F485168
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 901 | 424 | 899 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300006846|Ga0075430_100001959|Ga0075430_1000019597 |
| Length | 258 |
| Sequence | MKIDISFLPAYAAAFMLVFARIGTMIMLLPGLGEMSVPRRIRLTLALVLSAVLLPLHRTAYEVDISTTFGPILTLMAQEIFIGAVLGLTARLMISALQVAGFVIAQQLGLGFASAVDPTQGGQQGVLISNFLTMLGVTLIFATDLHHLIIAALNDSYRLFKPGEIPLIGDVAALTTQTIALAFKIGIQLSAPFLIFGLLFNLGLGVLSRLMPQMQVFFVGVPLSILIGLLILFLVLGAVMMVFLNSMETVLRQLAPYS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 5 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 6 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 8 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 10 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 11 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 16 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 17 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 18 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 19 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 20 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 21 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 22 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 23 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 24 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 25 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 26 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 124 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 126 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 127 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 143 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 144 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 145 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 160 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 161 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 162 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 247 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 248 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 249 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 254 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 255 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 256 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 257 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 258 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 259 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 261 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 262 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 263 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 265 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 274 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 277 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 280 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 287 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 288 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 296 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 297 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 298 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 299 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 300 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 301 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 302 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 303 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 304 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 305 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 306 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 351 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 352 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 353 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 354 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 355 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 362 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 399 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 400 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 413 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 415 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 417 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 419 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.33 |
| Metatranscriptomes | 0.33 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.66 |
| Nodule | 0.11 |
| Rhizoplane | 4.88 |
| Rhizosphere | 88.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1612269 | 2162886007 | Bacteria | 1530 |
| 2 | 2214856319 | 2209111006 | Bacteria | 7962 |
| 3 | ARcpr5oldR_c000300 | 3300000041 | Bacteria | 7236 |
| 4 | ARSoilYngRDRAFT_c00004 | 3300000042 | Bacteria | 40941 |
| 5 | ARcpr5yngRDRAFT_c000060 | 3300000043 | Bacteria | 17786 |
| 6 | ARSoilOldRDRAFT_c000283 | 3300000044 | Bacteria | 7128 |
| 7 | ARCol0yngRDRAFT_1000084 | 3300000652 | Bacteria | 17450 |
| 8 | JGI24032J14994_100202 | 3300001430 | Bacteria | 3032 |
| 9 | JGI24740J21852_10028821 | 3300001979 | Bacteria | 1830 |
| 10 | JGI24739J22299_10002358 | 3300001989 | Bacteria | 7275 |
| 11 | JGI24739J22299_10044017 | 3300001989 | Bacteria | 1472 |
| 12 | JGI24737J22298_10001122 | 3300001990 | Bacteria | 9408 |
| 13 | JGI24737J22298_10005585 | 3300001990 | Bacteria | 4334 |
| 14 | JGI24743J22301_10001232 | 3300001991 | Bacteria | 3474 |
| 15 | JGI24750J21931_1000032 | 3300002070 | Bacteria | 18759 |
| 16 | JGI24745J21846_1002345 | 3300002073 | Bacteria | 1928 |
| 17 | JGI24748J21848_1002107 | 3300002074 | Bacteria | 2227 |
| 18 | JGI24738J21930_10002299 | 3300002075 | Bacteria | 5042 |
| 19 | JGI24749J21850_1000809 | 3300002076 | Bacteria | 4502 |
| 20 | JGI24035J26624_1000092 | 3300002126 | Bacteria | 7552 |
| 21 | JGI24033J26618_1000309 | 3300002155 | Bacteria | 5203 |
| 22 | JGI24034J26672_10000536 | 3300002239 | Bacteria | 4842 |
| 23 | JGI24742J22300_10000050 | 3300002244 | Bacteria | 17817 |
| 24 | rootH1_10019190 | 3300003316 | Bacteria | 1001 |
| 25 | rootH1_10019190 | 3300003323 | Bacteria | 2761 |
| 26 | Ga0065716_1001561 | 3300005277 | Bacteria | 6561 |
| 27 | Ga0065714_10155348 | 3300005288 | Bacteria | 1082 |
| 28 | Ga0065704_10083099 | 3300005289 | Bacteria | 3509 |
| 29 | Ga0065712_10014760 | 3300005290 | Bacteria | 2589 |
| 30 | Ga0065712_10077134 | 3300005290 | Bacteria | 3544 |
| 31 | Ga0065712_10084044 | 3300005290 | Bacteria | 2793 |
| 32 | Ga0065715_10002288 | 3300005293 | Bacteria | 15558 |
| 33 | Ga0065715_10091974 | 3300005293 | Bacteria | 5418 |
| 34 | Ga0070658_10482445 | 3300005327 | Bacteria | 1070 |
| 35 | Ga0070676_10009142 | 3300005328 | Bacteria | 5361 |
| 36 | Ga0070676_10250917 | 3300005328 | Bacteria | 1181 |
| 37 | Ga0070683_100000259 | 3300005329 | Bacteria | 36454 |
| 38 | Ga0070683_100088494 | 3300005329 | Bacteria | 2905 |
| 39 | Ga0070683_100770214 | 3300005329 | Bacteria | 922 |
| 40 | Ga0070690_100013047 | 3300005330 | Bacteria | 4902 |
| 41 | Ga0070670_100043806 | 3300005331 | Bacteria | 3847 |
| 42 | Ga0070670_100084881 | 3300005331 | Bacteria | 2720 |
| 43 | Ga0070677_10000339 | 3300005333 | Bacteria | 16384 |
| 44 | Ga0068869_100000095 | 3300005334 | Bacteria | 41336 |
| 45 | Ga0068869_100028848 | 3300005334 | Bacteria | 3881 |
| 46 | Ga0068869_100218022 | 3300005334 | Bacteria | 1511 |
| 47 | Ga0068869_100268264 | 3300005334 | Bacteria | 1369 |
| 48 | Ga0070666_10046612 | 3300005335 | Bacteria | 2908 |
| 49 | Ga0070680_100019598 | 3300005336 | Bacteria | 5364 |
| 50 | Ga0070680_100019622 | 3300005336 | Bacteria | 5361 |
| 51 | Ga0070680_100147897 | 3300005336 | Bacteria | 1972 |
| 52 | Ga0070682_100002519 | 3300005337 | Bacteria | 10108 |
| 53 | Ga0070682_100051332 | 3300005337 | Bacteria | 2577 |
| 54 | Ga0068868_100006592 | 3300005338 | Bacteria | 8230 |
| 55 | Ga0068868_100011912 | 3300005338 | Bacteria | 6342 |
| 56 | Ga0070660_100016495 | 3300005339 | Bacteria | 5361 |
| 57 | Ga0070660_100214323 | 3300005339 | Bacteria | 1564 |
| 58 | Ga0070689_100020436 | 3300005340 | Bacteria | 4913 |
| 59 | Ga0070689_100087555 | 3300005340 | Bacteria | 2450 |
| 60 | Ga0070691_10006454 | 3300005341 | Bacteria | 5361 |
| 61 | Ga0070691_10115427 | 3300005341 | Bacteria | 1347 |
| 62 | Ga0070687_100004929 | 3300005343 | Bacteria | 5361 |
| 63 | Ga0070687_100064626 | 3300005343 | Bacteria | 1944 |
| 64 | Ga0070661_100000362 | 3300005344 | Bacteria | 35891 |
| 65 | Ga0070661_100424707 | 3300005344 | Bacteria | 1054 |
| 66 | Ga0070692_10005659 | 3300005345 | Bacteria | 5361 |
| 67 | Ga0070692_10028168 | 3300005345 | Bacteria | 2791 |
| 68 | Ga0070668_100017522 | 3300005347 | Bacteria | 5371 |
| 69 | Ga0070668_100017886 | 3300005347 | Bacteria | 5318 |
| 70 | Ga0070669_100002512 | 3300005353 | Bacteria | 13271 |
| 71 | Ga0070675_100019847 | 3300005354 | Bacteria | 5361 |
| 72 | Ga0070671_100000935 | 3300005355 | Bacteria | 21361 |
| 73 | Ga0070671_100028391 | 3300005355 | Bacteria | 4606 |
| 74 | Ga0070674_100008580 | 3300005356 | Bacteria | 6094 |
| 75 | Ga0070674_100009282 | 3300005356 | Bacteria | 5888 |
| 76 | Ga0070673_100000144 | 3300005364 | Bacteria | 33872 |
| 77 | Ga0070688_100001947 | 3300005365 | Bacteria | 10375 |
| 78 | Ga0070688_100009341 | 3300005365 | Bacteria | 5359 |
| 79 | Ga0070659_100017676 | 3300005366 | Bacteria | 5371 |
| 80 | Ga0070659_100033629 | 3300005366 | Bacteria | 3983 |
| 81 | Ga0070667_100005818 | 3300005367 | Bacteria | 10284 |
| 82 | Ga0070667_100011748 | 3300005367 | Bacteria | 7235 |
| 83 | Ga0070667_100126708 | 3300005367 | Bacteria | 2226 |
| 84 | Ga0070703_10008667 | 3300005406 | Bacteria | 2861 |
| 85 | Ga0070709_10290588 | 3300005434 | Bacteria | 1191 |
| 86 | Ga0070714_100007544 | 3300005435 | Bacteria | 8468 |
| 87 | Ga0070714_100067871 | 3300005435 | Bacteria | 3076 |
| 88 | Ga0070714_100311930 | 3300005435 | Bacteria | 1469 |
| 89 | Ga0070713_100015641 | 3300005436 | Bacteria | 5682 |
| 90 | Ga0070713_100116108 | 3300005436 | Bacteria | 2340 |
| 91 | Ga0070710_10019002 | 3300005437 | Bacteria | 3545 |
| 92 | Ga0070701_10010426 | 3300005438 | Bacteria | 4109 |
| 93 | Ga0070701_10053038 | 3300005438 | Bacteria | 2109 |
| 94 | Ga0070711_100036932 | 3300005439 | Bacteria | 3275 |
| 95 | Ga0070711_100325117 | 3300005439 | Bacteria | 1230 |
| 96 | Ga0070705_100001332 | 3300005440 | Bacteria | 13181 |
| 97 | Ga0070705_100241640 | 3300005440 | Bacteria | 1262 |
| 98 | Ga0070705_100313286 | 3300005440 | Unclassified | 1130 |
| 99 | Ga0070700_100009367 | 3300005441 | Bacteria | 5371 |
| 100 | Ga0070700_100030724 | 3300005441 | Bacteria | 3213 |
| 101 | Ga0070694_100012072 | 3300005444 | Bacteria | 5364 |
| 102 | Ga0070694_100012089 | 3300005444 | Bacteria | 5361 |
| 103 | Ga0070708_100059559 | 3300005445 | Bacteria | 3405 |
| 104 | Ga0070663_100012574 | 3300005455 | Bacteria | 5361 |
| 105 | Ga0070663_100092523 | 3300005455 | Bacteria | 2242 |
| 106 | Ga0070663_100286636 | 3300005455 | Bacteria | 1314 |
| 107 | Ga0070678_100000955 | 3300005456 | Bacteria | 14888 |
| 108 | Ga0070678_100359786 | 3300005456 | Bacteria | 1254 |
| 109 | Ga0070662_100013888 | 3300005457 | Bacteria | 5365 |
| 110 | Ga0070662_100416198 | 3300005457 | Bacteria | 1111 |
| 111 | Ga0070681_10048667 | 3300005458 | Bacteria | 4236 |
| 112 | Ga0070681_10060537 | 3300005458 | Bacteria | 3762 |
| 113 | Ga0070681_10164684 | 3300005458 | Bacteria | 2140 |
| 114 | Ga0070681_10369884 | 3300005458 | Bacteria | 1344 |
| 115 | Ga0070681_10390463 | 3300005458 | Bacteria | 1302 |
| 116 | Ga0068867_100000325 | 3300005459 | Bacteria | 31413 |
| 117 | Ga0070685_10069157 | 3300005466 | Bacteria | 2088 |
| 118 | Ga0070707_100546964 | 3300005468 | Bacteria | 1120 |
| 119 | Ga0070698_100258431 | 3300005471 | Bacteria | 1674 |
| 120 | Ga0070699_100109188 | 3300005518 | Bacteria | 2428 |
| 121 | Ga0070699_100775206 | 3300005518 | Unclassified | 877 |
| 122 | Ga0070679_100029943 | 3300005530 | Bacteria | 5371 |
| 123 | Ga0070679_100052219 | 3300005530 | Bacteria | 4072 |
| 124 | Ga0070679_100183834 | 3300005530 | Bacteria | 2062 |
| 125 | Ga0070679_100361578 | 3300005530 | Bacteria | 1399 |
| 126 | Ga0070679_100446228 | 3300005530 | Bacteria | 1238 |
| 127 | Ga0070684_100001386 | 3300005535 | Bacteria | 17402 |
| 128 | Ga0070684_100112100 | 3300005535 | Bacteria | 2447 |
| 129 | Ga0070684_100716989 | 3300005535 | Bacteria | 933 |
| 130 | Ga0070697_100002804 | 3300005536 | Bacteria | 13422 |
| 131 | Ga0070697_100180919 | 3300005536 | Bacteria | 1787 |
| 132 | Ga0068853_100021663 | 3300005539 | Bacteria | 5361 |
| 133 | Ga0068853_100748189 | 3300005539 | Bacteria | 934 |
| 134 | Ga0070672_100003185 | 3300005543 | Bacteria | 10620 |
| 135 | Ga0070672_100106629 | 3300005543 | Bacteria | 2279 |
| 136 | Ga0070686_100002814 | 3300005544 | Bacteria | 9585 |
| 137 | Ga0070686_100011949 | 3300005544 | Bacteria | 4937 |
| 138 | Ga0070695_100001945 | 3300005545 | Bacteria | 11708 |
| 139 | Ga0070695_100011210 | 3300005545 | Bacteria | 5360 |
| 140 | Ga0070695_100013577 | 3300005545 | Bacteria | 4896 |
| 141 | Ga0070695_100082509 | 3300005545 | Bacteria | 2128 |
| 142 | Ga0070695_100277518 | 3300005545 | Bacteria | 1230 |
| 143 | Ga0070696_100014107 | 3300005546 | Bacteria | 5364 |
| 144 | Ga0070696_100014120 | 3300005546 | Bacteria | 5361 |
| 145 | Ga0070696_100225817 | 3300005546 | Bacteria | 1407 |
| 146 | Ga0070693_100001679 | 3300005547 | Bacteria | 10029 |
| 147 | Ga0070693_100047790 | 3300005547 | Bacteria | 2436 |
| 148 | Ga0070665_100107883 | 3300005548 | Bacteria | 2787 |
| 149 | Ga0070665_100109057 | 3300005548 | Bacteria | 2771 |
| 150 | Ga0070704_100011878 | 3300005549 | Bacteria | 5361 |
| 151 | Ga0070704_100066027 | 3300005549 | Bacteria | 2607 |
| 152 | Ga0070704_100118122 | 3300005549 | Bacteria | 2031 |
| 153 | Ga0068855_100011491 | 3300005563 | Bacteria | 10700 |
| 154 | Ga0070664_100025252 | 3300005564 | Bacteria | 4923 |
| 155 | Ga0068857_100000521 | 3300005577 | Bacteria | 27715 |
| 156 | Ga0068854_100013433 | 3300005578 | Bacteria | 5375 |
| 157 | Ga0068854_100124485 | 3300005578 | Bacteria | 1961 |
| 158 | Ga0068854_100156484 | 3300005578 | Bacteria | 1761 |
| 159 | Ga0068856_100034966 | 3300005614 | Bacteria | 4923 |
| 160 | Ga0068856_100070595 | 3300005614 | Bacteria | 3455 |
| 161 | Ga0068856_100211800 | 3300005614 | Bacteria | 1953 |
| 162 | Ga0070702_100001916 | 3300005615 | Bacteria | 8741 |
| 163 | Ga0070702_100323926 | 3300005615 | Bacteria | 1075 |
| 164 | Ga0068859_100025977 | 3300005617 | Bacteria | 5875 |
| 165 | Ga0068859_100064359 | 3300005617 | Bacteria | 3699 |
| 166 | Ga0068859_100354210 | 3300005617 | Bacteria | 1563 |
| 167 | Ga0068859_100372990 | 3300005617 | Bacteria | 1523 |
| 168 | Ga0068859_100532973 | 3300005617 | Bacteria | 1269 |
| 169 | Ga0068864_100000459 | 3300005618 | Bacteria | 35328 |
| 170 | Ga0068866_10000987 | 3300005718 | Bacteria | 12531 |
| 171 | Ga0068866_10101535 | 3300005718 | Bacteria | 1588 |
| 172 | Ga0068851_10219166 | 3300005834 | Bacteria | 1068 |
| 173 | Ga0068870_10000034 | 3300005840 | Bacteria | 43913 |
| 174 | Ga0068863_100004287 | 3300005841 | Bacteria | 14047 |
| 175 | Ga0068858_100031677 | 3300005842 | Bacteria | 4913 |
| 176 | Ga0068858_100035496 | 3300005842 | Bacteria | 4625 |
| 177 | Ga0068858_100063955 | 3300005842 | Bacteria | 3404 |
| 178 | Ga0068858_100209543 | 3300005842 | Bacteria | 1844 |
| 179 | Ga0068860_100028836 | 3300005843 | Bacteria | 5341 |
| 180 | Ga0068860_100141077 | 3300005843 | Bacteria | 2316 |
| 181 | Ga0068860_100517741 | 3300005843 | Bacteria | 1193 |
| 182 | Ga0068860_100547411 | 3300005843 | Bacteria | 1159 |
| 183 | Ga0068862_100021695 | 3300005844 | Bacteria | 5371 |
| 184 | Ga0068862_100025938 | 3300005844 | Bacteria | 4924 |
| 185 | Ga0081455_10009792 | 3300005937 | Bacteria | 9813 |
| 186 | Ga0081455_10027923 | 3300005937 | Bacteria | 5163 |
| 187 | Ga0081455_10043322 | 3300005937 | Bacteria | 3938 |
| 188 | Ga0081540_1000068 | 3300005983 | Bacteria | 112697 |
| 189 | Ga0081540_1078594 | 3300005983 | Bacteria | 1494 |
| 190 | Ga0070717_10088016 | 3300006028 | Bacteria | 2617 |
| 191 | Ga0070717_10353030 | 3300006028 | Bacteria | 1315 |
| 192 | Ga0075365_10040537 | 3300006038 | Bacteria | 3037 |
| 193 | Ga0075365_10222244 | 3300006038 | Bacteria | 1325 |
| 194 | Ga0075365_10306005 | 3300006038 | Bacteria | 1119 |
| 195 | Ga0075368_10018895 | 3300006042 | Bacteria | 2597 |
| 196 | Ga0075368_10038132 | 3300006042 | Bacteria | 1881 |
| 197 | Ga0075363_100083856 | 3300006048 | Bacteria | 1747 |
| 198 | Ga0075363_100177238 | 3300006048 | Bacteria | 1212 |
| 199 | Ga0075364_10119889 | 3300006051 | Bacteria | 1760 |
| 200 | Ga0075364_10245725 | 3300006051 | Bacteria | 1216 |
| 201 | Ga0075364_10288205 | 3300006051 | Bacteria | 1117 |
| 202 | Ga0070715_10015446 | 3300006163 | Bacteria | 2848 |
| 203 | Ga0070712_100034300 | 3300006175 | Bacteria | 3438 |
| 204 | Ga0070712_100465114 | 3300006175 | Bacteria | 1055 |
| 205 | Ga0075367_10000344 | 3300006178 | Bacteria | 16544 |
| 206 | Ga0075367_10002451 | 3300006178 | Bacteria | 8486 |
| 207 | Ga0075367_10046406 | 3300006178 | Bacteria | 2552 |
| 208 | Ga0075369_10000100 | 3300006186 | Bacteria | 23074 |
| 209 | Ga0075369_10090117 | 3300006186 | Bacteria | 1368 |
| 210 | Ga0075366_10129847 | 3300006195 | Bacteria | 1520 |
| 211 | Ga0075366_10217567 | 3300006195 | Bacteria | 1164 |
| 212 | Ga0075366_10266979 | 3300006195 | Bacteria | 1045 |
| 213 | Ga0097621_100000010 | 3300006237 | Bacteria | 112867 |
| 214 | Ga0097621_100122680 | 3300006237 | Bacteria | 2205 |
| 215 | Ga0097621_100161114 | 3300006237 | Bacteria | 1929 |
| 216 | Ga0097621_100212019 | 3300006237 | Bacteria | 1685 |
| 217 | Ga0068871_100000193 | 3300006358 | Bacteria | 41878 |
| 218 | Ga0068871_100058204 | 3300006358 | Bacteria | 3146 |
| 219 | Ga0068871_100325706 | 3300006358 | Bacteria | 1354 |
| 220 | Ga0068871_100356654 | 3300006358 | Bacteria | 1294 |
| 221 | Ga0075430_100001959 | 3300006846 | Bacteria | 16923 |
| 222 | Ga0075431_100028363 | 3300006847 | Bacteria | 5751 |
| 223 | Ga0075433_10003868 | 3300006852 | Bacteria | 11596 |
| 224 | Ga0075434_100000202 | 3300006871 | Bacteria | 40164 |
| 225 | Ga0075434_100178546 | 3300006871 | Bacteria | 2143 |
| 226 | Ga0075429_100275689 | 3300006880 | Bacteria | 1473 |
| 227 | Ga0068865_100000252 | 3300006881 | Bacteria | 29599 |
| 228 | Ga0068865_100047404 | 3300006881 | Bacteria | 2953 |
| 229 | Ga0068865_100193971 | 3300006881 | Bacteria | 1573 |
| 230 | Ga0075436_100004205 | 3300006914 | Bacteria | 9879 |
| 231 | Ga0075436_100005213 | 3300006914 | Bacteria | 8946 |
| 232 | Ga0075436_100127128 | 3300006914 | Bacteria | 1786 |
| 233 | Ga0097620_100025977 | 3300006931 | Bacteria | 5875 |
| 234 | Ga0097620_100064360 | 3300006931 | Bacteria | 3699 |
| 235 | Ga0097620_100354207 | 3300006931 | Bacteria | 1563 |
| 236 | Ga0097620_100372998 | 3300006931 | Bacteria | 1523 |
| 237 | Ga0097620_100532907 | 3300006931 | Bacteria | 1269 |
| 238 | Ga0075435_100062416 | 3300007076 | Bacteria | 3024 |
| 239 | Ga0075435_100266638 | 3300007076 | Bacteria | 1460 |
| 240 | Ga0099795_10000385 | 3300007788 | Bacteria | 8012 |
| 241 | Ga0105251_10059560 | 3300009011 | Bacteria | 1800 |
| 242 | Ga0105240_10034585 | 3300009093 | Bacteria | 6517 |
| 243 | Ga0111539_10022969 | 3300009094 | Bacteria | 7659 |
| 244 | Ga0111539_10043725 | 3300009094 | Bacteria | 5369 |
| 245 | Ga0111539_10043761 | 3300009094 | Bacteria | 5367 |
| 246 | Ga0111539_10161295 | 3300009094 | Bacteria | 2622 |
| 247 | Ga0111539_10255793 | 3300009094 | Bacteria | 2039 |
| 248 | Ga0105245_10000152 | 3300009098 | Bacteria | 65742 |
| 249 | Ga0105245_10011738 | 3300009098 | Bacteria | 7620 |
| 250 | Ga0105245_10165436 | 3300009098 | Bacteria | 2102 |
| 251 | Ga0105245_10423937 | 3300009098 | Bacteria | 1334 |
| 252 | Ga0105247_10001782 | 3300009101 | Bacteria | 15144 |
| 253 | Ga0105247_10017431 | 3300009101 | Bacteria | 4312 |
| 254 | Ga0105247_10031689 | 3300009101 | Bacteria | 3210 |
| 255 | Ga0114129_10004957 | 3300009147 | Bacteria | 18771 |
| 256 | Ga0114129_10100059 | 3300009147 | Bacteria | 4012 |
| 257 | Ga0114129_10123024 | 3300009147 | Bacteria | 3569 |
| 258 | Ga0114129_10242026 | 3300009147 | Bacteria | 2425 |
| 259 | Ga0105243_10018129 | 3300009148 | Bacteria | 5327 |
| 260 | Ga0105243_10043961 | 3300009148 | Bacteria | 3503 |
| 261 | Ga0105241_10016831 | 3300009174 | Bacteria | 5367 |
| 262 | Ga0105241_10081088 | 3300009174 | Bacteria | 2541 |
| 263 | Ga0105242_10019113 | 3300009176 | Bacteria | 5367 |
| 264 | Ga0105242_10175706 | 3300009176 | Bacteria | 1885 |
| 265 | Ga0105248_10001245 | 3300009177 | Bacteria | 28462 |
| 266 | Ga0105248_10065391 | 3300009177 | Bacteria | 4084 |
| 267 | Ga0105248_10132039 | 3300009177 | Bacteria | 2818 |
| 268 | Ga0105248_10433061 | 3300009177 | Bacteria | 1481 |
| 269 | Ga0105237_10023502 | 3300009545 | Bacteria | 6314 |
| 270 | Ga0105237_10031856 | 3300009545 | Bacteria | 5340 |
| 271 | Ga0105237_10050388 | 3300009545 | Bacteria | 4183 |
| 272 | Ga0105237_10193257 | 3300009545 | Bacteria | 2035 |
| 273 | Ga0105238_10011409 | 3300009551 | Bacteria | 8948 |
| 274 | Ga0105238_10042527 | 3300009551 | Bacteria | 4600 |
| 275 | Ga0105238_10121993 | 3300009551 | Bacteria | 2586 |
| 276 | Ga0105238_10178405 | 3300009551 | Bacteria | 2101 |
| 277 | Ga0105249_10024998 | 3300009553 | Bacteria | 5374 |
| 278 | Ga0105239_10036827 | 3300010375 | Bacteria | 5367 |
| 279 | Ga0105239_10076044 | 3300010375 | Bacteria | 3693 |
| 280 | Ga0105239_10244850 | 3300010375 | Bacteria | 2013 |
| 281 | Ga0105239_10684429 | 3300010375 | Bacteria | 1172 |
| 282 | Ga0105246_10001947 | 3300011119 | Bacteria | 12437 |
| 283 | Ga0105246_10039853 | 3300011119 | Bacteria | 3167 |
| 284 | Ga0105246_10091049 | 3300011119 | Bacteria | 2197 |
| 285 | Ga0157319_1000342 | 3300012497 | Bacteria | 2176 |
| 286 | Ga0157342_1000333 | 3300012507 | Bacteria | 2742 |
| 287 | Ga0157326_1012483 | 3300012513 | Bacteria | 970 |
| 288 | Ga0157373_10015560 | 3300013100 | Bacteria | 5560 |
| 289 | Ga0157373_10053754 | 3300013100 | Bacteria | 2863 |
| 290 | Ga0157371_10003620 | 3300013102 | Bacteria | 13910 |
| 291 | Ga0157371_10086333 | 3300013102 | Bacteria | 2222 |
| 292 | Ga0157370_10033106 | 3300013104 | Bacteria | 5039 |
| 293 | Ga0157370_10194826 | 3300013104 | Bacteria | 1881 |
| 294 | Ga0157369_10186322 | 3300013105 | Bacteria | 2182 |
| 295 | Ga0157374_10010563 | 3300013296 | Bacteria | 7949 |
| 296 | Ga0157378_10000990 | 3300013297 | Bacteria | 26013 |
| 297 | Ga0157378_10167363 | 3300013297 | Bacteria | 2059 |
| 298 | Ga0157378_10444789 | 3300013297 | Bacteria | 1285 |
| 299 | Ga0163162_10034398 | 3300013306 | Bacteria | 5043 |
| 300 | Ga0163162_10109363 | 3300013306 | Bacteria | 2861 |
| 301 | Ga0157372_10012895 | 3300013307 | Bacteria | 8911 |
| 302 | Ga0157375_10026919 | 3300013308 | Bacteria | 5368 |
| 303 | Ga0163163_10067522 | 3300014325 | Bacteria | 3556 |
| 304 | Ga0163163_10067631 | 3300014325 | Bacteria | 3553 |
| 305 | Ga0157380_10004398 | 3300014326 | Bacteria | 9771 |
| 306 | Ga0157380_10116379 | 3300014326 | Bacteria | 2256 |
| 307 | Ga0157380_10234855 | 3300014326 | Bacteria | 1649 |
| 308 | Ga0157377_10000463 | 3300014745 | Bacteria | 17484 |
| 309 | Ga0157376_10000098 | 3300014969 | Bacteria | 63149 |
| 310 | Ga0157376_10283299 | 3300014969 | Bacteria | 1562 |
| 311 | Ga0157376_10563546 | 3300014969 | Bacteria | 1129 |
| 312 | Ga0163161_10000866 | 3300017792 | Bacteria | 23560 |
| 313 | Ga0213876_10003554 | 3300021384 | Bacteria | 8883 |
| 314 | Ga0213876_10055020 | 3300021384 | Bacteria | 2101 |
| 315 | Ga0213876_10124093 | 3300021384 | Bacteria | 1371 |
| 316 | Ga0213875_10000003 | 3300021388 | Bacteria | 719367 |
| 317 | Ga0224572_1009661 | 3300024225 | Bacteria | 1804 |
| 318 | Ga0207666_1000450 | 3300025271 | Bacteria | 5319 |
| 319 | Ga0207697_10002237 | 3300025315 | Bacteria | 10113 |
| 320 | Ga0207697_10007190 | 3300025315 | Bacteria | 4976 |
| 321 | Ga0207653_10016205 | 3300025885 | Bacteria | 2340 |
| 322 | Ga0207682_10000006 | 3300025893 | Bacteria | 94953 |
| 323 | Ga0207692_10047300 | 3300025898 | Bacteria | 2159 |
| 324 | Ga0207692_10119115 | 3300025898 | Bacteria | 1475 |
| 325 | Ga0207692_10237895 | 3300025898 | Bacteria | 1086 |
| 326 | Ga0207642_10000107 | 3300025899 | Bacteria | 22438 |
| 327 | Ga0207642_10043328 | 3300025899 | Bacteria | 1984 |
| 328 | Ga0207642_10104663 | 3300025899 | Bacteria | 1428 |
| 329 | Ga0207710_10003925 | 3300025900 | Bacteria | 6564 |
| 330 | Ga0207710_10039847 | 3300025900 | Bacteria | 2080 |
| 331 | Ga0207688_10002370 | 3300025901 | Bacteria | 10144 |
| 332 | Ga0207688_10023763 | 3300025901 | Bacteria | 3359 |
| 333 | Ga0207680_10028611 | 3300025903 | Bacteria | 3120 |
| 334 | Ga0207647_10002014 | 3300025904 | Bacteria | 15551 |
| 335 | Ga0207647_10019660 | 3300025904 | Bacteria | 4539 |
| 336 | Ga0207647_10102240 | 3300025904 | Bacteria | 1699 |
| 337 | Ga0207685_10018147 | 3300025905 | Bacteria | 2290 |
| 338 | Ga0207699_10044580 | 3300025906 | Bacteria | 2583 |
| 339 | Ga0207699_10101992 | 3300025906 | Bacteria | 1823 |
| 340 | Ga0207699_10180876 | 3300025906 | Bacteria | 1417 |
| 341 | Ga0207645_10000023 | 3300025907 | Bacteria | 98724 |
| 342 | Ga0207645_10275901 | 3300025907 | Bacteria | 1115 |
| 343 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 344 | Ga0207684_10233878 | 3300025910 | Bacteria | 1585 |
| 345 | Ga0207654_10001016 | 3300025911 | Bacteria | 15352 |
| 346 | Ga0207654_10059728 | 3300025911 | Bacteria | 2225 |
| 347 | Ga0207707_10000786 | 3300025912 | Bacteria | 31086 |
| 348 | Ga0207707_10065647 | 3300025912 | Bacteria | 3161 |
| 349 | Ga0207695_10013268 | 3300025913 | Bacteria | 9831 |
| 350 | Ga0207671_10018636 | 3300025914 | Bacteria | 5319 |
| 351 | Ga0207671_10070434 | 3300025914 | Bacteria | 2607 |
| 352 | Ga0207671_10119018 | 3300025914 | Bacteria | 2017 |
| 353 | Ga0207693_10014866 | 3300025915 | Bacteria | 6253 |
| 354 | Ga0207663_10030770 | 3300025916 | Bacteria | 3169 |
| 355 | Ga0207663_10062800 | 3300025916 | Bacteria | 2363 |
| 356 | Ga0207663_10287520 | 3300025916 | Bacteria | 1223 |
| 357 | Ga0207660_10000058 | 3300025917 | Bacteria | 56791 |
| 358 | Ga0207660_10087819 | 3300025917 | Bacteria | 2298 |
| 359 | Ga0207660_10268310 | 3300025917 | Bacteria | 1351 |
| 360 | Ga0207662_10009553 | 3300025918 | Bacteria | 5344 |
| 361 | Ga0207662_10011718 | 3300025918 | Bacteria | 4870 |
| 362 | Ga0207657_10026832 | 3300025919 | Bacteria | 5285 |
| 363 | Ga0207657_10112909 | 3300025919 | Bacteria | 2242 |
| 364 | Ga0207657_10267313 | 3300025919 | Bacteria | 1360 |
| 365 | Ga0207649_10000384 | 3300025920 | Bacteria | 33073 |
| 366 | Ga0207652_10000377 | 3300025921 | Bacteria | 46255 |
| 367 | Ga0207652_10078184 | 3300025921 | Bacteria | 2888 |
| 368 | Ga0207646_10638428 | 3300025922 | Bacteria | 954 |
| 369 | Ga0207681_10000100 | 3300025923 | Bacteria | 72913 |
| 370 | Ga0207694_10012592 | 3300025924 | Bacteria | 6375 |
| 371 | Ga0207694_10128015 | 3300025924 | Bacteria | 2033 |
| 372 | Ga0207650_10004913 | 3300025925 | Bacteria | 9124 |
| 373 | Ga0207650_10032858 | 3300025925 | Bacteria | 3755 |
| 374 | Ga0207650_10047429 | 3300025925 | Bacteria | 3166 |
| 375 | Ga0207659_10000044 | 3300025926 | Bacteria | 88759 |
| 376 | Ga0207659_10170608 | 3300025926 | Bacteria | 1716 |
| 377 | Ga0207687_10001241 | 3300025927 | Bacteria | 17449 |
| 378 | Ga0207687_10097059 | 3300025927 | Bacteria | 2161 |
| 379 | Ga0207700_10036373 | 3300025928 | Bacteria | 3555 |
| 380 | Ga0207664_10347809 | 3300025929 | Bacteria | 1312 |
| 381 | Ga0207664_10470601 | 3300025929 | Bacteria | 1123 |
| 382 | Ga0207644_10002171 | 3300025931 | Bacteria | 12721 |
| 383 | Ga0207644_10033573 | 3300025931 | Bacteria | 3587 |
| 384 | Ga0207690_10001671 | 3300025932 | Bacteria | 13703 |
| 385 | Ga0207690_10019165 | 3300025932 | Bacteria | 4206 |
| 386 | Ga0207706_10016484 | 3300025933 | Bacteria | 6669 |
| 387 | Ga0207706_10025283 | 3300025933 | Bacteria | 5322 |
| 388 | Ga0207706_10025308 | 3300025933 | Bacteria | 5319 |
| 389 | Ga0207706_10324392 | 3300025933 | Bacteria | 1340 |
| 390 | Ga0207686_10000222 | 3300025934 | Bacteria | 43531 |
| 391 | Ga0207686_10135390 | 3300025934 | Bacteria | 1695 |
| 392 | Ga0207709_10000154 | 3300025935 | Bacteria | 93456 |
| 393 | Ga0207709_10027551 | 3300025935 | Bacteria | 3275 |
| 394 | Ga0207709_10038133 | 3300025935 | Bacteria | 2859 |
| 395 | Ga0207670_10000129 | 3300025936 | Bacteria | 49928 |
| 396 | Ga0207670_10034390 | 3300025936 | Bacteria | 3275 |
| 397 | Ga0207669_10000502 | 3300025937 | Bacteria | 17080 |
| 398 | Ga0207704_10000446 | 3300025938 | Bacteria | 18422 |
| 399 | Ga0207704_10199240 | 3300025938 | Bacteria | 1464 |
| 400 | Ga0207665_10022731 | 3300025939 | Bacteria | 4128 |
| 401 | Ga0207665_10024162 | 3300025939 | Bacteria | 4006 |
| 402 | Ga0207665_10393127 | 3300025939 | Bacteria | 1054 |
| 403 | Ga0207691_10005314 | 3300025940 | Bacteria | 12434 |
| 404 | Ga0207711_10021351 | 3300025941 | Bacteria | 5409 |
| 405 | Ga0207711_10078995 | 3300025941 | Bacteria | 2871 |
| 406 | Ga0207689_10000098 | 3300025942 | Bacteria | 69773 |
| 407 | Ga0207661_10000178 | 3300025944 | Bacteria | 41008 |
| 408 | Ga0207661_10092015 | 3300025944 | Bacteria | 2528 |
| 409 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 410 | Ga0207667_10010651 | 3300025949 | Bacteria | 10730 |
| 411 | Ga0207651_10000031 | 3300025960 | Bacteria | 66688 |
| 412 | Ga0207712_10000129 | 3300025961 | Bacteria | 79246 |
| 413 | Ga0207668_10000100 | 3300025972 | Bacteria | 60574 |
| 414 | Ga0207668_10000158 | 3300025972 | Bacteria | 47189 |
| 415 | Ga0207668_10047558 | 3300025972 | Bacteria | 2938 |
| 416 | Ga0207640_10000168 | 3300025981 | Bacteria | 47588 |
| 417 | Ga0207658_10014664 | 3300025986 | Bacteria | 5368 |
| 418 | Ga0207658_10202277 | 3300025986 | Bacteria | 1659 |
| 419 | Ga0207658_10255539 | 3300025986 | Bacteria | 1491 |
| 420 | Ga0207677_10004338 | 3300026023 | Bacteria | 7597 |
| 421 | Ga0207677_10016991 | 3300026023 | Bacteria | 4325 |
| 422 | Ga0207703_10005069 | 3300026035 | Bacteria | 10660 |
| 423 | Ga0207703_10447264 | 3300026035 | Bacteria | 1206 |
| 424 | Ga0207639_10015664 | 3300026041 | Bacteria | 5350 |
| 425 | Ga0207678_10004581 | 3300026067 | Bacteria | 12434 |
| 426 | Ga0207678_10038705 | 3300026067 | Bacteria | 4142 |
| 427 | Ga0207708_10017977 | 3300026075 | Bacteria | 5319 |
| 428 | Ga0207708_10043597 | 3300026075 | Bacteria | 3419 |
| 429 | Ga0207708_10297523 | 3300026075 | Bacteria | 1312 |
| 430 | Ga0207702_10000404 | 3300026078 | Bacteria | 49177 |
| 431 | Ga0207641_10001418 | 3300026088 | Bacteria | 23633 |
| 432 | Ga0207641_10128789 | 3300026088 | Bacteria | 2270 |
| 433 | Ga0207648_10000072 | 3300026089 | Bacteria | 94957 |
| 434 | Ga0207676_10000180 | 3300026095 | Bacteria | 55634 |
| 435 | Ga0207674_10010766 | 3300026116 | Bacteria | 10320 |
| 436 | Ga0207674_10369122 | 3300026116 | Bacteria | 1387 |
| 437 | Ga0207675_100026944 | 3300026118 | Bacteria | 5350 |
| 438 | Ga0207683_10000029 | 3300026121 | Bacteria | 109665 |
| 439 | Ga0207683_10097759 | 3300026121 | Bacteria | 2619 |
| 440 | Ga0207698_10009066 | 3300026142 | Bacteria | 6320 |
| 441 | Ga0209984_1004014 | 3300027424 | Bacteria | 1715 |
| 442 | Ga0209179_1000387 | 3300027512 | Bacteria | 4348 |
| 443 | Ga0209999_1012910 | 3300027543 | Unclassified | 1515 |
| 444 | Ga0209970_1004641 | 3300027614 | Bacteria | 2275 |
| 445 | Ga0210002_1004321 | 3300027617 | Bacteria | 2111 |
| 446 | Ga0209971_1003073 | 3300027682 | Bacteria | 3984 |
| 447 | Ga0209966_1001665 | 3300027695 | Bacteria | 3782 |
| 448 | Ga0209998_10002950 | 3300027717 | Bacteria | 3797 |
| 449 | Ga0209998_10003961 | 3300027717 | Bacteria | 3187 |
| 450 | Ga0209974_10004279 | 3300027876 | Bacteria | 5091 |
| 451 | Ga0209974_10111086 | 3300027876 | Bacteria | 965 |
| 452 | Ga0207428_10000100 | 3300027907 | Bacteria | 119495 |
| 453 | Ga0207428_10000968 | 3300027907 | Bacteria | 31823 |
| 454 | Ga0268266_10015777 | 3300028379 | Bacteria | 6469 |
| 455 | Ga0268265_10000698 | 3300028380 | Bacteria | 32950 |
| 456 | Ga0268265_10045744 | 3300028380 | Bacteria | 3268 |
| 457 | Ga0268264_10005684 | 3300028381 | Bacteria | 10573 |
| 458 | Ga0268264_10035806 | 3300028381 | Bacteria | 4087 |
| 459 | Ga0268264_10045929 | 3300028381 | Bacteria | 3628 |
| 460 | Ga0268264_10227850 | 3300028381 | Bacteria | 1719 |
| 461 | Ga0268264_10686908 | 3300028381 | Bacteria | 1016 |
| 462 | Ga0265337_1009820 | 3300028556 | Bacteria | 3391 |
| 463 | Ga0265338_10006337 | 3300028800 | Bacteria | 15116 |
| 464 | Ga0265338_10097140 | 3300028800 | Bacteria | 2414 |
| 465 | Ga0265773_1000896 | 3300031018 | Bacteria | 1419 |
| 466 | Ga0265760_10005992 | 3300031090 | Bacteria | 3474 |
| 467 | Ga0265760_10104969 | 3300031090 | Bacteria | 896 |
| 468 | Ga0265325_10000093 | 3300031241 | Bacteria | 63498 |
| 469 | Ga0265325_10001052 | 3300031241 | Bacteria | 19856 |
| 470 | Ga0265325_10005357 | 3300031241 | Bacteria | 7934 |
| 471 | Ga0265325_10006146 | 3300031241 | Bacteria | 7327 |
| 472 | Ga0265325_10104307 | 3300031241 | Bacteria | 1385 |
| 473 | Ga0265329_10086470 | 3300031242 | Bacteria | 994 |
| 474 | Ga0265340_10054915 | 3300031247 | Bacteria | 1920 |
| 475 | Ga0265339_10001451 | 3300031249 | Bacteria | 17559 |
| 476 | Ga0265339_10006787 | 3300031249 | Bacteria | 7467 |
| 477 | Ga0265339_10017062 | 3300031249 | Bacteria | 4306 |
| 478 | Ga0265316_10064653 | 3300031344 | Bacteria | 2834 |
| 479 | Ga0265316_10090520 | 3300031344 | Bacteria | 2334 |
| 480 | Ga0265316_10115830 | 3300031344 | Bacteria | 2026 |
| 481 | Ga0265316_10135669 | 3300031344 | Bacteria | 1851 |
| 482 | Ga0265316_10173121 | 3300031344 | Bacteria | 1609 |
| 483 | Ga0265313_10000366 | 3300031595 | Bacteria | 49088 |
| 484 | Ga0265313_10006019 | 3300031595 | Bacteria | 8754 |
| 485 | Ga0265313_10010557 | 3300031595 | Bacteria | 5824 |
| 486 | Ga0265313_10010885 | 3300031595 | Bacteria | 5705 |
| 487 | Ga0265313_10072842 | 3300031595 | Bacteria | 1578 |
| 488 | Ga0265314_10001247 | 3300031711 | Bacteria | 29026 |
| 489 | Ga0265314_10011299 | 3300031711 | Bacteria | 7383 |
| 490 | Ga0265314_10068973 | 3300031711 | Bacteria | 2375 |
| 491 | Ga0265342_10000564 | 3300031712 | Bacteria | 39142 |
| 492 | Ga0265342_10063090 | 3300031712 | Bacteria | 2179 |
| 493 | Ga0307407_10136708 | 3300031903 | Bacteria | 1576 |
| 494 | Ga0307409_100531496 | 3300031995 | Bacteria | 1151 |
| 495 | Ga0316583_10006661 | 3300032133 | Bacteria | 4159 |
| 496 | Ga0373930_0000941 | 3300034816 | Bacteria | 4167 |
| 497 | Ga0373948_0000551 | 3300034817 | Bacteria | 4730 |
| 498 | Ga0373950_0001071 | 3300034818 | Bacteria | 3498 |
| 499 | Ga0373958_0000214 | 3300034819 | Bacteria | 6811 |
| 500 | Ga0373959_0000795 | 3300034820 | Bacteria | 5397 |
| 501 | Ga0373938_0000050 | 3300034957 | Bacteria | 15256 |
| 502 | Ga0373938_0021500 | 3300034957 | Bacteria | 1308 |
| 503 | Ga0373928_0000023 | 3300035084 | Bacteria | 26137 |
| 504 | Ga0373929_0001804 | 3300035085 | Bacteria | 4014 |
| 505 | Ga0373929_0007180 | 3300035085 | Bacteria | 2029 |
| 506 | Ga0373934_0020106 | 3300035086 | Bacteria | 2566 |
| 507 | Ga0373940_0000075 | 3300035088 | Bacteria | 11629 |
| 508 | Ga0373940_0002001 | 3300035088 | Bacteria | 3859 |
| 509 | Ga0373949_0001683 | 3300035090 | Bacteria | 6159 |
| 510 | Ga0373949_0001759 | 3300035090 | Bacteria | 5977 |
| 511 | Ga0373951_0002175 | 3300035091 | Bacteria | 4992 |
| 512 | Ga0373952_0001100 | 3300035092 | Bacteria | 4929 |
| 513 | Ga0373952_0069870 | 3300035092 | Bacteria | 876 |
| 514 | Ga0373923_0014045 | 3300035111 | Bacteria | 3000 |
| 515 | Ga0373923_0047771 | 3300035111 | Bacteria | 1785 |
| 516 | Ga0373923_0071407 | 3300035111 | Bacteria | 1491 |
| 517 | Ga0373932_0000570 | 3300035112 | Bacteria | 11346 |
| 518 | Ga0373932_0002838 | 3300035112 | Bacteria | 4287 |
| 519 | Ga0373936_0072337 | 3300035113 | Bacteria | 1423 |
| 520 | Ga0373939_0002122 | 3300035114 | Bacteria | 4723 |
| 521 | Ga0373941_0000644 | 3300035115 | Bacteria | 7073 |
| 522 | Ga0373941_0067561 | 3300035115 | Bacteria | 1179 |
| 523 | Ga0373945_0021619 | 3300035116 | Bacteria | 2212 |
| 524 | Ga0373953_0015687 | 3300035117 | Bacteria | 2752 |
| 525 | Ga0373954_0000646 | 3300035118 | Bacteria | 13326 |
| 526 | Ga0373954_0006146 | 3300035118 | Bacteria | 5230 |
| 527 | Ga0373954_0047975 | 3300035118 | Bacteria | 2000 |
| 528 | Ga0373956_0005348 | 3300035119 | Bacteria | 5138 |
| 529 | Ga0373956_0008694 | 3300035119 | Bacteria | 4113 |
| 530 | Ga0373956_0035310 | 3300035119 | Bacteria | 2204 |
| 531 | Ga0373957_0039562 | 3300035120 | Bacteria | 1769 |
| 532 | Ga0373957_0050440 | 3300035120 | Bacteria | 1590 |
| 533 | Ga0373960_0005729 | 3300035121 | Bacteria | 2887 |
| 534 | Ga0373960_0012100 | 3300035121 | Bacteria | 2138 |
| 535 | Ga0373943_0000449 | 3300035170 | Bacteria | 17431 |
| 536 | Ga0373943_0271109 | 3300035170 | Bacteria | 957 |
| 537 | Ga0373946_0001441 | 3300035171 | Bacteria | 8276 |
| 538 | Ga0373955_0000177 | 3300035172 | Bacteria | 26296 |
| 539 | Ga0373955_0008083 | 3300035172 | Bacteria | 4865 |
| 540 | Ga0373955_0017545 | 3300035172 | Bacteria | 3545 |
| 541 | Ga0373955_0043769 | 3300035172 | Bacteria | 2409 |
| 542 | Ga0373942_0000843 | 3300035207 | Bacteria | 8417 |
| 543 | Ga0373942_0001126 | 3300035207 | Bacteria | 7089 |
| 544 | Ga0373961_0000536 | 3300035241 | Bacteria | 14433 |
| 545 | Ga0373962_0000064 | 3300035242 | Bacteria | 23523 |
| 546 | Ga0373962_0002485 | 3300035242 | Bacteria | 4382 |
| 547 | Ga0373924_0000051 | 3300035410 | Bacteria | 29889 |
| 548 | Ga0373931_0002530 | 3300035691 | Bacteria | 8117 |
| 549 | Ga0373931_0031105 | 3300035691 | Bacteria | 2752 |
| 550 | Ga0373931_0149910 | 3300035691 | Bacteria | 1358 |
| 551 | Ga0373935_0000018 | 3300035692 | Bacteria | 68811 |
| 552 | Ga0373935_0013696 | 3300035692 | Bacteria | 4896 |
| 553 | Ga0373927_0004668 | 3300035695 | Bacteria | 9551 |
| 554 | Ga0373927_0018003 | 3300035695 | Bacteria | 4647 |
| 555 | Ga0373933_0001351 | 3300035724 | Bacteria | 14455 |
| 556 | Ga0373933_0002708 | 3300035724 | Bacteria | 9918 |
| 557 | Ga0373933_0010009 | 3300035724 | Bacteria | 5192 |
| 558 | Ga0373933_0080337 | 3300035724 | Bacteria | 1998 |
| 559 | Ga0373933_0272262 | 3300035724 | Bacteria | 1093 |
| 560 | Ga0373933_0354727 | 3300035724 | Bacteria | 953 |
| 561 | Ga0373947_0000264 | 3300035725 | Bacteria | 29727 |
| 562 | Ga0373947_0128137 | 3300035725 | Bacteria | 1618 |
| 563 | Ga0373937_0000571 | 3300036401 | Bacteria | 32663 |
| 564 | Ga0373937_0004518 | 3300036401 | Bacteria | 11814 |
| 565 | Ga0373937_0007367 | 3300036401 | Bacteria | 9524 |
| 566 | Ga0373937_0014695 | 3300036401 | Bacteria | 6914 |
| 567 | Ga0373937_0066291 | 3300036401 | Bacteria | 3324 |
| 568 | Ga0373937_0068182 | 3300036401 | Bacteria | 3279 |
| 569 | Ga0373937_0433875 | 3300036401 | Bacteria | 1247 |
| 570 | Ga0373925_0000018 | 3300037068 | Bacteria | 174213 |
| 571 | Ga0436364_0145110 | 3300037853 | Bacteria | 19161 |
| 572 | Ga0242420_000299 | 3300038996 | Bacteria | 5466 |
| 573 | Ga0436365_0689921 | 3300039437 | Bacteria | 1382 |
| 574 | Ga0436365_1172725 | 3300039437 | Bacteria | 2976 |
| 575 | Ga0436365_1262142 | 3300039437 | Bacteria | 6818 |
| 576 | Ga0436365_1416741 | 3300039437 | Bacteria | 9089 |
| 577 | Ga0436363_1677324 | 3300039450 | Bacteria | 952 |
| 578 | Ga0439448_0016529 | 3300042005 | Bacteria | 2246 |
| 579 | Ga0439455_0004368 | 3300042012 | Bacteria | 2797 |
| 580 | Ga0439463_007824 | 3300042016 | Bacteria | 2640 |
| 581 | Ga0439464_0012964 | 3300042439 | Bacteria | 2227 |
| 582 | Ga0439464_0122550 | 3300042439 | Bacteria | 801 |
| 583 | Ga0466963_0037383 | 3300044694 | Bacteria | 3169 |
| 584 | Ga0451576_0067491 | 3300045051 | Bacteria | 3723 |
| 585 | Ga0466958_0062650 | 3300045836 | Bacteria | 2267 |
| 586 | Ga0495592_0000001 | 3300046454 | Bacteria | 305819 |
| 587 | Ga0495592_0012444 | 3300046454 | Bacteria | 6462 |
| 588 | Ga0495592_0022783 | 3300046454 | Bacteria | 4764 |
| 589 | Ga0495592_0063289 | 3300046454 | Bacteria | 2714 |
| 590 | Ga0495592_0336631 | 3300046454 | Bacteria | 971 |
| 591 | Ga0495603_0034527 | 3300046455 | Bacteria | 3040 |
| 592 | Ga0495629_0012920 | 3300046459 | Bacteria | 6040 |
| 593 | Ga0495651_0003778 | 3300046462 | Bacteria | 11582 |
| 594 | Ga0495651_0004527 | 3300046462 | Bacteria | 10630 |
| 595 | Ga0495651_0056228 | 3300046462 | Bacteria | 3023 |
| 596 | Ga0495651_0153038 | 3300046462 | Bacteria | 1660 |
| 597 | Ga0495653_0000015 | 3300046463 | Bacteria | 213697 |
| 598 | Ga0495653_0190091 | 3300046463 | Bacteria | 1401 |
| 599 | Ga0495580_0242200 | 3300046472 | Unclassified | 1236 |
| 600 | Ga0495582_0135861 | 3300046473 | Bacteria | 1391 |
| 601 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 602 | Ga0495664_0003133 | 3300046477 | Bacteria | 8983 |
| 603 | Ga0495584_0003512 | 3300046491 | Bacteria | 8603 |
| 604 | Ga0495594_0184511 | 3300046499 | Bacteria | 1188 |
| 605 | Ga0495608_0000116 | 3300046511 | Bacteria | 56633 |
| 606 | Ga0495608_0003179 | 3300046511 | Bacteria | 11754 |
| 607 | Ga0495608_0036553 | 3300046511 | Bacteria | 3307 |
| 608 | Ga0495618_0000021 | 3300046514 | Bacteria | 129750 |
| 609 | Ga0495618_0370126 | 3300046514 | Bacteria | 880 |
| 610 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 611 | Ga0495628_0056178 | 3300046516 | Bacteria | 3099 |
| 612 | Ga0495628_0058558 | 3300046516 | Bacteria | 3026 |
| 613 | Ga0495630_0001024 | 3300046517 | Bacteria | 19309 |
| 614 | Ga0495630_0060647 | 3300046517 | Bacteria | 2840 |
| 615 | Ga0495666_0140594 | 3300046526 | Bacteria | 1126 |
| 616 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 617 | Ga0495652_0075995 | 3300046529 | Bacteria | 2787 |
| 618 | Ga0495652_0085573 | 3300046529 | Bacteria | 2590 |
| 619 | Ga0495652_0348758 | 3300046529 | Bacteria | 1061 |
| 620 | Ga0495640_0000006 | 3300046533 | Bacteria | 285419 |
| 621 | Ga0495640_0007041 | 3300046533 | Bacteria | 8852 |
| 622 | Ga0495640_0017686 | 3300046533 | Bacteria | 5305 |
| 623 | Ga0495640_0181369 | 3300046533 | Bacteria | 1341 |
| 624 | Ga0495586_0087986 | 3300046535 | Bacteria | 1713 |
| 625 | Ga0495587_0000012 | 3300046536 | Bacteria | 197088 |
| 626 | Ga0495587_0001919 | 3300046536 | Bacteria | 13852 |
| 627 | Ga0495587_0069068 | 3300046536 | Bacteria | 2057 |
| 628 | Ga0495598_0055352 | 3300046537 | Bacteria | 1208 |
| 629 | Ga0495645_0000004 | 3300046543 | Bacteria | 532661 |
| 630 | Ga0495645_0004673 | 3300046543 | Bacteria | 9346 |
| 631 | Ga0495645_0029398 | 3300046543 | Bacteria | 3996 |
| 632 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 633 | Ga0495667_0002357 | 3300046559 | Bacteria | 12630 |
| 634 | Ga0495667_0002421 | 3300046559 | Bacteria | 12456 |
| 635 | Ga0495667_0017507 | 3300046559 | Bacteria | 4840 |
| 636 | Ga0495667_0086409 | 3300046559 | Bacteria | 2034 |
| 637 | Ga0495656_0004499 | 3300046615 | Bacteria | 4774 |
| 638 | Ga0495656_0017425 | 3300046615 | Bacteria | 2741 |
| 639 | Ga0495634_0000388 | 3300046642 | Bacteria | 42999 |
| 640 | Ga0495634_0071337 | 3300046642 | Bacteria | 2287 |
| 641 | Ga0495635_0000007 | 3300046663 | Bacteria | 278786 |
| 642 | Ga0495635_0003765 | 3300046663 | Bacteria | 10530 |
| 643 | Ga0495635_0022386 | 3300046663 | Bacteria | 4401 |
| 644 | Ga0495657_0000250 | 3300046675 | Bacteria | 48717 |
| 645 | Ga0495657_0004218 | 3300046675 | Bacteria | 11502 |
| 646 | Ga0495657_0042950 | 3300046675 | Bacteria | 3084 |
| 647 | Ga0495657_0079786 | 3300046675 | Bacteria | 2119 |
| 648 | Ga0495657_0088595 | 3300046675 | Bacteria | 1989 |
| 649 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 650 | Ga0495599_0003707 | 3300046678 | Bacteria | 8955 |
| 651 | Ga0495623_0000116 | 3300046679 | Bacteria | 48662 |
| 652 | Ga0495623_0003634 | 3300046679 | Bacteria | 10190 |
| 653 | Ga0495623_0009851 | 3300046679 | Bacteria | 6192 |
| 654 | Ga0495646_0000049 | 3300046680 | Bacteria | 60856 |
| 655 | Ga0495646_0001656 | 3300046680 | Bacteria | 13313 |
| 656 | Ga0495658_0047198 | 3300046683 | Bacteria | 2424 |
| 657 | Ga0495658_0060728 | 3300046683 | Bacteria | 2169 |
| 658 | Ga0495658_0088403 | 3300046683 | Bacteria | 1831 |
| 659 | Ga0495658_0325352 | 3300046683 | Bacteria | 975 |
| 660 | Ga0495613_0253656 | 3300046689 | Bacteria | 1227 |
| 661 | Ga0495600_0000013 | 3300046809 | Bacteria | 119404 |
| 662 | Ga0495600_0012298 | 3300046809 | Bacteria | 5348 |
| 663 | Ga0495600_0268208 | 3300046809 | Bacteria | 1083 |
| 664 | Ga0495581_0028974 | 3300047315 | Bacteria | 3211 |
| 665 | Ga0495581_0054346 | 3300047315 | Bacteria | 2312 |
| 666 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 667 | Ga0495604_0003594 | 3300047317 | Bacteria | 12361 |
| 668 | Ga0495604_0004967 | 3300047317 | Bacteria | 10547 |
| 669 | Ga0495604_0010963 | 3300047317 | Bacteria | 7195 |
| 670 | Ga0495604_0210324 | 3300047317 | Bacteria | 1344 |
| 671 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 672 | Ga0495674_0008518 | 3300047319 | Bacteria | 9762 |
| 673 | Ga0495674_0009238 | 3300047319 | Bacteria | 9369 |
| 674 | Ga0495672_0105354 | 3300047320 | Bacteria | 1522 |
| 675 | Ga0495672_0151348 | 3300047320 | Bacteria | 1203 |
| 676 | Ga0495680_0004250 | 3300047322 | Bacteria | 13751 |
| 677 | Ga0495680_0039378 | 3300047322 | Bacteria | 3771 |
| 678 | Ga0495680_0054431 | 3300047322 | Bacteria | 3107 |
| 679 | Ga0495680_0075040 | 3300047322 | Bacteria | 2566 |
| 680 | Ga0495675_0000014 | 3300047444 | Bacteria | 137646 |
| 681 | Ga0495675_0002510 | 3300047444 | Bacteria | 10986 |
| 682 | Ga0495675_0037936 | 3300047444 | Bacteria | 3068 |
| 683 | Ga0495675_0127329 | 3300047444 | Bacteria | 1584 |
| 684 | Ga0495684_0000219 | 3300047471 | Bacteria | 44380 |
| 685 | Ga0495684_0033778 | 3300047471 | Bacteria | 3924 |
| 686 | Ga0495684_0180435 | 3300047471 | Bacteria | 1565 |
| 687 | Ga0495602_0000004 | 3300048088 | Bacteria | 326932 |
| 688 | Ga0495602_0006216 | 3300048088 | Bacteria | 12535 |
| 689 | Ga0495602_0014034 | 3300048088 | Bacteria | 8154 |
| 690 | Ga0495602_0064297 | 3300048088 | Bacteria | 3173 |
| 691 | Ga0495614_0036401 | 3300048089 | Bacteria | 2113 |
| 692 | Ga0496100_0000529 | 3300048903 | Bacteria | 18180 |
| 693 | Ga0496100_0079283 | 3300048903 | Bacteria | 2212 |
| 694 | Ga0496100_0314855 | 3300048903 | Bacteria | 1174 |
| 695 | Ga0496101_0000187 | 3300048904 | Bacteria | 48785 |
| 696 | Ga0496101_0008964 | 3300048904 | Bacteria | 6557 |
| 697 | Ga0496102_0008774 | 3300048905 | Bacteria | 8670 |
| 698 | Ga0496102_0092799 | 3300048905 | Bacteria | 2796 |
| 699 | Ga0496102_0230568 | 3300048905 | Bacteria | 1746 |
| 700 | Ga0496102_0243605 | 3300048905 | Bacteria | 1695 |
| 701 | Ga0496102_0318357 | 3300048905 | Bacteria | 1465 |
| 702 | Ga0496103_0000157 | 3300048906 | Bacteria | 71452 |
| 703 | Ga0496103_0100007 | 3300048906 | Bacteria | 1835 |
| 704 | Ga0496103_0145214 | 3300048906 | Bacteria | 1518 |
| 705 | Ga0496104_0000388 | 3300048907 | Bacteria | 38522 |
| 706 | Ga0496104_0207062 | 3300048907 | Bacteria | 1873 |
| 707 | Ga0496104_0270089 | 3300048907 | Bacteria | 1613 |
| 708 | Ga0496104_0294107 | 3300048907 | Bacteria | 1537 |
| 709 | Ga0496105_0000307 | 3300048908 | Bacteria | 32178 |
| 710 | Ga0496105_0025707 | 3300048908 | Bacteria | 4795 |
| 711 | Ga0496105_0064743 | 3300048908 | Bacteria | 3017 |
| 712 | Ga0496106_0003377 | 3300048909 | Bacteria | 11896 |
| 713 | Ga0496106_0017370 | 3300048909 | Bacteria | 5324 |
| 714 | Ga0496106_0035482 | 3300048909 | Bacteria | 3729 |
| 715 | Ga0496106_0152330 | 3300048909 | Bacteria | 1824 |
| 716 | Ga0496107_0000805 | 3300048910 | Bacteria | 18202 |
| 717 | Ga0496107_0075681 | 3300048910 | Bacteria | 2450 |
| 718 | Ga0496108_0003275 | 3300048911 | Bacteria | 13012 |
| 719 | Ga0496109_0000313 | 3300048912 | Bacteria | 45501 |
| 720 | Ga0496109_0001125 | 3300048912 | Bacteria | 22254 |
| 721 | Ga0496109_0251269 | 3300048912 | Bacteria | 1665 |
| 722 | Ga0496109_0535919 | 3300048912 | Bacteria | 1104 |
| 723 | Ga0496110_0055870 | 3300048913 | Bacteria | 3474 |
| 724 | Ga0496110_0066895 | 3300048913 | Bacteria | 3178 |
| 725 | Ga0496110_0353982 | 3300048913 | Bacteria | 1337 |
| 726 | Ga0496112_0408176 | 3300048915 | Bacteria | 1298 |
| 727 | Ga0496113_0078764 | 3300048916 | Bacteria | 2522 |
| 728 | Ga0496113_0321804 | 3300048916 | Bacteria | 1240 |
| 729 | Ga0496114_0020658 | 3300048917 | Bacteria | 5345 |
| 730 | Ga0496114_0024270 | 3300048917 | Bacteria | 4947 |
| 731 | Ga0496114_0652986 | 3300048917 | Bacteria | 925 |
| 732 | Ga0496115_0001217 | 3300048918 | Bacteria | 18461 |
| 733 | Ga0496115_0027409 | 3300048918 | Bacteria | 4456 |
| 734 | Ga0496115_0131060 | 3300048918 | Bacteria | 2066 |
| 735 | Ga0496115_0223886 | 3300048918 | Bacteria | 1552 |
| 736 | Ga0496118_0184308 | 3300048921 | Bacteria | 1257 |
| 737 | Ga0496126_0028568 | 3300048929 | Bacteria | 5313 |
| 738 | Ga0501031_0018031 | 3300049568 | Bacteria | 4591 |
| 739 | Ga0501032_0017773 | 3300049569 | Bacteria | 4991 |
| 740 | Ga0501033_0039461 | 3300049570 | Bacteria | 3526 |
| 741 | Ga0501033_0048162 | 3300049570 | Bacteria | 3166 |
| 742 | Ga0501033_0063506 | 3300049570 | Bacteria | 2718 |
| 743 | Ga0501034_0000616 | 3300049571 | Bacteria | 55864 |
| 744 | Ga0501034_0008229 | 3300049571 | Bacteria | 11039 |
| 745 | Ga0501034_0014011 | 3300049571 | Bacteria | 8255 |
| 746 | Ga0501034_0014223 | 3300049571 | Bacteria | 8203 |
| 747 | Ga0501034_0192087 | 3300049571 | Bacteria | 2003 |
| 748 | Ga0501034_0251021 | 3300049571 | Bacteria | 1713 |
| 749 | Ga0501036_0047287 | 3300049572 | Bacteria | 3644 |
| 750 | Ga0501036_0087238 | 3300049572 | Bacteria | 2637 |
| 751 | Ga0501036_0091655 | 3300049572 | Bacteria | 2567 |
| 752 | Ga0501036_0291403 | 3300049572 | Bacteria | 1365 |
| 753 | Ga0501037_0009677 | 3300049573 | Bacteria | 7074 |
| 754 | Ga0501037_0018243 | 3300049573 | Bacteria | 5170 |
| 755 | Ga0501037_0023898 | 3300049573 | Bacteria | 4520 |
| 756 | Ga0501037_0034118 | 3300049573 | Bacteria | 3756 |
| 757 | Ga0501038_0010995 | 3300049574 | Bacteria | 8264 |
| 758 | Ga0501038_0112956 | 3300049574 | Bacteria | 2248 |
| 759 | Ga0501038_0203958 | 3300049574 | Bacteria | 1585 |
| 760 | Ga0501039_0124947 | 3300049575 | Bacteria | 2018 |
| 761 | Ga0501039_0345861 | 3300049575 | Bacteria | 1168 |
| 762 | Ga0501040_0339825 | 3300049576 | Bacteria | 1075 |
| 763 | Ga0501040_0529764 | 3300049576 | Bacteria | 850 |
| 764 | Ga0501041_0110790 | 3300049577 | Bacteria | 1702 |
| 765 | Ga0501042_0212625 | 3300049578 | Bacteria | 1395 |
| 766 | Ga0501043_0028099 | 3300049579 | Bacteria | 4415 |
| 767 | Ga0501043_0084075 | 3300049579 | Bacteria | 2501 |
| 768 | Ga0501043_0151430 | 3300049579 | Bacteria | 1815 |
| 769 | Ga0501043_0168852 | 3300049579 | Bacteria | 1707 |
| 770 | Ga0501043_0272665 | 3300049579 | Bacteria | 1298 |
| 771 | Ga0501046_0153320 | 3300049580 | Bacteria | 1737 |
| 772 | Ga0501047_0006413 | 3300049581 | Bacteria | 11068 |
| 773 | Ga0501047_0009087 | 3300049581 | Bacteria | 9386 |
| 774 | Ga0501047_0011118 | 3300049581 | Bacteria | 8519 |
| 775 | Ga0501047_0091740 | 3300049581 | Bacteria | 2916 |
| 776 | Ga0501047_0238790 | 3300049581 | Bacteria | 1668 |
| 777 | Ga0501048_0114091 | 3300049582 | Bacteria | 1909 |
| 778 | Ga0501048_0300582 | 3300049582 | Bacteria | 1142 |
| 779 | Ga0501048_0403044 | 3300049582 | Bacteria | 978 |
| 780 | Ga0501067_0143566 | 3300049583 | Bacteria | 1330 |
| 781 | Ga0501068_0022329 | 3300049584 | Bacteria | 3699 |
| 782 | Ga0501068_0091851 | 3300049584 | Bacteria | 1873 |
| 783 | Ga0501068_0403489 | 3300049584 | Bacteria | 881 |
| 784 | Ga0501069_0068348 | 3300049585 | Bacteria | 1988 |
| 785 | Ga0501069_0175528 | 3300049585 | Bacteria | 1237 |
| 786 | Ga0501069_0395357 | 3300049585 | Bacteria | 817 |
| 787 | Ga0501070_0029989 | 3300049586 | Bacteria | 4557 |
| 788 | Ga0501070_0035360 | 3300049586 | Bacteria | 4175 |
| 789 | Ga0501070_0040714 | 3300049586 | Bacteria | 3874 |
| 790 | Ga0501070_0074396 | 3300049586 | Bacteria | 2812 |
| 791 | Ga0501070_0075813 | 3300049586 | Bacteria | 2784 |
| 792 | Ga0501070_0125475 | 3300049586 | Bacteria | 2121 |
| 793 | Ga0501070_0203780 | 3300049586 | Bacteria | 1624 |
| 794 | Ga0501070_0372415 | 3300049586 | Bacteria | 1157 |
| 795 | Ga0501071_0045769 | 3300049587 | Bacteria | 3141 |
| 796 | Ga0501072_0000674 | 3300049588 | Bacteria | 24677 |
| 797 | Ga0501072_0056931 | 3300049588 | Bacteria | 3080 |
| 798 | Ga0501072_0369844 | 3300049588 | Bacteria | 1138 |
| 799 | Ga0501072_0596696 | 3300049588 | Bacteria | 871 |
| 800 | Ga0501073_0005090 | 3300049589 | Bacteria | 9859 |
| 801 | Ga0501073_0191444 | 3300049589 | Bacteria | 1415 |
| 802 | Ga0501074_0152536 | 3300049590 | Bacteria | 1651 |
| 803 | Ga0501075_0033896 | 3300049591 | Bacteria | 3800 |
| 804 | Ga0501076_0077924 | 3300049592 | Bacteria | 2659 |
| 805 | Ga0501079_0073215 | 3300049741 | Bacteria | 2648 |
| 806 | Ga0501080_0012989 | 3300049742 | Bacteria | 7647 |
| 807 | Ga0501080_0050705 | 3300049742 | Bacteria | 3862 |
| 808 | Ga0501080_0075084 | 3300049742 | Bacteria | 3145 |
| 809 | Ga0501080_0131578 | 3300049742 | Bacteria | 2316 |
| 810 | Ga0501080_0143407 | 3300049742 | Bacteria | 2208 |
| 811 | Ga0501080_0170788 | 3300049742 | Bacteria | 2005 |
| 812 | Ga0501083_0001288 | 3300049744 | Bacteria | 16960 |
| 813 | Ga0501083_0013916 | 3300049744 | Bacteria | 5624 |
| 814 | Ga0501035_0007147 | 3300049822 | Bacteria | 10442 |
| 815 | Ga0501035_0172050 | 3300049822 | Bacteria | 1870 |
| 816 | Ga0501035_0252659 | 3300049822 | Bacteria | 1496 |
| 817 | Ga0501044_0010736 | 3300049823 | Bacteria | 9940 |
| 818 | Ga0501044_0068147 | 3300049823 | Bacteria | 3625 |
| 819 | Ga0501044_0076401 | 3300049823 | Bacteria | 3399 |
| 820 | Ga0501044_0130521 | 3300049823 | Bacteria | 2507 |
| 821 | Ga0501044_0193518 | 3300049823 | Bacteria | 1995 |
| 822 | Ga0501044_0215139 | 3300049823 | Bacteria | 1874 |
| 823 | Ga0501044_0255081 | 3300049823 | Bacteria | 1693 |
| 824 | Ga0501044_0452322 | 3300049823 | Bacteria | 1191 |
| 825 | Ga0501044_0505359 | 3300049823 | Bacteria | 1109 |
| 826 | Ga0501045_0473805 | 3300049824 | Bacteria | 930 |
| 827 | nmdc:mga03n38_50280_c1 | 3300050490 | Bacteria | 1857 |
| 828 | nmdc:mga00v17_42628_c1 | 3300050491 | Bacteria | 2730 |
| 829 | nmdc:mga00v17_82958_c1 | 3300050491 | Bacteria | 2004 |
| 830 | nmdc:mga0yw44_278724_c1 | 3300050492 | Bacteria | 1117 |
| 831 | nmdc:mga06z11_54699_c1 | 3300050494 | Bacteria | 2058 |
| 832 | nmdc:mga06z11_6126_c1 | 3300050494 | Bacteria | 4867 |
| 833 | nmdc:mga04h51_33699_c1 | 3300050495 | Bacteria | 1632 |
| 834 | nmdc:mga04h51_7388_c1 | 3300050495 | Bacteria | 2897 |
| 835 | nmdc:mga04h51_9915_c1 | 3300050495 | Bacteria | 1985 |
| 836 | nmdc:mga07m45_100802_c1 | 3300050496 | Bacteria | 1658 |
| 837 | nmdc:mga07m45_54348_c1 | 3300050496 | Bacteria | 2263 |
| 838 | nmdc:mga05p37_11988_c1 | 3300050507 | Bacteria | 10343 |
| 839 | nmdc:mga05p37_18354_c1 | 3300050507 | Bacteria | 8448 |
| 840 | nmdc:mga0qj67_228381_c1 | 3300050509 | Bacteria | 1510 |
| 841 | nmdc:mga0qj67_704_c1 | 3300050509 | Bacteria | 22789 |
| 842 | nmdc:mga08y16_133764_c1 | 3300050511 | Bacteria | 2577 |
| 843 | nmdc:mga08y16_142088_c1 | 3300050511 | Bacteria | 2495 |
| 844 | nmdc:mga08y16_1621_c1 | 3300050511 | Bacteria | 22793 |
| 845 | nmdc:mga08y16_168408_c1 | 3300050511 | Unclassified | 2276 |
| 846 | nmdc:mga08y16_2193_c1 | 3300050511 | Bacteria | 20044 |
| 847 | nmdc:mga08y16_231127_c1 | 3300050511 | Bacteria | 1913 |
| 848 | nmdc:mga08y16_238163_c1 | 3300050511 | Bacteria | 1881 |
| 849 | nmdc:mga0n895_1250_c1 | 3300050512 | Bacteria | 18758 |
| 850 | nmdc:mga0n895_12677_c1 | 3300050512 | Bacteria | 7569 |
| 851 | nmdc:mga0n895_267853_c1 | 3300050512 | Bacteria | 1733 |
| 852 | nmdc:mga0n895_45466_c1 | 3300050512 | Bacteria | 4284 |
| 853 | nmdc:mga0n895_867201_c1 | 3300050512 | Unclassified | 890 |
| 854 | nmdc:mga0rr50_260943_c1 | 3300050513 | Bacteria | 1441 |
| 855 | nmdc:mga08x19_23_c1 | 3300050514 | Bacteria | 288286 |
| 856 | nmdc:mga08x19_54995_c1 | 3300050514 | Bacteria | 2564 |
| 857 | nmdc:mga0a205_3872_c1 | 3300050515 | Bacteria | 13406 |
| 858 | nmdc:mga0a205_80336_c1 | 3300050515 | Bacteria | 3151 |
| 859 | nmdc:mga0a205_93540_c1 | 3300050515 | Bacteria | 1949 |
| 860 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 861 | Ga0495601_0000255 | 3300053077 | Bacteria | 28587 |
| 862 | Ga0495601_0014658 | 3300053077 | Bacteria | 4726 |
| 863 | Ga0495601_0065387 | 3300053077 | Bacteria | 2314 |
| 864 | Ga0495612_0000004 | 3300053078 | Bacteria | 286946 |
| 865 | Ga0495612_0003475 | 3300053078 | Bacteria | 6529 |
| 866 | Ga0495612_0003875 | 3300053078 | Bacteria | 6205 |
| 867 | Ga0495612_0013595 | 3300053078 | Bacteria | 3279 |
| 868 | Ga0495595_0000006 | 3300053084 | Bacteria | 231295 |
| 869 | Ga0495595_0001068 | 3300053084 | Bacteria | 10603 |
| 870 | Ga0495595_0003045 | 3300053084 | Bacteria | 6628 |
| 871 | Ga0495595_0008241 | 3300053084 | Bacteria | 4280 |
| 872 | Ga0495619_0000161 | 3300053085 | Bacteria | 49400 |
| 873 | Ga0495619_0000240 | 3300053085 | Bacteria | 39732 |
| 874 | Ga0495619_0004783 | 3300053085 | Bacteria | 8612 |
| 875 | Ga0495619_0009923 | 3300053085 | Bacteria | 5997 |
| 876 | Ga0495619_0017362 | 3300053085 | Bacteria | 4557 |
| 877 | Ga0495619_0022984 | 3300053085 | Bacteria | 3992 |
| 878 | Ga0495619_0075509 | 3300053085 | Bacteria | 2262 |
| 879 | Ga0500643_006735 | 3300053087 | Bacteria | 4748 |
| 880 | Ga0500644_0001049 | 3300053088 | Bacteria | 8235 |
| 881 | Ga0500651_0029241 | 3300053093 | Bacteria | 3465 |
| 882 | Ga0500641_0002552 | 3300053096 | Bacteria | 6431 |
| 883 | Ga0500641_0014864 | 3300053096 | Bacteria | 2878 |
| 884 | Ga0500594_0006844 | 3300053118 | Bacteria | 2569 |
| 885 | Ga0500595_000056 | 3300053119 | Bacteria | 83521 |
| 886 | Ga0500652_000030 | 3300053131 | Bacteria | 90754 |
| 887 | Ga0500655_016098 | 3300053133 | Bacteria | 1376 |
| 888 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 889 | Ga0500616_0153977 | 3300053153 | Bacteria | 1061 |
| 890 | Ga0500645_000384 | 3300053730 | Bacteria | 30994 |
| 891 | Ga0500645_031550 | 3300053730 | Bacteria | 1592 |
| 892 | Ga0501084_0564161 | 3300054114 | Bacteria | 962 |
| 893 | Ga0501082_0000365 | 3300060353 | Bacteria | 39948 |
| 894 | Ga0501082_0027281 | 3300060353 | Bacteria | 4918 |
| 895 | Ga0501082_0036920 | 3300060353 | Bacteria | 4209 |
| 896 | Ga0501082_0059171 | 3300060353 | Bacteria | 3302 |
| 897 | Ga0501082_0085460 | 3300060353 | Bacteria | 2721 |
| 898 | Ga0501082_0760422 | 3300060353 | Bacteria | 848 |
| 899 | Ga0530510_0020106 | 3300061734 | Bacteria | 4747 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049576 | Ga0501040_0529764 | Ga0501040_0529764_21_662 | 203 |
| 2 | 3300005617 | Ga0068859_100532973 | Ga0068859_1005329731 | 206 |
| 3 | 3300006931 | Ga0097620_100532907 | Ga0097620_1005329071 | 206 |
| 4 | 3300005331 | Ga0070670_100043806 | Ga0070670_1000438063 | 207 |
| 5 | 3300005843 | Ga0068860_100547411 | Ga0068860_1005474112 | 207 |
| 6 | 3300025925 | Ga0207650_10032858 | Ga0207650_100328584 | 207 |
| 7 | 3300025972 | Ga0207668_10047558 | Ga0207668_100475585 | 207 |
| 8 | 3300028381 | Ga0268264_10686908 | Ga0268264_106869082 | 207 |
| 9 | 3300049588 | Ga0501072_0596696 | Ga0501072_0596696_196_855 | 209 |
| 10 | 3300025904 | Ga0207647_10102240 | Ga0207647_101022403 | 210 |
| 11 | 3300042439 | Ga0439464_0122550 | Ga0439464_0122550_54_779 | 219 |
| 12 | 3300009147 | Ga0114129_10123024 | Ga0114129_101230242 | 223 |
| 13 | 3300009094 | Ga0111539_10255793 | Ga0111539_102557934 | 224 |
| 14 | 3300050511 | nmdc:mga08y16_142088_c1 | nmdc:mga08y16_142088_c1_648_1421 | 225 |
| 15 | 3300049576 | Ga0501040_0339825 | Ga0501040_0339825_200_970 | 226 |
| 16 | 3300049577 | Ga0501041_0110790 | Ga0501041_0110790_317_1087 | 226 |
| 17 | 3300049582 | Ga0501048_0114091 | Ga0501048_0114091_199_969 | 226 |
| 18 | 3300049587 | Ga0501071_0045769 | Ga0501071_0045769_1030_1800 | 226 |
| 19 | 3300049588 | Ga0501072_0056931 | Ga0501072_0056931_1246_2016 | 226 |
| 20 | 3300049591 | Ga0501075_0033896 | Ga0501075_0033896_2242_3012 | 226 |
| 21 | 3300049741 | Ga0501079_0073215 | Ga0501079_0073215_1425_2195 | 226 |
| 22 | 3300061734 | Ga0530510_0020106 | Ga0530510_0020106_2322_3092 | 226 |
| 23 | 3300005614 | Ga0068856_100070595 | Ga0068856_1000705953 | 228 |
| 24 | 3300025899 | Ga0207642_10104663 | Ga0207642_101046632 | 228 |
| 25 | 3300025916 | Ga0207663_10287520 | Ga0207663_102875202 | 228 |
| 26 | 3300025939 | Ga0207665_10024162 | Ga0207665_100241625 | 228 |
| 27 | 3300035086 | Ga0373934_0020106 | Ga0373934_0020106_1780_2550 | 228 |
| 28 | 3300035118 | Ga0373954_0047975 | Ga0373954_0047975_1175_1945 | 228 |
| 29 | 3300035119 | Ga0373956_0005348 | Ga0373956_0005348_28_798 | 228 |
| 30 | 3300035172 | Ga0373955_0008083 | Ga0373955_0008083_2215_2985 | 228 |
| 31 | 3300035724 | Ga0373933_0001351 | Ga0373933_0001351_2045_2815 | 228 |
| 32 | 3300036401 | Ga0373937_0004518 | Ga0373937_0004518_2249_3019 | 228 |
| 33 | 3300046529 | Ga0495652_0348758 | Ga0495652_0348758_56_826 | 228 |
| 34 | 3300046536 | Ga0495587_0069068 | Ga0495587_0069068_112_882 | 228 |
| 35 | 3300046559 | Ga0495667_0086409 | Ga0495667_0086409_946_1716 | 228 |
| 36 | 3300046675 | Ga0495657_0042950 | Ga0495657_0042950_2129_2899 | 228 |
| 37 | 3300047317 | Ga0495604_0210324 | Ga0495604_0210324_261_1031 | 228 |
| 38 | 3300047322 | Ga0495680_0075040 | Ga0495680_0075040_1517_2287 | 228 |
| 39 | 3300047444 | Ga0495675_0037936 | Ga0495675_0037936_2271_3047 | 228 |
| 40 | 3300048088 | Ga0495602_0064297 | Ga0495602_0064297_2319_3089 | 228 |
| 41 | 3300053077 | Ga0495601_0065387 | Ga0495601_0065387_1113_1883 | 228 |
| 42 | 3300053078 | Ga0495612_0013595 | Ga0495612_0013595_2154_2924 | 228 |
| 43 | 3300053084 | Ga0495595_0008241 | Ga0495595_0008241_1596_2366 | 228 |
| 44 | 3300053085 | Ga0495619_0009923 | Ga0495619_0009923_4652_5422 | 228 |
| 45 | 3300005337 | Ga0070682_100051332 | Ga0070682_1000513321 | 229 |
| 46 | 3300005355 | Ga0070671_100028391 | Ga0070671_1000283913 | 229 |
| 47 | 3300005367 | Ga0070667_100011748 | Ga0070667_1000117488 | 229 |
| 48 | 3300005434 | Ga0070709_10290588 | Ga0070709_102905882 | 229 |
| 49 | 3300005436 | Ga0070713_100015641 | Ga0070713_1000156415 | 229 |
| 50 | 3300005437 | Ga0070710_10019002 | Ga0070710_100190022 | 229 |
| 51 | 3300005439 | Ga0070711_100036932 | Ga0070711_1000369322 | 229 |
| 52 | 3300005439 | Ga0070711_100325117 | Ga0070711_1003251171 | 229 |
| 53 | 3300005455 | Ga0070663_100092523 | Ga0070663_1000925233 | 229 |
| 54 | 3300005456 | Ga0070678_100359786 | Ga0070678_1003597862 | 229 |
| 55 | 3300005458 | Ga0070681_10390463 | Ga0070681_103904632 | 229 |
| 56 | 3300005468 | Ga0070707_100546964 | Ga0070707_1005469642 | 229 |
| 57 | 3300005530 | Ga0070679_100052219 | Ga0070679_1000522192 | 229 |
| 58 | 3300005545 | Ga0070695_100082509 | Ga0070695_1000825092 | 229 |
| 59 | 3300005548 | Ga0070665_100109057 | Ga0070665_1001090572 | 229 |
| 60 | 3300005549 | Ga0070704_100118122 | Ga0070704_1001181222 | 229 |
| 61 | 3300005578 | Ga0068854_100156484 | Ga0068854_1001564842 | 229 |
| 62 | 3300005842 | Ga0068858_100035496 | Ga0068858_1000354963 | 229 |
| 63 | 3300005937 | Ga0081455_10009792 | Ga0081455_1000979213 | 229 |
| 64 | 3300006028 | Ga0070717_10353030 | Ga0070717_103530302 | 229 |
| 65 | 3300006042 | Ga0075368_10038132 | Ga0075368_100381322 | 229 |
| 66 | 3300006175 | Ga0070712_100465114 | Ga0070712_1004651141 | 229 |
| 67 | 3300006237 | Ga0097621_100161114 | Ga0097621_1001611143 | 229 |
| 68 | 3300006358 | Ga0068871_100058204 | Ga0068871_1000582042 | 229 |
| 69 | 3300006881 | Ga0068865_100047404 | Ga0068865_1000474042 | 229 |
| 70 | 3300007076 | Ga0075435_100062416 | Ga0075435_1000624162 | 229 |
| 71 | 3300009098 | Ga0105245_10165436 | Ga0105245_101654362 | 229 |
| 72 | 3300009101 | Ga0105247_10017431 | Ga0105247_100174316 | 229 |
| 73 | 3300009148 | Ga0105243_10043961 | Ga0105243_100439614 | 229 |
| 74 | 3300009176 | Ga0105242_10175706 | Ga0105242_101757062 | 229 |
| 75 | 3300009545 | Ga0105237_10023502 | Ga0105237_100235022 | 229 |
| 76 | 3300009551 | Ga0105238_10178405 | Ga0105238_101784054 | 229 |
| 77 | 3300011119 | Ga0105246_10039853 | Ga0105246_100398533 | 229 |
| 78 | 3300013306 | Ga0163162_10109363 | Ga0163162_101093633 | 229 |
| 79 | 3300014969 | Ga0157376_10283299 | Ga0157376_102832992 | 229 |
| 80 | 3300021384 | Ga0213876_10003554 | Ga0213876_100035547 | 229 |
| 81 | 3300025898 | Ga0207692_10047300 | Ga0207692_100473002 | 229 |
| 82 | 3300025903 | Ga0207680_10028611 | Ga0207680_100286112 | 229 |
| 83 | 3300025906 | Ga0207699_10044580 | Ga0207699_100445802 | 229 |
| 84 | 3300025906 | Ga0207699_10101992 | Ga0207699_101019922 | 229 |
| 85 | 3300025907 | Ga0207645_10275901 | Ga0207645_102759012 | 229 |
| 86 | 3300025914 | Ga0207671_10070434 | Ga0207671_100704342 | 229 |
| 87 | 3300025916 | Ga0207663_10030770 | Ga0207663_100307702 | 229 |
| 88 | 3300025916 | Ga0207663_10062800 | Ga0207663_100628002 | 229 |
| 89 | 3300025919 | Ga0207657_10267313 | Ga0207657_102673133 | 229 |
| 90 | 3300025922 | Ga0207646_10638428 | Ga0207646_106384281 | 229 |
| 91 | 3300025927 | Ga0207687_10097059 | Ga0207687_100970592 | 229 |
| 92 | 3300025928 | Ga0207700_10036373 | Ga0207700_100363733 | 229 |
| 93 | 3300025931 | Ga0207644_10033573 | Ga0207644_100335735 | 229 |
| 94 | 3300025933 | Ga0207706_10016484 | Ga0207706_100164843 | 229 |
| 95 | 3300025934 | Ga0207686_10135390 | Ga0207686_101353902 | 229 |
| 96 | 3300025935 | Ga0207709_10038133 | Ga0207709_100381332 | 229 |
| 97 | 3300025939 | Ga0207665_10393127 | Ga0207665_103931271 | 229 |
| 98 | 3300025986 | Ga0207658_10202277 | Ga0207658_102022771 | 229 |
| 99 | 3300026075 | Ga0207708_10297523 | Ga0207708_102975232 | 229 |
| 100 | 3300026121 | Ga0207683_10097759 | Ga0207683_100977592 | 229 |
| 101 | 3300028381 | Ga0268264_10045929 | Ga0268264_100459296 | 229 |
| 102 | 3300028800 | Ga0265338_10097140 | Ga0265338_100971403 | 229 |
| 103 | 3300031241 | Ga0265325_10000093 | Ga0265325_1000009339 | 229 |
| 104 | 3300031344 | Ga0265316_10064653 | Ga0265316_100646532 | 229 |
| 105 | 3300031595 | Ga0265313_10010885 | Ga0265313_100108857 | 229 |
| 106 | 3300031595 | Ga0265313_10072842 | Ga0265313_100728422 | 229 |
| 107 | 3300035092 | Ga0373952_0069870 | Ga0373952_0069870_93_863 | 229 |
| 108 | 3300035111 | Ga0373923_0014045 | Ga0373923_0014045_123_893 | 229 |
| 109 | 3300035111 | Ga0373923_0071407 | Ga0373923_0071407_586_1356 | 229 |
| 110 | 3300035113 | Ga0373936_0072337 | Ga0373936_0072337_386_1156 | 229 |
| 111 | 3300035117 | Ga0373953_0015687 | Ga0373953_0015687_1329_2099 | 229 |
| 112 | 3300035118 | Ga0373954_0000646 | Ga0373954_0000646_8203_8973 | 229 |
| 113 | 3300035119 | Ga0373956_0008694 | Ga0373956_0008694_315_1085 | 229 |
| 114 | 3300035119 | Ga0373956_0035310 | Ga0373956_0035310_984_1754 | 229 |
| 115 | 3300035120 | Ga0373957_0039562 | Ga0373957_0039562_804_1574 | 229 |
| 116 | 3300035170 | Ga0373943_0271109 | Ga0373943_0271109_48_818 | 229 |
| 117 | 3300035172 | Ga0373955_0017545 | Ga0373955_0017545_347_1117 | 229 |
| 118 | 3300035172 | Ga0373955_0043769 | Ga0373955_0043769_560_1330 | 229 |
| 119 | 3300035692 | Ga0373935_0013696 | Ga0373935_0013696_585_1355 | 229 |
| 120 | 3300035724 | Ga0373933_0002708 | Ga0373933_0002708_9048_9818 | 229 |
| 121 | 3300035724 | Ga0373933_0010009 | Ga0373933_0010009_1780_2550 | 229 |
| 122 | 3300036401 | Ga0373937_0014695 | Ga0373937_0014695_5876_6646 | 229 |
| 123 | 3300036401 | Ga0373937_0068182 | Ga0373937_0068182_1729_2499 | 229 |
| 124 | 3300039437 | Ga0436365_1416741 | Ga0436365_1416741_3813_4583 | 229 |
| 125 | 3300046454 | Ga0495592_0012444 | Ga0495592_0012444_4213_4983 | 229 |
| 126 | 3300046454 | Ga0495592_0022783 | Ga0495592_0022783_781_1551 | 229 |
| 127 | 3300046454 | Ga0495592_0063289 | Ga0495592_0063289_1573_2343 | 229 |
| 128 | 3300046455 | Ga0495603_0034527 | Ga0495603_0034527_1505_2275 | 229 |
| 129 | 3300046462 | Ga0495651_0003778 | Ga0495651_0003778_4665_5435 | 229 |
| 130 | 3300046462 | Ga0495651_0056228 | Ga0495651_0056228_1749_2519 | 229 |
| 131 | 3300046462 | Ga0495651_0153038 | Ga0495651_0153038_184_954 | 229 |
| 132 | 3300046463 | Ga0495653_0190091 | Ga0495653_0190091_164_934 | 229 |
| 133 | 3300046472 | Ga0495580_0242200 | Ga0495580_0242200_382_1152 | 229 |
| 134 | 3300046473 | Ga0495582_0135861 | Ga0495582_0135861_72_842 | 229 |
| 135 | 3300046477 | Ga0495664_0003133 | Ga0495664_0003133_5177_5947 | 229 |
| 136 | 3300046511 | Ga0495608_0003179 | Ga0495608_0003179_1744_2514 | 229 |
| 137 | 3300046511 | Ga0495608_0036553 | Ga0495608_0036553_615_1385 | 229 |
| 138 | 3300046514 | Ga0495618_0370126 | Ga0495618_0370126_34_804 | 229 |
| 139 | 3300046516 | Ga0495628_0056178 | Ga0495628_0056178_1741_2511 | 229 |
| 140 | 3300046516 | Ga0495628_0058558 | Ga0495628_0058558_273_1043 | 229 |
| 141 | 3300046529 | Ga0495652_0075995 | Ga0495652_0075995_277_1047 | 229 |
| 142 | 3300046529 | Ga0495652_0085573 | Ga0495652_0085573_25_795 | 229 |
| 143 | 3300046533 | Ga0495640_0007041 | Ga0495640_0007041_2048_2818 | 229 |
| 144 | 3300046533 | Ga0495640_0017686 | Ga0495640_0017686_2945_3715 | 229 |
| 145 | 3300046533 | Ga0495640_0181369 | Ga0495640_0181369_347_1117 | 229 |
| 146 | 3300046536 | Ga0495587_0001919 | Ga0495587_0001919_3029_3799 | 229 |
| 147 | 3300046543 | Ga0495645_0004673 | Ga0495645_0004673_4776_5546 | 229 |
| 148 | 3300046543 | Ga0495645_0029398 | Ga0495645_0029398_3165_3935 | 229 |
| 149 | 3300046559 | Ga0495667_0002357 | Ga0495667_0002357_277_1047 | 229 |
| 150 | 3300046559 | Ga0495667_0002421 | Ga0495667_0002421_9792_10562 | 229 |
| 151 | 3300046559 | Ga0495667_0017507 | Ga0495667_0017507_1597_2367 | 229 |
| 152 | 3300046642 | Ga0495634_0071337 | Ga0495634_0071337_215_985 | 229 |
| 153 | 3300046663 | Ga0495635_0003765 | Ga0495635_0003765_3029_3799 | 229 |
| 154 | 3300046663 | Ga0495635_0022386 | Ga0495635_0022386_364_1134 | 229 |
| 155 | 3300046675 | Ga0495657_0004218 | Ga0495657_0004218_4644_5414 | 229 |
| 156 | 3300046675 | Ga0495657_0079786 | Ga0495657_0079786_253_1023 | 229 |
| 157 | 3300046675 | Ga0495657_0088595 | Ga0495657_0088595_1034_1804 | 229 |
| 158 | 3300046678 | Ga0495599_0003707 | Ga0495599_0003707_5542_6312 | 229 |
| 159 | 3300046679 | Ga0495623_0003634 | Ga0495623_0003634_9241_10011 | 229 |
| 160 | 3300046679 | Ga0495623_0009851 | Ga0495623_0009851_4742_5512 | 229 |
| 161 | 3300046680 | Ga0495646_0001656 | Ga0495646_0001656_11064_11834 | 229 |
| 162 | 3300046683 | Ga0495658_0060728 | Ga0495658_0060728_338_1108 | 229 |
| 163 | 3300046683 | Ga0495658_0325352 | Ga0495658_0325352_103_873 | 229 |
| 164 | 3300046809 | Ga0495600_0012298 | Ga0495600_0012298_4155_4925 | 229 |
| 165 | 3300046809 | Ga0495600_0268208 | Ga0495600_0268208_97_867 | 229 |
| 166 | 3300047315 | Ga0495581_0054346 | Ga0495581_0054346_659_1429 | 229 |
| 167 | 3300047317 | Ga0495604_0003594 | Ga0495604_0003594_5734_6504 | 229 |
| 168 | 3300047317 | Ga0495604_0004967 | Ga0495604_0004967_9753_10523 | 229 |
| 169 | 3300047317 | Ga0495604_0010963 | Ga0495604_0010963_1295_2065 | 229 |
| 170 | 3300047319 | Ga0495674_0008518 | Ga0495674_0008518_7716_8486 | 229 |
| 171 | 3300047319 | Ga0495674_0009238 | Ga0495674_0009238_5455_6225 | 229 |
| 172 | 3300047322 | Ga0495680_0039378 | Ga0495680_0039378_102_872 | 229 |
| 173 | 3300047322 | Ga0495680_0054431 | Ga0495680_0054431_576_1346 | 229 |
| 174 | 3300047444 | Ga0495675_0002510 | Ga0495675_0002510_5846_6616 | 229 |
| 175 | 3300047444 | Ga0495675_0127329 | Ga0495675_0127329_481_1251 | 229 |
| 176 | 3300047471 | Ga0495684_0033778 | Ga0495684_0033778_396_1166 | 229 |
| 177 | 3300047471 | Ga0495684_0180435 | Ga0495684_0180435_451_1221 | 229 |
| 178 | 3300048088 | Ga0495602_0006216 | Ga0495602_0006216_3241_4011 | 229 |
| 179 | 3300048088 | Ga0495602_0014034 | Ga0495602_0014034_1488_2258 | 229 |
| 180 | 3300048089 | Ga0495614_0036401 | Ga0495614_0036401_589_1359 | 229 |
| 181 | 3300048903 | Ga0496100_0079283 | Ga0496100_0079283_596_1366 | 229 |
| 182 | 3300048904 | Ga0496101_0008964 | Ga0496101_0008964_4235_5005 | 229 |
| 183 | 3300048905 | Ga0496102_0243605 | Ga0496102_0243605_138_908 | 229 |
| 184 | 3300048905 | Ga0496102_0318357 | Ga0496102_0318357_94_864 | 229 |
| 185 | 3300048906 | Ga0496103_0145214 | Ga0496103_0145214_697_1467 | 229 |
| 186 | 3300048907 | Ga0496104_0000388 | Ga0496104_0000388_31363_32133 | 229 |
| 187 | 3300048907 | Ga0496104_0294107 | Ga0496104_0294107_71_841 | 229 |
| 188 | 3300048908 | Ga0496105_0000307 | Ga0496105_0000307_21224_21994 | 229 |
| 189 | 3300048908 | Ga0496105_0025707 | Ga0496105_0025707_1799_2569 | 229 |
| 190 | 3300048909 | Ga0496106_0152330 | Ga0496106_0152330_896_1666 | 229 |
| 191 | 3300048910 | Ga0496107_0075681 | Ga0496107_0075681_593_1363 | 229 |
| 192 | 3300048912 | Ga0496109_0535919 | Ga0496109_0535919_296_1066 | 229 |
| 193 | 3300048913 | Ga0496110_0055870 | Ga0496110_0055870_52_822 | 229 |
| 194 | 3300048915 | Ga0496112_0408176 | Ga0496112_0408176_188_958 | 229 |
| 195 | 3300048916 | Ga0496113_0321804 | Ga0496113_0321804_62_832 | 229 |
| 196 | 3300048917 | Ga0496114_0020658 | Ga0496114_0020658_1137_1907 | 229 |
| 197 | 3300048918 | Ga0496115_0027409 | Ga0496115_0027409_3146_3916 | 229 |
| 198 | 3300049568 | Ga0501031_0018031 | Ga0501031_0018031_895_1665 | 229 |
| 199 | 3300049569 | Ga0501032_0017773 | Ga0501032_0017773_3078_3848 | 229 |
| 200 | 3300049570 | Ga0501033_0048162 | Ga0501033_0048162_884_1654 | 229 |
| 201 | 3300049572 | Ga0501036_0047287 | Ga0501036_0047287_2650_3420 | 229 |
| 202 | 3300049573 | Ga0501037_0018243 | Ga0501037_0018243_2634_3404 | 229 |
| 203 | 3300049574 | Ga0501038_0010995 | Ga0501038_0010995_3748_4518 | 229 |
| 204 | 3300049575 | Ga0501039_0124947 | Ga0501039_0124947_328_1098 | 229 |
| 205 | 3300049579 | Ga0501043_0151430 | Ga0501043_0151430_148_918 | 229 |
| 206 | 3300049581 | Ga0501047_0091740 | Ga0501047_0091740_1995_2765 | 229 |
| 207 | 3300049586 | Ga0501070_0040714 | Ga0501070_0040714_2705_3475 | 229 |
| 208 | 3300049822 | Ga0501035_0252659 | Ga0501035_0252659_346_1116 | 229 |
| 209 | 3300049823 | Ga0501044_0193518 | Ga0501044_0193518_986_1756 | 229 |
| 210 | 3300050495 | nmdc:mga04h51_7388_c1 | nmdc:mga04h51_7388_c1_1733_2503 | 229 |
| 211 | 3300050513 | nmdc:mga0rr50_260943_c1 | nmdc:mga0rr50_260943_c1_493_1263 | 229 |
| 212 | 3300053077 | Ga0495601_0000255 | Ga0495601_0000255_22919_23689 | 229 |
| 213 | 3300053077 | Ga0495601_0014658 | Ga0495601_0014658_233_1003 | 229 |
| 214 | 3300053078 | Ga0495612_0003475 | Ga0495612_0003475_101_871 | 229 |
| 215 | 3300053078 | Ga0495612_0003875 | Ga0495612_0003875_3259_4029 | 229 |
| 216 | 3300053084 | Ga0495595_0001068 | Ga0495595_0001068_9245_10015 | 229 |
| 217 | 3300053084 | Ga0495595_0003045 | Ga0495595_0003045_2839_3609 | 229 |
| 218 | 3300053085 | Ga0495619_0000161 | Ga0495619_0000161_5786_6556 | 229 |
| 219 | 3300053085 | Ga0495619_0004783 | Ga0495619_0004783_5068_5838 | 229 |
| 220 | 3300053085 | Ga0495619_0022984 | Ga0495619_0022984_1615_2385 | 229 |
| 221 | 3300060353 | Ga0501082_0027281 | Ga0501082_0027281_3153_3923 | 229 |
| 222 | 3300031344 | Ga0265316_10173121 | Ga0265316_101731213 | 231 |
| 223 | 3300003316 | rootH1_10019190 | rootH1_100191901 | 232 |
| 224 | 3300053153 | Ga0500616_0153977 | Ga0500616_0153977_223_993 | 232 |
| 225 | 3300025924 | Ga0207694_10128015 | Ga0207694_101280152 | 233 |
| 226 | 3300027614 | Ga0209970_1004641 | Ga0209970_10046412 | 233 |
| 227 | 3300047320 | Ga0495672_0105354 | Ga0495672_0105354_30_800 | 233 |
| 228 | 3300048921 | Ga0496118_0184308 | Ga0496118_0184308_134_901 | 233 |
| 229 | 3300005329 | Ga0070683_100088494 | Ga0070683_1000884943 | 234 |
| 230 | 3300005336 | Ga0070680_100147897 | Ga0070680_1001478973 | 234 |
| 231 | 3300005356 | Ga0070674_100009282 | Ga0070674_1000092822 | 234 |
| 232 | 3300005435 | Ga0070714_100007544 | Ga0070714_1000075444 | 234 |
| 233 | 3300005458 | Ga0070681_10164684 | Ga0070681_101646842 | 234 |
| 234 | 3300005530 | Ga0070679_100361578 | Ga0070679_1003615782 | 234 |
| 235 | 3300005617 | Ga0068859_100372990 | Ga0068859_1003729902 | 234 |
| 236 | 3300006175 | Ga0070712_100034300 | Ga0070712_1000343002 | 234 |
| 237 | 3300006931 | Ga0097620_100372998 | Ga0097620_1003729982 | 234 |
| 238 | 3300009174 | Ga0105241_10081088 | Ga0105241_100810882 | 234 |
| 239 | 3300009545 | Ga0105237_10050388 | Ga0105237_100503884 | 234 |
| 240 | 3300009551 | Ga0105238_10011409 | Ga0105238_1001140911 | 234 |
| 241 | 3300010375 | Ga0105239_10244850 | Ga0105239_102448503 | 234 |
| 242 | 3300013104 | Ga0157370_10194826 | Ga0157370_101948262 | 234 |
| 243 | 3300013105 | Ga0157369_10186322 | Ga0157369_101863222 | 234 |
| 244 | 3300025898 | Ga0207692_10119115 | Ga0207692_101191152 | 234 |
| 245 | 3300025911 | Ga0207654_10059728 | Ga0207654_100597282 | 234 |
| 246 | 3300025915 | Ga0207693_10014866 | Ga0207693_100148667 | 234 |
| 247 | 3300025917 | Ga0207660_10268310 | Ga0207660_102683102 | 234 |
| 248 | 3300025929 | Ga0207664_10470601 | Ga0207664_104706012 | 234 |
| 249 | 3300025944 | Ga0207661_10092015 | Ga0207661_100920152 | 234 |
| 250 | 3300026035 | Ga0207703_10447264 | Ga0207703_104472642 | 234 |
| 251 | 3300031241 | Ga0265325_10001052 | Ga0265325_100010528 | 234 |
| 252 | 3300031344 | Ga0265316_10135669 | Ga0265316_101356691 | 234 |
| 253 | 3300031595 | Ga0265313_10006019 | Ga0265313_100060196 | 234 |
| 254 | 3300035724 | Ga0373933_0354727 | Ga0373933_0354727_46_906 | 234 |
| 255 | 3300036401 | Ga0373937_0066291 | Ga0373937_0066291_2431_3291 | 234 |
| 256 | 3300039437 | Ga0436365_0689921 | Ga0436365_0689921_576_1346 | 234 |
| 257 | 3300046454 | Ga0495592_0336631 | Ga0495592_0336631_27_794 | 234 |
| 258 | 3300050509 | nmdc:mga0qj67_228381_c1 | nmdc:mga0qj67_228381_c1_35_808 | 234 |
| 259 | 3300053096 | Ga0500641_0014864 | Ga0500641_0014864_1029_1799 | 234 |
| 260 | 3300006038 | Ga0075365_10306005 | Ga0075365_103060051 | 235 |
| 261 | 3300050492 | nmdc:mga0yw44_278724_c1 | nmdc:mga0yw44_278724_c1_316_1086 | 235 |
| 262 | 3300035115 | Ga0373941_0067561 | Ga0373941_0067561_389_1159 | 236 |
| 263 | 3300060353 | Ga0501082_0760422 | Ga0501082_0760422_96_836 | 236 |
| 264 | 3300013100 | Ga0157373_10053754 | Ga0157373_100537542 | 237 |
| 265 | 3300036401 | Ga0373937_0433875 | Ga0373937_0433875_33_800 | 237 |
| 266 | 3300048909 | Ga0496106_0035482 | Ga0496106_0035482_668_1438 | 237 |
| 267 | 3300050512 | nmdc:mga0n895_45466_c1 | nmdc:mga0n895_45466_c1_3359_4267 | 237 |
| 268 | 3300005983 | Ga0081540_1078594 | Ga0081540_10785942 | 238 |
| 269 | iso_pu_bacteria | 2842694124 | 2842697937 | 238 |
| 270 | 3300005535 | Ga0070684_100716989 | Ga0070684_1007169892 | 239 |
| 271 | 3300006042 | Ga0075368_10018895 | Ga0075368_100188953 | 239 |
| 272 | 3300006048 | Ga0075363_100083856 | Ga0075363_1000838562 | 239 |
| 273 | 3300006051 | Ga0075364_10245725 | Ga0075364_102457252 | 239 |
| 274 | 3300006178 | Ga0075367_10046406 | Ga0075367_100464062 | 239 |
| 275 | 3300009551 | Ga0105238_10042527 | Ga0105238_100425272 | 239 |
| 276 | 3300049572 | Ga0501036_0091655 | Ga0501036_0091655_890_1660 | 239 |
| 277 | 3300049579 | Ga0501043_0084075 | Ga0501043_0084075_815_1585 | 239 |
| 278 | 3300049582 | Ga0501048_0403044 | Ga0501048_0403044_44_814 | 239 |
| 279 | 3300049586 | Ga0501070_0029989 | Ga0501070_0029989_503_1273 | 239 |
| 280 | 3300049586 | Ga0501070_0035360 | Ga0501070_0035360_1450_2220 | 239 |
| 281 | 3300049588 | Ga0501072_0369844 | Ga0501072_0369844_58_828 | 239 |
| 282 | 3300050490 | nmdc:mga03n38_50280_c1 | nmdc:mga03n38_50280_c1_442_1212 | 239 |
| 283 | 3300050494 | nmdc:mga06z11_54699_c1 | nmdc:mga06z11_54699_c1_1179_1949 | 239 |
| 284 | 3300050495 | nmdc:mga04h51_33699_c1 | nmdc:mga04h51_33699_c1_593_1363 | 239 |
| 285 | 3300050496 | nmdc:mga07m45_54348_c1 | nmdc:mga07m45_54348_c1_1056_1826 | 239 |
| 286 | 3300021384 | Ga0213876_10055020 | Ga0213876_100550203 | 240 |
| 287 | 3300027543 | Ga0209999_1012910 | Ga0209999_10129102 | 240 |
| 288 | 3300039437 | Ga0436365_1172725 | Ga0436365_1172725_704_1471 | 240 |
| 289 | 3300042439 | Ga0439464_0012964 | Ga0439464_0012964_1243_2013 | 240 |
| 290 | 3300005436 | Ga0070713_100116108 | Ga0070713_1001161083 | 241 |
| 291 | 3300025898 | Ga0207692_10237895 | Ga0207692_102378952 | 241 |
| 292 | 3300025929 | Ga0207664_10347809 | Ga0207664_103478092 | 241 |
| 293 | iso_pu_bacteria | 2643221547 | 2643755441 | 241 |
| 294 | 3300024225 | Ga0224572_1009661 | Ga0224572_10096612 | 242 |
| 295 | 3300031090 | Ga0265760_10005992 | Ga0265760_100059923 | 242 |
| 296 | 3300049588 | Ga0501072_0000674 | Ga0501072_0000674_17623_18393 | 242 |
| 297 | 3300060353 | Ga0501082_0059171 | Ga0501082_0059171_1783_2553 | 242 |
| 298 | iso_pu_bacteria | 2513237101 | 2513695459 | 242 |
| 299 | 3300005937 | Ga0081455_10027923 | Ga0081455_100279233 | 244 |
| 300 | 3300031241 | Ga0265325_10006146 | Ga0265325_100061464 | 244 |
| 301 | 3300031249 | Ga0265339_10006787 | Ga0265339_100067874 | 244 |
| 302 | 3300031344 | Ga0265316_10115830 | Ga0265316_101158304 | 244 |
| 303 | 3300031595 | Ga0265313_10010557 | Ga0265313_100105574 | 244 |
| 304 | 3300049570 | Ga0501033_0039461 | Ga0501033_0039461_849_1619 | 244 |
| 305 | 3300049581 | Ga0501047_0011118 | Ga0501047_0011118_3019_3789 | 244 |
| 306 | 3300049586 | Ga0501070_0074396 | Ga0501070_0074396_717_1487 | 244 |
| 307 | 3300049823 | Ga0501044_0076401 | Ga0501044_0076401_1193_1963 | 244 |
| 308 | 3300049823 | Ga0501044_0452322 | Ga0501044_0452322_336_1106 | 244 |
| 309 | 3300001430 | JGI24032J14994_100202 | JGI24032J14994_1002026 | 245 |
| 310 | 3300001979 | JGI24740J21852_10028821 | JGI24740J21852_100288213 | 245 |
| 311 | 3300001989 | JGI24739J22299_10002358 | JGI24739J22299_100023586 | 245 |
| 312 | 3300001990 | JGI24737J22298_10001122 | JGI24737J22298_100011226 | 245 |
| 313 | 3300001991 | JGI24743J22301_10001232 | JGI24743J22301_100012326 | 245 |
| 314 | 3300002070 | JGI24750J21931_1000032 | JGI24750J21931_100003216 | 245 |
| 315 | 3300002073 | JGI24745J21846_1002345 | JGI24745J21846_10023453 | 245 |
| 316 | 3300002074 | JGI24748J21848_1002107 | JGI24748J21848_10021072 | 245 |
| 317 | 3300002075 | JGI24738J21930_10002299 | JGI24738J21930_100022993 | 245 |
| 318 | 3300002076 | JGI24749J21850_1000809 | JGI24749J21850_10008092 | 245 |
| 319 | 3300002126 | JGI24035J26624_1000092 | JGI24035J26624_10000925 | 245 |
| 320 | 3300002155 | JGI24033J26618_1000309 | JGI24033J26618_10003092 | 245 |
| 321 | 3300002239 | JGI24034J26672_10000536 | JGI24034J26672_100005363 | 245 |
| 322 | 3300002244 | JGI24742J22300_10000050 | JGI24742J22300_1000005016 | 245 |
| 323 | 3300005290 | Ga0065712_10084044 | Ga0065712_100840442 | 245 |
| 324 | 3300005293 | Ga0065715_10091974 | Ga0065715_100919742 | 245 |
| 325 | 3300005328 | Ga0070676_10009142 | Ga0070676_100091427 | 245 |
| 326 | 3300005328 | Ga0070676_10250917 | Ga0070676_102509172 | 245 |
| 327 | 3300005329 | Ga0070683_100000259 | Ga0070683_10000025935 | 245 |
| 328 | 3300005331 | Ga0070670_100084881 | Ga0070670_1000848814 | 245 |
| 329 | 3300005333 | Ga0070677_10000339 | Ga0070677_1000033917 | 245 |
| 330 | 3300005334 | Ga0068869_100000095 | Ga0068869_10000009517 | 245 |
| 331 | 3300005334 | Ga0068869_100028848 | Ga0068869_1000288484 | 245 |
| 332 | 3300005335 | Ga0070666_10046612 | Ga0070666_100466125 | 245 |
| 333 | 3300005336 | Ga0070680_100019622 | Ga0070680_1000196222 | 245 |
| 334 | 3300005337 | Ga0070682_100002519 | Ga0070682_1000025192 | 245 |
| 335 | 3300005338 | Ga0068868_100006592 | Ga0068868_1000065922 | 245 |
| 336 | 3300005339 | Ga0070660_100016495 | Ga0070660_1000164957 | 245 |
| 337 | 3300005340 | Ga0070689_100020436 | Ga0070689_1000204362 | 245 |
| 338 | 3300005341 | Ga0070691_10006454 | Ga0070691_100064547 | 245 |
| 339 | 3300005343 | Ga0070687_100004929 | Ga0070687_1000049297 | 245 |
| 340 | 3300005344 | Ga0070661_100000362 | Ga0070661_1000003622 | 245 |
| 341 | 3300005345 | Ga0070692_10005659 | Ga0070692_100056592 | 245 |
| 342 | 3300005347 | Ga0070668_100017522 | Ga0070668_1000175227 | 245 |
| 343 | 3300005353 | Ga0070669_100002512 | Ga0070669_1000025122 | 245 |
| 344 | 3300005354 | Ga0070675_100019847 | Ga0070675_1000198472 | 245 |
| 345 | 3300005355 | Ga0070671_100000935 | Ga0070671_10000093522 | 245 |
| 346 | 3300005356 | Ga0070674_100008580 | Ga0070674_1000085802 | 245 |
| 347 | 3300005364 | Ga0070673_100000144 | Ga0070673_10000014435 | 245 |
| 348 | 3300005365 | Ga0070688_100001947 | Ga0070688_10000194714 | 245 |
| 349 | 3300005366 | Ga0070659_100017676 | Ga0070659_1000176762 | 245 |
| 350 | 3300005367 | Ga0070667_100005818 | Ga0070667_1000058187 | 245 |
| 351 | 3300005406 | Ga0070703_10008667 | Ga0070703_100086672 | 245 |
| 352 | 3300005438 | Ga0070701_10010426 | Ga0070701_100104262 | 245 |
| 353 | 3300005440 | Ga0070705_100001332 | Ga0070705_1000013322 | 245 |
| 354 | 3300005440 | Ga0070705_100241640 | Ga0070705_1002416402 | 245 |
| 355 | 3300005441 | Ga0070700_100009367 | Ga0070700_1000093672 | 245 |
| 356 | 3300005444 | Ga0070694_100012089 | Ga0070694_1000120892 | 245 |
| 357 | 3300005445 | Ga0070708_100059559 | Ga0070708_1000595592 | 245 |
| 358 | 3300005455 | Ga0070663_100012574 | Ga0070663_1000125747 | 245 |
| 359 | 3300005456 | Ga0070678_100000955 | Ga0070678_10000095514 | 245 |
| 360 | 3300005457 | Ga0070662_100013888 | Ga0070662_1000138882 | 245 |
| 361 | 3300005458 | Ga0070681_10060537 | Ga0070681_100605375 | 245 |
| 362 | 3300005459 | Ga0068867_100000325 | Ga0068867_1000003257 | 245 |
| 363 | 3300005466 | Ga0070685_10069157 | Ga0070685_100691572 | 245 |
| 364 | 3300005518 | Ga0070699_100109188 | Ga0070699_1001091882 | 245 |
| 365 | 3300005530 | Ga0070679_100029943 | Ga0070679_1000299437 | 245 |
| 366 | 3300005530 | Ga0070679_100183834 | Ga0070679_1001838343 | 245 |
| 367 | 3300005535 | Ga0070684_100001386 | Ga0070684_10000138616 | 245 |
| 368 | 3300005536 | Ga0070697_100002804 | Ga0070697_1000028048 | 245 |
| 369 | 3300005536 | Ga0070697_100180919 | Ga0070697_1001809192 | 245 |
| 370 | 3300005539 | Ga0068853_100021663 | Ga0068853_1000216637 | 245 |
| 371 | 3300005543 | Ga0070672_100003185 | Ga0070672_1000031852 | 245 |
| 372 | 3300005544 | Ga0070686_100011949 | Ga0070686_1000119497 | 245 |
| 373 | 3300005545 | Ga0070695_100001945 | Ga0070695_10000194510 | 245 |
| 374 | 3300005545 | Ga0070695_100011210 | Ga0070695_1000112102 | 245 |
| 375 | 3300005546 | Ga0070696_100014120 | Ga0070696_1000141207 | 245 |
| 376 | 3300005547 | Ga0070693_100001679 | Ga0070693_1000016797 | 245 |
| 377 | 3300005548 | Ga0070665_100107883 | Ga0070665_1001078835 | 245 |
| 378 | 3300005549 | Ga0070704_100011878 | Ga0070704_1000118782 | 245 |
| 379 | 3300005563 | Ga0068855_100011491 | Ga0068855_1000114912 | 245 |
| 380 | 3300005564 | Ga0070664_100025252 | Ga0070664_1000252527 | 245 |
| 381 | 3300005577 | Ga0068857_100000521 | Ga0068857_10000052126 | 245 |
| 382 | 3300005578 | Ga0068854_100013433 | Ga0068854_1000134332 | 245 |
| 383 | 3300005614 | Ga0068856_100034966 | Ga0068856_1000349667 | 245 |
| 384 | 3300005615 | Ga0070702_100001916 | Ga0070702_1000019162 | 245 |
| 385 | 3300005615 | Ga0070702_100323926 | Ga0070702_1003239262 | 245 |
| 386 | 3300005617 | Ga0068859_100064359 | Ga0068859_1000643592 | 245 |
| 387 | 3300005618 | Ga0068864_100000459 | Ga0068864_10000045940 | 245 |
| 388 | 3300005718 | Ga0068866_10000987 | Ga0068866_1000098711 | 245 |
| 389 | 3300005840 | Ga0068870_10000034 | Ga0068870_1000003416 | 245 |
| 390 | 3300005841 | Ga0068863_100004287 | Ga0068863_1000042872 | 245 |
| 391 | 3300005842 | Ga0068858_100031677 | Ga0068858_1000316772 | 245 |
| 392 | 3300005843 | Ga0068860_100028836 | Ga0068860_1000288362 | 245 |
| 393 | 3300005844 | Ga0068862_100021695 | Ga0068862_1000216957 | 245 |
| 394 | 3300006178 | Ga0075367_10002451 | Ga0075367_100024516 | 245 |
| 395 | 3300006237 | Ga0097621_100000010 | Ga0097621_100000010120 | 245 |
| 396 | 3300006358 | Ga0068871_100000193 | Ga0068871_10000019318 | 245 |
| 397 | 3300006852 | Ga0075433_10003868 | Ga0075433_100038682 | 245 |
| 398 | 3300006871 | Ga0075434_100000202 | Ga0075434_10000020247 | 245 |
| 399 | 3300006881 | Ga0068865_100000252 | Ga0068865_10000025230 | 245 |
| 400 | 3300006914 | Ga0075436_100005213 | Ga0075436_1000052133 | 245 |
| 401 | 3300006931 | Ga0097620_100064360 | Ga0097620_1000643602 | 245 |
| 402 | 3300009093 | Ga0105240_10034585 | Ga0105240_100345856 | 245 |
| 403 | 3300009094 | Ga0111539_10043761 | Ga0111539_100437612 | 245 |
| 404 | 3300009098 | Ga0105245_10000152 | Ga0105245_1000015222 | 245 |
| 405 | 3300009101 | Ga0105247_10001782 | Ga0105247_1000178217 | 245 |
| 406 | 3300009174 | Ga0105241_10016831 | Ga0105241_100168312 | 245 |
| 407 | 3300009176 | Ga0105242_10019113 | Ga0105242_100191132 | 245 |
| 408 | 3300009177 | Ga0105248_10001245 | Ga0105248_100012452 | 245 |
| 409 | 3300009545 | Ga0105237_10031856 | Ga0105237_100318562 | 245 |
| 410 | 3300009553 | Ga0105249_10024998 | Ga0105249_100249982 | 245 |
| 411 | 3300010375 | Ga0105239_10036827 | Ga0105239_100368272 | 245 |
| 412 | 3300011119 | Ga0105246_10001947 | Ga0105246_1000194716 | 245 |
| 413 | 3300013100 | Ga0157373_10015560 | Ga0157373_100155603 | 245 |
| 414 | 3300013102 | Ga0157371_10003620 | Ga0157371_100036202 | 245 |
| 415 | 3300013296 | Ga0157374_10010563 | Ga0157374_100105634 | 245 |
| 416 | 3300013297 | Ga0157378_10000990 | Ga0157378_1000099011 | 245 |
| 417 | 3300013307 | Ga0157372_10012895 | Ga0157372_100128952 | 245 |
| 418 | 3300013308 | Ga0157375_10026919 | Ga0157375_100269192 | 245 |
| 419 | 3300014325 | Ga0163163_10067522 | Ga0163163_100675222 | 245 |
| 420 | 3300014745 | Ga0157377_10000463 | Ga0157377_1000046316 | 245 |
| 421 | 3300014969 | Ga0157376_10000098 | Ga0157376_1000009861 | 245 |
| 422 | 3300017792 | Ga0163161_10000866 | Ga0163161_1000086615 | 245 |
| 423 | 3300025271 | Ga0207666_1000450 | Ga0207666_10004502 | 245 |
| 424 | 3300025315 | Ga0207697_10002237 | Ga0207697_100022377 | 245 |
| 425 | 3300025893 | Ga0207682_10000006 | Ga0207682_1000000669 | 245 |
| 426 | 3300025899 | Ga0207642_10000107 | Ga0207642_1000010713 | 245 |
| 427 | 3300025900 | Ga0207710_10003925 | Ga0207710_100039257 | 245 |
| 428 | 3300025901 | Ga0207688_10002370 | Ga0207688_100023707 | 245 |
| 429 | 3300025904 | Ga0207647_10019660 | Ga0207647_100196606 | 245 |
| 430 | 3300025907 | Ga0207645_10000023 | Ga0207645_10000023106 | 245 |
| 431 | 3300025908 | Ga0207643_10000007 | Ga0207643_1000000797 | 245 |
| 432 | 3300025911 | Ga0207654_10001016 | Ga0207654_1000101615 | 245 |
| 433 | 3300025912 | Ga0207707_10000786 | Ga0207707_1000078616 | 245 |
| 434 | 3300025913 | Ga0207695_10013268 | Ga0207695_1001326810 | 245 |
| 435 | 3300025914 | Ga0207671_10018636 | Ga0207671_100186362 | 245 |
| 436 | 3300025917 | Ga0207660_10000058 | Ga0207660_1000005817 | 245 |
| 437 | 3300025918 | Ga0207662_10009553 | Ga0207662_100095532 | 245 |
| 438 | 3300025919 | Ga0207657_10026832 | Ga0207657_100268327 | 245 |
| 439 | 3300025920 | Ga0207649_10000384 | Ga0207649_1000038422 | 245 |
| 440 | 3300025921 | Ga0207652_10000377 | Ga0207652_1000037738 | 245 |
| 441 | 3300025923 | Ga0207681_10000100 | Ga0207681_1000010017 | 245 |
| 442 | 3300025925 | Ga0207650_10004913 | Ga0207650_1000491312 | 245 |
| 443 | 3300025926 | Ga0207659_10000044 | Ga0207659_1000004432 | 245 |
| 444 | 3300025927 | Ga0207687_10001241 | Ga0207687_1000124111 | 245 |
| 445 | 3300025931 | Ga0207644_10002171 | Ga0207644_100021714 | 245 |
| 446 | 3300025932 | Ga0207690_10001671 | Ga0207690_1000167111 | 245 |
| 447 | 3300025933 | Ga0207706_10025308 | Ga0207706_100253082 | 245 |
| 448 | 3300025934 | Ga0207686_10000222 | Ga0207686_1000022234 | 245 |
| 449 | 3300025935 | Ga0207709_10000154 | Ga0207709_1000015435 | 245 |
| 450 | 3300025936 | Ga0207670_10000129 | Ga0207670_1000012917 | 245 |
| 451 | 3300025937 | Ga0207669_10000502 | Ga0207669_1000050216 | 245 |
| 452 | 3300025938 | Ga0207704_10000446 | Ga0207704_1000044616 | 245 |
| 453 | 3300025940 | Ga0207691_10005314 | Ga0207691_1000531416 | 245 |
| 454 | 3300025941 | Ga0207711_10021351 | Ga0207711_100213512 | 245 |
| 455 | 3300025942 | Ga0207689_10000098 | Ga0207689_1000009830 | 245 |
| 456 | 3300025944 | Ga0207661_10000178 | Ga0207661_1000017832 | 245 |
| 457 | 3300025945 | Ga0207679_10000029 | Ga0207679_10000029100 | 245 |
| 458 | 3300025949 | Ga0207667_10010651 | Ga0207667_100106517 | 245 |
| 459 | 3300025960 | Ga0207651_10000031 | Ga0207651_1000003132 | 245 |
| 460 | 3300025961 | Ga0207712_10000129 | Ga0207712_1000012923 | 245 |
| 461 | 3300025972 | Ga0207668_10000158 | Ga0207668_1000015847 | 245 |
| 462 | 3300025981 | Ga0207640_10000168 | Ga0207640_1000016822 | 245 |
| 463 | 3300025986 | Ga0207658_10014664 | Ga0207658_100146647 | 245 |
| 464 | 3300026023 | Ga0207677_10004338 | Ga0207677_100043389 | 245 |
| 465 | 3300026035 | Ga0207703_10005069 | Ga0207703_1000506913 | 245 |
| 466 | 3300026041 | Ga0207639_10015664 | Ga0207639_100156647 | 245 |
| 467 | 3300026067 | Ga0207678_10004581 | Ga0207678_100045812 | 245 |
| 468 | 3300026075 | Ga0207708_10017977 | Ga0207708_100179777 | 245 |
| 469 | 3300026078 | Ga0207702_10000404 | Ga0207702_100004045 | 245 |
| 470 | 3300026088 | Ga0207641_10001418 | Ga0207641_100014182 | 245 |
| 471 | 3300026089 | Ga0207648_10000072 | Ga0207648_1000007277 | 245 |
| 472 | 3300026095 | Ga0207676_10000180 | Ga0207676_1000018049 | 245 |
| 473 | 3300026116 | Ga0207674_10010766 | Ga0207674_100107668 | 245 |
| 474 | 3300026118 | Ga0207675_100026944 | Ga0207675_1000269447 | 245 |
| 475 | 3300026121 | Ga0207683_10000029 | Ga0207683_1000002987 | 245 |
| 476 | 3300027617 | Ga0210002_1004321 | Ga0210002_10043212 | 245 |
| 477 | 3300027682 | Ga0209971_1003073 | Ga0209971_10030737 | 245 |
| 478 | 3300027717 | Ga0209998_10002950 | Ga0209998_100029506 | 245 |
| 479 | 3300027876 | Ga0209974_10004279 | Ga0209974_100042795 | 245 |
| 480 | 3300027907 | Ga0207428_10000100 | Ga0207428_1000010049 | 245 |
| 481 | 3300028379 | Ga0268266_10015777 | Ga0268266_100157774 | 245 |
| 482 | 3300028380 | Ga0268265_10000698 | Ga0268265_1000069832 | 245 |
| 483 | 3300028381 | Ga0268264_10005684 | Ga0268264_100056847 | 245 |
| 484 | 3300031711 | Ga0265314_10011299 | Ga0265314_100112998 | 245 |
| 485 | 3300032133 | Ga0316583_10006661 | Ga0316583_100066614 | 245 |
| 486 | 3300034818 | Ga0373950_0001071 | Ga0373950_0001071_1600_2370 | 245 |
| 487 | 3300034957 | Ga0373938_0021500 | Ga0373938_0021500_457_1227 | 245 |
| 488 | 3300035085 | Ga0373929_0007180 | Ga0373929_0007180_1045_1815 | 245 |
| 489 | 3300035088 | Ga0373940_0002001 | Ga0373940_0002001_340_1110 | 245 |
| 490 | 3300035090 | Ga0373949_0001759 | Ga0373949_0001759_3379_4149 | 245 |
| 491 | 3300035112 | Ga0373932_0002838 | Ga0373932_0002838_167_937 | 245 |
| 492 | 3300035121 | Ga0373960_0005729 | Ga0373960_0005729_1081_1851 | 245 |
| 493 | 3300035207 | Ga0373942_0001126 | Ga0373942_0001126_4127_4897 | 245 |
| 494 | 3300035242 | Ga0373962_0002485 | Ga0373962_0002485_3372_4142 | 245 |
| 495 | 3300035691 | Ga0373931_0002530 | Ga0373931_0002530_3993_4763 | 245 |
| 496 | 3300048903 | Ga0496100_0000529 | Ga0496100_0000529_10619_11389 | 245 |
| 497 | 3300048904 | Ga0496101_0000187 | Ga0496101_0000187_11591_12361 | 245 |
| 498 | 3300048905 | Ga0496102_0008774 | Ga0496102_0008774_3993_4763 | 245 |
| 499 | 3300048906 | Ga0496103_0000157 | Ga0496103_0000157_10664_11434 | 245 |
| 500 | 3300048909 | Ga0496106_0003377 | Ga0496106_0003377_4121_4891 | 245 |
| 501 | 3300048910 | Ga0496107_0000805 | Ga0496107_0000805_15780_16550 | 245 |
| 502 | 3300048911 | Ga0496108_0003275 | Ga0496108_0003275_6146_6916 | 245 |
| 503 | 3300048912 | Ga0496109_0000313 | Ga0496109_0000313_9935_10705 | 245 |
| 504 | 3300048913 | Ga0496110_0066895 | Ga0496110_0066895_2059_2829 | 245 |
| 505 | 3300048916 | Ga0496113_0078764 | Ga0496113_0078764_1560_2330 | 245 |
| 506 | 3300048918 | Ga0496115_0001217 | Ga0496115_0001217_12475_13245 | 245 |
| 507 | 3300049570 | Ga0501033_0063506 | Ga0501033_0063506_358_1128 | 245 |
| 508 | 3300049571 | Ga0501034_0008229 | Ga0501034_0008229_6031_6798 | 245 |
| 509 | 3300049571 | Ga0501034_0014223 | Ga0501034_0014223_5448_6215 | 245 |
| 510 | 3300049571 | Ga0501034_0251021 | Ga0501034_0251021_140_907 | 245 |
| 511 | 3300049572 | Ga0501036_0087238 | Ga0501036_0087238_589_1356 | 245 |
| 512 | 3300049573 | Ga0501037_0009677 | Ga0501037_0009677_5737_6504 | 245 |
| 513 | 3300049574 | Ga0501038_0203958 | Ga0501038_0203958_183_950 | 245 |
| 514 | 3300049579 | Ga0501043_0168852 | Ga0501043_0168852_19_786 | 245 |
| 515 | 3300049581 | Ga0501047_0006413 | Ga0501047_0006413_5454_6221 | 245 |
| 516 | 3300049581 | Ga0501047_0009087 | Ga0501047_0009087_5632_6402 | 245 |
| 517 | 3300049584 | Ga0501068_0091851 | Ga0501068_0091851_334_1101 | 245 |
| 518 | 3300049584 | Ga0501068_0403489 | Ga0501068_0403489_53_820 | 245 |
| 519 | 3300049585 | Ga0501069_0395357 | Ga0501069_0395357_10_777 | 245 |
| 520 | 3300049586 | Ga0501070_0075813 | Ga0501070_0075813_1976_2743 | 245 |
| 521 | 3300049586 | Ga0501070_0372415 | Ga0501070_0372415_70_837 | 245 |
| 522 | 3300049589 | Ga0501073_0191444 | Ga0501073_0191444_342_1109 | 245 |
| 523 | 3300049590 | Ga0501074_0152536 | Ga0501074_0152536_300_1067 | 245 |
| 524 | 3300049742 | Ga0501080_0012989 | Ga0501080_0012989_5475_6242 | 245 |
| 525 | 3300049742 | Ga0501080_0131578 | Ga0501080_0131578_743_1510 | 245 |
| 526 | 3300049742 | Ga0501080_0143407 | Ga0501080_0143407_1011_1778 | 245 |
| 527 | 3300049744 | Ga0501083_0001288 | Ga0501083_0001288_15819_16586 | 245 |
| 528 | 3300049823 | Ga0501044_0010736 | Ga0501044_0010736_3278_4045 | 245 |
| 529 | 3300049823 | Ga0501044_0068147 | Ga0501044_0068147_1618_2388 | 245 |
| 530 | 3300049823 | Ga0501044_0130521 | Ga0501044_0130521_946_1713 | 245 |
| 531 | 3300049823 | Ga0501044_0255081 | Ga0501044_0255081_220_987 | 245 |
| 532 | 3300050494 | nmdc:mga06z11_6126_c1 | nmdc:mga06z11_6126_c1_2764_3534 | 245 |
| 533 | 3300050511 | nmdc:mga08y16_2193_c1 | nmdc:mga08y16_2193_c1_10511_11281 | 245 |
| 534 | 3300050512 | nmdc:mga0n895_1250_c1 | nmdc:mga0n895_1250_c1_6066_6836 | 245 |
| 535 | 3300050514 | nmdc:mga08x19_23_c1 | nmdc:mga08x19_23_c1_258398_259168 | 245 |
| 536 | 3300050515 | nmdc:mga0a205_3872_c1 | nmdc:mga0a205_3872_c1_4120_4890 | 245 |
| 537 | 3300060353 | Ga0501082_0036920 | Ga0501082_0036920_498_1265 | 245 |
| 538 | 3300060353 | Ga0501082_0085460 | Ga0501082_0085460_1907_2674 | 245 |
| 539 | 2162886007 | SwRhRL2b_contig_1612269 | SwRhRL2b_0786.00000260 | 246 |
| 540 | 2209111006 | 2214856319 | 2213902605 | 246 |
| 541 | 3300000041 | ARcpr5oldR_c000300 | ARcpr5oldR_0003006 | 246 |
| 542 | 3300000042 | ARSoilYngRDRAFT_c00004 | ARSoilYngRDRAFT_0000428 | 246 |
| 543 | 3300000043 | ARcpr5yngRDRAFT_c000060 | ARcpr5yngRDRAFT_00006018 | 246 |
| 544 | 3300000044 | ARSoilOldRDRAFT_c000283 | ARSoilOldRDRAFT_0002836 | 246 |
| 545 | 3300000652 | ARCol0yngRDRAFT_1000084 | ARCol0yngRDRAFT_10000846 | 246 |
| 546 | 3300001989 | JGI24739J22299_10044017 | JGI24739J22299_100440173 | 246 |
| 547 | 3300001990 | JGI24737J22298_10005585 | JGI24737J22298_100055857 | 246 |
| 548 | 3300005277 | Ga0065716_1001561 | Ga0065716_10015613 | 246 |
| 549 | 3300005288 | Ga0065714_10155348 | Ga0065714_101553481 | 246 |
| 550 | 3300005289 | Ga0065704_10083099 | Ga0065704_100830995 | 246 |
| 551 | 3300005290 | Ga0065712_10014760 | Ga0065712_100147605 | 246 |
| 552 | 3300005290 | Ga0065712_10077134 | Ga0065712_100771342 | 246 |
| 553 | 3300005293 | Ga0065715_10002288 | Ga0065715_1000228817 | 246 |
| 554 | 3300005327 | Ga0070658_10482445 | Ga0070658_104824452 | 246 |
| 555 | 3300005329 | Ga0070683_100770214 | Ga0070683_1007702141 | 246 |
| 556 | 3300005330 | Ga0070690_100013047 | Ga0070690_1000130472 | 246 |
| 557 | 3300005334 | Ga0068869_100218022 | Ga0068869_1002180223 | 246 |
| 558 | 3300005334 | Ga0068869_100268264 | Ga0068869_1002682641 | 246 |
| 559 | 3300005336 | Ga0070680_100019598 | Ga0070680_1000195982 | 246 |
| 560 | 3300005338 | Ga0068868_100011912 | Ga0068868_1000119126 | 246 |
| 561 | 3300005339 | Ga0070660_100214323 | Ga0070660_1002143231 | 246 |
| 562 | 3300005340 | Ga0070689_100087555 | Ga0070689_1000875553 | 246 |
| 563 | 3300005341 | Ga0070691_10115427 | Ga0070691_101154273 | 246 |
| 564 | 3300005343 | Ga0070687_100064626 | Ga0070687_1000646263 | 246 |
| 565 | 3300005344 | Ga0070661_100424707 | Ga0070661_1004247072 | 246 |
| 566 | 3300005345 | Ga0070692_10028168 | Ga0070692_100281682 | 246 |
| 567 | 3300005347 | Ga0070668_100017886 | Ga0070668_1000178862 | 246 |
| 568 | 3300005365 | Ga0070688_100009341 | Ga0070688_1000093412 | 246 |
| 569 | 3300005366 | Ga0070659_100033629 | Ga0070659_1000336292 | 246 |
| 570 | 3300005367 | Ga0070667_100126708 | Ga0070667_1001267083 | 246 |
| 571 | 3300005435 | Ga0070714_100067871 | Ga0070714_1000678713 | 246 |
| 572 | 3300005435 | Ga0070714_100311930 | Ga0070714_1003119302 | 246 |
| 573 | 3300005438 | Ga0070701_10053038 | Ga0070701_100530382 | 246 |
| 574 | 3300005440 | Ga0070705_100313286 | Ga0070705_1003132862 | 246 |
| 575 | 3300005441 | Ga0070700_100030724 | Ga0070700_1000307245 | 246 |
| 576 | 3300005444 | Ga0070694_100012072 | Ga0070694_1000120722 | 246 |
| 577 | 3300005455 | Ga0070663_100286636 | Ga0070663_1002866362 | 246 |
| 578 | 3300005457 | Ga0070662_100416198 | Ga0070662_1004161982 | 246 |
| 579 | 3300005458 | Ga0070681_10048667 | Ga0070681_100486673 | 246 |
| 580 | 3300005458 | Ga0070681_10369884 | Ga0070681_103698842 | 246 |
| 581 | 3300005471 | Ga0070698_100258431 | Ga0070698_1002584312 | 246 |
| 582 | 3300005518 | Ga0070699_100775206 | Ga0070699_1007752061 | 246 |
| 583 | 3300005530 | Ga0070679_100446228 | Ga0070679_1004462282 | 246 |
| 584 | 3300005535 | Ga0070684_100112100 | Ga0070684_1001121002 | 246 |
| 585 | 3300005539 | Ga0068853_100748189 | Ga0068853_1007481891 | 246 |
| 586 | 3300005543 | Ga0070672_100106629 | Ga0070672_1001066294 | 246 |
| 587 | 3300005544 | Ga0070686_100002814 | Ga0070686_10000281413 | 246 |
| 588 | 3300005545 | Ga0070695_100013577 | Ga0070695_1000135777 | 246 |
| 589 | 3300005545 | Ga0070695_100277518 | Ga0070695_1002775181 | 246 |
| 590 | 3300005546 | Ga0070696_100014107 | Ga0070696_1000141072 | 246 |
| 591 | 3300005546 | Ga0070696_100225817 | Ga0070696_1002258172 | 246 |
| 592 | 3300005547 | Ga0070693_100047790 | Ga0070693_1000477904 | 246 |
| 593 | 3300005549 | Ga0070704_100066027 | Ga0070704_1000660275 | 246 |
| 594 | 3300005578 | Ga0068854_100124485 | Ga0068854_1001244853 | 246 |
| 595 | 3300005614 | Ga0068856_100211800 | Ga0068856_1002118002 | 246 |
| 596 | 3300005617 | Ga0068859_100025977 | Ga0068859_1000259777 | 246 |
| 597 | 3300005617 | Ga0068859_100354210 | Ga0068859_1003542102 | 246 |
| 598 | 3300005718 | Ga0068866_10101535 | Ga0068866_101015352 | 246 |
| 599 | 3300005834 | Ga0068851_10219166 | Ga0068851_102191661 | 246 |
| 600 | 3300005842 | Ga0068858_100063955 | Ga0068858_1000639552 | 246 |
| 601 | 3300005842 | Ga0068858_100209543 | Ga0068858_1002095432 | 246 |
| 602 | 3300005843 | Ga0068860_100141077 | Ga0068860_1001410774 | 246 |
| 603 | 3300005843 | Ga0068860_100517741 | Ga0068860_1005177412 | 246 |
| 604 | 3300005844 | Ga0068862_100025938 | Ga0068862_1000259387 | 246 |
| 605 | 3300005937 | Ga0081455_10043322 | Ga0081455_100433226 | 246 |
| 606 | 3300005983 | Ga0081540_1000068 | Ga0081540_100006860 | 246 |
| 607 | 3300006028 | Ga0070717_10088016 | Ga0070717_100880164 | 246 |
| 608 | 3300006038 | Ga0075365_10040537 | Ga0075365_100405372 | 246 |
| 609 | 3300006038 | Ga0075365_10222244 | Ga0075365_102222441 | 246 |
| 610 | 3300006048 | Ga0075363_100177238 | Ga0075363_1001772382 | 246 |
| 611 | 3300006051 | Ga0075364_10119889 | Ga0075364_101198892 | 246 |
| 612 | 3300006051 | Ga0075364_10288205 | Ga0075364_102882052 | 246 |
| 613 | 3300006163 | Ga0070715_10015446 | Ga0070715_100154463 | 246 |
| 614 | 3300006178 | Ga0075367_10000344 | Ga0075367_1000034411 | 246 |
| 615 | 3300006186 | Ga0075369_10000100 | Ga0075369_100001009 | 246 |
| 616 | 3300006186 | Ga0075369_10090117 | Ga0075369_100901171 | 246 |
| 617 | 3300006195 | Ga0075366_10129847 | Ga0075366_101298471 | 246 |
| 618 | 3300006195 | Ga0075366_10217567 | Ga0075366_102175672 | 246 |
| 619 | 3300006195 | Ga0075366_10266979 | Ga0075366_102669791 | 246 |
| 620 | 3300006237 | Ga0097621_100122680 | Ga0097621_1001226803 | 246 |
| 621 | 3300006237 | Ga0097621_100212019 | Ga0097621_1002120192 | 246 |
| 622 | 3300006358 | Ga0068871_100325706 | Ga0068871_1003257062 | 246 |
| 623 | 3300006358 | Ga0068871_100356654 | Ga0068871_1003566541 | 246 |
| 624 | 3300006846 | Ga0075430_100001959 | Ga0075430_1000019597 | 246 |
| 625 | 3300006847 | Ga0075431_100028363 | Ga0075431_1000283636 | 246 |
| 626 | 3300006871 | Ga0075434_100178546 | Ga0075434_1001785463 | 246 |
| 627 | 3300006880 | Ga0075429_100275689 | Ga0075429_1002756892 | 246 |
| 628 | 3300006881 | Ga0068865_100193971 | Ga0068865_1001939712 | 246 |
| 629 | 3300006914 | Ga0075436_100004205 | Ga0075436_1000042058 | 246 |
| 630 | 3300006914 | Ga0075436_100127128 | Ga0075436_1001271284 | 246 |
| 631 | 3300006931 | Ga0097620_100025977 | Ga0097620_1000259777 | 246 |
| 632 | 3300006931 | Ga0097620_100354207 | Ga0097620_1003542072 | 246 |
| 633 | 3300007076 | Ga0075435_100266638 | Ga0075435_1002666382 | 246 |
| 634 | 3300007788 | Ga0099795_10000385 | Ga0099795_100003856 | 246 |
| 635 | 3300009011 | Ga0105251_10059560 | Ga0105251_100595602 | 246 |
| 636 | 3300009094 | Ga0111539_10022969 | Ga0111539_100229697 | 246 |
| 637 | 3300009094 | Ga0111539_10043725 | Ga0111539_100437252 | 246 |
| 638 | 3300009094 | Ga0111539_10161295 | Ga0111539_101612952 | 246 |
| 639 | 3300009098 | Ga0105245_10011738 | Ga0105245_100117388 | 246 |
| 640 | 3300009098 | Ga0105245_10423937 | Ga0105245_104239372 | 246 |
| 641 | 3300009101 | Ga0105247_10031689 | Ga0105247_100316895 | 246 |
| 642 | 3300009147 | Ga0114129_10004957 | Ga0114129_1000495712 | 246 |
| 643 | 3300009147 | Ga0114129_10100059 | Ga0114129_101000593 | 246 |
| 644 | 3300009147 | Ga0114129_10242026 | Ga0114129_102420263 | 246 |
| 645 | 3300009148 | Ga0105243_10018129 | Ga0105243_100181297 | 246 |
| 646 | 3300009177 | Ga0105248_10065391 | Ga0105248_100653912 | 246 |
| 647 | 3300009177 | Ga0105248_10132039 | Ga0105248_101320393 | 246 |
| 648 | 3300009177 | Ga0105248_10433061 | Ga0105248_104330613 | 246 |
| 649 | 3300009545 | Ga0105237_10193257 | Ga0105237_101932574 | 246 |
| 650 | 3300009551 | Ga0105238_10121993 | Ga0105238_101219933 | 246 |
| 651 | 3300010375 | Ga0105239_10076044 | Ga0105239_100760442 | 246 |
| 652 | 3300010375 | Ga0105239_10684429 | Ga0105239_106844291 | 246 |
| 653 | 3300011119 | Ga0105246_10091049 | Ga0105246_100910492 | 246 |
| 654 | 3300012497 | Ga0157319_1000342 | Ga0157319_10003422 | 246 |
| 655 | 3300012507 | Ga0157342_1000333 | Ga0157342_10003334 | 246 |
| 656 | 3300012513 | Ga0157326_1012483 | Ga0157326_10124832 | 246 |
| 657 | 3300013102 | Ga0157371_10086333 | Ga0157371_100863334 | 246 |
| 658 | 3300013104 | Ga0157370_10033106 | Ga0157370_100331062 | 246 |
| 659 | 3300013297 | Ga0157378_10167363 | Ga0157378_101673633 | 246 |
| 660 | 3300013297 | Ga0157378_10444789 | Ga0157378_104447892 | 246 |
| 661 | 3300013306 | Ga0163162_10034398 | Ga0163162_100343983 | 246 |
| 662 | 3300014325 | Ga0163163_10067631 | Ga0163163_100676312 | 246 |
| 663 | 3300014326 | Ga0157380_10004398 | Ga0157380_100043987 | 246 |
| 664 | 3300014326 | Ga0157380_10116379 | Ga0157380_101163792 | 246 |
| 665 | 3300014326 | Ga0157380_10234855 | Ga0157380_102348552 | 246 |
| 666 | 3300014969 | Ga0157376_10563546 | Ga0157376_105635462 | 246 |
| 667 | 3300021384 | Ga0213876_10124093 | Ga0213876_101240931 | 246 |
| 668 | 3300021388 | Ga0213875_10000003 | Ga0213875_100000039 | 246 |
| 669 | 3300025315 | Ga0207697_10007190 | Ga0207697_100071902 | 246 |
| 670 | 3300025885 | Ga0207653_10016205 | Ga0207653_100162052 | 246 |
| 671 | 3300025899 | Ga0207642_10043328 | Ga0207642_100433283 | 246 |
| 672 | 3300025900 | Ga0207710_10039847 | Ga0207710_100398472 | 246 |
| 673 | 3300025901 | Ga0207688_10023763 | Ga0207688_100237636 | 246 |
| 674 | 3300025904 | Ga0207647_10002014 | Ga0207647_1000201414 | 246 |
| 675 | 3300025905 | Ga0207685_10018147 | Ga0207685_100181472 | 246 |
| 676 | 3300025906 | Ga0207699_10180876 | Ga0207699_101808762 | 246 |
| 677 | 3300025910 | Ga0207684_10233878 | Ga0207684_102338783 | 246 |
| 678 | 3300025912 | Ga0207707_10065647 | Ga0207707_100656474 | 246 |
| 679 | 3300025914 | Ga0207671_10119018 | Ga0207671_101190182 | 246 |
| 680 | 3300025917 | Ga0207660_10087819 | Ga0207660_100878195 | 246 |
| 681 | 3300025918 | Ga0207662_10011718 | Ga0207662_100117182 | 246 |
| 682 | 3300025919 | Ga0207657_10112909 | Ga0207657_101129094 | 246 |
| 683 | 3300025921 | Ga0207652_10078184 | Ga0207652_100781842 | 246 |
| 684 | 3300025924 | Ga0207694_10012592 | Ga0207694_100125923 | 246 |
| 685 | 3300025925 | Ga0207650_10047429 | Ga0207650_100474292 | 246 |
| 686 | 3300025926 | Ga0207659_10170608 | Ga0207659_101706083 | 246 |
| 687 | 3300025932 | Ga0207690_10019165 | Ga0207690_100191653 | 246 |
| 688 | 3300025933 | Ga0207706_10025283 | Ga0207706_100252832 | 246 |
| 689 | 3300025933 | Ga0207706_10324392 | Ga0207706_103243922 | 246 |
| 690 | 3300025935 | Ga0207709_10027551 | Ga0207709_100275515 | 246 |
| 691 | 3300025936 | Ga0207670_10034390 | Ga0207670_100343905 | 246 |
| 692 | 3300025938 | Ga0207704_10199240 | Ga0207704_101992402 | 246 |
| 693 | 3300025939 | Ga0207665_10022731 | Ga0207665_100227313 | 246 |
| 694 | 3300025941 | Ga0207711_10078995 | Ga0207711_100789952 | 246 |
| 695 | 3300025972 | Ga0207668_10000100 | Ga0207668_100001001 | 246 |
| 696 | 3300025986 | Ga0207658_10255539 | Ga0207658_102555391 | 246 |
| 697 | 3300026023 | Ga0207677_10016991 | Ga0207677_100169912 | 246 |
| 698 | 3300026067 | Ga0207678_10038705 | Ga0207678_100387056 | 246 |
| 699 | 3300026075 | Ga0207708_10043597 | Ga0207708_100435972 | 246 |
| 700 | 3300026088 | Ga0207641_10128789 | Ga0207641_101287894 | 246 |
| 701 | 3300026116 | Ga0207674_10369122 | Ga0207674_103691222 | 246 |
| 702 | 3300026142 | Ga0207698_10009066 | Ga0207698_100090667 | 246 |
| 703 | 3300027424 | Ga0209984_1004014 | Ga0209984_10040143 | 246 |
| 704 | 3300027512 | Ga0209179_1000387 | Ga0209179_10003876 | 246 |
| 705 | 3300027695 | Ga0209966_1001665 | Ga0209966_10016655 | 246 |
| 706 | 3300027717 | Ga0209998_10003961 | Ga0209998_100039612 | 246 |
| 707 | 3300027876 | Ga0209974_10111086 | Ga0209974_101110862 | 246 |
| 708 | 3300027907 | Ga0207428_10000968 | Ga0207428_1000096816 | 246 |
| 709 | 3300028380 | Ga0268265_10045744 | Ga0268265_100457445 | 246 |
| 710 | 3300028381 | Ga0268264_10035806 | Ga0268264_100358063 | 246 |
| 711 | 3300028381 | Ga0268264_10227850 | Ga0268264_102278501 | 246 |
| 712 | 3300028556 | Ga0265337_1009820 | Ga0265337_10098206 | 246 |
| 713 | 3300028800 | Ga0265338_10006337 | Ga0265338_1000633712 | 246 |
| 714 | 3300031018 | Ga0265773_1000896 | Ga0265773_10008962 | 246 |
| 715 | 3300031090 | Ga0265760_10104969 | Ga0265760_101049691 | 246 |
| 716 | 3300031241 | Ga0265325_10005357 | Ga0265325_100053579 | 246 |
| 717 | 3300031241 | Ga0265325_10104307 | Ga0265325_101043073 | 246 |
| 718 | 3300031242 | Ga0265329_10086470 | Ga0265329_100864702 | 246 |
| 719 | 3300031247 | Ga0265340_10054915 | Ga0265340_100549152 | 246 |
| 720 | 3300031249 | Ga0265339_10001451 | Ga0265339_100014516 | 246 |
| 721 | 3300031249 | Ga0265339_10017062 | Ga0265339_100170623 | 246 |
| 722 | 3300031344 | Ga0265316_10090520 | Ga0265316_100905202 | 246 |
| 723 | 3300031595 | Ga0265313_10000366 | Ga0265313_1000036612 | 246 |
| 724 | 3300031711 | Ga0265314_10001247 | Ga0265314_1000124716 | 246 |
| 725 | 3300031711 | Ga0265314_10068973 | Ga0265314_100689731 | 246 |
| 726 | 3300031712 | Ga0265342_10000564 | Ga0265342_1000056420 | 246 |
| 727 | 3300031712 | Ga0265342_10063090 | Ga0265342_100630902 | 246 |
| 728 | 3300031903 | Ga0307407_10136708 | Ga0307407_101367083 | 246 |
| 729 | 3300031995 | Ga0307409_100531496 | Ga0307409_1005314962 | 246 |
| 730 | 3300034816 | Ga0373930_0000941 | Ga0373930_0000941_3387_4157 | 246 |
| 731 | 3300034817 | Ga0373948_0000551 | Ga0373948_0000551_759_1529 | 246 |
| 732 | 3300034819 | Ga0373958_0000214 | Ga0373958_0000214_3317_4087 | 246 |
| 733 | 3300034820 | Ga0373959_0000795 | Ga0373959_0000795_4104_4874 | 246 |
| 734 | 3300034957 | Ga0373938_0000050 | Ga0373938_0000050_10351_11121 | 246 |
| 735 | 3300035084 | Ga0373928_0000023 | Ga0373928_0000023_23882_24652 | 246 |
| 736 | 3300035085 | Ga0373929_0001804 | Ga0373929_0001804_506_1276 | 246 |
| 737 | 3300035088 | Ga0373940_0000075 | Ga0373940_0000075_3056_3826 | 246 |
| 738 | 3300035090 | Ga0373949_0001683 | Ga0373949_0001683_2339_3109 | 246 |
| 739 | 3300035091 | Ga0373951_0002175 | Ga0373951_0002175_2222_2992 | 246 |
| 740 | 3300035092 | Ga0373952_0001100 | Ga0373952_0001100_3938_4708 | 246 |
| 741 | 3300035111 | Ga0373923_0047771 | Ga0373923_0047771_118_900 | 246 |
| 742 | 3300035112 | Ga0373932_0000570 | Ga0373932_0000570_4115_4885 | 246 |
| 743 | 3300035114 | Ga0373939_0002122 | Ga0373939_0002122_1837_2607 | 246 |
| 744 | 3300035115 | Ga0373941_0000644 | Ga0373941_0000644_4786_5556 | 246 |
| 745 | 3300035116 | Ga0373945_0021619 | Ga0373945_0021619_281_1063 | 246 |
| 746 | 3300035118 | Ga0373954_0006146 | Ga0373954_0006146_3227_4009 | 246 |
| 747 | 3300035120 | Ga0373957_0050440 | Ga0373957_0050440_680_1462 | 246 |
| 748 | 3300035121 | Ga0373960_0012100 | Ga0373960_0012100_1042_1812 | 246 |
| 749 | 3300035170 | Ga0373943_0000449 | Ga0373943_0000449_12180_12962 | 246 |
| 750 | 3300035171 | Ga0373946_0001441 | Ga0373946_0001441_800_1582 | 246 |
| 751 | 3300035172 | Ga0373955_0000177 | Ga0373955_0000177_23216_23998 | 246 |
| 752 | 3300035207 | Ga0373942_0000843 | Ga0373942_0000843_7258_8028 | 246 |
| 753 | 3300035241 | Ga0373961_0000536 | Ga0373961_0000536_1965_2735 | 246 |
| 754 | 3300035242 | Ga0373962_0000064 | Ga0373962_0000064_18860_19630 | 246 |
| 755 | 3300035410 | Ga0373924_0000051 | Ga0373924_0000051_25522_26304 | 246 |
| 756 | 3300035691 | Ga0373931_0031105 | Ga0373931_0031105_496_1266 | 246 |
| 757 | 3300035691 | Ga0373931_0149910 | Ga0373931_0149910_270_1040 | 246 |
| 758 | 3300035692 | Ga0373935_0000018 | Ga0373935_0000018_38862_39644 | 246 |
| 759 | 3300035695 | Ga0373927_0004668 | Ga0373927_0004668_797_1567 | 246 |
| 760 | 3300035695 | Ga0373927_0018003 | Ga0373927_0018003_25_807 | 246 |
| 761 | 3300035724 | Ga0373933_0080337 | Ga0373933_0080337_1203_1985 | 246 |
| 762 | 3300035724 | Ga0373933_0272262 | Ga0373933_0272262_297_1067 | 246 |
| 763 | 3300035725 | Ga0373947_0000264 | Ga0373947_0000264_22467_23249 | 246 |
| 764 | 3300035725 | Ga0373947_0128137 | Ga0373947_0128137_131_901 | 246 |
| 765 | 3300036401 | Ga0373937_0000571 | Ga0373937_0000571_3880_4662 | 246 |
| 766 | 3300036401 | Ga0373937_0007367 | Ga0373937_0007367_5868_6638 | 246 |
| 767 | 3300037068 | Ga0373925_0000018 | Ga0373925_0000018_27045_27827 | 246 |
| 768 | 3300037853 | Ga0436364_0145110 | Ga0436364_0145110_6584_7354 | 246 |
| 769 | 3300038996 | Ga0242420_000299 | Ga0242420_000299_4171_4941 | 246 |
| 770 | 3300039437 | Ga0436365_1262142 | Ga0436365_1262142_4195_4965 | 246 |
| 771 | 3300039450 | Ga0436363_1677324 | Ga0436363_1677324_25_795 | 246 |
| 772 | 3300042005 | Ga0439448_0016529 | Ga0439448_0016529_1228_1998 | 246 |
| 773 | 3300042012 | Ga0439455_0004368 | Ga0439455_0004368_485_1255 | 246 |
| 774 | 3300042016 | Ga0439463_007824 | Ga0439463_007824_584_1354 | 246 |
| 775 | 3300044694 | Ga0466963_0037383 | Ga0466963_0037383_2201_2971 | 246 |
| 776 | 3300045051 | Ga0451576_0067491 | Ga0451576_0067491_2548_3318 | 246 |
| 777 | 3300045836 | Ga0466958_0062650 | Ga0466958_0062650_524_1294 | 246 |
| 778 | 3300046454 | Ga0495592_0000001 | Ga0495592_0000001_180570_181352 | 246 |
| 779 | 3300046459 | Ga0495629_0012920 | Ga0495629_0012920_3416_4198 | 246 |
| 780 | 3300046462 | Ga0495651_0004527 | Ga0495651_0004527_5971_6753 | 246 |
| 781 | 3300046463 | Ga0495653_0000015 | Ga0495653_0000015_139036_139818 | 246 |
| 782 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_135008_135790 | 246 |
| 783 | 3300046491 | Ga0495584_0003512 | Ga0495584_0003512_1446_2216 | 246 |
| 784 | 3300046499 | Ga0495594_0184511 | Ga0495594_0184511_213_983 | 246 |
| 785 | 3300046511 | Ga0495608_0000116 | Ga0495608_0000116_26164_26946 | 246 |
| 786 | 3300046514 | Ga0495618_0000021 | Ga0495618_0000021_103918_104700 | 246 |
| 787 | 3300046516 | Ga0495628_0000005 | Ga0495628_0000005_387009_387791 | 246 |
| 788 | 3300046517 | Ga0495630_0001024 | Ga0495630_0001024_6857_7639 | 246 |
| 789 | 3300046517 | Ga0495630_0060647 | Ga0495630_0060647_797_1567 | 246 |
| 790 | 3300046526 | Ga0495666_0140594 | Ga0495666_0140594_131_901 | 246 |
| 791 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_691375_692157 | 246 |
| 792 | 3300046533 | Ga0495640_0000006 | Ga0495640_0000006_139011_139793 | 246 |
| 793 | 3300046535 | Ga0495586_0087986 | Ga0495586_0087986_194_976 | 246 |
| 794 | 3300046536 | Ga0495587_0000012 | Ga0495587_0000012_33016_33798 | 246 |
| 795 | 3300046537 | Ga0495598_0055352 | Ga0495598_0055352_133_903 | 246 |
| 796 | 3300046543 | Ga0495645_0000004 | Ga0495645_0000004_28514_29296 | 246 |
| 797 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_531343_532125 | 246 |
| 798 | 3300046615 | Ga0495656_0004499 | Ga0495656_0004499_1228_1998 | 246 |
| 799 | 3300046615 | Ga0495656_0017425 | Ga0495656_0017425_822_1592 | 246 |
| 800 | 3300046642 | Ga0495634_0000388 | Ga0495634_0000388_26576_27358 | 246 |
| 801 | 3300046663 | Ga0495635_0000007 | Ga0495635_0000007_159542_160324 | 246 |
| 802 | 3300046675 | Ga0495657_0000250 | Ga0495657_0000250_33040_33822 | 246 |
| 803 | 3300046678 | Ga0495599_0000002 | Ga0495599_0000002_226594_227376 | 246 |
| 804 | 3300046679 | Ga0495623_0000116 | Ga0495623_0000116_19981_20763 | 246 |
| 805 | 3300046680 | Ga0495646_0000049 | Ga0495646_0000049_27042_27824 | 246 |
| 806 | 3300046683 | Ga0495658_0047198 | Ga0495658_0047198_841_1623 | 246 |
| 807 | 3300046683 | Ga0495658_0088403 | Ga0495658_0088403_610_1380 | 246 |
| 808 | 3300046689 | Ga0495613_0253656 | Ga0495613_0253656_412_1194 | 246 |
| 809 | 3300046809 | Ga0495600_0000013 | Ga0495600_0000013_2227_3009 | 246 |
| 810 | 3300047315 | Ga0495581_0028974 | Ga0495581_0028974_1270_2052 | 246 |
| 811 | 3300047317 | Ga0495604_0000007 | Ga0495604_0000007_58425_59207 | 246 |
| 812 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_334945_335727 | 246 |
| 813 | 3300047320 | Ga0495672_0151348 | Ga0495672_0151348_144_920 | 246 |
| 814 | 3300047322 | Ga0495680_0004250 | Ga0495680_0004250_9939_10721 | 246 |
| 815 | 3300047444 | Ga0495675_0000014 | Ga0495675_0000014_12964_13746 | 246 |
| 816 | 3300047471 | Ga0495684_0000219 | Ga0495684_0000219_29175_29957 | 246 |
| 817 | 3300048088 | Ga0495602_0000004 | Ga0495602_0000004_33059_33841 | 246 |
| 818 | 3300048903 | Ga0496100_0314855 | Ga0496100_0314855_108_878 | 246 |
| 819 | 3300048905 | Ga0496102_0092799 | Ga0496102_0092799_994_1764 | 246 |
| 820 | 3300048905 | Ga0496102_0230568 | Ga0496102_0230568_943_1713 | 246 |
| 821 | 3300048906 | Ga0496103_0100007 | Ga0496103_0100007_349_1119 | 246 |
| 822 | 3300048907 | Ga0496104_0207062 | Ga0496104_0207062_331_1101 | 246 |
| 823 | 3300048907 | Ga0496104_0270089 | Ga0496104_0270089_155_925 | 246 |
| 824 | 3300048908 | Ga0496105_0064743 | Ga0496105_0064743_542_1312 | 246 |
| 825 | 3300048909 | Ga0496106_0017370 | Ga0496106_0017370_4205_4975 | 246 |
| 826 | 3300048912 | Ga0496109_0001125 | Ga0496109_0001125_8496_9266 | 246 |
| 827 | 3300048912 | Ga0496109_0251269 | Ga0496109_0251269_389_1159 | 246 |
| 828 | 3300048913 | Ga0496110_0353982 | Ga0496110_0353982_417_1187 | 246 |
| 829 | 3300048917 | Ga0496114_0024270 | Ga0496114_0024270_683_1453 | 246 |
| 830 | 3300048917 | Ga0496114_0652986 | Ga0496114_0652986_57_827 | 246 |
| 831 | 3300048918 | Ga0496115_0131060 | Ga0496115_0131060_550_1320 | 246 |
| 832 | 3300048918 | Ga0496115_0223886 | Ga0496115_0223886_583_1353 | 246 |
| 833 | 3300048929 | Ga0496126_0028568 | Ga0496126_0028568_333_1103 | 246 |
| 834 | 3300049571 | Ga0501034_0000616 | Ga0501034_0000616_19870_20640 | 246 |
| 835 | 3300049571 | Ga0501034_0014011 | Ga0501034_0014011_1556_2326 | 246 |
| 836 | 3300049571 | Ga0501034_0192087 | Ga0501034_0192087_857_1627 | 246 |
| 837 | 3300049572 | Ga0501036_0291403 | Ga0501036_0291403_68_838 | 246 |
| 838 | 3300049573 | Ga0501037_0023898 | Ga0501037_0023898_2679_3449 | 246 |
| 839 | 3300049573 | Ga0501037_0034118 | Ga0501037_0034118_2787_3557 | 246 |
| 840 | 3300049574 | Ga0501038_0112956 | Ga0501038_0112956_830_1600 | 246 |
| 841 | 3300049575 | Ga0501039_0345861 | Ga0501039_0345861_187_957 | 246 |
| 842 | 3300049578 | Ga0501042_0212625 | Ga0501042_0212625_247_1017 | 246 |
| 843 | 3300049579 | Ga0501043_0028099 | Ga0501043_0028099_134_904 | 246 |
| 844 | 3300049579 | Ga0501043_0272665 | Ga0501043_0272665_317_1087 | 246 |
| 845 | 3300049580 | Ga0501046_0153320 | Ga0501046_0153320_916_1686 | 246 |
| 846 | 3300049581 | Ga0501047_0238790 | Ga0501047_0238790_414_1184 | 246 |
| 847 | 3300049582 | Ga0501048_0300582 | Ga0501048_0300582_319_1089 | 246 |
| 848 | 3300049583 | Ga0501067_0143566 | Ga0501067_0143566_243_1013 | 246 |
| 849 | 3300049584 | Ga0501068_0022329 | Ga0501068_0022329_2619_3389 | 246 |
| 850 | 3300049585 | Ga0501069_0068348 | Ga0501069_0068348_474_1244 | 246 |
| 851 | 3300049585 | Ga0501069_0175528 | Ga0501069_0175528_334_1104 | 246 |
| 852 | 3300049586 | Ga0501070_0125475 | Ga0501070_0125475_563_1333 | 246 |
| 853 | 3300049586 | Ga0501070_0203780 | Ga0501070_0203780_212_982 | 246 |
| 854 | 3300049589 | Ga0501073_0005090 | Ga0501073_0005090_7928_8698 | 246 |
| 855 | 3300049592 | Ga0501076_0077924 | Ga0501076_0077924_1875_2645 | 246 |
| 856 | 3300049742 | Ga0501080_0050705 | Ga0501080_0050705_488_1258 | 246 |
| 857 | 3300049742 | Ga0501080_0075084 | Ga0501080_0075084_1650_2420 | 246 |
| 858 | 3300049742 | Ga0501080_0170788 | Ga0501080_0170788_763_1533 | 246 |
| 859 | 3300049744 | Ga0501083_0013916 | Ga0501083_0013916_1454_2224 | 246 |
| 860 | 3300049822 | Ga0501035_0007147 | Ga0501035_0007147_8156_8926 | 246 |
| 861 | 3300049822 | Ga0501035_0172050 | Ga0501035_0172050_303_1073 | 246 |
| 862 | 3300049823 | Ga0501044_0215139 | Ga0501044_0215139_577_1347 | 246 |
| 863 | 3300049823 | Ga0501044_0505359 | Ga0501044_0505359_184_954 | 246 |
| 864 | 3300049824 | Ga0501045_0473805 | Ga0501045_0473805_138_908 | 246 |
| 865 | 3300050491 | nmdc:mga00v17_42628_c1 | nmdc:mga00v17_42628_c1_1427_2197 | 246 |
| 866 | 3300050491 | nmdc:mga00v17_82958_c1 | nmdc:mga00v17_82958_c1_913_1683 | 246 |
| 867 | 3300050495 | nmdc:mga04h51_9915_c1 | nmdc:mga04h51_9915_c1_1159_1929 | 246 |
| 868 | 3300050496 | nmdc:mga07m45_100802_c1 | nmdc:mga07m45_100802_c1_420_1190 | 246 |
| 869 | 3300050507 | nmdc:mga05p37_11988_c1 | nmdc:mga05p37_11988_c1_3466_4236 | 246 |
| 870 | 3300050507 | nmdc:mga05p37_18354_c1 | nmdc:mga05p37_18354_c1_2423_3193 | 246 |
| 871 | 3300050509 | nmdc:mga0qj67_704_c1 | nmdc:mga0qj67_704_c1_12713_13489 | 246 |
| 872 | 3300050511 | nmdc:mga08y16_133764_c1 | nmdc:mga08y16_133764_c1_1670_2440 | 246 |
| 873 | 3300050511 | nmdc:mga08y16_1621_c1 | nmdc:mga08y16_1621_c1_10983_11753 | 246 |
| 874 | 3300050511 | nmdc:mga08y16_168408_c1 | nmdc:mga08y16_168408_c1_552_1322 | 246 |
| 875 | 3300050511 | nmdc:mga08y16_231127_c1 | nmdc:mga08y16_231127_c1_599_1369 | 246 |
| 876 | 3300050511 | nmdc:mga08y16_238163_c1 | nmdc:mga08y16_238163_c1_397_1167 | 246 |
| 877 | 3300050512 | nmdc:mga0n895_12677_c1 | nmdc:mga0n895_12677_c1_1090_1860 | 246 |
| 878 | 3300050512 | nmdc:mga0n895_267853_c1 | nmdc:mga0n895_267853_c1_405_1175 | 246 |
| 879 | 3300050512 | nmdc:mga0n895_867201_c1 | nmdc:mga0n895_867201_c1_94_864 | 246 |
| 880 | 3300050514 | nmdc:mga08x19_54995_c1 | nmdc:mga08x19_54995_c1_746_1528 | 246 |
| 881 | 3300050515 | nmdc:mga0a205_80336_c1 | nmdc:mga0a205_80336_c1_1108_1878 | 246 |
| 882 | 3300050515 | nmdc:mga0a205_93540_c1 | nmdc:mga0a205_93540_c1_1169_1939 | 246 |
| 883 | 3300053077 | Ga0495601_0000006 | Ga0495601_0000006_174995_175777 | 246 |
| 884 | 3300053078 | Ga0495612_0000004 | Ga0495612_0000004_138883_139665 | 246 |
| 885 | 3300053084 | Ga0495595_0000006 | Ga0495595_0000006_66329_67111 | 246 |
| 886 | 3300053085 | Ga0495619_0000240 | Ga0495619_0000240_5933_6715 | 246 |
| 887 | 3300053085 | Ga0495619_0017362 | Ga0495619_0017362_3670_4440 | 246 |
| 888 | 3300053085 | Ga0495619_0075509 | Ga0495619_0075509_1258_2028 | 246 |
| 889 | 3300053087 | Ga0500643_006735 | Ga0500643_006735_1895_2665 | 246 |
| 890 | 3300053088 | Ga0500644_0001049 | Ga0500644_0001049_472_1242 | 246 |
| 891 | 3300053093 | Ga0500651_0029241 | Ga0500651_0029241_972_1742 | 246 |
| 892 | 3300053096 | Ga0500641_0002552 | Ga0500641_0002552_74_844 | 246 |
| 893 | 3300053118 | Ga0500594_0006844 | Ga0500594_0006844_285_1055 | 246 |
| 894 | 3300053119 | Ga0500595_000056 | Ga0500595_000056_67091_67861 | 246 |
| 895 | 3300053131 | Ga0500652_000030 | Ga0500652_000030_75682_76452 | 246 |
| 896 | 3300053133 | Ga0500655_016098 | Ga0500655_016098_317_1087 | 246 |
| 897 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_330647_331417 | 246 |
| 898 | 3300053730 | Ga0500645_000384 | Ga0500645_000384_28407_29177 | 246 |
| 899 | 3300053730 | Ga0500645_031550 | Ga0500645_031550_405_1181 | 246 |
| 900 | 3300054114 | Ga0501084_0564161 | Ga0501084_0564161_25_795 | 246 |
| 901 | 3300060353 | Ga0501082_0000365 | Ga0501082_0000365_15855_16625 | 246 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s3l-assembly1.cif.gz_F | structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex. | 0.6053 | 18 | 237 |
| 6s3r-assembly1.cif.gz_F | structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi. | 0.5933 | 1 | 241 |
| 7e80-assembly1.cif.gz_CE | cryo-em structure of the flagellar rod with hook and export apparatus from salmonella | 0.5866 | 11 | 242 |
| 6s3r-assembly1.cif.gz_F | structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi. | 0.5798 | 1 | 241 |
| 7bin-assembly1.cif.gz_F | salmonella export gate and rod refined in focussed c1 map | 0.5723 | 3 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6ZMY3_591_703_1.10.472.30 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Transcription elongation factor S-II, central domain | 0.3967 | 1 | 90 | 1.10.472.30 |
| af_P22468_2_194_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.368 | 31 | 181 | 3.40.50.300 |
| af_I1J9Z8_276_439_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3508 | 51 | 223 | 1.20.1250.20 |
| af_A0A1D6P003_256_419_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3424 | 49 | 220 | 1.20.1250.20 |
| af_Q3V050_274_435_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3412 | 48 | 223 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E1XSW7-F1-model_v4 | deleted | 0.7437 | 6 | 243 |
|
| AF-A0A7C7GBR5-F1-model_v4 | Flagellar type III secretion system protein FliR | 0.7382 | 12 | 208 |
GO:0005886
GO:0006605 |
| AF-A0A257VTW9-F1-model_v4 | Flagellar biosynthetic protein FliR | 0.73 | 1 | 197 |
GO:0005886
GO:0006605 |
| AF-A0A3D3IUN9-F1-model_v4 | Flagellar biosynthetic protein FliR | 0.7287 | 7 | 199 |
GO:0005886
GO:0006605 |
| AF-A0A2E1XSW7-F1-model_v4 | deleted | 0.7204 | 6 | 243 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar