0068871_100018198
1161 Ga0068871_100034440
1162 Ga0075428_100013854
1163 Ga0075428_100027887
1164 Ga0075428_100092925
1165 Ga0075428_100571170
1166 Ga0075430_100000140
1167 Ga0075430_100034989
1168 Ga0075431_100001318
1169 Ga0075431_100080552
1170 Ga0075431_100155060
1171 Ga0075431_100178555
1172 Ga0075431_100269069
1173 Ga0075431_100333870
1174 Ga0075433_10000050
1175 Ga0075433_10005076
1176 Ga0075433_10421905
1177 Ga0075434_100000179
1178 Ga0075434_100062927
1179 Ga0075434_100117009
1180 Ga0075434_100145575
1181 Ga0075434_100459460
1182 Ga0075429_100009748
1183 Ga0068865_100040353
1184 Ga0075436_100120638
1185 Ga0097620_100000988
1186 Ga0097620_100005044
1187 Ga0097620_100029475
1188 Ga0097620_100065543
1189 Ga0075435_100014515
1190 Ga0075435_100137990
1191 Ga0075435_100278603
1192 Ga0099794_10005856
1193 Ga0105240_10046314
1194 Ga0111539_10000565
1195 Ga0111539_10003400
1196 Ga0111539_10042933
1197 Ga0105245_10006794
1198 Ga0105247_10123992
1199 Ga0105247_10158718
1200 Ga0114129_10007851
1201 Ga0114129_10008234
1202 Ga0114129_10015156
1203 Ga0114129_10109135
1204 Ga0114129_10180245
1205 Ga0114129_10372363
1206 Ga0105243_10007504
1207 Ga0105243_10029989
1208 Ga0105243_10041228
1209 Ga0105241_10002961
1210 Ga0105241_10040953
1211 Ga0105242_10004894
1212 Ga0105242_10045591
1213 Ga0105248_10005301
1214 Ga0105248_10005481
1215 Ga0105248_10018400
1216 Ga0105237_10059796
1217 Ga0105237_10074472
1218 Ga0105238_10036945
1219 Ga0105238_10052948
1220 Ga0105238_10078842
1221 Ga0105238_10265733
1222 Ga0105249_10000531
1223 Ga0105249_10095713
1224 Ga0105249_10169954
1225 Ga0105249_10318044
1226 Ga0105249_10667114
1227 Ga0105239_10124604
1228 Ga0105239_10482075
1229 Ga0105239_10570133
1230 Ga0105246_10006621
1231 Ga0105246_10029891
1232 Ga0105246_10066351
1233 Ga0157343_1001347
1234 Ga0157342_1000839
1235 Ga0157315_1001031
1236 Ga0157373_10019862
1237 Ga0157371_10018413
1238 Ga0157371_10219875
1239 Ga0157371_10289242
1240 Ga0157370_10180038
1241 Ga0157369_10382926
1242 Ga0157374_10005394
1243 Ga0157374_10018860
1244 Ga0157374_10226477
1245 Ga0157378_10045505
1246 Ga0157378_10409725
1247 Ga0163162_10011299
1248 Ga0163162_10143035
1249 Ga0163162_10216647
1250 Ga0163162_10241792
1251 Ga0157372_10005559
1252 Ga0157372_10108815
1253 Ga0157372_10285147
1254 Ga0157375_10004143
1255 Ga0157375_10020331
1256 Ga0163163_10004364
1257 Ga0163163_10049663
1258 Ga0163163_10129414
1259 Ga0163163_10161390
1260 Ga0157380_10004080
1261 Ga0157380_10060111
1262 Ga0182008_10109857
1263 Ga0157377_10002281
1264 Ga0157377_10083267
1265 Ga0157377_10147068
1266 Ga0157379_10003623
1267 Ga0157379_10029224
1268 Ga0157376_10008998
1269 Ga0163161_10088615
1270 Ga0209758_1000308
1271 Ga0207653_10000791
1272 Ga0207692_10006112
1273 Ga0207692_10069886
1274 Ga0207710_10002302
1275 Ga0207688_10006874
1276 Ga0207680_10004647
1277 Ga0207647_10042579
1278 Ga0207685_10000850
1279 Ga0207685_10016122
1280 Ga0207699_10090195
1281 Ga0207645_10078744
1282 Ga0207643_10001619
1283 Ga0207705_10048931
1284 Ga0207705_10105343
1285 Ga0207684_10064081
1286 Ga0207654_10056704
1287 Ga0207654_10206629
1288 Ga0207707_10036975
1289 Ga0207707_10153436
1290 Ga0207707_10478543
1291 Ga0207695_10186309
1292 Ga0207693_10003582
1293 Ga0207693_10004297
1294 Ga0207693_10011119
1295 Ga0207693_10066437
1296 Ga0207693_10235572
1297 Ga0207663_10037590
1298 Ga0207660_10008494
1299 Ga0207662_10144639
1300 Ga0207657_10021001
1301 Ga0207657_10056355
1302 Ga0207649_10062321
1303 Ga0207649_10084314
1304 Ga0207652_10036684
1305 Ga0207652_10126082
1306 Ga0207646_10143226
1307 Ga0207681_10079568
1308 Ga0207694_10052546
1309 Ga0207694_10069989
1310 Ga0207687_10008332
1311 Ga0207687_10211519
1312 Ga0207700_10000797
1313 Ga0207700_10021555
1314 Ga0207700_10039638
1315 Ga0207700_10166203
1316 Ga0207664_10003862
1317 Ga0207664_10080404
1318 Ga0207664_10108284
1319 Ga0207664_10139142
1320 Ga0207664_10219099
1321 Ga0207644_10014433
1322 Ga0207644_10068745
1323 Ga0207690_10054948
1324 Ga0207706_10142666
1325 Ga0207706_10155344
1326 Ga0207686_10064276
1327 Ga0207709_10183717
1328 Ga0207670_10048586
1329 Ga0207669_10266954
1330 Ga0207704_10164637
1331 Ga0207665_10002407
1332 Ga0207665_10034875
1333 Ga0207665_10056924
1334 Ga0207691_10000812
1335 Ga0207711_10003275
1336 Ga0207689_10032416
1337 Ga0207667_10007621
1338 Ga0207667_10054610
1339 Ga0207667_10110152
1340 Ga0207667_10369527
1341 Ga0207712_10015865
1342 Ga0207712_10066990
1343 Ga0207712_10275417
1344 Ga0207640_10231040
1345 Ga0207640_10285440
1346 Ga0207658_10011971
1347 Ga0207658_10172115
1348 Ga0207703_10031287
1349 Ga0207678_10008906
1350 Ga0207678_10014273
1351 Ga0207678_10082159
1352 Ga0207708_10002674
1353 Ga0207702_10062360
1354 Ga0207702_10156669
1355 Ga0207702_10284434
1356 Ga0207641_10050229
1357 Ga0207648_10024827
1358 Ga0207648_10094677
1359 Ga0207676_10008714
1360 Ga0207676_10053940
1361 Ga0207674_10010838
1362 Ga0207674_10365316
1363 Ga0207675_100003315
1364 Ga0207675_100106246
1365 Ga0207675_100300430
1366 Ga0207683_10157349
1367 Ga0207698_10004492
1368 Ga0207698_10040340
1369 Ga0207698_10296525
1370 Ga0207428_10000485
1371 Ga0207428_10171599
1372 Ga0268266_10010491
1373 Ga0268265_10001669
1374 Ga0268264_10002104
1375 Ga0268264_10055219
1376 Ga0268264_10101602
1377 Ga0268264_10274352
1378 Ga0265337_1000693
1379 Ga0265338_10104900
1380 Ga0265330_10026048
1381 Ga0265320_10043119
1382 Ga0265325_10000036
1383 Ga0265325_10000613
1384 Ga0265325_10000660
1385 Ga0265325_10002455
1386 Ga0265340_10023895
1387 Ga0265339_10006516
1388 Ga0265331_10042388
1389 Ga0265316_10078067
1390 Ga0265316_10083872
1391 Ga0265313_10001282
1392 Ga0265313_10021309
1393 Ga0265313_10040519
1394 Ga0265342_10004065
1395 Ga0265342_10009777
1396 Ga0316583_10000944
1397 Ga0373958_0000095
1398 Ga0373959_0001784
1399 Ga0373938_0000332
1400 Ga0373926_0006116
1401 Ga0373926_0077209
1402 Ga0373928_0000109
1403 Ga0373929_0000097
1404 Ga0373934_0070290
1405 Ga0373940_0001510
1406 Ga0373944_0091787
1407 Ga0373949_0000836
1408 Ga0373951_0000383
1409 Ga0373951_0019169
1410 Ga0373952_0004519
1411 Ga0373952_0009381
1412 Ga0373923_0014571
1413 Ga0373932_0000087
1414 Ga0373932_0044395
1415 Ga0373936_0009325
1416 Ga0373936_0017545
1417 Ga0373936_0017717
1418 Ga0373936_0024360
1419 Ga0373939_0002562
1420 Ga0373939_0004051
1421 Ga0373941_0000112
1422 Ga0373941_0021173
1423 Ga0373945_0009092
1424 Ga0373945_0010395
1425 Ga0373953_0002373
1426 Ga0373953_0007577
1427 Ga0373954_0005350
1428 Ga0373954_0009365
1429 Ga0373956_0064733
1430 Ga0373957_0011402
1431 Ga0373960_0000239
1432 Ga0373960_0003396
1433 Ga0373943_0002096
1434 Ga0373943_0006168
1435 Ga0373943_0026880
1436 Ga0373943_0057260
1437 Ga0373946_0000806
1438 Ga0373946_0005380
1439 Ga0373946_0007986
1440 Ga0373946_0008754
1441 Ga0373946_0044461
1442 Ga0373946_0067252
1443 Ga0373946_0117392
1444 Ga0373955_0004005
1445 Ga0373955_0172666
1446 Ga0373942_0000514
1447 Ga0373942_0024526
1448 Ga0373961_0000165
1449 Ga0373961_0005516
1450 Ga0373962_0000237
1451 Ga0373924_0015017
1452 Ga0373924_0029636
1453 Ga0373931_0002125
1454 Ga0373931_0059898
1455 Ga0373931_0074095
1456 Ga0373935_0002709
1457 Ga0373935_0003209
1458 Ga0373935_0011961
1459 Ga0373935_0024417
1460 Ga0373935_0042990
1461 Ga0373935_0100678
1462 Ga0373927_0002024
1463 Ga0373927_0002281
1464 Ga0373927_0018744
1465 Ga0373927_0025712
1466 Ga0373927_0071620
1467 Ga0373927_0096181
1468 Ga0373927_0153721
1469 Ga0373933_0002064
1470 Ga0373933_0009980
1471 Ga0373933_0031564
1472 Ga0373947_0000337
1473 Ga0373947_0008046
1474 Ga0373947_0008938
1475 Ga0373947_0026591
1476 Ga0373937_0001397
1477 Ga0373937_0010357
1478 Ga0373937_0044711
1479 Ga0373937_0056393
1480 Ga0373937_0075347
1481 Ga0316582_0186243
1482 Ga0373925_0001463
1483 Ga0373925_0010168
1484 Ga0373925_0115576
1485 Ga0373925_0153552
1486 Ga0373925_0161216
1487 Ga0395898_0048808
1488 Ga0395898_0132144
1489 Ga0395901_0121390
1490 Ga0242420_014311
1491 Ga0436360_0451215
1492 Ga0436361_0042376
1493 Ga0436361_0708897
1494 Ga0466971_0051866
1495 Ga0451576_0010805
1496 Ga0466958_0067913
1497 Ga0466967_0461687
1498 Ga0495617_005734
1499 Ga0495627_060925
1500 Ga0495592_0020683
1501 Ga0495592_0181705
1502 Ga0495592_0229540
1503 Ga0495603_0001421
1504 Ga0495603_0007341
1505 Ga0495603_0142053
1506 Ga0495590_0074617
1507 Ga0495629_0001742
1508 Ga0495641_0014778
1509 Ga0495641_0018265
1510 Ga0495641_0070758
1511 Ga0495651_0003967
1512 Ga0495651_0005894
1513 Ga0495651_0184493
1514 Ga0495653_0002617
1515 Ga0495653_0008661
1516 Ga0495580_0009323
1517 Ga0495580_0189545
1518 Ga0495582_0005451
1519 Ga0495582_0070539
1520 Ga0495639_0001541
1521 Ga0495639_0002862
1522 Ga0495639_0011982
1523 Ga0495639_0025847
1524 Ga0495639_0063239
1525 Ga0495662_0001109
1526 Ga0495662_0015048
1527 Ga0495662_0024413
1528 Ga0495664_0000510
1529 Ga0495584_0005702
1530 Ga0495584_0093031
1531 Ga0495585_0003676
1532 Ga0495585_0017566
1533 Ga0495585_0063900
1534 Ga0495594_0017133
1535 Ga0495596_0044366
1536 Ga0495607_0009728
1537 Ga0495608_0006100
1538 Ga0495608_0059729
1539 Ga0495608_0183858
1540 Ga0495618_0020575
1541 Ga0495618_0033878
1542 Ga0495628_0105709
1543 Ga0495628_0107672
1544 Ga0495628_0131207
1545 Ga0495628_0215300
1546 Ga0495630_0015854
1547 Ga0495630_0094603
1548 Ga0495630_0110907
1549 Ga0495631_0025806
1550 Ga0495632_0141286
1551 Ga0495637_0018273
1552 Ga0495637_0065024
1553 Ga0495644_0029737
1554 Ga0495663_0019919
1555 Ga0495666_0035319
1556 Ga0495666_0050434
1557 Ga0495652_0015920
1558 Ga0495652_0051751
1559 Ga0495665_0002284
1560 Ga0495665_0019106
1561 Ga0495665_0070738
1562 Ga0495640_0002882
1563 Ga0495640_0101767
1564 Ga0495640_0109782
1565 Ga0495640_0136128
1566 Ga0495586_0019415
1567 Ga0495587_0001485
1568 Ga0495587_0010534
1569 Ga0495587_0010972
1570 Ga0495598_0000140
1571 Ga0495598_0002282
1572 Ga0495598_0006516
1573 Ga0495621_0029892
1574 Ga0495645_0002547
1575 Ga0495645_0003754
1576 Ga0495645_0041228
1577 Ga0495622_0036486
1578 Ga0495633_0013142
1579 Ga0495667_0007578
1580 Ga0495667_0020590
1581 Ga0495667_0055252
1582 Ga0495656_0001097
1583 Ga0495634_0020779
1584 Ga0495634_0043898
1585 Ga0495634_0108124
1586 Ga0495634_0121683
1587 Ga0495635_0000662
1588 Ga0495635_0003035
1589 Ga0495635_0007370
1590 Ga0495635_0010431
1591 Ga0495635_0060262
1592 Ga0495659_0001233
1593 Ga0495659_0017682
1594 Ga0495659_0051289
1595 Ga0495661_0033872
1596 Ga0495657_0006498
1597 Ga0495657_0023801
1598 Ga0495657_0212620
1599 Ga0495599_0023928
1600 Ga0495623_0014481
1601 Ga0495646_0024804
1602 Ga0495646_0039442
1603 Ga0495647_0007367
1604 Ga0495647_0009683
1605 Ga0495647_0059643
1606 Ga0495658_0000231
1607 Ga0495658_0003159
1608 Ga0495658_0003902
1609 Ga0495658_0107501
1610 Ga0495669_0087449
1611 Ga0495669_0097515
1612 Ga0495613_0012961
1613 Ga0495613_0036851
1614 Ga0495613_0102260
1615 Ga0495613_0102776
1616 Ga0495613_0105302
1617 Ga0495624_0004671
1618 Ga0495624_0005449
1619 Ga0495624_0010346
1620 Ga0495624_0029199
1621 Ga0495670_0020527
1622 Ga0495649_0044597
1623 Ga0495600_0002443
1624 Ga0495600_0023851
1625 Ga0495581_0010107
1626 Ga0495581_0037680
1627 Ga0495581_0074410
1628 Ga0495604_0002660
1629 Ga0495604_0004875
1630 Ga0495604_0035531
1631 Ga0495604_0295873
1632 Ga0495674_0000138
1633 Ga0495674_0012742
1634 Ga0495674_0057468
1635 Ga0495674_0078906
1636 Ga0495674_0104861
1637 Ga0495674_0159197
1638 Ga0495674_0182666
1639 Ga0495676_0005696
1640 Ga0495676_0048159
1641 Ga0495676_0058061
1642 Ga0495680_0007757
1643 Ga0495680_0018968
1644 Ga0495680_0026697
1645 Ga0495680_0098297
1646 Ga0495675_0000984
1647 Ga0495679_010187
1648 Ga0495673_0112808
1649 Ga0495684_0002820
1650 Ga0495684_0006309
1651 Ga0495684_0011874
1652 Ga0495684_0018121
1653 Ga0495684_0142096
1654 Ga0495593_0001477
1655 Ga0495593_0023241
1656 Ga0495602_0003678
1657 Ga0495602_0044296
1658 Ga0495614_0015002
1659 Ga0495614_0049003
1660 Ga0496100_0013484
1661 Ga0496101_0031991
1662 Ga0496102_0001843
1663 Ga0496102_0003813
1664 Ga0496102_0030629
1665 Ga0496102_0051728
1666 Ga0496102_0077144
1667 Ga0496103_0058098
1668 Ga0496103_0080037
1669 Ga0496104_0026471
1670 Ga0496104_0056788
1671 Ga0496104_0087477
1672 Ga0496104_0097246
1673 Ga0496104_0163788
1674 Ga0496104_0331522
1675 Ga0496105_0000402
1676 Ga0496105_0028168
1677 Ga0496105_0041366
1678 Ga0496105_0076299
1679 Ga0496105_0087663
1680 Ga0496105_0103782
1681 Ga0496106_0000335
1682 Ga0496106_0002077
1683 Ga0496106_0025146
1684 Ga0496106_0037782
1685 Ga0496106_0065120
1686 Ga0496106_0109606
1687 Ga0496106_0320536
1688 Ga0496107_0007535
1689 Ga0496107_0017976
1690 Ga0496107_0046826
1691 Ga0496107_0053258
1692 Ga0496107_0118106
1693 Ga0496108_0009527
1694 Ga0496108_0018150
1695 Ga0496109_0001112
1696 Ga0496109_0089799
1697 Ga0496110_0001899
1698 Ga0496110_0047740
1699 Ga0496111_0001319
1700 Ga0496111_0006751
1701 Ga0496111_0029229
1702 Ga0496112_0030691
1703 Ga0496112_0034047
1704 Ga0496112_0043154
1705 Ga0496113_0000266
1706 Ga0496113_0133503
1707 Ga0496113_0175339
1708 Ga0496114_0051199
1709 Ga0496114_0078985
1710 Ga0496114_0178501
1711 Ga0496114_0192133
1712 Ga0496115_0016093
1713 Ga0496115_0051907
1714 Ga0496115_0061732
1715 Ga0496115_0196777
1716 Ga0501031_0007374
1717 Ga0501032_0019130
1718 Ga0501033_0007639
1719 Ga0501036_0007513
1720 Ga0501036_0126425
1721 Ga0501037_0003786
1722 Ga0501037_0026174
1723 Ga0501038_0005967
1724 Ga0501039_0065878
1725 Ga0501046_0029673
1726 Ga0501047_0008734
1727 Ga0501068_0002319
1728 Ga0501069_0075657
1729 Ga0501070_0008236
1730 Ga0501070_0076661
1731 Ga0501073_0165159
1732 Ga0501076_0270714
1733 Ga0501079_0049670
1734 Ga0501080_0028428
1735 Ga0501080_0319550
1736 Ga0501083_0040133
1737 Ga0501083_0266583
1738 Ga0501035_0033181
1739 Ga0501044_0028392
1740 Ga0501045_0239490
1741 nmdc:mga03n38_93649_c1
1742 nmdc:mga0yw44_20458_c1
1743 nmdc:mga0yw44_22137_c1
1744 nmdc:mga0yw44_26051_c1
1745 nmdc:mga0k408_6575_c1
1746 nmdc:mga0k408_67153_c1
1747 nmdc:mga05p37_219_c1
1748 nmdc:mga05p37_2721_c1
1749 nmdc:mga05p37_47936_c1
1750 nmdc:mga05p37_55107_c1
1751 nmdc:mga05p37_7502_c1
1752 nmdc:mga09592_2153_c1
1753 nmdc:mga09592_347708_c1
1754 nmdc:mga09592_371445_c1
1755 nmdc:mga0qj67_1123_c1
1756 nmdc:mga0qj67_264186_c1
1757 nmdc:mga0qj67_57343_c1
1758 nmdc:mga06r32_2657_c1
1759 nmdc:mga06r32_274_c1
1760 nmdc:mga06r32_312597_c1
1761 nmdc:mga08y16_161224_c1
1762 nmdc:mga08y16_25664_c1
1763 nmdc:mga08y16_389045_c1
1764 nmdc:mga08y16_7375_c1
1765 nmdc:mga0n895_124_c1
1766 nmdc:mga0n895_126689_c1
1767 nmdc:mga0n895_44058_c1
1768 nmdc:mga0n895_7901_c1
1769 nmdc:mga0rr50_1076_c1
1770 nmdc:mga0rr50_120094_c1
1771 nmdc:mga0rr50_148456_c1
1772 nmdc:mga08x19_10905_c1
1773 nmdc:mga08x19_65523_c1
1774 nmdc:mga0a205_207680_c1
1775 nmdc:mga0a205_95251_c1
1776 nmdc:mga0a205_97_c1
1777 Ga0495601_0001064
1778 Ga0495601_0007427
1779 Ga0495601_0009051
1780 Ga0495601_0011407
1781 Ga0495601_0034393
1782 Ga0495601_0068849
1783 Ga0495601_0087547
1784 Ga0495601_0172624
1785 Ga0495612_0002279
1786 Ga0495612_0065721
1787 Ga0495612_0080670
1788 Ga0495595_0002059
1789 Ga0495595_0028977
1790 Ga0495619_0000145
1791 Ga0495619_0001114
1792 Ga0495619_0001312
1793 Ga0495619_0007717
1794 Ga0495619_0008464
1795 Ga0495619_0011423
1796 Ga0495619_0018253
1797 Ga0495619_0100373
1798 Ga0500651_0000483
1799 Ga0500562_013205
1800 Ga0500652_044825
1801 Ga0500616_0000006
1802 Ga0530510_0029224

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

41

285

0.9

PF09084

NMT1

NMT1/THI5 like

136

276

0.89

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

76

208

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8048 26 328
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.7999 26 328
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.7947 29 312
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7926 25 324
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.7883 26 323
ID Description Score Start End Superfamily
4wedA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8585 61 83 3.40.190.10
af_Q2G1L7_145_252_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8518 118 212 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8464 119 216 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8427 117 213 3.40.190.10
3qslB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8294 120 209 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A090MGL9-F1-model_v4 Uncultured bacterium genome assembly Metasoil_fosmids_resub 0.9725 124 334
AF-A0A090MGL9-F1-model_v4 Uncultured bacterium genome assembly Metasoil_fosmids_resub 0.9335 124 334
AF-A0A3Q8Z045-F1-model_v4 deleted 0.9279 1 335
AF-A0A3Q8Z045-F1-model_v4 deleted 0.9252 1 335
AF-A0A1F7TNB6-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.916 4 334

Map