F485168

General Info

Members Datasets Scaffolds Average Seq Length
901 424 899 244

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100001959|Ga0075430_1000019597
Length 258
Sequence MKIDISFLPAYAAAFMLVFARIGTMIMLLPGLGEMSVPRRIRLTLALVLSAVLLPLHRTAYEVDISTTFGPILTLMAQEIFIGAVLGLTARLMISALQVAGFVIAQQLGLGFASAVDPTQGGQQGVLISNFLTMLGVTLIFATDLHHLIIAALNDSYRLFKPGEIPLIGDVAALTTQTIALAFKIGIQLSAPFLIFGLLFNLGLGVLSRLMPQMQVFFVGVPLSILIGLLILFLVLGAVMMVFLNSMETVLRQLAPYS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
5 2842694124 Methylopila sp. R-72369 Isolate Unclassified
6 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
7 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
8 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
9 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
10 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
11 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
16 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
17 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
18 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
21 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
22 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
65 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
143 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
144 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
161 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
162 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
247 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
248 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
249 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
250 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
251 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
252 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
253 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
254 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
255 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
256 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
257 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
258 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
259 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
260 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
261 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
262 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
263 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
264 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
265 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
266 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
267 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
268 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
269 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
272 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
274 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
275 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
276 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
277 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
278 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
279 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
280 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
281 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
282 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
283 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
284 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
285 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
286 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
287 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
288 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
289 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
296 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
297 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
298 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
299 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
300 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
301 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
302 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
303 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
304 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
305 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
310 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
311 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
312 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
313 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
314 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
315 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
316 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
317 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
318 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
319 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
320 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
321 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
322 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
323 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
324 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
325 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
326 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
332 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
338 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
339 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
340 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
341 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
342 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
346 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
355 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
380 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
381 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
384 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
385 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
386 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
387 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
388 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
389 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
390 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
391 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
392 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
395 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
396 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
397 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
398 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
399 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
403 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
404 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
405 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
406 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
407 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
408 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
409 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
410 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
411 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
412 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
413 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
414 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
415 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
416 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
417 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
418 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
419 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.33
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0.11
Rhizoplane 4.88
Rhizosphere 88.68
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1612269 2162886007 Bacteria 1530
2 2214856319 2209111006 Bacteria 7962
3 ARcpr5oldR_c000300 3300000041 Bacteria 7236
4 ARSoilYngRDRAFT_c00004 3300000042 Bacteria 40941
5 ARcpr5yngRDRAFT_c000060 3300000043 Bacteria 17786
6 ARSoilOldRDRAFT_c000283 3300000044 Bacteria 7128
7 ARCol0yngRDRAFT_1000084 3300000652 Bacteria 17450
8 JGI24032J14994_100202 3300001430 Bacteria 3032
9 JGI24740J21852_10028821 3300001979 Bacteria 1830
10 JGI24739J22299_10002358 3300001989 Bacteria 7275
11 JGI24739J22299_10044017 3300001989 Bacteria 1472
12 JGI24737J22298_10001122 3300001990 Bacteria 9408
13 JGI24737J22298_10005585 3300001990 Bacteria 4334
14 JGI24743J22301_10001232 3300001991 Bacteria 3474
15 JGI24750J21931_1000032 3300002070 Bacteria 18759
16 JGI24745J21846_1002345 3300002073 Bacteria 1928
17 JGI24748J21848_1002107 3300002074 Bacteria 2227
18 JGI24738J21930_10002299 3300002075 Bacteria 5042
19 JGI24749J21850_1000809 3300002076 Bacteria 4502
20 JGI24035J26624_1000092 3300002126 Bacteria 7552
21 JGI24033J26618_1000309 3300002155 Bacteria 5203
22 JGI24034J26672_10000536 3300002239 Bacteria 4842
23 JGI24742J22300_10000050 3300002244 Bacteria 17817
24 rootH1_10019190 3300003316 Bacteria 1001
25 rootH1_10019190 3300003323 Bacteria 2761
26 Ga0065716_1001561 3300005277 Bacteria 6561
27 Ga0065714_10155348 3300005288 Bacteria 1082
28 Ga0065704_10083099 3300005289 Bacteria 3509
29 Ga0065712_10014760 3300005290 Bacteria 2589
30 Ga0065712_10077134 3300005290 Bacteria 3544
31 Ga0065712_10084044 3300005290 Bacteria 2793
32 Ga0065715_10002288 3300005293 Bacteria 15558
33 Ga0065715_10091974 3300005293 Bacteria 5418
34 Ga0070658_10482445 3300005327 Bacteria 1070
35 Ga0070676_10009142 3300005328 Bacteria 5361
36 Ga0070676_10250917 3300005328 Bacteria 1181
37 Ga0070683_100000259 3300005329 Bacteria 36454
38 Ga0070683_100088494 3300005329 Bacteria 2905
39 Ga0070683_100770214 3300005329 Bacteria 922
40 Ga0070690_100013047 3300005330 Bacteria 4902
41 Ga0070670_100043806 3300005331 Bacteria 3847
42 Ga0070670_100084881 3300005331 Bacteria 2720
43 Ga0070677_10000339 3300005333 Bacteria 16384
44 Ga0068869_100000095 3300005334 Bacteria 41336
45 Ga0068869_100028848 3300005334 Bacteria 3881
46 Ga0068869_100218022 3300005334 Bacteria 1511
47 Ga0068869_100268264 3300005334 Bacteria 1369
48 Ga0070666_10046612 3300005335 Bacteria 2908
49 Ga0070680_100019598 3300005336 Bacteria 5364
50 Ga0070680_100019622 3300005336 Bacteria 5361
51 Ga0070680_100147897 3300005336 Bacteria 1972
52 Ga0070682_100002519 3300005337 Bacteria 10108
53 Ga0070682_100051332 3300005337 Bacteria 2577
54 Ga0068868_100006592 3300005338 Bacteria 8230
55 Ga0068868_100011912 3300005338 Bacteria 6342
56 Ga0070660_100016495 3300005339 Bacteria 5361
57 Ga0070660_100214323 3300005339 Bacteria 1564
58 Ga0070689_100020436 3300005340 Bacteria 4913
59 Ga0070689_100087555 3300005340 Bacteria 2450
60 Ga0070691_10006454 3300005341 Bacteria 5361
61 Ga0070691_10115427 3300005341 Bacteria 1347
62 Ga0070687_100004929 3300005343 Bacteria 5361
63 Ga0070687_100064626 3300005343 Bacteria 1944
64 Ga0070661_100000362 3300005344 Bacteria 35891
65 Ga0070661_100424707 3300005344 Bacteria 1054
66 Ga0070692_10005659 3300005345 Bacteria 5361
67 Ga0070692_10028168 3300005345 Bacteria 2791
68 Ga0070668_100017522 3300005347 Bacteria 5371
69 Ga0070668_100017886 3300005347 Bacteria 5318
70 Ga0070669_100002512 3300005353 Bacteria 13271
71 Ga0070675_100019847 3300005354 Bacteria 5361
72 Ga0070671_100000935 3300005355 Bacteria 21361
73 Ga0070671_100028391 3300005355 Bacteria 4606
74 Ga0070674_100008580 3300005356 Bacteria 6094
75 Ga0070674_100009282 3300005356 Bacteria 5888
76 Ga0070673_100000144 3300005364 Bacteria 33872
77 Ga0070688_100001947 3300005365 Bacteria 10375
78 Ga0070688_100009341 3300005365 Bacteria 5359
79 Ga0070659_100017676 3300005366 Bacteria 5371
80 Ga0070659_100033629 3300005366 Bacteria 3983
81 Ga0070667_100005818 3300005367 Bacteria 10284
82 Ga0070667_100011748 3300005367 Bacteria 7235
83 Ga0070667_100126708 3300005367 Bacteria 2226
84 Ga0070703_10008667 3300005406 Bacteria 2861
85 Ga0070709_10290588 3300005434 Bacteria 1191
86 Ga0070714_100007544 3300005435 Bacteria 8468
87 Ga0070714_100067871 3300005435 Bacteria 3076
88 Ga0070714_100311930 3300005435 Bacteria 1469
89 Ga0070713_100015641 3300005436 Bacteria 5682
90 Ga0070713_100116108 3300005436 Bacteria 2340
91 Ga0070710_10019002 3300005437 Bacteria 3545
92 Ga0070701_10010426 3300005438 Bacteria 4109
93 Ga0070701_10053038 3300005438 Bacteria 2109
94 Ga0070711_100036932 3300005439 Bacteria 3275
95 Ga0070711_100325117 3300005439 Bacteria 1230
96 Ga0070705_100001332 3300005440 Bacteria 13181
97 Ga0070705_100241640 3300005440 Bacteria 1262
98 Ga0070705_100313286 3300005440 Unclassified 1130
99 Ga0070700_100009367 3300005441 Bacteria 5371
100 Ga0070700_100030724 3300005441 Bacteria 3213
101 Ga0070694_100012072 3300005444 Bacteria 5364
102 Ga0070694_100012089 3300005444 Bacteria 5361
103 Ga0070708_100059559 3300005445 Bacteria 3405
104 Ga0070663_100012574 3300005455 Bacteria 5361
105 Ga0070663_100092523 3300005455 Bacteria 2242
106 Ga0070663_100286636 3300005455 Bacteria 1314
107 Ga0070678_100000955 3300005456 Bacteria 14888
108 Ga0070678_100359786 3300005456 Bacteria 1254
109 Ga0070662_100013888 3300005457 Bacteria 5365
110 Ga0070662_100416198 3300005457 Bacteria 1111
111 Ga0070681_10048667 3300005458 Bacteria 4236
112 Ga0070681_10060537 3300005458 Bacteria 3762
113 Ga0070681_10164684 3300005458 Bacteria 2140
114 Ga0070681_10369884 3300005458 Bacteria 1344
115 Ga0070681_10390463 3300005458 Bacteria 1302
116 Ga0068867_100000325 3300005459 Bacteria 31413
117 Ga0070685_10069157 3300005466 Bacteria 2088
118 Ga0070707_100546964 3300005468 Bacteria 1120
119 Ga0070698_100258431 3300005471 Bacteria 1674
120 Ga0070699_100109188 3300005518 Bacteria 2428
121 Ga0070699_100775206 3300005518 Unclassified 877
122 Ga0070679_100029943 3300005530 Bacteria 5371
123 Ga0070679_100052219 3300005530 Bacteria 4072
124 Ga0070679_100183834 3300005530 Bacteria 2062
125 Ga0070679_100361578 3300005530 Bacteria 1399
126 Ga0070679_100446228 3300005530 Bacteria 1238
127 Ga0070684_100001386 3300005535 Bacteria 17402
128 Ga0070684_100112100 3300005535 Bacteria 2447
129 Ga0070684_100716989 3300005535 Bacteria 933
130 Ga0070697_100002804 3300005536 Bacteria 13422
131 Ga0070697_100180919 3300005536 Bacteria 1787
132 Ga0068853_100021663 3300005539 Bacteria 5361
133 Ga0068853_100748189 3300005539 Bacteria 934
134 Ga0070672_100003185 3300005543 Bacteria 10620
135 Ga0070672_100106629 3300005543 Bacteria 2279
136 Ga0070686_100002814 3300005544 Bacteria 9585
137 Ga0070686_100011949 3300005544 Bacteria 4937
138 Ga0070695_100001945 3300005545 Bacteria 11708
139 Ga0070695_100011210 3300005545 Bacteria 5360
140 Ga0070695_100013577 3300005545 Bacteria 4896
141 Ga0070695_100082509 3300005545 Bacteria 2128
142 Ga0070695_100277518 3300005545 Bacteria 1230
143 Ga0070696_100014107 3300005546 Bacteria 5364
144 Ga0070696_100014120 3300005546 Bacteria 5361
145 Ga0070696_100225817 3300005546 Bacteria 1407
146 Ga0070693_100001679 3300005547 Bacteria 10029
147 Ga0070693_100047790 3300005547 Bacteria 2436
148 Ga0070665_100107883 3300005548 Bacteria 2787
149 Ga0070665_100109057 3300005548 Bacteria 2771
150 Ga0070704_100011878 3300005549 Bacteria 5361
151 Ga0070704_100066027 3300005549 Bacteria 2607
152 Ga0070704_100118122 3300005549 Bacteria 2031
153 Ga0068855_100011491 3300005563 Bacteria 10700
154 Ga0070664_100025252 3300005564 Bacteria 4923
155 Ga0068857_100000521 3300005577 Bacteria 27715
156 Ga0068854_100013433 3300005578 Bacteria 5375
157 Ga0068854_100124485 3300005578 Bacteria 1961
158 Ga0068854_100156484 3300005578 Bacteria 1761
159 Ga0068856_100034966 3300005614 Bacteria 4923
160 Ga0068856_100070595 3300005614 Bacteria 3455
161 Ga0068856_100211800 3300005614 Bacteria 1953
162 Ga0070702_100001916 3300005615 Bacteria 8741
163 Ga0070702_100323926 3300005615 Bacteria 1075
164 Ga0068859_100025977 3300005617 Bacteria 5875
165 Ga0068859_100064359 3300005617 Bacteria 3699
166 Ga0068859_100354210 3300005617 Bacteria 1563
167 Ga0068859_100372990 3300005617 Bacteria 1523
168 Ga0068859_100532973 3300005617 Bacteria 1269
169 Ga0068864_100000459 3300005618 Bacteria 35328
170 Ga0068866_10000987 3300005718 Bacteria 12531
171 Ga0068866_10101535 3300005718 Bacteria 1588
172 Ga0068851_10219166 3300005834 Bacteria 1068
173 Ga0068870_10000034 3300005840 Bacteria 43913
174 Ga0068863_100004287 3300005841 Bacteria 14047
175 Ga0068858_100031677 3300005842 Bacteria 4913
176 Ga0068858_100035496 3300005842 Bacteria 4625
177 Ga0068858_100063955 3300005842 Bacteria 3404
178 Ga0068858_100209543 3300005842 Bacteria 1844
179 Ga0068860_100028836 3300005843 Bacteria 5341
180 Ga0068860_100141077 3300005843 Bacteria 2316
181 Ga0068860_100517741 3300005843 Bacteria 1193
182 Ga0068860_100547411 3300005843 Bacteria 1159
183 Ga0068862_100021695 3300005844 Bacteria 5371
184 Ga0068862_100025938 3300005844 Bacteria 4924
185 Ga0081455_10009792 3300005937 Bacteria 9813
186 Ga0081455_10027923 3300005937 Bacteria 5163
187 Ga0081455_10043322 3300005937 Bacteria 3938
188 Ga0081540_1000068 3300005983 Bacteria 112697
189 Ga0081540_1078594 3300005983 Bacteria 1494
190 Ga0070717_10088016 3300006028 Bacteria 2617
191 Ga0070717_10353030 3300006028 Bacteria 1315
192 Ga0075365_10040537 3300006038 Bacteria 3037
193 Ga0075365_10222244 3300006038 Bacteria 1325
194 Ga0075365_10306005 3300006038 Bacteria 1119
195 Ga0075368_10018895 3300006042 Bacteria 2597
196 Ga0075368_10038132 3300006042 Bacteria 1881
197 Ga0075363_100083856 3300006048 Bacteria 1747
198 Ga0075363_100177238 3300006048 Bacteria 1212
199 Ga0075364_10119889 3300006051 Bacteria 1760
200 Ga0075364_10245725 3300006051 Bacteria 1216
201 Ga0075364_10288205 3300006051 Bacteria 1117
202 Ga0070715_10015446 3300006163 Bacteria 2848
203 Ga0070712_100034300 3300006175 Bacteria 3438
204 Ga0070712_100465114 3300006175 Bacteria 1055
205 Ga0075367_10000344 3300006178 Bacteria 16544
206 Ga0075367_10002451 3300006178 Bacteria 8486
207 Ga0075367_10046406 3300006178 Bacteria 2552
208 Ga0075369_10000100 3300006186 Bacteria 23074
209 Ga0075369_10090117 3300006186 Bacteria 1368
210 Ga0075366_10129847 3300006195 Bacteria 1520
211 Ga0075366_10217567 3300006195 Bacteria 1164
212 Ga0075366_10266979 3300006195 Bacteria 1045
213 Ga0097621_100000010 3300006237 Bacteria 112867
214 Ga0097621_100122680 3300006237 Bacteria 2205
215 Ga0097621_100161114 3300006237 Bacteria 1929
216 Ga0097621_100212019 3300006237 Bacteria 1685
217 Ga0068871_100000193 3300006358 Bacteria 41878
218 Ga0068871_100058204 3300006358 Bacteria 3146
219 Ga0068871_100325706 3300006358 Bacteria 1354
220 Ga0068871_100356654 3300006358 Bacteria 1294
221 Ga0075430_100001959 3300006846 Bacteria 16923
222 Ga0075431_100028363 3300006847 Bacteria 5751
223 Ga0075433_10003868 3300006852 Bacteria 11596
224 Ga0075434_100000202 3300006871 Bacteria 40164
225 Ga0075434_100178546 3300006871 Bacteria 2143
226 Ga0075429_100275689 3300006880 Bacteria 1473
227 Ga0068865_100000252 3300006881 Bacteria 29599
228 Ga0068865_100047404 3300006881 Bacteria 2953
229 Ga0068865_100193971 3300006881 Bacteria 1573
230 Ga0075436_100004205 3300006914 Bacteria 9879
231 Ga0075436_100005213 3300006914 Bacteria 8946
232 Ga0075436_100127128 3300006914 Bacteria 1786
233 Ga0097620_100025977 3300006931 Bacteria 5875
234 Ga0097620_100064360 3300006931 Bacteria 3699
235 Ga0097620_100354207 3300006931 Bacteria 1563
236 Ga0097620_100372998 3300006931 Bacteria 1523
237 Ga0097620_100532907 3300006931 Bacteria 1269
238 Ga0075435_100062416 3300007076 Bacteria 3024
239 Ga0075435_100266638 3300007076 Bacteria 1460
240 Ga0099795_10000385 3300007788 Bacteria 8012
241 Ga0105251_10059560 3300009011 Bacteria 1800
242 Ga0105240_10034585 3300009093 Bacteria 6517
243 Ga0111539_10022969 3300009094 Bacteria 7659
244 Ga0111539_10043725 3300009094 Bacteria 5369
245 Ga0111539_10043761 3300009094 Bacteria 5367
246 Ga0111539_10161295 3300009094 Bacteria 2622
247 Ga0111539_10255793 3300009094 Bacteria 2039
248 Ga0105245_10000152 3300009098 Bacteria 65742
249 Ga0105245_10011738 3300009098 Bacteria 7620
250 Ga0105245_10165436 3300009098 Bacteria 2102
251 Ga0105245_10423937 3300009098 Bacteria 1334
252 Ga0105247_10001782 3300009101 Bacteria 15144
253 Ga0105247_10017431 3300009101 Bacteria 4312
254 Ga0105247_10031689 3300009101 Bacteria 3210
255 Ga0114129_10004957 3300009147 Bacteria 18771
256 Ga0114129_10100059 3300009147 Bacteria 4012
257 Ga0114129_10123024 3300009147 Bacteria 3569
258 Ga0114129_10242026 3300009147 Bacteria 2425
259 Ga0105243_10018129 3300009148 Bacteria 5327
260 Ga0105243_10043961 3300009148 Bacteria 3503
261 Ga0105241_10016831 3300009174 Bacteria 5367
262 Ga0105241_10081088 3300009174 Bacteria 2541
263 Ga0105242_10019113 3300009176 Bacteria 5367
264 Ga0105242_10175706 3300009176 Bacteria 1885
265 Ga0105248_10001245 3300009177 Bacteria 28462
266 Ga0105248_10065391 3300009177 Bacteria 4084
267 Ga0105248_10132039 3300009177 Bacteria 2818
268 Ga0105248_10433061 3300009177 Bacteria 1481
269 Ga0105237_10023502 3300009545 Bacteria 6314
270 Ga0105237_10031856 3300009545 Bacteria 5340
271 Ga0105237_10050388 3300009545 Bacteria 4183
272 Ga0105237_10193257 3300009545 Bacteria 2035
273 Ga0105238_10011409 3300009551 Bacteria 8948
274 Ga0105238_10042527 3300009551 Bacteria 4600
275 Ga0105238_10121993 3300009551 Bacteria 2586
276 Ga0105238_10178405 3300009551 Bacteria 2101
277 Ga0105249_10024998 3300009553 Bacteria 5374
278 Ga0105239_10036827 3300010375 Bacteria 5367
279 Ga0105239_10076044 3300010375 Bacteria 3693
280 Ga0105239_10244850 3300010375 Bacteria 2013
281 Ga0105239_10684429 3300010375 Bacteria 1172
282 Ga0105246_10001947 3300011119 Bacteria 12437
283 Ga0105246_10039853 3300011119 Bacteria 3167
284 Ga0105246_10091049 3300011119 Bacteria 2197
285 Ga0157319_1000342 3300012497 Bacteria 2176
286 Ga0157342_1000333 3300012507 Bacteria 2742
287 Ga0157326_1012483 3300012513 Bacteria 970
288 Ga0157373_10015560 3300013100 Bacteria 5560
289 Ga0157373_10053754 3300013100 Bacteria 2863
290 Ga0157371_10003620 3300013102 Bacteria 13910
291 Ga0157371_10086333 3300013102 Bacteria 2222
292 Ga0157370_10033106 3300013104 Bacteria 5039
293 Ga0157370_10194826 3300013104 Bacteria 1881
294 Ga0157369_10186322 3300013105 Bacteria 2182
295 Ga0157374_10010563 3300013296 Bacteria 7949
296 Ga0157378_10000990 3300013297 Bacteria 26013
297 Ga0157378_10167363 3300013297 Bacteria 2059
298 Ga0157378_10444789 3300013297 Bacteria 1285
299 Ga0163162_10034398 3300013306 Bacteria 5043
300 Ga0163162_10109363 3300013306 Bacteria 2861
301 Ga0157372_10012895 3300013307 Bacteria 8911
302 Ga0157375_10026919 3300013308 Bacteria 5368
303 Ga0163163_10067522 3300014325 Bacteria 3556
304 Ga0163163_10067631 3300014325 Bacteria 3553
305 Ga0157380_10004398 3300014326 Bacteria 9771
306 Ga0157380_10116379 3300014326 Bacteria 2256
307 Ga0157380_10234855 3300014326 Bacteria 1649
308 Ga0157377_10000463 3300014745 Bacteria 17484
309 Ga0157376_10000098 3300014969 Bacteria 63149
310 Ga0157376_10283299 3300014969 Bacteria 1562
311 Ga0157376_10563546 3300014969 Bacteria 1129
312 Ga0163161_10000866 3300017792 Bacteria 23560
313 Ga0213876_10003554 3300021384 Bacteria 8883
314 Ga0213876_10055020 3300021384 Bacteria 2101
315 Ga0213876_10124093 3300021384 Bacteria 1371
316 Ga0213875_10000003 3300021388 Bacteria 719367
317 Ga0224572_1009661 3300024225 Bacteria 1804
318 Ga0207666_1000450 3300025271 Bacteria 5319
319 Ga0207697_10002237 3300025315 Bacteria 10113
320 Ga0207697_10007190 3300025315 Bacteria 4976
321 Ga0207653_10016205 3300025885 Bacteria 2340
322 Ga0207682_10000006 3300025893 Bacteria 94953
323 Ga0207692_10047300 3300025898 Bacteria 2159
324 Ga0207692_10119115 3300025898 Bacteria 1475
325 Ga0207692_10237895 3300025898 Bacteria 1086
326 Ga0207642_10000107 3300025899 Bacteria 22438
327 Ga0207642_10043328 3300025899 Bacteria 1984
328 Ga0207642_10104663 3300025899 Bacteria 1428
329 Ga0207710_10003925 3300025900 Bacteria 6564
330 Ga0207710_10039847 3300025900 Bacteria 2080
331 Ga0207688_10002370 3300025901 Bacteria 10144
332 Ga0207688_10023763 3300025901 Bacteria 3359
333 Ga0207680_10028611 3300025903 Bacteria 3120
334 Ga0207647_10002014 3300025904 Bacteria 15551
335 Ga0207647_10019660 3300025904 Bacteria 4539
336 Ga0207647_10102240 3300025904 Bacteria 1699
337 Ga0207685_10018147 3300025905 Bacteria 2290
338 Ga0207699_10044580 3300025906 Bacteria 2583
339 Ga0207699_10101992 3300025906 Bacteria 1823
340 Ga0207699_10180876 3300025906 Bacteria 1417
341 Ga0207645_10000023 3300025907 Bacteria 98724
342 Ga0207645_10275901 3300025907 Bacteria 1115
343 Ga0207643_10000007 3300025908 Bacteria 171706
344 Ga0207684_10233878 3300025910 Bacteria 1585
345 Ga0207654_10001016 3300025911 Bacteria 15352
346 Ga0207654_10059728 3300025911 Bacteria 2225
347 Ga0207707_10000786 3300025912 Bacteria 31086
348 Ga0207707_10065647 3300025912 Bacteria 3161
349 Ga0207695_10013268 3300025913 Bacteria 9831
350 Ga0207671_10018636 3300025914 Bacteria 5319
351 Ga0207671_10070434 3300025914 Bacteria 2607
352 Ga0207671_10119018 3300025914 Bacteria 2017
353 Ga0207693_10014866 3300025915 Bacteria 6253
354 Ga0207663_10030770 3300025916 Bacteria 3169
355 Ga0207663_10062800 3300025916 Bacteria 2363
356 Ga0207663_10287520 3300025916 Bacteria 1223
357 Ga0207660_10000058 3300025917 Bacteria 56791
358 Ga0207660_10087819 3300025917 Bacteria 2298
359 Ga0207660_10268310 3300025917 Bacteria 1351
360 Ga0207662_10009553 3300025918 Bacteria 5344
361 Ga0207662_10011718 3300025918 Bacteria 4870
362 Ga0207657_10026832 3300025919 Bacteria 5285
363 Ga0207657_10112909 3300025919 Bacteria 2242
364 Ga0207657_10267313 3300025919 Bacteria 1360
365 Ga0207649_10000384 3300025920 Bacteria 33073
366 Ga0207652_10000377 3300025921 Bacteria 46255
367 Ga0207652_10078184 3300025921 Bacteria 2888
368 Ga0207646_10638428 3300025922 Bacteria 954
369 Ga0207681_10000100 3300025923 Bacteria 72913
370 Ga0207694_10012592 3300025924 Bacteria 6375
371 Ga0207694_10128015 3300025924 Bacteria 2033
372 Ga0207650_10004913 3300025925 Bacteria 9124
373 Ga0207650_10032858 3300025925 Bacteria 3755
374 Ga0207650_10047429 3300025925 Bacteria 3166
375 Ga0207659_10000044 3300025926 Bacteria 88759
376 Ga0207659_10170608 3300025926 Bacteria 1716
377 Ga0207687_10001241 3300025927 Bacteria 17449
378 Ga0207687_10097059 3300025927 Bacteria 2161
379 Ga0207700_10036373 3300025928 Bacteria 3555
380 Ga0207664_10347809 3300025929 Bacteria 1312
381 Ga0207664_10470601 3300025929 Bacteria 1123
382 Ga0207644_10002171 3300025931 Bacteria 12721
383 Ga0207644_10033573 3300025931 Bacteria 3587
384 Ga0207690_10001671 3300025932 Bacteria 13703
385 Ga0207690_10019165 3300025932 Bacteria 4206
386 Ga0207706_10016484 3300025933 Bacteria 6669
387 Ga0207706_10025283 3300025933 Bacteria 5322
388 Ga0207706_10025308 3300025933 Bacteria 5319
389 Ga0207706_10324392 3300025933 Bacteria 1340
390 Ga0207686_10000222 3300025934 Bacteria 43531
391 Ga0207686_10135390 3300025934 Bacteria 1695
392 Ga0207709_10000154 3300025935 Bacteria 93456
393 Ga0207709_10027551 3300025935 Bacteria 3275
394 Ga0207709_10038133 3300025935 Bacteria 2859
395 Ga0207670_10000129 3300025936 Bacteria 49928
396 Ga0207670_10034390 3300025936 Bacteria 3275
397 Ga0207669_10000502 3300025937 Bacteria 17080
398 Ga0207704_10000446 3300025938 Bacteria 18422
399 Ga0207704_10199240 3300025938 Bacteria 1464
400 Ga0207665_10022731 3300025939 Bacteria 4128
401 Ga0207665_10024162 3300025939 Bacteria 4006
402 Ga0207665_10393127 3300025939 Bacteria 1054
403 Ga0207691_10005314 3300025940 Bacteria 12434
404 Ga0207711_10021351 3300025941 Bacteria 5409
405 Ga0207711_10078995 3300025941 Bacteria 2871
406 Ga0207689_10000098 3300025942 Bacteria 69773
407 Ga0207661_10000178 3300025944 Bacteria 41008
408 Ga0207661_10092015 3300025944 Bacteria 2528
409 Ga0207679_10000029 3300025945 Bacteria 183002
410 Ga0207667_10010651 3300025949 Bacteria 10730
411 Ga0207651_10000031 3300025960 Bacteria 66688
412 Ga0207712_10000129 3300025961 Bacteria 79246
413 Ga0207668_10000100 3300025972 Bacteria 60574
414 Ga0207668_10000158 3300025972 Bacteria 47189
415 Ga0207668_10047558 3300025972 Bacteria 2938
416 Ga0207640_10000168 3300025981 Bacteria 47588
417 Ga0207658_10014664 3300025986 Bacteria 5368
418 Ga0207658_10202277 3300025986 Bacteria 1659
419 Ga0207658_10255539 3300025986 Bacteria 1491
420 Ga0207677_10004338 3300026023 Bacteria 7597
421 Ga0207677_10016991 3300026023 Bacteria 4325
422 Ga0207703_10005069 3300026035 Bacteria 10660
423 Ga0207703_10447264 3300026035 Bacteria 1206
424 Ga0207639_10015664 3300026041 Bacteria 5350
425 Ga0207678_10004581 3300026067 Bacteria 12434
426 Ga0207678_10038705 3300026067 Bacteria 4142
427 Ga0207708_10017977 3300026075 Bacteria 5319
428 Ga0207708_10043597 3300026075 Bacteria 3419
429 Ga0207708_10297523 3300026075 Bacteria 1312
430 Ga0207702_10000404 3300026078 Bacteria 49177
431 Ga0207641_10001418 3300026088 Bacteria 23633
432 Ga0207641_10128789 3300026088 Bacteria 2270
433 Ga0207648_10000072 3300026089 Bacteria 94957
434 Ga0207676_10000180 3300026095 Bacteria 55634
435 Ga0207674_10010766 3300026116 Bacteria 10320
436 Ga0207674_10369122 3300026116 Bacteria 1387
437 Ga0207675_100026944 3300026118 Bacteria 5350
438 Ga0207683_10000029 3300026121 Bacteria 109665
439 Ga0207683_10097759 3300026121 Bacteria 2619
440 Ga0207698_10009066 3300026142 Bacteria 6320
441 Ga0209984_1004014 3300027424 Bacteria 1715
442 Ga0209179_1000387 3300027512 Bacteria 4348
443 Ga0209999_1012910 3300027543 Unclassified 1515
444 Ga0209970_1004641 3300027614 Bacteria 2275
445 Ga0210002_1004321 3300027617 Bacteria 2111
446 Ga0209971_1003073 3300027682 Bacteria 3984
447 Ga0209966_1001665 3300027695 Bacteria 3782
448 Ga0209998_10002950 3300027717 Bacteria 3797
449 Ga0209998_10003961 3300027717 Bacteria 3187
450 Ga0209974_10004279 3300027876 Bacteria 5091
451 Ga0209974_10111086 3300027876 Bacteria 965
452 Ga0207428_10000100 3300027907 Bacteria 119495
453 Ga0207428_10000968 3300027907 Bacteria 31823
454 Ga0268266_10015777 3300028379 Bacteria 6469
455 Ga0268265_10000698 3300028380 Bacteria 32950
456 Ga0268265_10045744 3300028380 Bacteria 3268
457 Ga0268264_10005684 3300028381 Bacteria 10573
458 Ga0268264_10035806 3300028381 Bacteria 4087
459 Ga0268264_10045929 3300028381 Bacteria 3628
460 Ga0268264_10227850 3300028381 Bacteria 1719
461 Ga0268264_10686908 3300028381 Bacteria 1016
462 Ga0265337_1009820 3300028556 Bacteria 3391
463 Ga0265338_10006337 3300028800 Bacteria 15116
464 Ga0265338_10097140 3300028800 Bacteria 2414
465 Ga0265773_1000896 3300031018 Bacteria 1419
466 Ga0265760_10005992 3300031090 Bacteria 3474
467 Ga0265760_10104969 3300031090 Bacteria 896
468 Ga0265325_10000093 3300031241 Bacteria 63498
469 Ga0265325_10001052 3300031241 Bacteria 19856
470 Ga0265325_10005357 3300031241 Bacteria 7934
471 Ga0265325_10006146 3300031241 Bacteria 7327
472 Ga0265325_10104307 3300031241 Bacteria 1385
473 Ga0265329_10086470 3300031242 Bacteria 994
474 Ga0265340_10054915 3300031247 Bacteria 1920
475 Ga0265339_10001451 3300031249 Bacteria 17559
476 Ga0265339_10006787 3300031249 Bacteria 7467
477 Ga0265339_10017062 3300031249 Bacteria 4306
478 Ga0265316_10064653 3300031344 Bacteria 2834
479 Ga0265316_10090520 3300031344 Bacteria 2334
480 Ga0265316_10115830 3300031344 Bacteria 2026
481 Ga0265316_10135669 3300031344 Bacteria 1851
482 Ga0265316_10173121 3300031344 Bacteria 1609
483 Ga0265313_10000366 3300031595 Bacteria 49088
484 Ga0265313_10006019 3300031595 Bacteria 8754
485 Ga0265313_10010557 3300031595 Bacteria 5824
486 Ga0265313_10010885 3300031595 Bacteria 5705
487 Ga0265313_10072842 3300031595 Bacteria 1578
488 Ga0265314_10001247 3300031711 Bacteria 29026
489 Ga0265314_10011299 3300031711 Bacteria 7383
490 Ga0265314_10068973 3300031711 Bacteria 2375
491 Ga0265342_10000564 3300031712 Bacteria 39142
492 Ga0265342_10063090 3300031712 Bacteria 2179
493 Ga0307407_10136708 3300031903 Bacteria 1576
494 Ga0307409_100531496 3300031995 Bacteria 1151
495 Ga0316583_10006661 3300032133 Bacteria 4159
496 Ga0373930_0000941 3300034816 Bacteria 4167
497 Ga0373948_0000551 3300034817 Bacteria 4730
498 Ga0373950_0001071 3300034818 Bacteria 3498
499 Ga0373958_0000214 3300034819 Bacteria 6811
500 Ga0373959_0000795 3300034820 Bacteria 5397
501 Ga0373938_0000050 3300034957 Bacteria 15256
502 Ga0373938_0021500 3300034957 Bacteria 1308
503 Ga0373928_0000023 3300035084 Bacteria 26137
504 Ga0373929_0001804 3300035085 Bacteria 4014
505 Ga0373929_0007180 3300035085 Bacteria 2029
506 Ga0373934_0020106 3300035086 Bacteria 2566
507 Ga0373940_0000075 3300035088 Bacteria 11629
508 Ga0373940_0002001 3300035088 Bacteria 3859
509 Ga0373949_0001683 3300035090 Bacteria 6159
510 Ga0373949_0001759 3300035090 Bacteria 5977
511 Ga0373951_0002175 3300035091 Bacteria 4992
512 Ga0373952_0001100 3300035092 Bacteria 4929
513 Ga0373952_0069870 3300035092 Bacteria 876
514 Ga0373923_0014045 3300035111 Bacteria 3000
515 Ga0373923_0047771 3300035111 Bacteria 1785
516 Ga0373923_0071407 3300035111 Bacteria 1491
517 Ga0373932_0000570 3300035112 Bacteria 11346
518 Ga0373932_0002838 3300035112 Bacteria 4287
519 Ga0373936_0072337 3300035113 Bacteria 1423
520 Ga0373939_0002122 3300035114 Bacteria 4723
521 Ga0373941_0000644 3300035115 Bacteria 7073
522 Ga0373941_0067561 3300035115 Bacteria 1179
523 Ga0373945_0021619 3300035116 Bacteria 2212
524 Ga0373953_0015687 3300035117 Bacteria 2752
525 Ga0373954_0000646 3300035118 Bacteria 13326
526 Ga0373954_0006146 3300035118 Bacteria 5230
527 Ga0373954_0047975 3300035118 Bacteria 2000
528 Ga0373956_0005348 3300035119 Bacteria 5138
529 Ga0373956_0008694 3300035119 Bacteria 4113
530 Ga0373956_0035310 3300035119 Bacteria 2204
531 Ga0373957_0039562 3300035120 Bacteria 1769
532 Ga0373957_0050440 3300035120 Bacteria 1590
533 Ga0373960_0005729 3300035121 Bacteria 2887
534 Ga0373960_0012100 3300035121 Bacteria 2138
535 Ga0373943_0000449 3300035170 Bacteria 17431
536 Ga0373943_0271109 3300035170 Bacteria 957
537 Ga0373946_0001441 3300035171 Bacteria 8276
538 Ga0373955_0000177 3300035172 Bacteria 26296
539 Ga0373955_0008083 3300035172 Bacteria 4865
540 Ga0373955_0017545 3300035172 Bacteria 3545
541 Ga0373955_0043769 3300035172 Bacteria 2409
542 Ga0373942_0000843 3300035207 Bacteria 8417
543 Ga0373942_0001126 3300035207 Bacteria 7089
544 Ga0373961_0000536 3300035241 Bacteria 14433
545 Ga0373962_0000064 3300035242 Bacteria 23523
546 Ga0373962_0002485 3300035242 Bacteria 4382
547 Ga0373924_0000051 3300035410 Bacteria 29889
548 Ga0373931_0002530 3300035691 Bacteria 8117
549 Ga0373931_0031105 3300035691 Bacteria 2752
550 Ga0373931_0149910 3300035691 Bacteria 1358
551 Ga0373935_0000018 3300035692 Bacteria 68811
552 Ga0373935_0013696 3300035692 Bacteria 4896
553 Ga0373927_0004668 3300035695 Bacteria 9551
554 Ga0373927_0018003 3300035695 Bacteria 4647
555 Ga0373933_0001351 3300035724 Bacteria 14455
556 Ga0373933_0002708 3300035724 Bacteria 9918
557 Ga0373933_0010009 3300035724 Bacteria 5192
558 Ga0373933_0080337 3300035724 Bacteria 1998
559 Ga0373933_0272262 3300035724 Bacteria 1093
560 Ga0373933_0354727 3300035724 Bacteria 953
561 Ga0373947_0000264 3300035725 Bacteria 29727
562 Ga0373947_0128137 3300035725 Bacteria 1618
563 Ga0373937_0000571 3300036401 Bacteria 32663
564 Ga0373937_0004518 3300036401 Bacteria 11814
565 Ga0373937_0007367 3300036401 Bacteria 9524
566 Ga0373937_0014695 3300036401 Bacteria 6914
567 Ga0373937_0066291 3300036401 Bacteria 3324
568 Ga0373937_0068182 3300036401 Bacteria 3279
569 Ga0373937_0433875 3300036401 Bacteria 1247
570 Ga0373925_0000018 3300037068 Bacteria 174213
571 Ga0436364_0145110 3300037853 Bacteria 19161
572 Ga0242420_000299 3300038996 Bacteria 5466
573 Ga0436365_0689921 3300039437 Bacteria 1382
574 Ga0436365_1172725 3300039437 Bacteria 2976
575 Ga0436365_1262142 3300039437 Bacteria 6818
576 Ga0436365_1416741 3300039437 Bacteria 9089
577 Ga0436363_1677324 3300039450 Bacteria 952
578 Ga0439448_0016529 3300042005 Bacteria 2246
579 Ga0439455_0004368 3300042012 Bacteria 2797
580 Ga0439463_007824 3300042016 Bacteria 2640
581 Ga0439464_0012964 3300042439 Bacteria 2227
582 Ga0439464_0122550 3300042439 Bacteria 801
583 Ga0466963_0037383 3300044694 Bacteria 3169
584 Ga0451576_0067491 3300045051 Bacteria 3723
585 Ga0466958_0062650 3300045836 Bacteria 2267
586 Ga0495592_0000001 3300046454 Bacteria 305819
587 Ga0495592_0012444 3300046454 Bacteria 6462
588 Ga0495592_0022783 3300046454 Bacteria 4764
589 Ga0495592_0063289 3300046454 Bacteria 2714
590 Ga0495592_0336631 3300046454 Bacteria 971
591 Ga0495603_0034527 3300046455 Bacteria 3040
592 Ga0495629_0012920 3300046459 Bacteria 6040
593 Ga0495651_0003778 3300046462 Bacteria 11582
594 Ga0495651_0004527 3300046462 Bacteria 10630
595 Ga0495651_0056228 3300046462 Bacteria 3023
596 Ga0495651_0153038 3300046462 Bacteria 1660
597 Ga0495653_0000015 3300046463 Bacteria 213697
598 Ga0495653_0190091 3300046463 Bacteria 1401
599 Ga0495580_0242200 3300046472 Unclassified 1236
600 Ga0495582_0135861 3300046473 Bacteria 1391
601 Ga0495664_0000001 3300046477 Bacteria 757730
602 Ga0495664_0003133 3300046477 Bacteria 8983
603 Ga0495584_0003512 3300046491 Bacteria 8603
604 Ga0495594_0184511 3300046499 Bacteria 1188
605 Ga0495608_0000116 3300046511 Bacteria 56633
606 Ga0495608_0003179 3300046511 Bacteria 11754
607 Ga0495608_0036553 3300046511 Bacteria 3307
608 Ga0495618_0000021 3300046514 Bacteria 129750
609 Ga0495618_0370126 3300046514 Bacteria 880
610 Ga0495628_0000005 3300046516 Bacteria 420969
611 Ga0495628_0056178 3300046516 Bacteria 3099
612 Ga0495628_0058558 3300046516 Bacteria 3026
613 Ga0495630_0001024 3300046517 Bacteria 19309
614 Ga0495630_0060647 3300046517 Bacteria 2840
615 Ga0495666_0140594 3300046526 Bacteria 1126
616 Ga0495652_0000001 3300046529 Bacteria 1045081
617 Ga0495652_0075995 3300046529 Bacteria 2787
618 Ga0495652_0085573 3300046529 Bacteria 2590
619 Ga0495652_0348758 3300046529 Bacteria 1061
620 Ga0495640_0000006 3300046533 Bacteria 285419
621 Ga0495640_0007041 3300046533 Bacteria 8852
622 Ga0495640_0017686 3300046533 Bacteria 5305
623 Ga0495640_0181369 3300046533 Bacteria 1341
624 Ga0495586_0087986 3300046535 Bacteria 1713
625 Ga0495587_0000012 3300046536 Bacteria 197088
626 Ga0495587_0001919 3300046536 Bacteria 13852
627 Ga0495587_0069068 3300046536 Bacteria 2057
628 Ga0495598_0055352 3300046537 Bacteria 1208
629 Ga0495645_0000004 3300046543 Bacteria 532661
630 Ga0495645_0004673 3300046543 Bacteria 9346
631 Ga0495645_0029398 3300046543 Bacteria 3996
632 Ga0495667_0000001 3300046559 Bacteria 834831
633 Ga0495667_0002357 3300046559 Bacteria 12630
634 Ga0495667_0002421 3300046559 Bacteria 12456
635 Ga0495667_0017507 3300046559 Bacteria 4840
636 Ga0495667_0086409 3300046559 Bacteria 2034
637 Ga0495656_0004499 3300046615 Bacteria 4774
638 Ga0495656_0017425 3300046615 Bacteria 2741
639 Ga0495634_0000388 3300046642 Bacteria 42999
640 Ga0495634_0071337 3300046642 Bacteria 2287
641 Ga0495635_0000007 3300046663 Bacteria 278786
642 Ga0495635_0003765 3300046663 Bacteria 10530
643 Ga0495635_0022386 3300046663 Bacteria 4401
644 Ga0495657_0000250 3300046675 Bacteria 48717
645 Ga0495657_0004218 3300046675 Bacteria 11502
646 Ga0495657_0042950 3300046675 Bacteria 3084
647 Ga0495657_0079786 3300046675 Bacteria 2119
648 Ga0495657_0088595 3300046675 Bacteria 1989
649 Ga0495599_0000002 3300046678 Bacteria 348168
650 Ga0495599_0003707 3300046678 Bacteria 8955
651 Ga0495623_0000116 3300046679 Bacteria 48662
652 Ga0495623_0003634 3300046679 Bacteria 10190
653 Ga0495623_0009851 3300046679 Bacteria 6192
654 Ga0495646_0000049 3300046680 Bacteria 60856
655 Ga0495646_0001656 3300046680 Bacteria 13313
656 Ga0495658_0047198 3300046683 Bacteria 2424
657 Ga0495658_0060728 3300046683 Bacteria 2169
658 Ga0495658_0088403 3300046683 Bacteria 1831
659 Ga0495658_0325352 3300046683 Bacteria 975
660 Ga0495613_0253656 3300046689 Bacteria 1227
661 Ga0495600_0000013 3300046809 Bacteria 119404
662 Ga0495600_0012298 3300046809 Bacteria 5348
663 Ga0495600_0268208 3300046809 Bacteria 1083
664 Ga0495581_0028974 3300047315 Bacteria 3211
665 Ga0495581_0054346 3300047315 Bacteria 2312
666 Ga0495604_0000007 3300047317 Bacteria 412174
667 Ga0495604_0003594 3300047317 Bacteria 12361
668 Ga0495604_0004967 3300047317 Bacteria 10547
669 Ga0495604_0010963 3300047317 Bacteria 7195
670 Ga0495604_0210324 3300047317 Bacteria 1344
671 Ga0495674_0000001 3300047319 Bacteria 778665
672 Ga0495674_0008518 3300047319 Bacteria 9762
673 Ga0495674_0009238 3300047319 Bacteria 9369
674 Ga0495672_0105354 3300047320 Bacteria 1522
675 Ga0495672_0151348 3300047320 Bacteria 1203
676 Ga0495680_0004250 3300047322 Bacteria 13751
677 Ga0495680_0039378 3300047322 Bacteria 3771
678 Ga0495680_0054431 3300047322 Bacteria 3107
679 Ga0495680_0075040 3300047322 Bacteria 2566
680 Ga0495675_0000014 3300047444 Bacteria 137646
681 Ga0495675_0002510 3300047444 Bacteria 10986
682 Ga0495675_0037936 3300047444 Bacteria 3068
683 Ga0495675_0127329 3300047444 Bacteria 1584
684 Ga0495684_0000219 3300047471 Bacteria 44380
685 Ga0495684_0033778 3300047471 Bacteria 3924
686 Ga0495684_0180435 3300047471 Bacteria 1565
687 Ga0495602_0000004 3300048088 Bacteria 326932
688 Ga0495602_0006216 3300048088 Bacteria 12535
689 Ga0495602_0014034 3300048088 Bacteria 8154
690 Ga0495602_0064297 3300048088 Bacteria 3173
691 Ga0495614_0036401 3300048089 Bacteria 2113
692 Ga0496100_0000529 3300048903 Bacteria 18180
693 Ga0496100_0079283 3300048903 Bacteria 2212
694 Ga0496100_0314855 3300048903 Bacteria 1174
695 Ga0496101_0000187 3300048904 Bacteria 48785
696 Ga0496101_0008964 3300048904 Bacteria 6557
697 Ga0496102_0008774 3300048905 Bacteria 8670
698 Ga0496102_0092799 3300048905 Bacteria 2796
699 Ga0496102_0230568 3300048905 Bacteria 1746
700 Ga0496102_0243605 3300048905 Bacteria 1695
701 Ga0496102_0318357 3300048905 Bacteria 1465
702 Ga0496103_0000157 3300048906 Bacteria 71452
703 Ga0496103_0100007 3300048906 Bacteria 1835
704 Ga0496103_0145214 3300048906 Bacteria 1518
705 Ga0496104_0000388 3300048907 Bacteria 38522
706 Ga0496104_0207062 3300048907 Bacteria 1873
707 Ga0496104_0270089 3300048907 Bacteria 1613
708 Ga0496104_0294107 3300048907 Bacteria 1537
709 Ga0496105_0000307 3300048908 Bacteria 32178
710 Ga0496105_0025707 3300048908 Bacteria 4795
711 Ga0496105_0064743 3300048908 Bacteria 3017
712 Ga0496106_0003377 3300048909 Bacteria 11896
713 Ga0496106_0017370 3300048909 Bacteria 5324
714 Ga0496106_0035482 3300048909 Bacteria 3729
715 Ga0496106_0152330 3300048909 Bacteria 1824
716 Ga0496107_0000805 3300048910 Bacteria 18202
717 Ga0496107_0075681 3300048910 Bacteria 2450
718 Ga0496108_0003275 3300048911 Bacteria 13012
719 Ga0496109_0000313 3300048912 Bacteria 45501
720 Ga0496109_0001125 3300048912 Bacteria 22254
721 Ga0496109_0251269 3300048912 Bacteria 1665
722 Ga0496109_0535919 3300048912 Bacteria 1104
723 Ga0496110_0055870 3300048913 Bacteria 3474
724 Ga0496110_0066895 3300048913 Bacteria 3178
725 Ga0496110_0353982 3300048913 Bacteria 1337
726 Ga0496112_0408176 3300048915 Bacteria 1298
727 Ga0496113_0078764 3300048916 Bacteria 2522
728 Ga0496113_0321804 3300048916 Bacteria 1240
729 Ga0496114_0020658 3300048917 Bacteria 5345
730 Ga0496114_0024270 3300048917 Bacteria 4947
731 Ga0496114_0652986 3300048917 Bacteria 925
732 Ga0496115_0001217 3300048918 Bacteria 18461
733 Ga0496115_0027409 3300048918 Bacteria 4456
734 Ga0496115_0131060 3300048918 Bacteria 2066
735 Ga0496115_0223886 3300048918 Bacteria 1552
736 Ga0496118_0184308 3300048921 Bacteria 1257
737 Ga0496126_0028568 3300048929 Bacteria 5313
738 Ga0501031_0018031 3300049568 Bacteria 4591
739 Ga0501032_0017773 3300049569 Bacteria 4991
740 Ga0501033_0039461 3300049570 Bacteria 3526
741 Ga0501033_0048162 3300049570 Bacteria 3166
742 Ga0501033_0063506 3300049570 Bacteria 2718
743 Ga0501034_0000616 3300049571 Bacteria 55864
744 Ga0501034_0008229 3300049571 Bacteria 11039
745 Ga0501034_0014011 3300049571 Bacteria 8255
746 Ga0501034_0014223 3300049571 Bacteria 8203
747 Ga0501034_0192087 3300049571 Bacteria 2003
748 Ga0501034_0251021 3300049571 Bacteria 1713
749 Ga0501036_0047287 3300049572 Bacteria 3644
750 Ga0501036_0087238 3300049572 Bacteria 2637
751 Ga0501036_0091655 3300049572 Bacteria 2567
752 Ga0501036_0291403 3300049572 Bacteria 1365
753 Ga0501037_0009677 3300049573 Bacteria 7074
754 Ga0501037_0018243 3300049573 Bacteria 5170
755 Ga0501037_0023898 3300049573 Bacteria 4520
756 Ga0501037_0034118 3300049573 Bacteria 3756
757 Ga0501038_0010995 3300049574 Bacteria 8264
758 Ga0501038_0112956 3300049574 Bacteria 2248
759 Ga0501038_0203958 3300049574 Bacteria 1585
760 Ga0501039_0124947 3300049575 Bacteria 2018
761 Ga0501039_0345861 3300049575 Bacteria 1168
762 Ga0501040_0339825 3300049576 Bacteria 1075
763 Ga0501040_0529764 3300049576 Bacteria 850
764 Ga0501041_0110790 3300049577 Bacteria 1702
765 Ga0501042_0212625 3300049578 Bacteria 1395
766 Ga0501043_0028099 3300049579 Bacteria 4415
767 Ga0501043_0084075 3300049579 Bacteria 2501
768 Ga0501043_0151430 3300049579 Bacteria 1815
769 Ga0501043_0168852 3300049579 Bacteria 1707
770 Ga0501043_0272665 3300049579 Bacteria 1298
771 Ga0501046_0153320 3300049580 Bacteria 1737
772 Ga0501047_0006413 3300049581 Bacteria 11068
773 Ga0501047_0009087 3300049581 Bacteria 9386
774 Ga0501047_0011118 3300049581 Bacteria 8519
775 Ga0501047_0091740 3300049581 Bacteria 2916
776 Ga0501047_0238790 3300049581 Bacteria 1668
777 Ga0501048_0114091 3300049582 Bacteria 1909
778 Ga0501048_0300582 3300049582 Bacteria 1142
779 Ga0501048_0403044 3300049582 Bacteria 978
780 Ga0501067_0143566 3300049583 Bacteria 1330
781 Ga0501068_0022329 3300049584 Bacteria 3699
782 Ga0501068_0091851 3300049584 Bacteria 1873
783 Ga0501068_0403489 3300049584 Bacteria 881
784 Ga0501069_0068348 3300049585 Bacteria 1988
785 Ga0501069_0175528 3300049585 Bacteria 1237
786 Ga0501069_0395357 3300049585 Bacteria 817
787 Ga0501070_0029989 3300049586 Bacteria 4557
788 Ga0501070_0035360 3300049586 Bacteria 4175
789 Ga0501070_0040714 3300049586 Bacteria 3874
790 Ga0501070_0074396 3300049586 Bacteria 2812
791 Ga0501070_0075813 3300049586 Bacteria 2784
792 Ga0501070_0125475 3300049586 Bacteria 2121
793 Ga0501070_0203780 3300049586 Bacteria 1624
794 Ga0501070_0372415 3300049586 Bacteria 1157
795 Ga0501071_0045769 3300049587 Bacteria 3141
796 Ga0501072_0000674 3300049588 Bacteria 24677
797 Ga0501072_0056931 3300049588 Bacteria 3080
798 Ga0501072_0369844 3300049588 Bacteria 1138
799 Ga0501072_0596696 3300049588 Bacteria 871
800 Ga0501073_0005090 3300049589 Bacteria 9859
801 Ga0501073_0191444 3300049589 Bacteria 1415
802 Ga0501074_0152536 3300049590 Bacteria 1651
803 Ga0501075_0033896 3300049591 Bacteria 3800
804 Ga0501076_0077924 3300049592 Bacteria 2659
805 Ga0501079_0073215 3300049741 Bacteria 2648
806 Ga0501080_0012989 3300049742 Bacteria 7647
807 Ga0501080_0050705 3300049742 Bacteria 3862
808 Ga0501080_0075084 3300049742 Bacteria 3145
809 Ga0501080_0131578 3300049742 Bacteria 2316
810 Ga0501080_0143407 3300049742 Bacteria 2208
811 Ga0501080_0170788 3300049742 Bacteria 2005
812 Ga0501083_0001288 3300049744 Bacteria 16960
813 Ga0501083_0013916 3300049744 Bacteria 5624
814 Ga0501035_0007147 3300049822 Bacteria 10442
815 Ga0501035_0172050 3300049822 Bacteria 1870
816 Ga0501035_0252659 3300049822 Bacteria 1496
817 Ga0501044_0010736 3300049823 Bacteria 9940
818 Ga0501044_0068147 3300049823 Bacteria 3625
819 Ga0501044_0076401 3300049823 Bacteria 3399
820 Ga0501044_0130521 3300049823 Bacteria 2507
821 Ga0501044_0193518 3300049823 Bacteria 1995
822 Ga0501044_0215139 3300049823 Bacteria 1874
823 Ga0501044_0255081 3300049823 Bacteria 1693
824 Ga0501044_0452322 3300049823 Bacteria 1191
825 Ga0501044_0505359 3300049823 Bacteria 1109
826 Ga0501045_0473805 3300049824 Bacteria 930
827 nmdc:mga03n38_50280_c1 3300050490 Bacteria 1857
828 nmdc:mga00v17_42628_c1 3300050491 Bacteria 2730
829 nmdc:mga00v17_82958_c1 3300050491 Bacteria 2004
830 nmdc:mga0yw44_278724_c1 3300050492 Bacteria 1117
831 nmdc:mga06z11_54699_c1 3300050494 Bacteria 2058
832 nmdc:mga06z11_6126_c1 3300050494 Bacteria 4867
833 nmdc:mga04h51_33699_c1 3300050495 Bacteria 1632
834 nmdc:mga04h51_7388_c1 3300050495 Bacteria 2897
835 nmdc:mga04h51_9915_c1 3300050495 Bacteria 1985
836 nmdc:mga07m45_100802_c1 3300050496 Bacteria 1658
837 nmdc:mga07m45_54348_c1 3300050496 Bacteria 2263
838 nmdc:mga05p37_11988_c1 3300050507 Bacteria 10343
839 nmdc:mga05p37_18354_c1 3300050507 Bacteria 8448
840 nmdc:mga0qj67_228381_c1 3300050509 Bacteria 1510
841 nmdc:mga0qj67_704_c1 3300050509 Bacteria 22789
842 nmdc:mga08y16_133764_c1 3300050511 Bacteria 2577
843 nmdc:mga08y16_142088_c1 3300050511 Bacteria 2495
844 nmdc:mga08y16_1621_c1 3300050511 Bacteria 22793
845 nmdc:mga08y16_168408_c1 3300050511 Unclassified 2276
846 nmdc:mga08y16_2193_c1 3300050511 Bacteria 20044
847 nmdc:mga08y16_231127_c1 3300050511 Bacteria 1913
848 nmdc:mga08y16_238163_c1 3300050511 Bacteria 1881
849 nmdc:mga0n895_1250_c1 3300050512 Bacteria 18758
850 nmdc:mga0n895_12677_c1 3300050512 Bacteria 7569
851 nmdc:mga0n895_267853_c1 3300050512 Bacteria 1733
852 nmdc:mga0n895_45466_c1 3300050512 Bacteria 4284
853 nmdc:mga0n895_867201_c1 3300050512 Unclassified 890
854 nmdc:mga0rr50_260943_c1 3300050513 Bacteria 1441
855 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
856 nmdc:mga08x19_54995_c1 3300050514 Bacteria 2564
857 nmdc:mga0a205_3872_c1 3300050515 Bacteria 13406
858 nmdc:mga0a205_80336_c1 3300050515 Bacteria 3151
859 nmdc:mga0a205_93540_c1 3300050515 Bacteria 1949
860 Ga0495601_0000006 3300053077 Bacteria 373770
861 Ga0495601_0000255 3300053077 Bacteria 28587
862 Ga0495601_0014658 3300053077 Bacteria 4726
863 Ga0495601_0065387 3300053077 Bacteria 2314
864 Ga0495612_0000004 3300053078 Bacteria 286946
865 Ga0495612_0003475 3300053078 Bacteria 6529
866 Ga0495612_0003875 3300053078 Bacteria 6205
867 Ga0495612_0013595 3300053078 Bacteria 3279
868 Ga0495595_0000006 3300053084 Bacteria 231295
869 Ga0495595_0001068 3300053084 Bacteria 10603
870 Ga0495595_0003045 3300053084 Bacteria 6628
871 Ga0495595_0008241 3300053084 Bacteria 4280
872 Ga0495619_0000161 3300053085 Bacteria 49400
873 Ga0495619_0000240 3300053085 Bacteria 39732
874 Ga0495619_0004783 3300053085 Bacteria 8612
875 Ga0495619_0009923 3300053085 Bacteria 5997
876 Ga0495619_0017362 3300053085 Bacteria 4557
877 Ga0495619_0022984 3300053085 Bacteria 3992
878 Ga0495619_0075509 3300053085 Bacteria 2262
879 Ga0500643_006735 3300053087 Bacteria 4748
880 Ga0500644_0001049 3300053088 Bacteria 8235
881 Ga0500651_0029241 3300053093 Bacteria 3465
882 Ga0500641_0002552 3300053096 Bacteria 6431
883 Ga0500641_0014864 3300053096 Bacteria 2878
884 Ga0500594_0006844 3300053118 Bacteria 2569
885 Ga0500595_000056 3300053119 Bacteria 83521
886 Ga0500652_000030 3300053131 Bacteria 90754
887 Ga0500655_016098 3300053133 Bacteria 1376
888 Ga0500616_0000006 3300053153 Bacteria 944738
889 Ga0500616_0153977 3300053153 Bacteria 1061
890 Ga0500645_000384 3300053730 Bacteria 30994
891 Ga0500645_031550 3300053730 Bacteria 1592
892 Ga0501084_0564161 3300054114 Bacteria 962
893 Ga0501082_0000365 3300060353 Bacteria 39948
894 Ga0501082_0027281 3300060353 Bacteria 4918
895 Ga0501082_0036920 3300060353 Bacteria 4209
896 Ga0501082_0059171 3300060353 Bacteria 3302
897 Ga0501082_0085460 3300060353 Bacteria 2721
898 Ga0501082_0760422 3300060353 Bacteria 848
899 Ga0530510_0020106 3300061734 Bacteria 4747

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0529764 Ga0501040_0529764_21_662 203
2 3300005617 Ga0068859_100532973 Ga0068859_1005329731 206
3 3300006931 Ga0097620_100532907 Ga0097620_1005329071 206
4 3300005331 Ga0070670_100043806 Ga0070670_1000438063 207
5 3300005843 Ga0068860_100547411 Ga0068860_1005474112 207
6 3300025925 Ga0207650_10032858 Ga0207650_100328584 207
7 3300025972 Ga0207668_10047558 Ga0207668_100475585 207
8 3300028381 Ga0268264_10686908 Ga0268264_106869082 207
9 3300049588 Ga0501072_0596696 Ga0501072_0596696_196_855 209
10 3300025904 Ga0207647_10102240 Ga0207647_101022403 210
11 3300042439 Ga0439464_0122550 Ga0439464_0122550_54_779 219
12 3300009147 Ga0114129_10123024 Ga0114129_101230242 223
13 3300009094 Ga0111539_10255793 Ga0111539_102557934 224
14 3300050511 nmdc:mga08y16_142088_c1 nmdc:mga08y16_142088_c1_648_1421 225
15 3300049576 Ga0501040_0339825 Ga0501040_0339825_200_970 226
16 3300049577 Ga0501041_0110790 Ga0501041_0110790_317_1087 226
17 3300049582 Ga0501048_0114091 Ga0501048_0114091_199_969 226
18 3300049587 Ga0501071_0045769 Ga0501071_0045769_1030_1800 226
19 3300049588 Ga0501072_0056931 Ga0501072_0056931_1246_2016 226
20 3300049591 Ga0501075_0033896 Ga0501075_0033896_2242_3012 226
21 3300049741 Ga0501079_0073215 Ga0501079_0073215_1425_2195 226
22 3300061734 Ga0530510_0020106 Ga0530510_0020106_2322_3092 226
23 3300005614 Ga0068856_100070595 Ga0068856_1000705953 228
24 3300025899 Ga0207642_10104663 Ga0207642_101046632 228
25 3300025916 Ga0207663_10287520 Ga0207663_102875202 228
26 3300025939 Ga0207665_10024162 Ga0207665_100241625 228
27 3300035086 Ga0373934_0020106 Ga0373934_0020106_1780_2550 228
28 3300035118 Ga0373954_0047975 Ga0373954_0047975_1175_1945 228
29 3300035119 Ga0373956_0005348 Ga0373956_0005348_28_798 228
30 3300035172 Ga0373955_0008083 Ga0373955_0008083_2215_2985 228
31 3300035724 Ga0373933_0001351 Ga0373933_0001351_2045_2815 228
32 3300036401 Ga0373937_0004518 Ga0373937_0004518_2249_3019 228
33 3300046529 Ga0495652_0348758 Ga0495652_0348758_56_826 228
34 3300046536 Ga0495587_0069068 Ga0495587_0069068_112_882 228
35 3300046559 Ga0495667_0086409 Ga0495667_0086409_946_1716 228
36 3300046675 Ga0495657_0042950 Ga0495657_0042950_2129_2899 228
37 3300047317 Ga0495604_0210324 Ga0495604_0210324_261_1031 228
38 3300047322 Ga0495680_0075040 Ga0495680_0075040_1517_2287 228
39 3300047444 Ga0495675_0037936 Ga0495675_0037936_2271_3047 228
40 3300048088 Ga0495602_0064297 Ga0495602_0064297_2319_3089 228
41 3300053077 Ga0495601_0065387 Ga0495601_0065387_1113_1883 228
42 3300053078 Ga0495612_0013595 Ga0495612_0013595_2154_2924 228
43 3300053084 Ga0495595_0008241 Ga0495595_0008241_1596_2366 228
44 3300053085 Ga0495619_0009923 Ga0495619_0009923_4652_5422 228
45 3300005337 Ga0070682_100051332 Ga0070682_1000513321 229
46 3300005355 Ga0070671_100028391 Ga0070671_1000283913 229
47 3300005367 Ga0070667_100011748 Ga0070667_1000117488 229
48 3300005434 Ga0070709_10290588 Ga0070709_102905882 229
49 3300005436 Ga0070713_100015641 Ga0070713_1000156415 229
50 3300005437 Ga0070710_10019002 Ga0070710_100190022 229
51 3300005439 Ga0070711_100036932 Ga0070711_1000369322 229
52 3300005439 Ga0070711_100325117 Ga0070711_1003251171 229
53 3300005455 Ga0070663_100092523 Ga0070663_1000925233 229
54 3300005456 Ga0070678_100359786 Ga0070678_1003597862 229
55 3300005458 Ga0070681_10390463 Ga0070681_103904632 229
56 3300005468 Ga0070707_100546964 Ga0070707_1005469642 229
57 3300005530 Ga0070679_100052219 Ga0070679_1000522192 229
58 3300005545 Ga0070695_100082509 Ga0070695_1000825092 229
59 3300005548 Ga0070665_100109057 Ga0070665_1001090572 229
60 3300005549 Ga0070704_100118122 Ga0070704_1001181222 229
61 3300005578 Ga0068854_100156484 Ga0068854_1001564842 229
62 3300005842 Ga0068858_100035496 Ga0068858_1000354963 229
63 3300005937 Ga0081455_10009792 Ga0081455_1000979213 229
64 3300006028 Ga0070717_10353030 Ga0070717_103530302 229
65 3300006042 Ga0075368_10038132 Ga0075368_100381322 229
66 3300006175 Ga0070712_100465114 Ga0070712_1004651141 229
67 3300006237 Ga0097621_100161114 Ga0097621_1001611143 229
68 3300006358 Ga0068871_100058204 Ga0068871_1000582042 229
69 3300006881 Ga0068865_100047404 Ga0068865_1000474042 229
70 3300007076 Ga0075435_100062416 Ga0075435_1000624162 229
71 3300009098 Ga0105245_10165436 Ga0105245_101654362 229
72 3300009101 Ga0105247_10017431 Ga0105247_100174316 229
73 3300009148 Ga0105243_10043961 Ga0105243_100439614 229
74 3300009176 Ga0105242_10175706 Ga0105242_101757062 229
75 3300009545 Ga0105237_10023502 Ga0105237_100235022 229
76 3300009551 Ga0105238_10178405 Ga0105238_101784054 229
77 3300011119 Ga0105246_10039853 Ga0105246_100398533 229
78 3300013306 Ga0163162_10109363 Ga0163162_101093633 229
79 3300014969 Ga0157376_10283299 Ga0157376_102832992 229
80 3300021384 Ga0213876_10003554 Ga0213876_100035547 229
81 3300025898 Ga0207692_10047300 Ga0207692_100473002 229
82 3300025903 Ga0207680_10028611 Ga0207680_100286112 229
83 3300025906 Ga0207699_10044580 Ga0207699_100445802 229
84 3300025906 Ga0207699_10101992 Ga0207699_101019922 229
85 3300025907 Ga0207645_10275901 Ga0207645_102759012 229
86 3300025914 Ga0207671_10070434 Ga0207671_100704342 229
87 3300025916 Ga0207663_10030770 Ga0207663_100307702 229
88 3300025916 Ga0207663_10062800 Ga0207663_100628002 229
89 3300025919 Ga0207657_10267313 Ga0207657_102673133 229
90 3300025922 Ga0207646_10638428 Ga0207646_106384281 229
91 3300025927 Ga0207687_10097059 Ga0207687_100970592 229
92 3300025928 Ga0207700_10036373 Ga0207700_100363733 229
93 3300025931 Ga0207644_10033573 Ga0207644_100335735 229
94 3300025933 Ga0207706_10016484 Ga0207706_100164843 229
95 3300025934 Ga0207686_10135390 Ga0207686_101353902 229
96 3300025935 Ga0207709_10038133 Ga0207709_100381332 229
97 3300025939 Ga0207665_10393127 Ga0207665_103931271 229
98 3300025986 Ga0207658_10202277 Ga0207658_102022771 229
99 3300026075 Ga0207708_10297523 Ga0207708_102975232 229
100 3300026121 Ga0207683_10097759 Ga0207683_100977592 229
101 3300028381 Ga0268264_10045929 Ga0268264_100459296 229
102 3300028800 Ga0265338_10097140 Ga0265338_100971403 229
103 3300031241 Ga0265325_10000093 Ga0265325_1000009339 229
104 3300031344 Ga0265316_10064653 Ga0265316_100646532 229
105 3300031595 Ga0265313_10010885 Ga0265313_100108857 229
106 3300031595 Ga0265313_10072842 Ga0265313_100728422 229
107 3300035092 Ga0373952_0069870 Ga0373952_0069870_93_863 229
108 3300035111 Ga0373923_0014045 Ga0373923_0014045_123_893 229
109 3300035111 Ga0373923_0071407 Ga0373923_0071407_586_1356 229
110 3300035113 Ga0373936_0072337 Ga0373936_0072337_386_1156 229
111 3300035117 Ga0373953_0015687 Ga0373953_0015687_1329_2099 229
112 3300035118 Ga0373954_0000646 Ga0373954_0000646_8203_8973 229
113 3300035119 Ga0373956_0008694 Ga0373956_0008694_315_1085 229
114 3300035119 Ga0373956_0035310 Ga0373956_0035310_984_1754 229
115 3300035120 Ga0373957_0039562 Ga0373957_0039562_804_1574 229
116 3300035170 Ga0373943_0271109 Ga0373943_0271109_48_818 229
117 3300035172 Ga0373955_0017545 Ga0373955_0017545_347_1117 229
118 3300035172 Ga0373955_0043769 Ga0373955_0043769_560_1330 229
119 3300035692 Ga0373935_0013696 Ga0373935_0013696_585_1355 229
120 3300035724 Ga0373933_0002708 Ga0373933_0002708_9048_9818 229
121 3300035724 Ga0373933_0010009 Ga0373933_0010009_1780_2550 229
122 3300036401 Ga0373937_0014695 Ga0373937_0014695_5876_6646 229
123 3300036401 Ga0373937_0068182 Ga0373937_0068182_1729_2499 229
124 3300039437 Ga0436365_1416741 Ga0436365_1416741_3813_4583 229
125 3300046454 Ga0495592_0012444 Ga0495592_0012444_4213_4983 229
126 3300046454 Ga0495592_0022783 Ga0495592_0022783_781_1551 229
127 3300046454 Ga0495592_0063289 Ga0495592_0063289_1573_2343 229
128 3300046455 Ga0495603_0034527 Ga0495603_0034527_1505_2275 229
129 3300046462 Ga0495651_0003778 Ga0495651_0003778_4665_5435 229
130 3300046462 Ga0495651_0056228 Ga0495651_0056228_1749_2519 229
131 3300046462 Ga0495651_0153038 Ga0495651_0153038_184_954 229
132 3300046463 Ga0495653_0190091 Ga0495653_0190091_164_934 229
133 3300046472 Ga0495580_0242200 Ga0495580_0242200_382_1152 229
134 3300046473 Ga0495582_0135861 Ga0495582_0135861_72_842 229
135 3300046477 Ga0495664_0003133 Ga0495664_0003133_5177_5947 229
136 3300046511 Ga0495608_0003179 Ga0495608_0003179_1744_2514 229
137 3300046511 Ga0495608_0036553 Ga0495608_0036553_615_1385 229
138 3300046514 Ga0495618_0370126 Ga0495618_0370126_34_804 229
139 3300046516 Ga0495628_0056178 Ga0495628_0056178_1741_2511 229
140 3300046516 Ga0495628_0058558 Ga0495628_0058558_273_1043 229
141 3300046529 Ga0495652_0075995 Ga0495652_0075995_277_1047 229
142 3300046529 Ga0495652_0085573 Ga0495652_0085573_25_795 229
143 3300046533 Ga0495640_0007041 Ga0495640_0007041_2048_2818 229
144 3300046533 Ga0495640_0017686 Ga0495640_0017686_2945_3715 229
145 3300046533 Ga0495640_0181369 Ga0495640_0181369_347_1117 229
146 3300046536 Ga0495587_0001919 Ga0495587_0001919_3029_3799 229
147 3300046543 Ga0495645_0004673 Ga0495645_0004673_4776_5546 229
148 3300046543 Ga0495645_0029398 Ga0495645_0029398_3165_3935 229
149 3300046559 Ga0495667_0002357 Ga0495667_0002357_277_1047 229
150 3300046559 Ga0495667_0002421 Ga0495667_0002421_9792_10562 229
151 3300046559 Ga0495667_0017507 Ga0495667_0017507_1597_2367 229
152 3300046642 Ga0495634_0071337 Ga0495634_0071337_215_985 229
153 3300046663 Ga0495635_0003765 Ga0495635_0003765_3029_3799 229
154 3300046663 Ga0495635_0022386 Ga0495635_0022386_364_1134 229
155 3300046675 Ga0495657_0004218 Ga0495657_0004218_4644_5414 229
156 3300046675 Ga0495657_0079786 Ga0495657_0079786_253_1023 229
157 3300046675 Ga0495657_0088595 Ga0495657_0088595_1034_1804 229
158 3300046678 Ga0495599_0003707 Ga0495599_0003707_5542_6312 229
159 3300046679 Ga0495623_0003634 Ga0495623_0003634_9241_10011 229
160 3300046679 Ga0495623_0009851 Ga0495623_0009851_4742_5512 229
161 3300046680 Ga0495646_0001656 Ga0495646_0001656_11064_11834 229
162 3300046683 Ga0495658_0060728 Ga0495658_0060728_338_1108 229
163 3300046683 Ga0495658_0325352 Ga0495658_0325352_103_873 229
164 3300046809 Ga0495600_0012298 Ga0495600_0012298_4155_4925 229
165 3300046809 Ga0495600_0268208 Ga0495600_0268208_97_867 229
166 3300047315 Ga0495581_0054346 Ga0495581_0054346_659_1429 229
167 3300047317 Ga0495604_0003594 Ga0495604_0003594_5734_6504 229
168 3300047317 Ga0495604_0004967 Ga0495604_0004967_9753_10523 229
169 3300047317 Ga0495604_0010963 Ga0495604_0010963_1295_2065 229
170 3300047319 Ga0495674_0008518 Ga0495674_0008518_7716_8486 229
171 3300047319 Ga0495674_0009238 Ga0495674_0009238_5455_6225 229
172 3300047322 Ga0495680_0039378 Ga0495680_0039378_102_872 229
173 3300047322 Ga0495680_0054431 Ga0495680_0054431_576_1346 229
174 3300047444 Ga0495675_0002510 Ga0495675_0002510_5846_6616 229
175 3300047444 Ga0495675_0127329 Ga0495675_0127329_481_1251 229
176 3300047471 Ga0495684_0033778 Ga0495684_0033778_396_1166 229
177 3300047471 Ga0495684_0180435 Ga0495684_0180435_451_1221 229
178 3300048088 Ga0495602_0006216 Ga0495602_0006216_3241_4011 229
179 3300048088 Ga0495602_0014034 Ga0495602_0014034_1488_2258 229
180 3300048089 Ga0495614_0036401 Ga0495614_0036401_589_1359 229
181 3300048903 Ga0496100_0079283 Ga0496100_0079283_596_1366 229
182 3300048904 Ga0496101_0008964 Ga0496101_0008964_4235_5005 229
183 3300048905 Ga0496102_0243605 Ga0496102_0243605_138_908 229
184 3300048905 Ga0496102_0318357 Ga0496102_0318357_94_864 229
185 3300048906 Ga0496103_0145214 Ga0496103_0145214_697_1467 229
186 3300048907 Ga0496104_0000388 Ga0496104_0000388_31363_32133 229
187 3300048907 Ga0496104_0294107 Ga0496104_0294107_71_841 229
188 3300048908 Ga0496105_0000307 Ga0496105_0000307_21224_21994 229
189 3300048908 Ga0496105_0025707 Ga0496105_0025707_1799_2569 229
190 3300048909 Ga0496106_0152330 Ga0496106_0152330_896_1666 229
191 3300048910 Ga0496107_0075681 Ga0496107_0075681_593_1363 229
192 3300048912 Ga0496109_0535919 Ga0496109_0535919_296_1066 229
193 3300048913 Ga0496110_0055870 Ga0496110_0055870_52_822 229
194 3300048915 Ga0496112_0408176 Ga0496112_0408176_188_958 229
195 3300048916 Ga0496113_0321804 Ga0496113_0321804_62_832 229
196 3300048917 Ga0496114_0020658 Ga0496114_0020658_1137_1907 229
197 3300048918 Ga0496115_0027409 Ga0496115_0027409_3146_3916 229
198 3300049568 Ga0501031_0018031 Ga0501031_0018031_895_1665 229
199 3300049569 Ga0501032_0017773 Ga0501032_0017773_3078_3848 229
200 3300049570 Ga0501033_0048162 Ga0501033_0048162_884_1654 229
201 3300049572 Ga0501036_0047287 Ga0501036_0047287_2650_3420 229
202 3300049573 Ga0501037_0018243 Ga0501037_0018243_2634_3404 229
203 3300049574 Ga0501038_0010995 Ga0501038_0010995_3748_4518 229
204 3300049575 Ga0501039_0124947 Ga0501039_0124947_328_1098 229
205 3300049579 Ga0501043_0151430 Ga0501043_0151430_148_918 229
206 3300049581 Ga0501047_0091740 Ga0501047_0091740_1995_2765 229
207 3300049586 Ga0501070_0040714 Ga0501070_0040714_2705_3475 229
208 3300049822 Ga0501035_0252659 Ga0501035_0252659_346_1116 229
209 3300049823 Ga0501044_0193518 Ga0501044_0193518_986_1756 229
210 3300050495 nmdc:mga04h51_7388_c1 nmdc:mga04h51_7388_c1_1733_2503 229
211 3300050513 nmdc:mga0rr50_260943_c1 nmdc:mga0rr50_260943_c1_493_1263 229
212 3300053077 Ga0495601_0000255 Ga0495601_0000255_22919_23689 229
213 3300053077 Ga0495601_0014658 Ga0495601_0014658_233_1003 229
214 3300053078 Ga0495612_0003475 Ga0495612_0003475_101_871 229
215 3300053078 Ga0495612_0003875 Ga0495612_0003875_3259_4029 229
216 3300053084 Ga0495595_0001068 Ga0495595_0001068_9245_10015 229
217 3300053084 Ga0495595_0003045 Ga0495595_0003045_2839_3609 229
218 3300053085 Ga0495619_0000161 Ga0495619_0000161_5786_6556 229
219 3300053085 Ga0495619_0004783 Ga0495619_0004783_5068_5838 229
220 3300053085 Ga0495619_0022984 Ga0495619_0022984_1615_2385 229
221 3300060353 Ga0501082_0027281 Ga0501082_0027281_3153_3923 229
222 3300031344 Ga0265316_10173121 Ga0265316_101731213 231
223 3300003316 rootH1_10019190 rootH1_100191901 232
224 3300053153 Ga0500616_0153977 Ga0500616_0153977_223_993 232
225 3300025924 Ga0207694_10128015 Ga0207694_101280152 233
226 3300027614 Ga0209970_1004641 Ga0209970_10046412 233
227 3300047320 Ga0495672_0105354 Ga0495672_0105354_30_800 233
228 3300048921 Ga0496118_0184308 Ga0496118_0184308_134_901 233
229 3300005329 Ga0070683_100088494 Ga0070683_1000884943 234
230 3300005336 Ga0070680_100147897 Ga0070680_1001478973 234
231 3300005356 Ga0070674_100009282 Ga0070674_1000092822 234
232 3300005435 Ga0070714_100007544 Ga0070714_1000075444 234
233 3300005458 Ga0070681_10164684 Ga0070681_101646842 234
234 3300005530 Ga0070679_100361578 Ga0070679_1003615782 234
235 3300005617 Ga0068859_100372990 Ga0068859_1003729902 234
236 3300006175 Ga0070712_100034300 Ga0070712_1000343002 234
237 3300006931 Ga0097620_100372998 Ga0097620_1003729982 234
238 3300009174 Ga0105241_10081088 Ga0105241_100810882 234
239 3300009545 Ga0105237_10050388 Ga0105237_100503884 234
240 3300009551 Ga0105238_10011409 Ga0105238_1001140911 234
241 3300010375 Ga0105239_10244850 Ga0105239_102448503 234
242 3300013104 Ga0157370_10194826 Ga0157370_101948262 234
243 3300013105 Ga0157369_10186322 Ga0157369_101863222 234
244 3300025898 Ga0207692_10119115 Ga0207692_101191152 234
245 3300025911 Ga0207654_10059728 Ga0207654_100597282 234
246 3300025915 Ga0207693_10014866 Ga0207693_100148667 234
247 3300025917 Ga0207660_10268310 Ga0207660_102683102 234
248 3300025929 Ga0207664_10470601 Ga0207664_104706012 234
249 3300025944 Ga0207661_10092015 Ga0207661_100920152 234
250 3300026035 Ga0207703_10447264 Ga0207703_104472642 234
251 3300031241 Ga0265325_10001052 Ga0265325_100010528 234
252 3300031344 Ga0265316_10135669 Ga0265316_101356691 234
253 3300031595 Ga0265313_10006019 Ga0265313_100060196 234
254 3300035724 Ga0373933_0354727 Ga0373933_0354727_46_906 234
255 3300036401 Ga0373937_0066291 Ga0373937_0066291_2431_3291 234
256 3300039437 Ga0436365_0689921 Ga0436365_0689921_576_1346 234
257 3300046454 Ga0495592_0336631 Ga0495592_0336631_27_794 234
258 3300050509 nmdc:mga0qj67_228381_c1 nmdc:mga0qj67_228381_c1_35_808 234
259 3300053096 Ga0500641_0014864 Ga0500641_0014864_1029_1799 234
260 3300006038 Ga0075365_10306005 Ga0075365_103060051 235
261 3300050492 nmdc:mga0yw44_278724_c1 nmdc:mga0yw44_278724_c1_316_1086 235
262 3300035115 Ga0373941_0067561 Ga0373941_0067561_389_1159 236
263 3300060353 Ga0501082_0760422 Ga0501082_0760422_96_836 236
264 3300013100 Ga0157373_10053754 Ga0157373_100537542 237
265 3300036401 Ga0373937_0433875 Ga0373937_0433875_33_800 237
266 3300048909 Ga0496106_0035482 Ga0496106_0035482_668_1438 237
267 3300050512 nmdc:mga0n895_45466_c1 nmdc:mga0n895_45466_c1_3359_4267 237
268 3300005983 Ga0081540_1078594 Ga0081540_10785942 238
269 iso_pu_bacteria 2842694124 2842697937 238
270 3300005535 Ga0070684_100716989 Ga0070684_1007169892 239
271 3300006042 Ga0075368_10018895 Ga0075368_100188953 239
272 3300006048 Ga0075363_100083856 Ga0075363_1000838562 239
273 3300006051 Ga0075364_10245725 Ga0075364_102457252 239
274 3300006178 Ga0075367_10046406 Ga0075367_100464062 239
275 3300009551 Ga0105238_10042527 Ga0105238_100425272 239
276 3300049572 Ga0501036_0091655 Ga0501036_0091655_890_1660 239
277 3300049579 Ga0501043_0084075 Ga0501043_0084075_815_1585 239
278 3300049582 Ga0501048_0403044 Ga0501048_0403044_44_814 239
279 3300049586 Ga0501070_0029989 Ga0501070_0029989_503_1273 239
280 3300049586 Ga0501070_0035360 Ga0501070_0035360_1450_2220 239
281 3300049588 Ga0501072_0369844 Ga0501072_0369844_58_828 239
282 3300050490 nmdc:mga03n38_50280_c1 nmdc:mga03n38_50280_c1_442_1212 239
283 3300050494 nmdc:mga06z11_54699_c1 nmdc:mga06z11_54699_c1_1179_1949 239
284 3300050495 nmdc:mga04h51_33699_c1 nmdc:mga04h51_33699_c1_593_1363 239
285 3300050496 nmdc:mga07m45_54348_c1 nmdc:mga07m45_54348_c1_1056_1826 239
286 3300021384 Ga0213876_10055020 Ga0213876_100550203 240
287 3300027543 Ga0209999_1012910 Ga0209999_10129102 240
288 3300039437 Ga0436365_1172725 Ga0436365_1172725_704_1471 240
289 3300042439 Ga0439464_0012964 Ga0439464_0012964_1243_2013 240
290 3300005436 Ga0070713_100116108 Ga0070713_1001161083 241
291 3300025898 Ga0207692_10237895 Ga0207692_102378952 241
292 3300025929 Ga0207664_10347809 Ga0207664_103478092 241
293 iso_pu_bacteria 2643221547 2643755441 241
294 3300024225 Ga0224572_1009661 Ga0224572_10096612 242
295 3300031090 Ga0265760_10005992 Ga0265760_100059923 242
296 3300049588 Ga0501072_0000674 Ga0501072_0000674_17623_18393 242
297 3300060353 Ga0501082_0059171 Ga0501082_0059171_1783_2553 242
298 iso_pu_bacteria 2513237101 2513695459 242
299 3300005937 Ga0081455_10027923 Ga0081455_100279233 244
300 3300031241 Ga0265325_10006146 Ga0265325_100061464 244
301 3300031249 Ga0265339_10006787 Ga0265339_100067874 244
302 3300031344 Ga0265316_10115830 Ga0265316_101158304 244
303 3300031595 Ga0265313_10010557 Ga0265313_100105574 244
304 3300049570 Ga0501033_0039461 Ga0501033_0039461_849_1619 244
305 3300049581 Ga0501047_0011118 Ga0501047_0011118_3019_3789 244
306 3300049586 Ga0501070_0074396 Ga0501070_0074396_717_1487 244
307 3300049823 Ga0501044_0076401 Ga0501044_0076401_1193_1963 244
308 3300049823 Ga0501044_0452322 Ga0501044_0452322_336_1106 244
309 3300001430 JGI24032J14994_100202 JGI24032J14994_1002026 245
310 3300001979 JGI24740J21852_10028821 JGI24740J21852_100288213 245
311 3300001989 JGI24739J22299_10002358 JGI24739J22299_100023586 245
312 3300001990 JGI24737J22298_10001122 JGI24737J22298_100011226 245
313 3300001991 JGI24743J22301_10001232 JGI24743J22301_100012326 245
314 3300002070 JGI24750J21931_1000032 JGI24750J21931_100003216 245
315 3300002073 JGI24745J21846_1002345 JGI24745J21846_10023453 245
316 3300002074 JGI24748J21848_1002107 JGI24748J21848_10021072 245
317 3300002075 JGI24738J21930_10002299 JGI24738J21930_100022993 245
318 3300002076 JGI24749J21850_1000809 JGI24749J21850_10008092 245
319 3300002126 JGI24035J26624_1000092 JGI24035J26624_10000925 245
320 3300002155 JGI24033J26618_1000309 JGI24033J26618_10003092 245
321 3300002239 JGI24034J26672_10000536 JGI24034J26672_100005363 245
322 3300002244 JGI24742J22300_10000050 JGI24742J22300_1000005016 245
323 3300005290 Ga0065712_10084044 Ga0065712_100840442 245
324 3300005293 Ga0065715_10091974 Ga0065715_100919742 245
325 3300005328 Ga0070676_10009142 Ga0070676_100091427 245
326 3300005328 Ga0070676_10250917 Ga0070676_102509172 245
327 3300005329 Ga0070683_100000259 Ga0070683_10000025935 245
328 3300005331 Ga0070670_100084881 Ga0070670_1000848814 245
329 3300005333 Ga0070677_10000339 Ga0070677_1000033917 245
330 3300005334 Ga0068869_100000095 Ga0068869_10000009517 245
331 3300005334 Ga0068869_100028848 Ga0068869_1000288484 245
332 3300005335 Ga0070666_10046612 Ga0070666_100466125 245
333 3300005336 Ga0070680_100019622 Ga0070680_1000196222 245
334 3300005337 Ga0070682_100002519 Ga0070682_1000025192 245
335 3300005338 Ga0068868_100006592 Ga0068868_1000065922 245
336 3300005339 Ga0070660_100016495 Ga0070660_1000164957 245
337 3300005340 Ga0070689_100020436 Ga0070689_1000204362 245
338 3300005341 Ga0070691_10006454 Ga0070691_100064547 245
339 3300005343 Ga0070687_100004929 Ga0070687_1000049297 245
340 3300005344 Ga0070661_100000362 Ga0070661_1000003622 245
341 3300005345 Ga0070692_10005659 Ga0070692_100056592 245
342 3300005347 Ga0070668_100017522 Ga0070668_1000175227 245
343 3300005353 Ga0070669_100002512 Ga0070669_1000025122 245
344 3300005354 Ga0070675_100019847 Ga0070675_1000198472 245
345 3300005355 Ga0070671_100000935 Ga0070671_10000093522 245
346 3300005356 Ga0070674_100008580 Ga0070674_1000085802 245
347 3300005364 Ga0070673_100000144 Ga0070673_10000014435 245
348 3300005365 Ga0070688_100001947 Ga0070688_10000194714 245
349 3300005366 Ga0070659_100017676 Ga0070659_1000176762 245
350 3300005367 Ga0070667_100005818 Ga0070667_1000058187 245
351 3300005406 Ga0070703_10008667 Ga0070703_100086672 245
352 3300005438 Ga0070701_10010426 Ga0070701_100104262 245
353 3300005440 Ga0070705_100001332 Ga0070705_1000013322 245
354 3300005440 Ga0070705_100241640 Ga0070705_1002416402 245
355 3300005441 Ga0070700_100009367 Ga0070700_1000093672 245
356 3300005444 Ga0070694_100012089 Ga0070694_1000120892 245
357 3300005445 Ga0070708_100059559 Ga0070708_1000595592 245
358 3300005455 Ga0070663_100012574 Ga0070663_1000125747 245
359 3300005456 Ga0070678_100000955 Ga0070678_10000095514 245
360 3300005457 Ga0070662_100013888 Ga0070662_1000138882 245
361 3300005458 Ga0070681_10060537 Ga0070681_100605375 245
362 3300005459 Ga0068867_100000325 Ga0068867_1000003257 245
363 3300005466 Ga0070685_10069157 Ga0070685_100691572 245
364 3300005518 Ga0070699_100109188 Ga0070699_1001091882 245
365 3300005530 Ga0070679_100029943 Ga0070679_1000299437 245
366 3300005530 Ga0070679_100183834 Ga0070679_1001838343 245
367 3300005535 Ga0070684_100001386 Ga0070684_10000138616 245
368 3300005536 Ga0070697_100002804 Ga0070697_1000028048 245
369 3300005536 Ga0070697_100180919 Ga0070697_1001809192 245
370 3300005539 Ga0068853_100021663 Ga0068853_1000216637 245
371 3300005543 Ga0070672_100003185 Ga0070672_1000031852 245
372 3300005544 Ga0070686_100011949 Ga0070686_1000119497 245
373 3300005545 Ga0070695_100001945 Ga0070695_10000194510 245
374 3300005545 Ga0070695_100011210 Ga0070695_1000112102 245
375 3300005546 Ga0070696_100014120 Ga0070696_1000141207 245
376 3300005547 Ga0070693_100001679 Ga0070693_1000016797 245
377 3300005548 Ga0070665_100107883 Ga0070665_1001078835 245
378 3300005549 Ga0070704_100011878 Ga0070704_1000118782 245
379 3300005563 Ga0068855_100011491 Ga0068855_1000114912 245
380 3300005564 Ga0070664_100025252 Ga0070664_1000252527 245
381 3300005577 Ga0068857_100000521 Ga0068857_10000052126 245
382 3300005578 Ga0068854_100013433 Ga0068854_1000134332 245
383 3300005614 Ga0068856_100034966 Ga0068856_1000349667 245
384 3300005615 Ga0070702_100001916 Ga0070702_1000019162 245
385 3300005615 Ga0070702_100323926 Ga0070702_1003239262 245
386 3300005617 Ga0068859_100064359 Ga0068859_1000643592 245
387 3300005618 Ga0068864_100000459 Ga0068864_10000045940 245
388 3300005718 Ga0068866_10000987 Ga0068866_1000098711 245
389 3300005840 Ga0068870_10000034 Ga0068870_1000003416 245
390 3300005841 Ga0068863_100004287 Ga0068863_1000042872 245
391 3300005842 Ga0068858_100031677 Ga0068858_1000316772 245
392 3300005843 Ga0068860_100028836 Ga0068860_1000288362 245
393 3300005844 Ga0068862_100021695 Ga0068862_1000216957 245
394 3300006178 Ga0075367_10002451 Ga0075367_100024516 245
395 3300006237 Ga0097621_100000010 Ga0097621_100000010120 245
396 3300006358 Ga0068871_100000193 Ga0068871_10000019318 245
397 3300006852 Ga0075433_10003868 Ga0075433_100038682 245
398 3300006871 Ga0075434_100000202 Ga0075434_10000020247 245
399 3300006881 Ga0068865_100000252 Ga0068865_10000025230 245
400 3300006914 Ga0075436_100005213 Ga0075436_1000052133 245
401 3300006931 Ga0097620_100064360 Ga0097620_1000643602 245
402 3300009093 Ga0105240_10034585 Ga0105240_100345856 245
403 3300009094 Ga0111539_10043761 Ga0111539_100437612 245
404 3300009098 Ga0105245_10000152 Ga0105245_1000015222 245
405 3300009101 Ga0105247_10001782 Ga0105247_1000178217 245
406 3300009174 Ga0105241_10016831 Ga0105241_100168312 245
407 3300009176 Ga0105242_10019113 Ga0105242_100191132 245
408 3300009177 Ga0105248_10001245 Ga0105248_100012452 245
409 3300009545 Ga0105237_10031856 Ga0105237_100318562 245
410 3300009553 Ga0105249_10024998 Ga0105249_100249982 245
411 3300010375 Ga0105239_10036827 Ga0105239_100368272 245
412 3300011119 Ga0105246_10001947 Ga0105246_1000194716 245
413 3300013100 Ga0157373_10015560 Ga0157373_100155603 245
414 3300013102 Ga0157371_10003620 Ga0157371_100036202 245
415 3300013296 Ga0157374_10010563 Ga0157374_100105634 245
416 3300013297 Ga0157378_10000990 Ga0157378_1000099011 245
417 3300013307 Ga0157372_10012895 Ga0157372_100128952 245
418 3300013308 Ga0157375_10026919 Ga0157375_100269192 245
419 3300014325 Ga0163163_10067522 Ga0163163_100675222 245
420 3300014745 Ga0157377_10000463 Ga0157377_1000046316 245
421 3300014969 Ga0157376_10000098 Ga0157376_1000009861 245
422 3300017792 Ga0163161_10000866 Ga0163161_1000086615 245
423 3300025271 Ga0207666_1000450 Ga0207666_10004502 245
424 3300025315 Ga0207697_10002237 Ga0207697_100022377 245
425 3300025893 Ga0207682_10000006 Ga0207682_1000000669 245
426 3300025899 Ga0207642_10000107 Ga0207642_1000010713 245
427 3300025900 Ga0207710_10003925 Ga0207710_100039257 245
428 3300025901 Ga0207688_10002370 Ga0207688_100023707 245
429 3300025904 Ga0207647_10019660 Ga0207647_100196606 245
430 3300025907 Ga0207645_10000023 Ga0207645_10000023106 245
431 3300025908 Ga0207643_10000007 Ga0207643_1000000797 245
432 3300025911 Ga0207654_10001016 Ga0207654_1000101615 245
433 3300025912 Ga0207707_10000786 Ga0207707_1000078616 245
434 3300025913 Ga0207695_10013268 Ga0207695_1001326810 245
435 3300025914 Ga0207671_10018636 Ga0207671_100186362 245
436 3300025917 Ga0207660_10000058 Ga0207660_1000005817 245
437 3300025918 Ga0207662_10009553 Ga0207662_100095532 245
438 3300025919 Ga0207657_10026832 Ga0207657_100268327 245
439 3300025920 Ga0207649_10000384 Ga0207649_1000038422 245
440 3300025921 Ga0207652_10000377 Ga0207652_1000037738 245
441 3300025923 Ga0207681_10000100 Ga0207681_1000010017 245
442 3300025925 Ga0207650_10004913 Ga0207650_1000491312 245
443 3300025926 Ga0207659_10000044 Ga0207659_1000004432 245
444 3300025927 Ga0207687_10001241 Ga0207687_1000124111 245
445 3300025931 Ga0207644_10002171 Ga0207644_100021714 245
446 3300025932 Ga0207690_10001671 Ga0207690_1000167111 245
447 3300025933 Ga0207706_10025308 Ga0207706_100253082 245
448 3300025934 Ga0207686_10000222 Ga0207686_1000022234 245
449 3300025935 Ga0207709_10000154 Ga0207709_1000015435 245
450 3300025936 Ga0207670_10000129 Ga0207670_1000012917 245
451 3300025937 Ga0207669_10000502 Ga0207669_1000050216 245
452 3300025938 Ga0207704_10000446 Ga0207704_1000044616 245
453 3300025940 Ga0207691_10005314 Ga0207691_1000531416 245
454 3300025941 Ga0207711_10021351 Ga0207711_100213512 245
455 3300025942 Ga0207689_10000098 Ga0207689_1000009830 245
456 3300025944 Ga0207661_10000178 Ga0207661_1000017832 245
457 3300025945 Ga0207679_10000029 Ga0207679_10000029100 245
458 3300025949 Ga0207667_10010651 Ga0207667_100106517 245
459 3300025960 Ga0207651_10000031 Ga0207651_1000003132 245
460 3300025961 Ga0207712_10000129 Ga0207712_1000012923 245
461 3300025972 Ga0207668_10000158 Ga0207668_1000015847 245
462 3300025981 Ga0207640_10000168 Ga0207640_1000016822 245
463 3300025986 Ga0207658_10014664 Ga0207658_100146647 245
464 3300026023 Ga0207677_10004338 Ga0207677_100043389 245
465 3300026035 Ga0207703_10005069 Ga0207703_1000506913 245
466 3300026041 Ga0207639_10015664 Ga0207639_100156647 245
467 3300026067 Ga0207678_10004581 Ga0207678_100045812 245
468 3300026075 Ga0207708_10017977 Ga0207708_100179777 245
469 3300026078 Ga0207702_10000404 Ga0207702_100004045 245
470 3300026088 Ga0207641_10001418 Ga0207641_100014182 245
471 3300026089 Ga0207648_10000072 Ga0207648_1000007277 245
472 3300026095 Ga0207676_10000180 Ga0207676_1000018049 245
473 3300026116 Ga0207674_10010766 Ga0207674_100107668 245
474 3300026118 Ga0207675_100026944 Ga0207675_1000269447 245
475 3300026121 Ga0207683_10000029 Ga0207683_1000002987 245
476 3300027617 Ga0210002_1004321 Ga0210002_10043212 245
477 3300027682 Ga0209971_1003073 Ga0209971_10030737 245
478 3300027717 Ga0209998_10002950 Ga0209998_100029506 245
479 3300027876 Ga0209974_10004279 Ga0209974_100042795 245
480 3300027907 Ga0207428_10000100 Ga0207428_1000010049 245
481 3300028379 Ga0268266_10015777 Ga0268266_100157774 245
482 3300028380 Ga0268265_10000698 Ga0268265_1000069832 245
483 3300028381 Ga0268264_10005684 Ga0268264_100056847 245
484 3300031711 Ga0265314_10011299 Ga0265314_100112998 245
485 3300032133 Ga0316583_10006661 Ga0316583_100066614 245
486 3300034818 Ga0373950_0001071 Ga0373950_0001071_1600_2370 245
487 3300034957 Ga0373938_0021500 Ga0373938_0021500_457_1227 245
488 3300035085 Ga0373929_0007180 Ga0373929_0007180_1045_1815 245
489 3300035088 Ga0373940_0002001 Ga0373940_0002001_340_1110 245
490 3300035090 Ga0373949_0001759 Ga0373949_0001759_3379_4149 245
491 3300035112 Ga0373932_0002838 Ga0373932_0002838_167_937 245
492 3300035121 Ga0373960_0005729 Ga0373960_0005729_1081_1851 245
493 3300035207 Ga0373942_0001126 Ga0373942_0001126_4127_4897 245
494 3300035242 Ga0373962_0002485 Ga0373962_0002485_3372_4142 245
495 3300035691 Ga0373931_0002530 Ga0373931_0002530_3993_4763 245
496 3300048903 Ga0496100_0000529 Ga0496100_0000529_10619_11389 245
497 3300048904 Ga0496101_0000187 Ga0496101_0000187_11591_12361 245
498 3300048905 Ga0496102_0008774 Ga0496102_0008774_3993_4763 245
499 3300048906 Ga0496103_0000157 Ga0496103_0000157_10664_11434 245
500 3300048909 Ga0496106_0003377 Ga0496106_0003377_4121_4891 245
501 3300048910 Ga0496107_0000805 Ga0496107_0000805_15780_16550 245
502 3300048911 Ga0496108_0003275 Ga0496108_0003275_6146_6916 245
503 3300048912 Ga0496109_0000313 Ga0496109_0000313_9935_10705 245
504 3300048913 Ga0496110_0066895 Ga0496110_0066895_2059_2829 245
505 3300048916 Ga0496113_0078764 Ga0496113_0078764_1560_2330 245
506 3300048918 Ga0496115_0001217 Ga0496115_0001217_12475_13245 245
507 3300049570 Ga0501033_0063506 Ga0501033_0063506_358_1128 245
508 3300049571 Ga0501034_0008229 Ga0501034_0008229_6031_6798 245
509 3300049571 Ga0501034_0014223 Ga0501034_0014223_5448_6215 245
510 3300049571 Ga0501034_0251021 Ga0501034_0251021_140_907 245
511 3300049572 Ga0501036_0087238 Ga0501036_0087238_589_1356 245
512 3300049573 Ga0501037_0009677 Ga0501037_0009677_5737_6504 245
513 3300049574 Ga0501038_0203958 Ga0501038_0203958_183_950 245
514 3300049579 Ga0501043_0168852 Ga0501043_0168852_19_786 245
515 3300049581 Ga0501047_0006413 Ga0501047_0006413_5454_6221 245
516 3300049581 Ga0501047_0009087 Ga0501047_0009087_5632_6402 245
517 3300049584 Ga0501068_0091851 Ga0501068_0091851_334_1101 245
518 3300049584 Ga0501068_0403489 Ga0501068_0403489_53_820 245
519 3300049585 Ga0501069_0395357 Ga0501069_0395357_10_777 245
520 3300049586 Ga0501070_0075813 Ga0501070_0075813_1976_2743 245
521 3300049586 Ga0501070_0372415 Ga0501070_0372415_70_837 245
522 3300049589 Ga0501073_0191444 Ga0501073_0191444_342_1109 245
523 3300049590 Ga0501074_0152536 Ga0501074_0152536_300_1067 245
524 3300049742 Ga0501080_0012989 Ga0501080_0012989_5475_6242 245
525 3300049742 Ga0501080_0131578 Ga0501080_0131578_743_1510 245
526 3300049742 Ga0501080_0143407 Ga0501080_0143407_1011_1778 245
527 3300049744 Ga0501083_0001288 Ga0501083_0001288_15819_16586 245
528 3300049823 Ga0501044_0010736 Ga0501044_0010736_3278_4045 245
529 3300049823 Ga0501044_0068147 Ga0501044_0068147_1618_2388 245
530 3300049823 Ga0501044_0130521 Ga0501044_0130521_946_1713 245
531 3300049823 Ga0501044_0255081 Ga0501044_0255081_220_987 245
532 3300050494 nmdc:mga06z11_6126_c1 nmdc:mga06z11_6126_c1_2764_3534 245
533 3300050511 nmdc:mga08y16_2193_c1 nmdc:mga08y16_2193_c1_10511_11281 245
534 3300050512 nmdc:mga0n895_1250_c1 nmdc:mga0n895_1250_c1_6066_6836 245
535 3300050514 nmdc:mga08x19_23_c1 nmdc:mga08x19_23_c1_258398_259168 245
536 3300050515 nmdc:mga0a205_3872_c1 nmdc:mga0a205_3872_c1_4120_4890 245
537 3300060353 Ga0501082_0036920 Ga0501082_0036920_498_1265 245
538 3300060353 Ga0501082_0085460 Ga0501082_0085460_1907_2674 245
539 2162886007 SwRhRL2b_contig_1612269 SwRhRL2b_0786.00000260 246
540 2209111006 2214856319 2213902605 246
541 3300000041 ARcpr5oldR_c000300 ARcpr5oldR_0003006 246
542 3300000042 ARSoilYngRDRAFT_c00004 ARSoilYngRDRAFT_0000428 246
543 3300000043 ARcpr5yngRDRAFT_c000060 ARcpr5yngRDRAFT_00006018 246
544 3300000044 ARSoilOldRDRAFT_c000283 ARSoilOldRDRAFT_0002836 246
545 3300000652 ARCol0yngRDRAFT_1000084 ARCol0yngRDRAFT_10000846 246
546 3300001989 JGI24739J22299_10044017 JGI24739J22299_100440173 246
547 3300001990 JGI24737J22298_10005585 JGI24737J22298_100055857 246
548 3300005277 Ga0065716_1001561 Ga0065716_10015613 246
549 3300005288 Ga0065714_10155348 Ga0065714_101553481 246
550 3300005289 Ga0065704_10083099 Ga0065704_100830995 246
551 3300005290 Ga0065712_10014760 Ga0065712_100147605 246
552 3300005290 Ga0065712_10077134 Ga0065712_100771342 246
553 3300005293 Ga0065715_10002288 Ga0065715_1000228817 246
554 3300005327 Ga0070658_10482445 Ga0070658_104824452 246
555 3300005329 Ga0070683_100770214 Ga0070683_1007702141 246
556 3300005330 Ga0070690_100013047 Ga0070690_1000130472 246
557 3300005334 Ga0068869_100218022 Ga0068869_1002180223 246
558 3300005334 Ga0068869_100268264 Ga0068869_1002682641 246
559 3300005336 Ga0070680_100019598 Ga0070680_1000195982 246
560 3300005338 Ga0068868_100011912 Ga0068868_1000119126 246
561 3300005339 Ga0070660_100214323 Ga0070660_1002143231 246
562 3300005340 Ga0070689_100087555 Ga0070689_1000875553 246
563 3300005341 Ga0070691_10115427 Ga0070691_101154273 246
564 3300005343 Ga0070687_100064626 Ga0070687_1000646263 246
565 3300005344 Ga0070661_100424707 Ga0070661_1004247072 246
566 3300005345 Ga0070692_10028168 Ga0070692_100281682 246
567 3300005347 Ga0070668_100017886 Ga0070668_1000178862 246
568 3300005365 Ga0070688_100009341 Ga0070688_1000093412 246
569 3300005366 Ga0070659_100033629 Ga0070659_1000336292 246
570 3300005367 Ga0070667_100126708 Ga0070667_1001267083 246
571 3300005435 Ga0070714_100067871 Ga0070714_1000678713 246
572 3300005435 Ga0070714_100311930 Ga0070714_1003119302 246
573 3300005438 Ga0070701_10053038 Ga0070701_100530382 246
574 3300005440 Ga0070705_100313286 Ga0070705_1003132862 246
575 3300005441 Ga0070700_100030724 Ga0070700_1000307245 246
576 3300005444 Ga0070694_100012072 Ga0070694_1000120722 246
577 3300005455 Ga0070663_100286636 Ga0070663_1002866362 246
578 3300005457 Ga0070662_100416198 Ga0070662_1004161982 246
579 3300005458 Ga0070681_10048667 Ga0070681_100486673 246
580 3300005458 Ga0070681_10369884 Ga0070681_103698842 246
581 3300005471 Ga0070698_100258431 Ga0070698_1002584312 246
582 3300005518 Ga0070699_100775206 Ga0070699_1007752061 246
583 3300005530 Ga0070679_100446228 Ga0070679_1004462282 246
584 3300005535 Ga0070684_100112100 Ga0070684_1001121002 246
585 3300005539 Ga0068853_100748189 Ga0068853_1007481891 246
586 3300005543 Ga0070672_100106629 Ga0070672_1001066294 246
587 3300005544 Ga0070686_100002814 Ga0070686_10000281413 246
588 3300005545 Ga0070695_100013577 Ga0070695_1000135777 246
589 3300005545 Ga0070695_100277518 Ga0070695_1002775181 246
590 3300005546 Ga0070696_100014107 Ga0070696_1000141072 246
591 3300005546 Ga0070696_100225817 Ga0070696_1002258172 246
592 3300005547 Ga0070693_100047790 Ga0070693_1000477904 246
593 3300005549 Ga0070704_100066027 Ga0070704_1000660275 246
594 3300005578 Ga0068854_100124485 Ga0068854_1001244853 246
595 3300005614 Ga0068856_100211800 Ga0068856_1002118002 246
596 3300005617 Ga0068859_100025977 Ga0068859_1000259777 246
597 3300005617 Ga0068859_100354210 Ga0068859_1003542102 246
598 3300005718 Ga0068866_10101535 Ga0068866_101015352 246
599 3300005834 Ga0068851_10219166 Ga0068851_102191661 246
600 3300005842 Ga0068858_100063955 Ga0068858_1000639552 246
601 3300005842 Ga0068858_100209543 Ga0068858_1002095432 246
602 3300005843 Ga0068860_100141077 Ga0068860_1001410774 246
603 3300005843 Ga0068860_100517741 Ga0068860_1005177412 246
604 3300005844 Ga0068862_100025938 Ga0068862_1000259387 246
605 3300005937 Ga0081455_10043322 Ga0081455_100433226 246
606 3300005983 Ga0081540_1000068 Ga0081540_100006860 246
607 3300006028 Ga0070717_10088016 Ga0070717_100880164 246
608 3300006038 Ga0075365_10040537 Ga0075365_100405372 246
609 3300006038 Ga0075365_10222244 Ga0075365_102222441 246
610 3300006048 Ga0075363_100177238 Ga0075363_1001772382 246
611 3300006051 Ga0075364_10119889 Ga0075364_101198892 246
612 3300006051 Ga0075364_10288205 Ga0075364_102882052 246
613 3300006163 Ga0070715_10015446 Ga0070715_100154463 246
614 3300006178 Ga0075367_10000344 Ga0075367_1000034411 246
615 3300006186 Ga0075369_10000100 Ga0075369_100001009 246
616 3300006186 Ga0075369_10090117 Ga0075369_100901171 246
617 3300006195 Ga0075366_10129847 Ga0075366_101298471 246
618 3300006195 Ga0075366_10217567 Ga0075366_102175672 246
619 3300006195 Ga0075366_10266979 Ga0075366_102669791 246
620 3300006237 Ga0097621_100122680 Ga0097621_1001226803 246
621 3300006237 Ga0097621_100212019 Ga0097621_1002120192 246
622 3300006358 Ga0068871_100325706 Ga0068871_1003257062 246
623 3300006358 Ga0068871_100356654 Ga0068871_1003566541 246
624 3300006846 Ga0075430_100001959 Ga0075430_1000019597 246
625 3300006847 Ga0075431_100028363 Ga0075431_1000283636 246
626 3300006871 Ga0075434_100178546 Ga0075434_1001785463 246
627 3300006880 Ga0075429_100275689 Ga0075429_1002756892 246
628 3300006881 Ga0068865_100193971 Ga0068865_1001939712 246
629 3300006914 Ga0075436_100004205 Ga0075436_1000042058 246
630 3300006914 Ga0075436_100127128 Ga0075436_1001271284 246
631 3300006931 Ga0097620_100025977 Ga0097620_1000259777 246
632 3300006931 Ga0097620_100354207 Ga0097620_1003542072 246
633 3300007076 Ga0075435_100266638 Ga0075435_1002666382 246
634 3300007788 Ga0099795_10000385 Ga0099795_100003856 246
635 3300009011 Ga0105251_10059560 Ga0105251_100595602 246
636 3300009094 Ga0111539_10022969 Ga0111539_100229697 246
637 3300009094 Ga0111539_10043725 Ga0111539_100437252 246
638 3300009094 Ga0111539_10161295 Ga0111539_101612952 246
639 3300009098 Ga0105245_10011738 Ga0105245_100117388 246
640 3300009098 Ga0105245_10423937 Ga0105245_104239372 246
641 3300009101 Ga0105247_10031689 Ga0105247_100316895 246
642 3300009147 Ga0114129_10004957 Ga0114129_1000495712 246
643 3300009147 Ga0114129_10100059 Ga0114129_101000593 246
644 3300009147 Ga0114129_10242026 Ga0114129_102420263 246
645 3300009148 Ga0105243_10018129 Ga0105243_100181297 246
646 3300009177 Ga0105248_10065391 Ga0105248_100653912 246
647 3300009177 Ga0105248_10132039 Ga0105248_101320393 246
648 3300009177 Ga0105248_10433061 Ga0105248_104330613 246
649 3300009545 Ga0105237_10193257 Ga0105237_101932574 246
650 3300009551 Ga0105238_10121993 Ga0105238_101219933 246
651 3300010375 Ga0105239_10076044 Ga0105239_100760442 246
652 3300010375 Ga0105239_10684429 Ga0105239_106844291 246
653 3300011119 Ga0105246_10091049 Ga0105246_100910492 246
654 3300012497 Ga0157319_1000342 Ga0157319_10003422 246
655 3300012507 Ga0157342_1000333 Ga0157342_10003334 246
656 3300012513 Ga0157326_1012483 Ga0157326_10124832 246
657 3300013102 Ga0157371_10086333 Ga0157371_100863334 246
658 3300013104 Ga0157370_10033106 Ga0157370_100331062 246
659 3300013297 Ga0157378_10167363 Ga0157378_101673633 246
660 3300013297 Ga0157378_10444789 Ga0157378_104447892 246
661 3300013306 Ga0163162_10034398 Ga0163162_100343983 246
662 3300014325 Ga0163163_10067631 Ga0163163_100676312 246
663 3300014326 Ga0157380_10004398 Ga0157380_100043987 246
664 3300014326 Ga0157380_10116379 Ga0157380_101163792 246
665 3300014326 Ga0157380_10234855 Ga0157380_102348552 246
666 3300014969 Ga0157376_10563546 Ga0157376_105635462 246
667 3300021384 Ga0213876_10124093 Ga0213876_101240931 246
668 3300021388 Ga0213875_10000003 Ga0213875_100000039 246
669 3300025315 Ga0207697_10007190 Ga0207697_100071902 246
670 3300025885 Ga0207653_10016205 Ga0207653_100162052 246
671 3300025899 Ga0207642_10043328 Ga0207642_100433283 246
672 3300025900 Ga0207710_10039847 Ga0207710_100398472 246
673 3300025901 Ga0207688_10023763 Ga0207688_100237636 246
674 3300025904 Ga0207647_10002014 Ga0207647_1000201414 246
675 3300025905 Ga0207685_10018147 Ga0207685_100181472 246
676 3300025906 Ga0207699_10180876 Ga0207699_101808762 246
677 3300025910 Ga0207684_10233878 Ga0207684_102338783 246
678 3300025912 Ga0207707_10065647 Ga0207707_100656474 246
679 3300025914 Ga0207671_10119018 Ga0207671_101190182 246
680 3300025917 Ga0207660_10087819 Ga0207660_100878195 246
681 3300025918 Ga0207662_10011718 Ga0207662_100117182 246
682 3300025919 Ga0207657_10112909 Ga0207657_101129094 246
683 3300025921 Ga0207652_10078184 Ga0207652_100781842 246
684 3300025924 Ga0207694_10012592 Ga0207694_100125923 246
685 3300025925 Ga0207650_10047429 Ga0207650_100474292 246
686 3300025926 Ga0207659_10170608 Ga0207659_101706083 246
687 3300025932 Ga0207690_10019165 Ga0207690_100191653 246
688 3300025933 Ga0207706_10025283 Ga0207706_100252832 246
689 3300025933 Ga0207706_10324392 Ga0207706_103243922 246
690 3300025935 Ga0207709_10027551 Ga0207709_100275515 246
691 3300025936 Ga0207670_10034390 Ga0207670_100343905 246
692 3300025938 Ga0207704_10199240 Ga0207704_101992402 246
693 3300025939 Ga0207665_10022731 Ga0207665_100227313 246
694 3300025941 Ga0207711_10078995 Ga0207711_100789952 246
695 3300025972 Ga0207668_10000100 Ga0207668_100001001 246
696 3300025986 Ga0207658_10255539 Ga0207658_102555391 246
697 3300026023 Ga0207677_10016991 Ga0207677_100169912 246
698 3300026067 Ga0207678_10038705 Ga0207678_100387056 246
699 3300026075 Ga0207708_10043597 Ga0207708_100435972 246
700 3300026088 Ga0207641_10128789 Ga0207641_101287894 246
701 3300026116 Ga0207674_10369122 Ga0207674_103691222 246
702 3300026142 Ga0207698_10009066 Ga0207698_100090667 246
703 3300027424 Ga0209984_1004014 Ga0209984_10040143 246
704 3300027512 Ga0209179_1000387 Ga0209179_10003876 246
705 3300027695 Ga0209966_1001665 Ga0209966_10016655 246
706 3300027717 Ga0209998_10003961 Ga0209998_100039612 246
707 3300027876 Ga0209974_10111086 Ga0209974_101110862 246
708 3300027907 Ga0207428_10000968 Ga0207428_1000096816 246
709 3300028380 Ga0268265_10045744 Ga0268265_100457445 246
710 3300028381 Ga0268264_10035806 Ga0268264_100358063 246
711 3300028381 Ga0268264_10227850 Ga0268264_102278501 246
712 3300028556 Ga0265337_1009820 Ga0265337_10098206 246
713 3300028800 Ga0265338_10006337 Ga0265338_1000633712 246
714 3300031018 Ga0265773_1000896 Ga0265773_10008962 246
715 3300031090 Ga0265760_10104969 Ga0265760_101049691 246
716 3300031241 Ga0265325_10005357 Ga0265325_100053579 246
717 3300031241 Ga0265325_10104307 Ga0265325_101043073 246
718 3300031242 Ga0265329_10086470 Ga0265329_100864702 246
719 3300031247 Ga0265340_10054915 Ga0265340_100549152 246
720 3300031249 Ga0265339_10001451 Ga0265339_100014516 246
721 3300031249 Ga0265339_10017062 Ga0265339_100170623 246
722 3300031344 Ga0265316_10090520 Ga0265316_100905202 246
723 3300031595 Ga0265313_10000366 Ga0265313_1000036612 246
724 3300031711 Ga0265314_10001247 Ga0265314_1000124716 246
725 3300031711 Ga0265314_10068973 Ga0265314_100689731 246
726 3300031712 Ga0265342_10000564 Ga0265342_1000056420 246
727 3300031712 Ga0265342_10063090 Ga0265342_100630902 246
728 3300031903 Ga0307407_10136708 Ga0307407_101367083 246
729 3300031995 Ga0307409_100531496 Ga0307409_1005314962 246
730 3300034816 Ga0373930_0000941 Ga0373930_0000941_3387_4157 246
731 3300034817 Ga0373948_0000551 Ga0373948_0000551_759_1529 246
732 3300034819 Ga0373958_0000214 Ga0373958_0000214_3317_4087 246
733 3300034820 Ga0373959_0000795 Ga0373959_0000795_4104_4874 246
734 3300034957 Ga0373938_0000050 Ga0373938_0000050_10351_11121 246
735 3300035084 Ga0373928_0000023 Ga0373928_0000023_23882_24652 246
736 3300035085 Ga0373929_0001804 Ga0373929_0001804_506_1276 246
737 3300035088 Ga0373940_0000075 Ga0373940_0000075_3056_3826 246
738 3300035090 Ga0373949_0001683 Ga0373949_0001683_2339_3109 246
739 3300035091 Ga0373951_0002175 Ga0373951_0002175_2222_2992 246
740 3300035092 Ga0373952_0001100 Ga0373952_0001100_3938_4708 246
741 3300035111 Ga0373923_0047771 Ga0373923_0047771_118_900 246
742 3300035112 Ga0373932_0000570 Ga0373932_0000570_4115_4885 246
743 3300035114 Ga0373939_0002122 Ga0373939_0002122_1837_2607 246
744 3300035115 Ga0373941_0000644 Ga0373941_0000644_4786_5556 246
745 3300035116 Ga0373945_0021619 Ga0373945_0021619_281_1063 246
746 3300035118 Ga0373954_0006146 Ga0373954_0006146_3227_4009 246
747 3300035120 Ga0373957_0050440 Ga0373957_0050440_680_1462 246
748 3300035121 Ga0373960_0012100 Ga0373960_0012100_1042_1812 246
749 3300035170 Ga0373943_0000449 Ga0373943_0000449_12180_12962 246
750 3300035171 Ga0373946_0001441 Ga0373946_0001441_800_1582 246
751 3300035172 Ga0373955_0000177 Ga0373955_0000177_23216_23998 246
752 3300035207 Ga0373942_0000843 Ga0373942_0000843_7258_8028 246
753 3300035241 Ga0373961_0000536 Ga0373961_0000536_1965_2735 246
754 3300035242 Ga0373962_0000064 Ga0373962_0000064_18860_19630 246
755 3300035410 Ga0373924_0000051 Ga0373924_0000051_25522_26304 246
756 3300035691 Ga0373931_0031105 Ga0373931_0031105_496_1266 246
757 3300035691 Ga0373931_0149910 Ga0373931_0149910_270_1040 246
758 3300035692 Ga0373935_0000018 Ga0373935_0000018_38862_39644 246
759 3300035695 Ga0373927_0004668 Ga0373927_0004668_797_1567 246
760 3300035695 Ga0373927_0018003 Ga0373927_0018003_25_807 246
761 3300035724 Ga0373933_0080337 Ga0373933_0080337_1203_1985 246
762 3300035724 Ga0373933_0272262 Ga0373933_0272262_297_1067 246
763 3300035725 Ga0373947_0000264 Ga0373947_0000264_22467_23249 246
764 3300035725 Ga0373947_0128137 Ga0373947_0128137_131_901 246
765 3300036401 Ga0373937_0000571 Ga0373937_0000571_3880_4662 246
766 3300036401 Ga0373937_0007367 Ga0373937_0007367_5868_6638 246
767 3300037068 Ga0373925_0000018 Ga0373925_0000018_27045_27827 246
768 3300037853 Ga0436364_0145110 Ga0436364_0145110_6584_7354 246
769 3300038996 Ga0242420_000299 Ga0242420_000299_4171_4941 246
770 3300039437 Ga0436365_1262142 Ga0436365_1262142_4195_4965 246
771 3300039450 Ga0436363_1677324 Ga0436363_1677324_25_795 246
772 3300042005 Ga0439448_0016529 Ga0439448_0016529_1228_1998 246
773 3300042012 Ga0439455_0004368 Ga0439455_0004368_485_1255 246
774 3300042016 Ga0439463_007824 Ga0439463_007824_584_1354 246
775 3300044694 Ga0466963_0037383 Ga0466963_0037383_2201_2971 246
776 3300045051 Ga0451576_0067491 Ga0451576_0067491_2548_3318 246
777 3300045836 Ga0466958_0062650 Ga0466958_0062650_524_1294 246
778 3300046454 Ga0495592_0000001 Ga0495592_0000001_180570_181352 246
779 3300046459 Ga0495629_0012920 Ga0495629_0012920_3416_4198 246
780 3300046462 Ga0495651_0004527 Ga0495651_0004527_5971_6753 246
781 3300046463 Ga0495653_0000015 Ga0495653_0000015_139036_139818 246
782 3300046477 Ga0495664_0000001 Ga0495664_0000001_135008_135790 246
783 3300046491 Ga0495584_0003512 Ga0495584_0003512_1446_2216 246
784 3300046499 Ga0495594_0184511 Ga0495594_0184511_213_983 246
785 3300046511 Ga0495608_0000116 Ga0495608_0000116_26164_26946 246
786 3300046514 Ga0495618_0000021 Ga0495618_0000021_103918_104700 246
787 3300046516 Ga0495628_0000005 Ga0495628_0000005_387009_387791 246
788 3300046517 Ga0495630_0001024 Ga0495630_0001024_6857_7639 246
789 3300046517 Ga0495630_0060647 Ga0495630_0060647_797_1567 246
790 3300046526 Ga0495666_0140594 Ga0495666_0140594_131_901 246
791 3300046529 Ga0495652_0000001 Ga0495652_0000001_691375_692157 246
792 3300046533 Ga0495640_0000006 Ga0495640_0000006_139011_139793 246
793 3300046535 Ga0495586_0087986 Ga0495586_0087986_194_976 246
794 3300046536 Ga0495587_0000012 Ga0495587_0000012_33016_33798 246
795 3300046537 Ga0495598_0055352 Ga0495598_0055352_133_903 246
796 3300046543 Ga0495645_0000004 Ga0495645_0000004_28514_29296 246
797 3300046559 Ga0495667_0000001 Ga0495667_0000001_531343_532125 246
798 3300046615 Ga0495656_0004499 Ga0495656_0004499_1228_1998 246
799 3300046615 Ga0495656_0017425 Ga0495656_0017425_822_1592 246
800 3300046642 Ga0495634_0000388 Ga0495634_0000388_26576_27358 246
801 3300046663 Ga0495635_0000007 Ga0495635_0000007_159542_160324 246
802 3300046675 Ga0495657_0000250 Ga0495657_0000250_33040_33822 246
803 3300046678 Ga0495599_0000002 Ga0495599_0000002_226594_227376 246
804 3300046679 Ga0495623_0000116 Ga0495623_0000116_19981_20763 246
805 3300046680 Ga0495646_0000049 Ga0495646_0000049_27042_27824 246
806 3300046683 Ga0495658_0047198 Ga0495658_0047198_841_1623 246
807 3300046683 Ga0495658_0088403 Ga0495658_0088403_610_1380 246
808 3300046689 Ga0495613_0253656 Ga0495613_0253656_412_1194 246
809 3300046809 Ga0495600_0000013 Ga0495600_0000013_2227_3009 246
810 3300047315 Ga0495581_0028974 Ga0495581_0028974_1270_2052 246
811 3300047317 Ga0495604_0000007 Ga0495604_0000007_58425_59207 246
812 3300047319 Ga0495674_0000001 Ga0495674_0000001_334945_335727 246
813 3300047320 Ga0495672_0151348 Ga0495672_0151348_144_920 246
814 3300047322 Ga0495680_0004250 Ga0495680_0004250_9939_10721 246
815 3300047444 Ga0495675_0000014 Ga0495675_0000014_12964_13746 246
816 3300047471 Ga0495684_0000219 Ga0495684_0000219_29175_29957 246
817 3300048088 Ga0495602_0000004 Ga0495602_0000004_33059_33841 246
818 3300048903 Ga0496100_0314855 Ga0496100_0314855_108_878 246
819 3300048905 Ga0496102_0092799 Ga0496102_0092799_994_1764 246
820 3300048905 Ga0496102_0230568 Ga0496102_0230568_943_1713 246
821 3300048906 Ga0496103_0100007 Ga0496103_0100007_349_1119 246
822 3300048907 Ga0496104_0207062 Ga0496104_0207062_331_1101 246
823 3300048907 Ga0496104_0270089 Ga0496104_0270089_155_925 246
824 3300048908 Ga0496105_0064743 Ga0496105_0064743_542_1312 246
825 3300048909 Ga0496106_0017370 Ga0496106_0017370_4205_4975 246
826 3300048912 Ga0496109_0001125 Ga0496109_0001125_8496_9266 246
827 3300048912 Ga0496109_0251269 Ga0496109_0251269_389_1159 246
828 3300048913 Ga0496110_0353982 Ga0496110_0353982_417_1187 246
829 3300048917 Ga0496114_0024270 Ga0496114_0024270_683_1453 246
830 3300048917 Ga0496114_0652986 Ga0496114_0652986_57_827 246
831 3300048918 Ga0496115_0131060 Ga0496115_0131060_550_1320 246
832 3300048918 Ga0496115_0223886 Ga0496115_0223886_583_1353 246
833 3300048929 Ga0496126_0028568 Ga0496126_0028568_333_1103 246
834 3300049571 Ga0501034_0000616 Ga0501034_0000616_19870_20640 246
835 3300049571 Ga0501034_0014011 Ga0501034_0014011_1556_2326 246
836 3300049571 Ga0501034_0192087 Ga0501034_0192087_857_1627 246
837 3300049572 Ga0501036_0291403 Ga0501036_0291403_68_838 246
838 3300049573 Ga0501037_0023898 Ga0501037_0023898_2679_3449 246
839 3300049573 Ga0501037_0034118 Ga0501037_0034118_2787_3557 246
840 3300049574 Ga0501038_0112956 Ga0501038_0112956_830_1600 246
841 3300049575 Ga0501039_0345861 Ga0501039_0345861_187_957 246
842 3300049578 Ga0501042_0212625 Ga0501042_0212625_247_1017 246
843 3300049579 Ga0501043_0028099 Ga0501043_0028099_134_904 246
844 3300049579 Ga0501043_0272665 Ga0501043_0272665_317_1087 246
845 3300049580 Ga0501046_0153320 Ga0501046_0153320_916_1686 246
846 3300049581 Ga0501047_0238790 Ga0501047_0238790_414_1184 246
847 3300049582 Ga0501048_0300582 Ga0501048_0300582_319_1089 246
848 3300049583 Ga0501067_0143566 Ga0501067_0143566_243_1013 246
849 3300049584 Ga0501068_0022329 Ga0501068_0022329_2619_3389 246
850 3300049585 Ga0501069_0068348 Ga0501069_0068348_474_1244 246
851 3300049585 Ga0501069_0175528 Ga0501069_0175528_334_1104 246
852 3300049586 Ga0501070_0125475 Ga0501070_0125475_563_1333 246
853 3300049586 Ga0501070_0203780 Ga0501070_0203780_212_982 246
854 3300049589 Ga0501073_0005090 Ga0501073_0005090_7928_8698 246
855 3300049592 Ga0501076_0077924 Ga0501076_0077924_1875_2645 246
856 3300049742 Ga0501080_0050705 Ga0501080_0050705_488_1258 246
857 3300049742 Ga0501080_0075084 Ga0501080_0075084_1650_2420 246
858 3300049742 Ga0501080_0170788 Ga0501080_0170788_763_1533 246
859 3300049744 Ga0501083_0013916 Ga0501083_0013916_1454_2224 246
860 3300049822 Ga0501035_0007147 Ga0501035_0007147_8156_8926 246
861 3300049822 Ga0501035_0172050 Ga0501035_0172050_303_1073 246
862 3300049823 Ga0501044_0215139 Ga0501044_0215139_577_1347 246
863 3300049823 Ga0501044_0505359 Ga0501044_0505359_184_954 246
864 3300049824 Ga0501045_0473805 Ga0501045_0473805_138_908 246
865 3300050491 nmdc:mga00v17_42628_c1 nmdc:mga00v17_42628_c1_1427_2197 246
866 3300050491 nmdc:mga00v17_82958_c1 nmdc:mga00v17_82958_c1_913_1683 246
867 3300050495 nmdc:mga04h51_9915_c1 nmdc:mga04h51_9915_c1_1159_1929 246
868 3300050496 nmdc:mga07m45_100802_c1 nmdc:mga07m45_100802_c1_420_1190 246
869 3300050507 nmdc:mga05p37_11988_c1 nmdc:mga05p37_11988_c1_3466_4236 246
870 3300050507 nmdc:mga05p37_18354_c1 nmdc:mga05p37_18354_c1_2423_3193 246
871 3300050509 nmdc:mga0qj67_704_c1 nmdc:mga0qj67_704_c1_12713_13489 246
872 3300050511 nmdc:mga08y16_133764_c1 nmdc:mga08y16_133764_c1_1670_2440 246
873 3300050511 nmdc:mga08y16_1621_c1 nmdc:mga08y16_1621_c1_10983_11753 246
874 3300050511 nmdc:mga08y16_168408_c1 nmdc:mga08y16_168408_c1_552_1322 246
875 3300050511 nmdc:mga08y16_231127_c1 nmdc:mga08y16_231127_c1_599_1369 246
876 3300050511 nmdc:mga08y16_238163_c1 nmdc:mga08y16_238163_c1_397_1167 246
877 3300050512 nmdc:mga0n895_12677_c1 nmdc:mga0n895_12677_c1_1090_1860 246
878 3300050512 nmdc:mga0n895_267853_c1 nmdc:mga0n895_267853_c1_405_1175 246
879 3300050512 nmdc:mga0n895_867201_c1 nmdc:mga0n895_867201_c1_94_864 246
880 3300050514 nmdc:mga08x19_54995_c1 nmdc:mga08x19_54995_c1_746_1528 246
881 3300050515 nmdc:mga0a205_80336_c1 nmdc:mga0a205_80336_c1_1108_1878 246
882 3300050515 nmdc:mga0a205_93540_c1 nmdc:mga0a205_93540_c1_1169_1939 246
883 3300053077 Ga0495601_0000006 Ga0495601_0000006_174995_175777 246
884 3300053078 Ga0495612_0000004 Ga0495612_0000004_138883_139665 246
885 3300053084 Ga0495595_0000006 Ga0495595_0000006_66329_67111 246
886 3300053085 Ga0495619_0000240 Ga0495619_0000240_5933_6715 246
887 3300053085 Ga0495619_0017362 Ga0495619_0017362_3670_4440 246
888 3300053085 Ga0495619_0075509 Ga0495619_0075509_1258_2028 246
889 3300053087 Ga0500643_006735 Ga0500643_006735_1895_2665 246
890 3300053088 Ga0500644_0001049 Ga0500644_0001049_472_1242 246
891 3300053093 Ga0500651_0029241 Ga0500651_0029241_972_1742 246
892 3300053096 Ga0500641_0002552 Ga0500641_0002552_74_844 246
893 3300053118 Ga0500594_0006844 Ga0500594_0006844_285_1055 246
894 3300053119 Ga0500595_000056 Ga0500595_000056_67091_67861 246
895 3300053131 Ga0500652_000030 Ga0500652_000030_75682_76452 246
896 3300053133 Ga0500655_016098 Ga0500655_016098_317_1087 246
897 3300053153 Ga0500616_0000006 Ga0500616_0000006_330647_331417 246
898 3300053730 Ga0500645_000384 Ga0500645_000384_28407_29177 246
899 3300053730 Ga0500645_031550 Ga0500645_031550_405_1181 246
900 3300054114 Ga0501084_0564161 Ga0501084_0564161_25_795 246
901 3300060353 Ga0501082_0000365 Ga0501082_0000365_15855_16625 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01311

Bac_export_1

Bacterial export proteins, family 1

12

250

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s3l-assembly1.cif.gz_F structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex. 0.6053 18 237
6s3r-assembly1.cif.gz_F structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi. 0.5933 1 241
7e80-assembly1.cif.gz_CE cryo-em structure of the flagellar rod with hook and export apparatus from salmonella 0.5866 11 242
6s3r-assembly1.cif.gz_F structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi. 0.5798 1 241
7bin-assembly1.cif.gz_F salmonella export gate and rod refined in focussed c1 map 0.5723 3 244
ID Description Score Start End Superfamily
af_Q6ZMY3_591_703_1.10.472.30 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Transcription elongation factor S-II, central domain 0.3967 1 90 1.10.472.30
af_P22468_2_194_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.368 31 181 3.40.50.300
af_I1J9Z8_276_439_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3508 51 223 1.20.1250.20
af_A0A1D6P003_256_419_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3424 49 220 1.20.1250.20
af_Q3V050_274_435_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3412 48 223 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2E1XSW7-F1-model_v4 deleted 0.7437 6 243
AF-A0A7C7GBR5-F1-model_v4 Flagellar type III secretion system protein FliR 0.7382 12 208 GO:0005886
GO:0006605
AF-A0A257VTW9-F1-model_v4 Flagellar biosynthetic protein FliR 0.73 1 197 GO:0005886
GO:0006605
AF-A0A3D3IUN9-F1-model_v4 Flagellar biosynthetic protein FliR 0.7287 7 199 GO:0005886
GO:0006605
AF-A0A2E1XSW7-F1-model_v4 deleted 0.7204 6 243

Feature Viewer

pLDDT pTM Quality
72.82 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map