F485100

General Info

Members Datasets Scaffolds Average Seq Length
899 736 367 235

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10287399|Ga0105240_102873992
Length 291
Sequence MEVCQFDVALNRRALSAKFIRLKTHMRTMRYDSIMPIPERLNPIFANSEPANLRLEQARQRLIIALDVPDAASAVALVDRLEGTCRWCKVGLELFVAAGPAIVEKLSKRGLSIFLDLKFHDIPNTVAGAVRSASALGAKMLTLHAAGGPAMLASAHDAVSQLSDPPQLLAVTVLTSMDKAQLGAVGVKREPGPQVKLLAEMGMAAGLRGFVCSPEEVAELRSLSGQEGVLVVPGIRPAGAAVGDQKRIATPASAIRDGASYLVVGRPISQASNAAAAADAIVHEIAEELSA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
10 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
11 2512875024 Mesorhizobium loti R88b Isolate Nodule
12 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
13 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
14 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
15 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
16 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
17 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
18 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
19 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
20 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
21 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
22 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
23 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
24 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
25 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
26 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
27 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
28 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
29 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
30 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
31 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
32 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
33 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
34 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
35 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
36 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
37 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
38 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
39 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
40 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
41 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
42 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
43 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
44 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
45 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
46 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
47 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
48 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
49 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
50 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
51 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
52 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
53 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
54 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
55 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
56 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
57 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
58 2643221599 Rhizobium sp. Root708 Isolate Unclassified
59 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
60 2643221626 Ensifer sp. Root31 Isolate Unclassified
61 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
62 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
63 2643221655 Ensifer sp. Root1252 Isolate Unclassified
64 2643221659 Ensifer sp. Root127 Isolate Unclassified
65 2643221698 Ensifer sp. Root142 Isolate Unclassified
66 2643221712 Ensifer sp. Root258 Isolate Unclassified
67 2643221723 Ensifer sp. Root278 Isolate Unclassified
68 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
69 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
70 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
71 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
72 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
73 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
74 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
75 2738543024 Aminobacter sp. AP02 Isolate Unclassified
76 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
77 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
78 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
79 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
80 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
81 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
82 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
83 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
84 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
85 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
86 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
87 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
88 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
89 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
90 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
91 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
92 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
93 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
94 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
95 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
96 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
97 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
98 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
99 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
100 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
101 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
102 2844163670 Ensifer sp. 1H6 Isolate Unclassified
103 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
104 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
105 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
106 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
107 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
108 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
109 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
110 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
111 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
112 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
113 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
114 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
115 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
116 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
117 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
118 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
119 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
120 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
121 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
122 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
123 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
124 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
125 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
126 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
127 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
128 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
129 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
130 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
131 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
132 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
133 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
134 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
135 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
136 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
137 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
138 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
139 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
140 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
141 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
142 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
143 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
144 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
145 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
146 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
147 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
148 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
149 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
150 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
151 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
152 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
153 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
154 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
155 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
156 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
157 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
158 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
159 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
160 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
161 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
162 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
163 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
164 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
165 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
166 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
167 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
168 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
169 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
170 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
171 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
172 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
173 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
174 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
175 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
176 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
177 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
178 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
179 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
180 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
181 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
182 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
183 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
184 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
185 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
186 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
187 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
188 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
189 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
190 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
191 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
192 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
193 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
194 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
195 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
196 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
197 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
198 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
199 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
200 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
201 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
202 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
203 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
204 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
205 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
206 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
207 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
208 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
209 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
210 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
211 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
212 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
213 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
214 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
215 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
216 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
217 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
218 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
219 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
220 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
221 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
222 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
223 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
224 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
225 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
226 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
227 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
228 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
229 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
230 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
231 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
232 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
233 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
234 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
235 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
236 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
237 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
238 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
239 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
240 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
241 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
242 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
243 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
244 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
245 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
246 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
247 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
248 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
249 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
250 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
251 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
252 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
253 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
254 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
255 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
256 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
257 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
258 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
259 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
260 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
261 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
262 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
263 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
264 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
265 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
266 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
267 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
268 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
269 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
270 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
271 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
272 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
273 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
274 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
275 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
276 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
277 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
278 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
279 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
280 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
281 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
282 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
283 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
284 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
285 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
286 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
287 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
288 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
289 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
290 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
291 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
292 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
293 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
294 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
295 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
296 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
297 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
298 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
299 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
300 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
301 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
302 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
303 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
304 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
305 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
306 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
307 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
308 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
309 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
310 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
311 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
312 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
313 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
314 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
315 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
316 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
317 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
318 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
319 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
320 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
321 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
322 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
323 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
324 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
325 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
326 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
327 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
328 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
329 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
330 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
331 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
332 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
333 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
334 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
335 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
336 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
337 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
338 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
339 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
340 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
341 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
342 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
343 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
344 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
345 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
346 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
347 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
348 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
349 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
350 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
351 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
352 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
353 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
354 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
355 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
356 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
357 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
358 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
359 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
360 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
361 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
362 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
363 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
364 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
365 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
366 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
367 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
368 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
369 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
370 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
371 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
372 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
373 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
374 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
375 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
376 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
377 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
378 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
379 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
380 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
381 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
382 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
383 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
384 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
385 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
386 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
387 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
388 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
389 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
390 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
391 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
392 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
393 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
394 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
395 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
396 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
397 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
398 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
399 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
400 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
401 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
402 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
403 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
404 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
405 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
406 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
407 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
408 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
409 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
410 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
411 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
412 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
413 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
414 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
415 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
416 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
417 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
418 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
419 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
420 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
421 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
422 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
423 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
424 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
425 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
426 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
427 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
428 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
429 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
430 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
431 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
432 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
433 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
434 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
435 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
436 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
437 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
438 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
439 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
440 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
441 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
442 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
443 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
444 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
445 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
446 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
447 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
448 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
449 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
450 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
451 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
452 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
453 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
454 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
455 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
456 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
457 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
458 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
459 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
460 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
461 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
462 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
463 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
464 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
465 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
466 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
467 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
468 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
469 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
470 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
471 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
472 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
473 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
474 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
475 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
476 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
477 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
478 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
479 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
480 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
481 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
482 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
483 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
484 2996887358 Rhizobium sp. R711 Isolate Nodule
485 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
486 3004167301 Mesorhizobium loti 582 Isolate Unclassified
487 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
488 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
489 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
490 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
491 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
492 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
493 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
494 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
495 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
496 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
497 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
498 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
499 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
500 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
501 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
502 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
503 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
504 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
505 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
506 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
507 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
508 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
509 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
510 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
511 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
512 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
513 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
514 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
515 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
516 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
517 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
518 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
519 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
520 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
521 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
522 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
523 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
524 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
525 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
526 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
527 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
528 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
529 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
530 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
531 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
532 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
533 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
534 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
535 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
536 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
537 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
538 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
539 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
540 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
541 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
542 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
543 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
544 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
545 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
546 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
547 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
548 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
549 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
550 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
551 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
552 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
553 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
554 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
555 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
556 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
557 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
558 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
559 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
560 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
561 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
562 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
563 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
564 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
565 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
566 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
567 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
568 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
569 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
570 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
571 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
572 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
573 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
574 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
575 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
576 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
577 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
578 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
579 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
580 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
581 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
582 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
583 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
584 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
585 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
586 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
587 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
588 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
589 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
590 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
591 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
605 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
606 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
608 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
609 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
610 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
611 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
612 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
614 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
615 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
616 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
617 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
618 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
619 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
620 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
621 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
622 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
623 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
624 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
625 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
626 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
627 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
628 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
629 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
630 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
631 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
632 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
633 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
634 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
635 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
636 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
637 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
638 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
639 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
640 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
641 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
642 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
643 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
644 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
645 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
646 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
647 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
648 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
649 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
650 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
651 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
652 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
653 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
654 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
655 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
656 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
657 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
658 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
659 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
660 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
661 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
662 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
663 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
664 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
665 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
666 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
667 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
668 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
669 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
670 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
671 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
672 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
673 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
674 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
675 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
676 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
677 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
678 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
679 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
680 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
681 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
682 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
683 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
684 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
685 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
686 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
687 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
688 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
689 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
690 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
691 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
692 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
693 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
694 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
695 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
696 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
697 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
698 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
699 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
700 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
701 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
702 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
703 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
704 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
705 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
706 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
707 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
708 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
709 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
710 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
711 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
712 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
713 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
714 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
715 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
716 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
717 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
718 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
719 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
720 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
721 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
722 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
723 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
724 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
725 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
726 8005321885 Rhizobium sp. R72 Isolate Nodule
727 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
728 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
729 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
730 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
731 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
732 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
733 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
734 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
735 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
736 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.71
Metatranscriptomes 0.11
Isolates 59.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.46
Nodule 51.06
Rhizoplane 1.11
Rhizosphere 28.92
Stem 0
Stem Tuber 0
Unclassified 8.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000120 3300000546 Bacteria 12289
2 JGI24740J21852_10003637 3300001979 Bacteria 6723
3 JGI24739J22299_10028216 3300001989 Bacteria 1958
4 JGI24735J21928_10019579 3300002067 Bacteria 2079
5 JGI25156J39149_1013450 3300002705 Bacteria 1734
6 JGI25162J39368_1000244 3300002737 Bacteria 54424
7 JGI25162J39368_1000493 3300002737 Bacteria 29984
8 JGI25158J39367_1000756 3300002739 Bacteria 6197
9 JGI25157J39369_1000555 3300002741 Bacteria 22318
10 JGI25152J39213_1004107 3300002773 Bacteria 4706
11 JGI25159J45721_1000015 3300002987 Bacteria 142431
12 JGI25159J45721_1000338 3300002987 Bacteria 21677
13 JGI25151J46595_10033099 3300003187 Bacteria 1996
14 JGI25406J46586_10006406 3300003203 Bacteria 5426
15 JGI25165J46597_1000079 3300003214 Bacteria 179163
16 JGI25165J46597_1000553 3300003214 Bacteria 34037
17 JGI25165J46597_1000796 3300003214 Bacteria 23932
18 rootH2_10027501 3300003320 Bacteria 5291
19 rootH1_10271729 3300003323 Bacteria 1405
20 JGI25160J50197_1000003 3300003354 Bacteria 482719
21 JGI25160J50197_1000012 3300003354 Bacteria 267582
22 JGI25161J50226_1000002 3300003374 Bacteria 420324
23 JGI25161J50226_1000219 3300003374 Bacteria 35426
24 Ga0055542_1000618 3300003762 Bacteria 30135
25 Ga0055542_1001408 3300003762 Bacteria 12130
26 Ga0055529_1003209 3300003763 Bacteria 2793
27 Ga0055526_1003824 3300003771 Bacteria 9358
28 Ga0055536_1005156 3300003781 Bacteria 6460
29 Ga0055528_1021666 3300003790 Bacteria 2029
30 Ga0055540_1008648 3300003792 Bacteria 3639
31 Ga0055531_10011294 3300003794 Bacteria 4327
32 Ga0055543_1000011 3300004625 Bacteria 196089
33 Ga0055543_1000034 3300004625 Bacteria 128668
34 Ga0065165_1000025 3300005262 Bacteria 246909
35 Ga0065165_1000082 3300005262 Bacteria 158536
36 Ga0070658_10085777 3300005327 Bacteria 2590
37 Ga0070660_100079572 3300005339 Bacteria 2571
38 Ga0070660_100209391 3300005339 Bacteria 1582
39 Ga0070668_100006252 3300005347 Bacteria 8821
40 Ga0070671_100130795 3300005355 Bacteria 2114
41 Ga0070663_100068052 3300005455 Bacteria 2585
42 Ga0068853_100328096 3300005539 Bacteria 1420
43 Ga0070665_100028010 3300005548 Bacteria 5675
44 Ga0070665_100052306 3300005548 Bacteria 4097
45 Ga0070665_100079272 3300005548 Bacteria 3290
46 Ga0070665_100112308 3300005548 Bacteria 2727
47 Ga0070665_100270158 3300005548 Bacteria 1702
48 Ga0070665_100303155 3300005548 Bacteria 1600
49 Ga0070665_100628597 3300005548 Bacteria 1087
50 Ga0068855_100008160 3300005563 Bacteria 12659
51 Ga0068855_100310359 3300005563 Bacteria 1745
52 Ga0068855_100463947 3300005563 Bacteria 1381
53 Ga0068857_100206963 3300005577 Bacteria 1790
54 Ga0068854_100100728 3300005578 Bacteria 2166
55 Ga0068856_100976370 3300005614 Bacteria 865
56 Ga0068852_100191337 3300005616 Bacteria 1931
57 Ga0081540_1009710 3300005983 Bacteria 6604
58 Ga0081539_10002395 3300005985 Bacteria 26644
59 Ga0075365_10014555 3300006038 Bacteria 4736
60 Ga0075365_10154229 3300006038 Bacteria 1598
61 Ga0075365_10180082 3300006038 Bacteria 1477
62 Ga0075368_10016651 3300006042 Bacteria 2741
63 Ga0075364_10270979 3300006051 Bacteria 1155
64 Ga0075362_10034225 3300006177 Bacteria 2213
65 Ga0075367_10002953 3300006178 Bacteria 7945
66 Ga0075367_10099335 3300006178 Bacteria 1778
67 Ga0075367_10299299 3300006178 Bacteria 1012
68 Ga0075367_10371192 3300006178 Bacteria 904
69 Ga0075370_10147872 3300006353 Bacteria 1376
70 Ga0075370_10294165 3300006353 Bacteria 965
71 Ga0068871_100538950 3300006358 Bacteria 1056
72 Ga0079104_1002459 3300006946 Bacteria 9964
73 Ga0079104_1006003 3300006946 Bacteria 4704
74 Ga0105251_10009293 3300009011 Bacteria 5819
75 Ga0105240_10249534 3300009093 Bacteria 2053
76 Ga0105240_10287399 3300009093 Bacteria 1887
77 Ga0105247_10172516 3300009101 Bacteria 1439
78 Ga0105248_10012216 3300009177 Bacteria 9469
79 Ga0105237_10038673 3300009545 Bacteria 4817
80 Ga0105237_10540323 3300009545 Bacteria 1172
81 Ga0105237_10851545 3300009545 Bacteria 918
82 Ga0105238_10040306 3300009551 Bacteria 4733
83 Ga0105239_10127612 3300010375 Bacteria 2828
84 Ga0157370_10064885 3300013104 Bacteria 3455
85 Ga0157370_10593368 3300013104 Bacteria 1014
86 Ga0157369_10006251 3300013105 Bacteria 13822
87 Ga0157369_10021348 3300013105 Bacteria 7241
88 Ga0157369_10059190 3300013105 Bacteria 4131
89 Ga0157374_10014300 3300013296 Bacteria 6945
90 Ga0157372_10022080 3300013307 Bacteria 6883
91 Ga0157372_10356875 3300013307 Bacteria 1703
92 Ga0163163_10029885 3300014325 Bacteria 5244
93 Ga0163163_10220505 3300014325 Bacteria 1945
94 Ga0182008_10042226 3300014497 Bacteria 2272
95 Ga0157376_10037849 3300014969 Bacteria 3921
96 Ga0182006_1047427 3300015261 Bacteria 1665
97 Ga0182007_10004110 3300015262 Bacteria 6690
98 Ga0182005_1007445 3300015265 Bacteria 3283
99 Ga0228711_1003057 3300022739 Bacteria 25943
100 Ga0228710_1000004 3300022740 Bacteria 250560
101 Ga0209760_101730 3300025207 Bacteria 2200
102 Ga0209436_100767 3300025208 Bacteria 13307
103 Ga0209436_115828 3300025208 Bacteria 1151
104 Ga0209563_105661 3300025230 Bacteria 2234
105 Ga0209437_100050 3300025233 Bacteria 394010
106 Ga0209437_100056 3300025233 Bacteria 363071
107 Ga0209437_107127 3300025233 Bacteria 1833
108 Ga0207425_1014638 3300025245 Bacteria 1777
109 Ga0209026_1000118 3300025250 Bacteria 130611
110 Ga0209677_102979 3300025253 Bacteria 5879
111 Ga0209148_1000212 3300025254 Bacteria 101454
112 Ga0209148_1005894 3300025254 Bacteria 2729
113 Ga0209759_1000076 3300025256 Bacteria 175911
114 Ga0209129_1001420 3300025258 Bacteria 13383
115 Ga0209233_1000037 3300025261 Bacteria 554620
116 Ga0209233_1000071 3300025261 Bacteria 363290
117 Ga0209233_1000236 3300025261 Bacteria 92446
118 Ga0209233_1000247 3300025261 Bacteria 87890
119 Ga0209233_1009599 3300025261 Bacteria 2938
120 Ga0209233_1019681 3300025261 Bacteria 1788
121 Ga0209455_1000170 3300025272 Bacteria 110681
122 Ga0209455_1021969 3300025272 Bacteria 1226
123 Ga0209673_1006659 3300025273 Bacteria 5518
124 Ga0209130_1000005 3300025284 Bacteria 599620
125 Ga0209130_1000028 3300025284 Bacteria 325668
126 Ga0209676_1003201 3300025292 Bacteria 10368
127 Ga0209025_1000105 3300025294 Bacteria 224157
128 Ga0209025_1040299 3300025294 Bacteria 2023
129 Ga0209564_1000113 3300025295 Bacteria 211564
130 Ga0209564_1009543 3300025295 Bacteria 4601
131 Ga0209758_1015666 3300025297 Bacteria 3908
132 Ga0209050_1000773 3300025298 Bacteria 45942
133 Ga0209256_1004283 3300025299 Bacteria 9094
134 Ga0209256_1019044 3300025299 Bacteria 2202
135 Ga0207426_1000012 3300025302 Bacteria 730942
136 Ga0207426_1000015 3300025302 Bacteria 599316
137 Ga0207426_1003762 3300025302 Bacteria 7907
138 Ga0207426_1022640 3300025302 Bacteria 2153
139 Ga0209051_1003420 3300025303 Bacteria 10421
140 Ga0209257_1002062 3300025304 Bacteria 21252
141 Ga0207713_1052608 3300025735 Bacteria 1610
142 Ga0207647_10009305 3300025904 Bacteria 6984
143 Ga0207647_10039889 3300025904 Bacteria 2960
144 Ga0207705_10010808 3300025909 Bacteria 6627
145 Ga0207705_10112997 3300025909 Bacteria 2008
146 Ga0207705_10426788 3300025909 Bacteria 1027
147 Ga0207654_10390094 3300025911 Bacteria 966
148 Ga0207695_10235536 3300025913 Bacteria 1733
149 Ga0207695_10309487 3300025913 Bacteria 1470
150 Ga0207695_10364520 3300025913 Bacteria 1331
151 Ga0207695_10461299 3300025913 Bacteria 1153
152 Ga0207671_10119104 3300025914 Bacteria 2017
153 Ga0207671_10618974 3300025914 Bacteria 863
154 Ga0207657_10056625 3300025919 Bacteria 3381
155 Ga0207649_10106102 3300025920 Bacteria 1868
156 Ga0207694_10008166 3300025924 Bacteria 7909
157 Ga0207659_10173312 3300025926 Bacteria 1703
158 Ga0207711_10095829 3300025941 Bacteria 2618
159 Ga0207711_10182891 3300025941 Bacteria 1907
160 Ga0207667_10012351 3300025949 Bacteria 9847
161 Ga0207668_10039475 3300025972 Bacteria 3178
162 Ga0207640_10039683 3300025981 Bacteria 2982
163 Ga0207639_10149943 3300026041 Bacteria 1952
164 Ga0207678_10036692 3300026067 Bacteria 4267
165 Ga0207702_10071810 3300026078 Bacteria 2982
166 Ga0207674_10033322 3300026116 Bacteria 5394
167 Ga0207674_10684775 3300026116 Bacteria 990
168 Ga0209281_1000134 3300027111 Bacteria 185406
169 Ga0209281_1000445 3300027111 Bacteria 59209
170 Ga0209371_1004523 3300027312 Bacteria 5986
171 Ga0209282_1000029 3300027666 Bacteria 157883
172 Ga0268266_10002316 3300028379 Bacteria 20650
173 Ga0268266_10005331 3300028379 Bacteria 12041
174 Ga0268266_10012715 3300028379 Bacteria 7274
175 Ga0268266_10018558 3300028379 Bacteria 5928
176 Ga0268266_10022478 3300028379 Bacteria 5374
177 Ga0268266_10279701 3300028379 Bacteria 1551
178 Ga0268266_10684560 3300028379 Bacteria 988
179 Ga0265338_10234800 3300028800 Bacteria 1362
180 Ga0268256_1003507 3300030500 Bacteria 7043
181 Ga0265339_10030630 3300031249 Bacteria 3046
182 Ga0265316_10052088 3300031344 Bacteria 3212
183 Ga0307513_10104308 3300031456 Bacteria 2849
184 Ga0307408_100296053 3300031548 Bacteria 1353
185 Ga0307405_10379387 3300031731 Bacteria 1100
186 Ga0307413_10193624 3300031824 Bacteria 1462
187 Ga0307406_10520473 3300031901 Bacteria 968
188 Ga0307407_10305387 3300031903 Bacteria 1111
189 Ga0307412_10308405 3300031911 Bacteria 1254
190 Ga0315914_1000004 3300031967 Bacteria 288534
191 Ga0307416_100824385 3300032002 Bacteria 1025
192 Ga0307416_101006405 3300032002 Bacteria 936
193 Ga0307414_10591751 3300032004 Bacteria 994
194 Ga0315913_1000370 3300033430 Bacteria 38384
195 Ga0315915_1000003 3300033464 Bacteria 407996
196 Ga0373926_0084441 3300035083 Bacteria 1177
197 Ga0373927_0000144 3300035695 Bacteria 55726
198 Ga0373947_0100887 3300035725 Bacteria 1814
199 Ga0316582_0067401 3300036647 Bacteria 2309
200 Ga0316582_0296719 3300036647 Bacteria 1110
201 Ga0373925_0000481 3300037068 Bacteria 39959
202 Ga0395900_0246407 3300037418 Bacteria 1790
203 Ga0395900_0253816 3300037418 Bacteria 1759
204 Ga0395905_0069723 3300037471 Bacteria 3293
205 Ga0395905_0103827 3300037471 Bacteria 2668
206 Ga0395905_0401077 3300037471 Bacteria 1266
207 Ga0395905_0642189 3300037471 Bacteria 963
208 Ga0395901_0062742 3300038443 Bacteria 3867
209 Ga0395901_0090720 3300038443 Bacteria 3199
210 Ga0395901_0279437 3300038443 Bacteria 1735
211 Ga0466972_0082084 3300044658 Bacteria 1534
212 Ga0466965_0215208 3300044683 Bacteria 1023
213 Ga0466958_0020303 3300045836 Bacteria 3873
214 Ga0495638_0002052 3300046460 Bacteria 17104
215 Ga0495650_0003032 3300046471 Bacteria 12678
216 Ga0495585_0019476 3300046492 Bacteria 3912
217 Ga0495606_0206785 3300046507 Bacteria 1115
218 Ga0495643_0025307 3300046522 Bacteria 3359
219 Ga0495645_0024585 3300046543 Bacteria 4372
220 Ga0495625_0000182 3300046660 Bacteria 98244
221 Ga0495625_0005589 3300046660 Bacteria 11404
222 Ga0495625_0025984 3300046660 Bacteria 4430
223 Ga0495625_0041200 3300046660 Bacteria 3363
224 Ga0495660_0159642 3300046810 Bacteria 1107
225 Ga0495672_0067521 3300047320 Bacteria 2036
226 Ga0495687_063021 3300047443 Bacteria 1520
227 Ga0495681_0094339 3300047470 Bacteria 1317
228 Ga0495686_0005687 3300047472 Bacteria 9748
229 Ga0495615_0103679 3300048090 Bacteria 806
230 Ga0496102_0373845 3300048905 Bacteria 1341
231 Ga0496104_0245332 3300048907 Bacteria 1704
232 Ga0496108_0099977 3300048911 Bacteria 2473
233 Ga0496112_0073729 3300048915 Bacteria 3374
234 Ga0496112_0243971 3300048915 Bacteria 1748
235 Ga0496113_0224774 3300048916 Bacteria 1496
236 Ga0496115_0090073 3300048918 Bacteria 2506
237 Ga0496116_0014048 3300048919 Bacteria 6414
238 Ga0496116_0145175 3300048919 Bacteria 1327
239 Ga0496119_0016320 3300048922 Bacteria 5659
240 Ga0496120_0002072 3300048923 Bacteria 21552
241 Ga0496120_0023868 3300048923 Bacteria 3822
242 Ga0496122_0082939 3300048925 Bacteria 2225
243 Ga0496123_0029128 3300048926 Bacteria 4075
244 Ga0496124_0166319 3300048927 Bacteria 1714
245 Ga0496125_0075313 3300048928 Bacteria 2613
246 Ga0496125_0208006 3300048928 Bacteria 1274
247 Ga0496126_0003783 3300048929 Bacteria 18780
248 Ga0496126_0155177 3300048929 Bacteria 1960
249 Ga0501031_0000002 3300049568 Bacteria 217588
250 Ga0501031_0010981 3300049568 Bacteria 5901
251 Ga0501031_0032232 3300049568 Bacteria 3417
252 Ga0501031_0175768 3300049568 Bacteria 1399
253 Ga0501031_0259214 3300049568 Bacteria 1130
254 Ga0501032_0000004 3300049569 Bacteria 310855
255 Ga0501032_0001866 3300049569 Bacteria 16660
256 Ga0501032_0051201 3300049569 Bacteria 2785
257 Ga0501033_0000016 3300049570 Bacteria 217458
258 Ga0501033_0000182 3300049570 Bacteria 60298
259 Ga0501033_0000818 3300049570 Bacteria 28395
260 Ga0501033_0009577 3300049570 Bacteria 7452
261 Ga0501033_0022586 3300049570 Bacteria 4746
262 Ga0501033_0042065 3300049570 Bacteria 3407
263 Ga0501033_0133254 3300049570 Bacteria 1799
264 Ga0501033_0282180 3300049570 Bacteria 1172
265 Ga0501034_0000011 3300049571 Bacteria 310855
266 Ga0501034_0001712 3300049571 Bacteria 28224
267 Ga0501034_0007755 3300049571 Bacteria 11413
268 Ga0501034_0158900 3300049571 Bacteria 2233
269 Ga0501036_0000001 3300049572 Bacteria 310855
270 Ga0501036_0006422 3300049572 Bacteria 9544
271 Ga0501036_0030701 3300049572 Bacteria 4539
272 Ga0501036_0185647 3300049572 Bacteria 1750
273 Ga0501036_0278911 3300049572 Bacteria 1399
274 Ga0501036_0467918 3300049572 Bacteria 1050
275 Ga0501036_0477232 3300049572 Bacteria 1038
276 Ga0501037_0000006 3300049573 Bacteria 217461
277 Ga0501037_0000142 3300049573 Bacteria 66550
278 Ga0501038_0000003 3300049574 Bacteria 310855
279 Ga0501038_0000979 3300049574 Bacteria 25625
280 Ga0501038_0071504 3300049574 Bacteria 2943
281 Ga0501038_0148296 3300049574 Bacteria 1914
282 Ga0501038_0252505 3300049574 Bacteria 1396
283 Ga0501039_0000004 3300049575 Bacteria 310855
284 Ga0501039_0070449 3300049575 Bacteria 2716
285 Ga0501039_0605123 3300049575 Bacteria 859
286 Ga0501040_0004502 3300049576 Bacteria 9045
287 Ga0501042_0068089 3300049578 Bacteria 2545
288 Ga0501043_0000066 3300049579 Bacteria 93258
289 Ga0501043_0000588 3300049579 Bacteria 32210
290 Ga0501043_0009297 3300049579 Bacteria 7723
291 Ga0501043_0332533 3300049579 Bacteria 1157
292 Ga0501046_0015684 3300049580 Bacteria 6360
293 Ga0501046_0096005 3300049580 Bacteria 2277
294 Ga0501047_0011488 3300049581 Bacteria 8382
295 Ga0501047_0024880 3300049581 Bacteria 5749
296 Ga0501047_0030377 3300049581 Bacteria 5209
297 Ga0501047_0075152 3300049581 Bacteria 3251
298 Ga0501047_0167104 3300049581 Bacteria 2070
299 Ga0501047_0423512 3300049581 Bacteria 1162
300 Ga0501048_0005100 3300049582 Bacteria 10007
301 Ga0501067_0029599 3300049583 Bacteria 3035
302 Ga0501067_0074703 3300049583 Bacteria 1878
303 Ga0501068_0005415 3300049584 Bacteria 6984
304 Ga0501068_0014507 3300049584 Bacteria 4505
305 Ga0501068_0113680 3300049584 Bacteria 1685
306 Ga0501069_0000002 3300049585 Bacteria 269636
307 Ga0501069_0008770 3300049585 Bacteria 5324
308 Ga0501069_0048007 3300049585 Bacteria 2370
309 Ga0501069_0106949 3300049585 Bacteria 1591
310 Ga0501070_0000051 3300049586 Bacteria 101897
311 Ga0501070_0002384 3300049586 Bacteria 16474
312 Ga0501070_0004526 3300049586 Bacteria 11930
313 Ga0501070_0006025 3300049586 Bacteria 10327
314 Ga0501070_0016663 3300049586 Bacteria 6172
315 Ga0501071_0085231 3300049587 Bacteria 2316
316 Ga0501071_0106162 3300049587 Bacteria 2074
317 Ga0501073_0006953 3300049589 Bacteria 8425
318 Ga0501073_0010824 3300049589 Bacteria 6680
319 Ga0501074_0001350 3300049590 Bacteria 16259
320 Ga0501074_0227658 3300049590 Bacteria 1327
321 Ga0501080_0001856 3300049742 Bacteria 18153
322 Ga0501080_0007434 3300049742 Bacteria 9889
323 Ga0501080_0042886 3300049742 Bacteria 4212
324 Ga0501080_0236362 3300049742 Bacteria 1669
325 Ga0501083_0000187 3300049744 Bacteria 39905
326 Ga0501083_0033156 3300049744 Bacteria 3538
327 Ga0501083_0110715 3300049744 Bacteria 1806
328 Ga0501035_0000009 3300049822 Bacteria 310827
329 Ga0501035_0002215 3300049822 Bacteria 19311
330 Ga0501035_0002554 3300049822 Bacteria 17805
331 Ga0501035_0002576 3300049822 Bacteria 17719
332 Ga0501035_0003955 3300049822 Bacteria 14136
333 Ga0501035_0007237 3300049822 Bacteria 10383
334 Ga0501035_0019856 3300049822 Bacteria 6172
335 Ga0501035_0045873 3300049822 Bacteria 3931
336 Ga0501035_0216599 3300049822 Bacteria 1636
337 Ga0501035_0369045 3300049822 Bacteria 1198
338 Ga0501035_0558194 3300049822 Bacteria 937
339 Ga0501044_0000005 3300049823 Bacteria 310855
340 Ga0501044_0000923 3300049823 Bacteria 35383
341 Ga0501044_0007678 3300049823 Bacteria 11859
342 Ga0501044_0010931 3300049823 Bacteria 9853
343 Ga0501044_0017045 3300049823 Bacteria 7795
344 Ga0501044_0029897 3300049823 Bacteria 5744
345 Ga0501044_0157203 3300049823 Bacteria 2252
346 Ga0501044_0517847 3300049823 Bacteria 1093
347 Ga0501045_0015261 3300049824 Bacteria 5452
348 nmdc:mga03683_7962_c1 3300050489 Bacteria 3705
349 nmdc:mga03n38_49596_c1 3300050490 Bacteria 1867
350 nmdc:mga03n38_7203_c1 3300050490 Bacteria 3921
351 nmdc:mga00v17_115493_c1 3300050491 Bacteria 1706
352 nmdc:mga00v17_12374_c1 3300050491 Bacteria 4707
353 nmdc:mga0yw44_149407_c1 3300050492 Bacteria 1523
354 nmdc:mga0yw44_76772_c1 3300050492 Bacteria 2086
355 nmdc:mga0k408_388348_c1 3300050493 Bacteria 831
356 nmdc:mga0sz30_50634_c1 3300050516 Bacteria 1761
357 nmdc:mga0sz30_57025_c1 3300050516 Bacteria 1664
358 Ga0495612_0085143 3300053078 Bacteria 1332
359 Ga0500559_0001518 3300053136 Bacteria 13013
360 Ga0500568_0000010 3300053139 Bacteria 249043
361 Ga0500604_0038969 3300053151 Bacteria 1427
362 Ga0500616_0070377 3300053153 Bacteria 1786
363 Ga0500616_0216385 3300053153 Bacteria 838
364 Ga0500620_001452 3300053155 Bacteria 4384
365 Ga0500627_0210728 3300053158 Bacteria 869
366 Ga0500611_004053 3300053727 Bacteria 1940
367 Ga0587083_0014694 3300059505 Bacteria 1353

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053078 Ga0495612_0085143 Ga0495612_0085143_668_1315 211
2 3300006038 Ga0075365_10154229 Ga0075365_101542293 216
3 3300050492 nmdc:mga0yw44_149407_c1 nmdc:mga0yw44_149407_c1_751_1464 216
4 3300002739 JGI25158J39367_1000756 JGI25158J39367_10007565 217
5 3300002987 JGI25159J45721_1000015 JGI25159J45721_100001545 217
6 3300003187 JGI25151J46595_10033099 JGI25151J46595_100330991 217
7 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003139 217
8 3300003374 JGI25161J50226_1000219 JGI25161J50226_100021921 217
9 3300003771 Ga0055526_1003824 Ga0055526_10038244 217
10 3300003781 Ga0055536_1005156 Ga0055536_10051563 217
11 3300003794 Ga0055531_10011294 Ga0055531_100112945 217
12 3300004625 Ga0055543_1000034 Ga0055543_100003415 217
13 3300005262 Ga0065165_1000025 Ga0065165_1000025193 217
14 3300025208 Ga0209436_100767 Ga0209436_1007677 217
15 3300025245 Ga0207425_1014638 Ga0207425_10146383 217
16 3300025284 Ga0209130_1000005 Ga0209130_1000005342 217
17 3300025292 Ga0209676_1003201 Ga0209676_100320110 217
18 3300025294 Ga0209025_1000105 Ga0209025_100010575 217
19 3300025295 Ga0209564_1000113 Ga0209564_100011330 217
20 3300025298 Ga0209050_1000773 Ga0209050_10007737 217
21 3300025299 Ga0209256_1004283 Ga0209256_100428310 217
22 3300025302 Ga0207426_1000015 Ga0207426_1000015257 217
23 3300025304 Ga0209257_1002062 Ga0209257_100206210 217
24 3300049568 Ga0501031_0000002 Ga0501031_0000002_124491_125189 221
25 3300049570 Ga0501033_0000016 Ga0501033_0000016_124363_125061 221
26 3300049573 Ga0501037_0000006 Ga0501037_0000006_124330_125028 221
27 3300049579 Ga0501043_0000588 Ga0501043_0000588_26127_26825 221
28 3300049580 Ga0501046_0096005 Ga0501046_0096005_833_1531 221
29 3300049581 Ga0501047_0011488 Ga0501047_0011488_4916_5614 221
30 3300049822 Ga0501035_0000009 Ga0501035_0000009_217696_218394 221
31 iso_pu_bacteria 2693429783 2694627774 222
32 iso_pu_bacteria 2693429784 2694636047 222
33 iso_pu_bacteria 2693429784 2694636888 222
34 iso_pu_bacteria 2856320880 2856323815 222
35 iso_pu_bacteria 2869278585 2869284786 222
36 iso_pu_bacteria 2874139085 2874142893 222
37 iso_pu_bacteria 2874168670 2874172496 222
38 iso_pu_bacteria 2876392853 2876396982 222
39 iso_pu_bacteria 2878738818 2878741037 222
40 iso_pu_bacteria 2881161766 2881165039 222
41 iso_pu_bacteria 2888350351 2888353129 222
42 iso_pu_bacteria 2889010040 2889014975 222
43 iso_pu_bacteria 2889016732 2889019955 222
44 iso_pu_bacteria 2906354277 2906355873 222
45 iso_pu_bacteria 2922130491 2922134635 222
46 iso_pu_bacteria 2922185730 2922188853 222
47 iso_pu_bacteria 2924718760 2924720569 222
48 iso_pu_bacteria 2924776078 2924778638 222
49 iso_pu_bacteria 2937972304 2937974305 222
50 iso_pu_bacteria 2996336353 2996341488 222
51 iso_pu_bacteria 3004268573 3004271818 222
52 3300031731 Ga0307405_10379387 Ga0307405_103793872 223
53 3300031824 Ga0307413_10193624 Ga0307413_101936241 223
54 3300031901 Ga0307406_10520473 Ga0307406_105204732 223
55 iso_pu_bacteria 2551306089 2551709248 223
56 3300025261 Ga0209233_1009599 Ga0209233_10095992 224
57 3300037471 Ga0395905_0642189 Ga0395905_0642189_23_706 224
58 3300049571 Ga0501034_0007755 Ga0501034_0007755_2841_3608 224
59 3300049581 Ga0501047_0423512 Ga0501047_0423512_16_783 224
60 3300005548 Ga0070665_100028010 Ga0070665_1000280104 225
61 3300028379 Ga0268266_10018558 Ga0268266_100185585 225
62 iso_pu_bacteria 2510917022 2511137143 225
63 iso_pu_bacteria 2513237144 2513911075 225
64 iso_pu_bacteria 2513237146 2513924407 225
65 iso_pu_bacteria 2524023209 2524458030 225
66 iso_pu_bacteria 2582581307 2585273604 225
67 iso_pu_bacteria 2582581315 2585326311 225
68 iso_pu_bacteria 2582581316 2585330477 225
69 iso_pu_bacteria 2585427527 2585533831 225
70 iso_pu_bacteria 2585427530 2585553424 225
71 iso_pu_bacteria 2585427531 2585559777 225
72 iso_pu_bacteria 2585427608 2585900465 225
73 iso_pu_bacteria 2585427609 2585906043 225
74 iso_pu_bacteria 2585428125 2587978842 225
75 iso_pu_bacteria 2599185170 2599419634 225
76 iso_pu_bacteria 2615840698 2616556220 225
77 iso_pu_bacteria 2617270742 2617380582 225
78 iso_pu_bacteria 2667528174 2671113994 225
79 iso_pu_bacteria 2738541317 2738947736 225
80 iso_pu_bacteria 2775507266 2778173839 225
81 iso_pu_bacteria 2818991448 2819608735 225
82 iso_pu_bacteria 2818991453 2819640844 225
83 iso_pu_bacteria 2838029111 2838029626 225
84 iso_pu_bacteria 2838035591 2838039834 225
85 iso_pu_bacteria 2842298080 2842299788 225
86 iso_pu_bacteria 2842357229 2842359690 225
87 iso_pu_bacteria 2842475841 2842475944 225
88 iso_pu_bacteria 2842482326 2842486027 225
89 iso_pu_bacteria 2842502639 2842503154 225
90 iso_pu_bacteria 2842509118 2842513022 225
91 iso_pu_bacteria 2913308742 2913311610 225
92 iso_pu_bacteria 2919408235 2919408464 225
93 iso_pu_bacteria 3005409236 3005410736 225
94 iso_pu_bacteria 3005416602 3005423150 225
95 iso_pu_bacteria 8005314921 8005315477 225
96 iso_pu_bacteria 8005484373 8005484615 225
97 iso_pu_bacteria 8005645114 8005649308 225
98 iso_pu_bacteria 8005658619 8005661606 225
99 iso_pu_bacteria 8005682033 8005685455 225
100 iso_pu_bacteria 8046767195 8046769623 225
101 iso_pu_bacteria 8057575449 8057580338 225
102 3300049569 Ga0501032_0000004 Ga0501032_0000004_92386_93132 226
103 3300049571 Ga0501034_0000011 Ga0501034_0000011_92386_93132 226
104 3300049572 Ga0501036_0000001 Ga0501036_0000001_92386_93132 226
105 3300049574 Ga0501038_0000003 Ga0501038_0000003_92386_93132 226
106 3300049575 Ga0501039_0000004 Ga0501039_0000004_92386_93132 226
107 3300049576 Ga0501040_0004502 Ga0501040_0004502_3354_4100 226
108 3300049583 Ga0501067_0029599 Ga0501067_0029599_425_1108 226
109 3300049583 Ga0501067_0074703 Ga0501067_0074703_233_916 226
110 3300049586 Ga0501070_0006025 Ga0501070_0006025_4560_5306 226
111 3300049744 Ga0501083_0110715 Ga0501083_0110715_963_1646 226
112 3300049822 Ga0501035_0216599 Ga0501035_0216599_786_1469 226
113 3300049823 Ga0501044_0000005 Ga0501044_0000005_92386_93132 226
114 3300053153 Ga0500616_0070377 Ga0500616_0070377_266_949 226
115 3300053153 Ga0500616_0216385 Ga0500616_0216385_17_715 226
116 iso_pu_bacteria 2513237138 2513870246 226
117 iso_pu_bacteria 2534681796 2535514690 226
118 iso_pu_bacteria 2582581867 2585398968 226
119 iso_pu_bacteria 2585427590 2585818911 226
120 iso_pu_bacteria 2643221599 2644004532 226
121 iso_pu_bacteria 2643221634 2644196955 226
122 iso_pu_bacteria 2923556063 2923556304 226
123 iso_pu_bacteria 2996887358 2996888092 226
124 iso_pu_bacteria 3000135777 3000137400 226
125 iso_pu_bacteria 3005452660 3005456484 226
126 iso_pu_bacteria 8005321885 8005322619 226
127 iso_pu_bacteria 8005542996 8005543358 226
128 3300005983 Ga0081540_1009710 Ga0081540_10097104 227
129 3300046460 Ga0495638_0002052 Ga0495638_0002052_7910_8617 227
130 iso_pu_bacteria 2509276018 2509368776 227
131 iso_pu_bacteria 2512875026 2512973105 227
132 iso_pu_bacteria 2513237089 2513604314 227
133 iso_pu_bacteria 2513237160 2514008172 227
134 iso_pu_bacteria 2517487022 2517571895 227
135 iso_pu_bacteria 2582581283 2585164521 227
136 iso_pu_bacteria 2582581865 2585386114 227
137 iso_pu_bacteria 2643221623 2644134020 227
138 iso_pu_bacteria 2687453392 2688596031 227
139 iso_pu_bacteria 2738543024 2739309892 227
140 iso_pu_bacteria 2775506902 2776269449 227
141 iso_pu_bacteria 2775506904 2776282379 227
142 iso_pu_bacteria 2802428858 2802718672 227
143 iso_pu_bacteria 2802428859 2802724352 227
144 iso_pu_bacteria 2802428860 2802729986 227
145 iso_pu_bacteria 2802428861 2802737329 227
146 iso_pu_bacteria 2802428862 2802742245 227
147 iso_pu_bacteria 2802428863 2802748927 227
148 iso_pu_bacteria 2844002411 2844003406 227
149 iso_pu_bacteria 2856328259 2856332484 227
150 iso_pu_bacteria 2856334872 2856337387 227
151 iso_pu_bacteria 2857367948 2857370485 227
152 iso_pu_bacteria 2869249662 2869252877 227
153 iso_pu_bacteria 2869264136 2869267939 227
154 iso_pu_bacteria 2869271264 2869272818 227
155 iso_pu_bacteria 2871459585 2871462355 227
156 iso_pu_bacteria 2871466892 2871471713 227
157 iso_pu_bacteria 2874131515 2874131936 227
158 iso_pu_bacteria 2874162495 2874165960 227
159 iso_pu_bacteria 2876399893 2876400159 227
160 iso_pu_bacteria 2876406927 2876413444 227
161 iso_pu_bacteria 2878774303 2878777743 227
162 iso_pu_bacteria 2878781027 2878785704 227
163 iso_pu_bacteria 2881147464 2881148256 227
164 iso_pu_bacteria 2888337043 2888343352 227
165 iso_pu_bacteria 2906363423 2906367797 227
166 iso_pu_bacteria 2906370794 2906371268 227
167 iso_pu_bacteria 2906378014 2906382012 227
168 iso_pu_bacteria 2906386501 2906390073 227
169 iso_pu_bacteria 2906393657 2906399367 227
170 iso_pu_bacteria 2906408224 2906413864 227
171 iso_pu_bacteria 2915980308 2915986596 227
172 iso_pu_bacteria 2916061851 2916065888 227
173 iso_pu_bacteria 2921250672 2921254873 227
174 iso_pu_bacteria 2922151315 2922157629 227
175 iso_pu_bacteria 2922172374 2922175649 227
176 iso_pu_bacteria 2922178524 2922183223 227
177 iso_pu_bacteria 2924710171 2924710593 227
178 iso_pu_bacteria 2924748358 2924752954 227
179 iso_pu_bacteria 2937029754 2937033613 227
180 iso_pu_bacteria 2937036028 2937040351 227
181 iso_pu_bacteria 2937078374 2937082702 227
182 iso_pu_bacteria 2937084907 2937088639 227
183 iso_pu_bacteria 2937868953 2937870478 227
184 iso_pu_bacteria 2957375807 2957377919 227
185 iso_pu_bacteria 2957437181 2957437540 227
186 iso_pu_bacteria 2958122699 2958123987 227
187 iso_pu_bacteria 2958137437 2958141397 227
188 iso_pu_bacteria 2958158011 2958164386 227
189 iso_pu_bacteria 2960591022 2960593265 227
190 iso_pu_bacteria 2960631154 2960637051 227
191 iso_pu_bacteria 2960680706 2960685247 227
192 iso_pu_bacteria 2960693952 2960697376 227
193 iso_pu_bacteria 2961136820 2961139603 227
194 iso_pu_bacteria 2965025482 2965029932 227
195 iso_pu_bacteria 2965032056 2965035993 227
196 iso_pu_bacteria 2965040258 2965044239 227
197 iso_pu_bacteria 2965047637 2965052391 227
198 iso_pu_bacteria 2965089291 2965094816 227
199 iso_pu_bacteria 2965102966 2965105261 227
200 iso_pu_bacteria 2965110997 2965115722 227
201 iso_pu_bacteria 2967686174 2967689917 227
202 iso_pu_bacteria 2967728569 2967732787 227
203 iso_pu_bacteria 2970026789 2970031055 227
204 iso_pu_bacteria 2970122695 2970128607 227
205 iso_pu_bacteria 2970143518 2970149322 227
206 iso_pu_bacteria 2970547951 2970553232 227
207 iso_pu_bacteria 2977530762 2977530996 227
208 iso_pu_bacteria 2977544691 2977548645 227
209 iso_pu_bacteria 2977872689 2977875957 227
210 iso_pu_bacteria 2977915119 2977920181 227
211 iso_pu_bacteria 2977935797 2977941145 227
212 iso_pu_bacteria 2977950692 2977952899 227
213 iso_pu_bacteria 2977957713 2977962248 227
214 iso_pu_bacteria 2979793036 2979794125 227
215 iso_pu_bacteria 2987645492 2987650523 227
216 iso_pu_bacteria 2987673487 2987678534 227
217 iso_pu_bacteria 2996310559 2996311558 227
218 iso_pu_bacteria 3004195979 3004202459 227
219 iso_pu_bacteria 3004239961 3004240854 227
220 iso_pu_bacteria 649633066 649870598 227
221 iso_pu_bacteria 8003999396 8004003566 227
222 iso_pu_bacteria 8004300914 8004306371 227
223 iso_pu_bacteria 8004361976 8004363092 227
224 iso_pu_bacteria 8004695233 8004699362 227
225 3300006042 Ga0075368_10016651 Ga0075368_100166513 228
226 3300025926 Ga0207659_10173312 Ga0207659_101733122 228
227 3300032004 Ga0307414_10591751 Ga0307414_105917511 228
228 3300044683 Ga0466965_0215208 Ga0466965_0215208_37_726 228
229 3300050489 nmdc:mga03683_7962_c1 nmdc:mga03683_7962_c1_986_1690 228
230 3300050490 nmdc:mga03n38_7203_c1 nmdc:mga03n38_7203_c1_2786_3490 228
231 iso_pu_bacteria 2643221550 2643773368 228
232 iso_pu_bacteria 2643221564 2643839500 228
233 iso_pu_bacteria 2841734538 2841736421 228
234 iso_pu_bacteria 2847686936 2847689996 228
235 iso_pu_bacteria 2856342000 2856347486 228
236 iso_pu_bacteria 2856349417 2856350804 228
237 iso_pu_bacteria 2856356410 2856358208 228
238 iso_pu_bacteria 2871474448 2871477215 228
239 iso_pu_bacteria 2871488783 2871489792 228
240 iso_pu_bacteria 2874102143 2874107208 228
241 iso_pu_bacteria 2874123672 2874128388 228
242 iso_pu_bacteria 2874146452 2874153937 228
243 iso_pu_bacteria 2878753008 2878754172 228
244 iso_pu_bacteria 2878788777 2878788966 228
245 iso_pu_bacteria 2881155292 2881159339 228
246 iso_pu_bacteria 2881845957 2881847566 228
247 iso_pu_bacteria 2881853255 2881855859 228
248 iso_pu_bacteria 2881861095 2881864554 228
249 iso_pu_bacteria 2882912400 2882915899 228
250 iso_pu_bacteria 2885305155 2885306907 228
251 iso_pu_bacteria 2885312484 2885314086 228
252 iso_pu_bacteria 2885318864 2885320096 228
253 iso_pu_bacteria 2885334103 2885335464 228
254 iso_pu_bacteria 2885342637 2885344996 228
255 iso_pu_bacteria 2885350715 2885352925 228
256 iso_pu_bacteria 2888343758 2888344425 228
257 iso_pu_bacteria 2903492973 2903497513 228
258 iso_pu_bacteria 2906328253 2906334142 228
259 iso_pu_bacteria 2922158528 2922162016 228
260 iso_pu_bacteria 2924726620 2924731419 228
261 iso_pu_bacteria 2924754689 2924760814 228
262 iso_pu_bacteria 2924784321 2924784860 228
263 iso_pu_bacteria 2937891427 2937892671 228
264 iso_pu_bacteria 2958115193 2958119124 228
265 iso_pu_bacteria 2961127735 2961129713 228
266 iso_pu_bacteria 2965062239 2965064143 228
267 iso_pu_bacteria 2967996073 2967996855 228
268 iso_pu_bacteria 2968003550 2968004918 228
269 iso_pu_bacteria 2968091066 2968093553 228
270 iso_pu_bacteria 2968097103 2968101402 228
271 iso_pu_bacteria 2968128360 2968134018 228
272 iso_pu_bacteria 2970503327 2970508901 228
273 iso_pu_bacteria 2977828996 2977835456 228
274 iso_pu_bacteria 2977858184 2977864191 228
275 iso_pu_bacteria 2979779861 2979786418 228
276 iso_pu_bacteria 2996341866 2996341921 228
277 iso_pu_bacteria 8002285264 8002286423 228
278 iso_pu_bacteria 8004445564 8004449476 228
279 iso_pu_bacteria 8004703790 8004706707 228
280 3300001979 JGI24740J21852_10003637 JGI24740J21852_100036379 229
281 3300002737 JGI25162J39368_1000244 JGI25162J39368_100024419 229
282 3300002737 JGI25162J39368_1000493 JGI25162J39368_100049323 229
283 3300002773 JGI25152J39213_1004107 JGI25152J39213_10041073 229
284 3300002987 JGI25159J45721_1000338 JGI25159J45721_100033820 229
285 3300003214 JGI25165J46597_1000553 JGI25165J46597_100055319 229
286 3300003214 JGI25165J46597_1000796 JGI25165J46597_100079626 229
287 3300003320 rootH2_10027501 rootH2_100275015 229
288 3300003323 rootH1_10271729 rootH1_102717292 229
289 3300003354 JGI25160J50197_1000012 JGI25160J50197_1000012178 229
290 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002330 229
291 3300003790 Ga0055528_1021666 Ga0055528_10216663 229
292 3300004625 Ga0055543_1000011 Ga0055543_100001183 229
293 3300005262 Ga0065165_1000082 Ga0065165_100008247 229
294 3300005339 Ga0070660_100079572 Ga0070660_1000795722 229
295 3300005347 Ga0070668_100006252 Ga0070668_1000062528 229
296 3300006353 Ga0075370_10147872 Ga0075370_101478722 229
297 3300009011 Ga0105251_10009293 Ga0105251_100092935 229
298 3300010375 Ga0105239_10127612 Ga0105239_101276124 229
299 3300015262 Ga0182007_10004110 Ga0182007_100041103 229
300 3300015265 Ga0182005_1007445 Ga0182005_10074455 229
301 3300025207 Ga0209760_101730 Ga0209760_1017303 229
302 3300025208 Ga0209436_115828 Ga0209436_1158281 229
303 3300025233 Ga0209437_100050 Ga0209437_100050213 229
304 3300025233 Ga0209437_100056 Ga0209437_100056302 229
305 3300025253 Ga0209677_102979 Ga0209677_1029797 229
306 3300025258 Ga0209129_1001420 Ga0209129_10014208 229
307 3300025261 Ga0209233_1000037 Ga0209233_1000037255 229
308 3300025261 Ga0209233_1000071 Ga0209233_1000071302 229
309 3300025261 Ga0209233_1000236 Ga0209233_100023659 229
310 3300025272 Ga0209455_1021969 Ga0209455_10219692 229
311 3300025273 Ga0209673_1006659 Ga0209673_10066597 229
312 3300025284 Ga0209130_1000028 Ga0209130_1000028120 229
313 3300025295 Ga0209564_1009543 Ga0209564_10095436 229
314 3300025299 Ga0209256_1019044 Ga0209256_10190443 229
315 3300025302 Ga0207426_1000012 Ga0207426_1000012461 229
316 3300025302 Ga0207426_1003762 Ga0207426_10037623 229
317 3300025735 Ga0207713_1052608 Ga0207713_10526082 229
318 3300025972 Ga0207668_10039475 Ga0207668_100394752 229
319 3300027312 Ga0209371_1004523 Ga0209371_10045236 229
320 3300028379 Ga0268266_10022478 Ga0268266_100224787 229
321 3300030500 Ga0268256_1003507 Ga0268256_10035074 229
322 3300031456 Ga0307513_10104308 Ga0307513_101043083 229
323 3300032002 Ga0307416_100824385 Ga0307416_1008243852 229
324 3300035083 Ga0373926_0084441 Ga0373926_0084441_86_778 229
325 3300035695 Ga0373927_0000144 Ga0373927_0000144_14160_14852 229
326 3300035725 Ga0373947_0100887 Ga0373947_0100887_728_1420 229
327 3300037068 Ga0373925_0000481 Ga0373925_0000481_4161_4853 229
328 3300046660 Ga0495625_0005589 Ga0495625_0005589_471_1172 229
329 3300046810 Ga0495660_0159642 Ga0495660_0159642_119_820 229
330 3300048905 Ga0496102_0373845 Ga0496102_0373845_85_783 229
331 3300048919 Ga0496116_0014048 Ga0496116_0014048_3972_4664 229
332 3300048919 Ga0496116_0145175 Ga0496116_0145175_593_1285 229
333 3300048925 Ga0496122_0082939 Ga0496122_0082939_497_1189 229
334 3300048926 Ga0496123_0029128 Ga0496123_0029128_1126_1818 229
335 3300048928 Ga0496125_0075313 Ga0496125_0075313_208_900 229
336 3300049568 Ga0501031_0010981 Ga0501031_0010981_4796_5494 229
337 3300049568 Ga0501031_0259214 Ga0501031_0259214_172_873 229
338 3300049570 Ga0501033_0009577 Ga0501033_0009577_3285_3983 229
339 3300049570 Ga0501033_0042065 Ga0501033_0042065_1283_1984 229
340 3300049571 Ga0501034_0001712 Ga0501034_0001712_6481_7179 229
341 3300049572 Ga0501036_0006422 Ga0501036_0006422_3581_4279 229
342 3300049572 Ga0501036_0467918 Ga0501036_0467918_208_909 229
343 3300049574 Ga0501038_0000979 Ga0501038_0000979_3340_4038 229
344 3300049574 Ga0501038_0148296 Ga0501038_0148296_321_1022 229
345 3300049575 Ga0501039_0070449 Ga0501039_0070449_977_1675 229
346 3300049578 Ga0501042_0068089 Ga0501042_0068089_407_1105 229
347 3300049580 Ga0501046_0015684 Ga0501046_0015684_4832_5530 229
348 3300049581 Ga0501047_0030377 Ga0501047_0030377_1042_1740 229
349 3300049582 Ga0501048_0005100 Ga0501048_0005100_5240_5938 229
350 3300049584 Ga0501068_0005415 Ga0501068_0005415_3039_3737 229
351 3300049585 Ga0501069_0106949 Ga0501069_0106949_691_1389 229
352 3300049586 Ga0501070_0004526 Ga0501070_0004526_4155_4853 229
353 3300049589 Ga0501073_0006953 Ga0501073_0006953_3991_4689 229
354 3300049590 Ga0501074_0227658 Ga0501074_0227658_173_871 229
355 3300049742 Ga0501080_0007434 Ga0501080_0007434_3709_4407 229
356 3300049822 Ga0501035_0007237 Ga0501035_0007237_2584_3282 229
357 3300049822 Ga0501035_0369045 Ga0501035_0369045_310_1011 229
358 3300049823 Ga0501044_0000923 Ga0501044_0000923_3285_3983 229
359 3300049823 Ga0501044_0157203 Ga0501044_0157203_668_1369 229
360 3300049824 Ga0501045_0015261 Ga0501045_0015261_4729_5427 229
361 3300053136 Ga0500559_0001518 Ga0500559_0001518_10385_11077 229
362 3300053151 Ga0500604_0038969 Ga0500604_0038969_694_1395 229
363 3300053158 Ga0500627_0210728 Ga0500627_0210728_34_735 229
364 3300053727 Ga0500611_004053 Ga0500611_004053_16_717 229
365 3300059505 Ga0587083_0014694 Ga0587083_0014694_586_1278 229
366 iso_pu_bacteria 2510065057 2510308163 229
367 iso_pu_bacteria 2511231052 2511498942 229
368 iso_pu_bacteria 2513237086 2513587210 229
369 iso_pu_bacteria 2513237091 2513616200 229
370 iso_pu_bacteria 2513237140 2513882647 229
371 iso_pu_bacteria 2513237143 2513904630 229
372 iso_pu_bacteria 2516653046 2516895218 229
373 iso_pu_bacteria 2551306084 2551675220 229
374 iso_pu_bacteria 2551306085 2551686967 229
375 iso_pu_bacteria 2551306093 2551743146 229
376 iso_pu_bacteria 2599185352 2600197546 229
377 iso_pu_bacteria 2643221626 2644144561 229
378 iso_pu_bacteria 2643221655 2644306612 229
379 iso_pu_bacteria 2643221659 2644330802 229
380 iso_pu_bacteria 2643221698 2644542392 229
381 iso_pu_bacteria 2643221712 2644612223 229
382 iso_pu_bacteria 2643221723 2644671579 229
383 iso_pu_bacteria 2690316117 2692317657 229
384 iso_pu_bacteria 2791355082 2792583338 229
385 iso_pu_bacteria 2844163670 2844170042 229
386 iso_pu_bacteria 2847417321 2847421363 229
387 iso_pu_bacteria 2847670302 2847673487 229
388 iso_pu_bacteria 2855825444 2855827856 229
389 iso_pu_bacteria 2855839649 2855843224 229
390 iso_pu_bacteria 2856314179 2856319044 229
391 iso_pu_bacteria 2856364286 2856369813 229
392 iso_pu_bacteria 2857349434 2857352991 229
393 iso_pu_bacteria 2858800743 2858802952 229
394 iso_pu_bacteria 2869162929 2869166073 229
395 iso_pu_bacteria 2869285874 2869290620 229
396 iso_pu_bacteria 2871429161 2871432902 229
397 iso_pu_bacteria 2874155637 2874158625 229
398 iso_pu_bacteria 2876377896 2876379261 229
399 iso_pu_bacteria 2876413966 2876419242 229
400 iso_pu_bacteria 2878035449 2878039433 229
401 iso_pu_bacteria 2878745973 2878750515 229
402 iso_pu_bacteria 2903492973 2903499639 229
403 iso_pu_bacteria 2906308376 2906313440 229
404 iso_pu_bacteria 2906321335 2906326149 229
405 iso_pu_bacteria 2906414383 2906419115 229
406 iso_pu_bacteria 2915986958 2915993660 229
407 iso_pu_bacteria 2915993759 2915994196 229
408 iso_pu_bacteria 2916000859 2916004902 229
409 iso_pu_bacteria 2916007675 2916008305 229
410 iso_pu_bacteria 2916014648 2916015124 229
411 iso_pu_bacteria 2916021584 2916026181 229
412 iso_pu_bacteria 2916028427 2916035163 229
413 iso_pu_bacteria 2916035215 2916041532 229
414 iso_pu_bacteria 2916041962 2916047426 229
415 iso_pu_bacteria 2916048683 2916054837 229
416 iso_pu_bacteria 2916055098 2916058943 229
417 iso_pu_bacteria 2916068649 2916071699 229
418 iso_pu_bacteria 2916076590 2916077278 229
419 iso_pu_bacteria 2921201388 2921202469 229
420 iso_pu_bacteria 2921208531 2921209226 229
421 iso_pu_bacteria 2921237296 2921237611 229
422 iso_pu_bacteria 2921244191 2921249756 229
423 iso_pu_bacteria 2921257292 2921263866 229
424 iso_pu_bacteria 2921263974 2921270529 229
425 iso_pu_bacteria 2921282425 2921283121 229
426 iso_pu_bacteria 2921289301 2921290001 229
427 iso_pu_bacteria 2921296804 2921301751 229
428 iso_pu_bacteria 2924144063 2924146146 229
429 iso_pu_bacteria 2924150972 2924158219 229
430 iso_pu_bacteria 2924158325 2924164548 229
431 iso_pu_bacteria 2924165586 2924171361 229
432 iso_pu_bacteria 2924172951 2924179621 229
433 iso_pu_bacteria 2924179722 2924180045 229
434 iso_pu_bacteria 2924186466 2924186811 229
435 iso_pu_bacteria 2924193448 2924200286 229
436 iso_pu_bacteria 2924200457 2924202603 229
437 iso_pu_bacteria 2924207177 2924209452 229
438 iso_pu_bacteria 2924214083 2924216663 229
439 iso_pu_bacteria 2924221636 2924227049 229
440 iso_pu_bacteria 2924228884 2924234751 229
441 iso_pu_bacteria 2937002841 2937006328 229
442 iso_pu_bacteria 2937009748 2937011686 229
443 iso_pu_bacteria 2937016420 2937018392 229
444 iso_pu_bacteria 2937023124 2937025734 229
445 iso_pu_bacteria 2937042894 2937044593 229
446 iso_pu_bacteria 2937049772 2937055983 229
447 iso_pu_bacteria 2937056579 2937057231 229
448 iso_pu_bacteria 2937063883 2937069957 229
449 iso_pu_bacteria 2937071275 2937078325 229
450 iso_pu_bacteria 2937091812 2937092589 229
451 iso_pu_bacteria 2937098957 2937106313 229
452 iso_pu_bacteria 2937106411 2937108289 229
453 iso_pu_bacteria 2937113482 2937118678 229
454 iso_pu_bacteria 2937119839 2937121877 229
455 iso_pu_bacteria 2937126314 2937129665 229
456 iso_pu_bacteria 2957382221 2957384337 229
457 iso_pu_bacteria 2957388812 2957393787 229
458 iso_pu_bacteria 2957395598 2957396037 229
459 iso_pu_bacteria 2957402308 2957405590 229
460 iso_pu_bacteria 2957408893 2957413517 229
461 iso_pu_bacteria 2957415311 2957422284 229
462 iso_pu_bacteria 2957422303 2957425509 229
463 iso_pu_bacteria 2957430029 2957434343 229
464 iso_pu_bacteria 2957443900 2957450150 229
465 iso_pu_bacteria 2957450854 2957452830 229
466 iso_pu_bacteria 2957457609 2957458223 229
467 iso_pu_bacteria 2957464669 2957466299 229
468 iso_pu_bacteria 2957471148 2957474681 229
469 iso_pu_bacteria 2957478035 2957484092 229
470 iso_pu_bacteria 2957484790 2957485215 229
471 iso_pu_bacteria 2957491536 2957493785 229
472 iso_pu_bacteria 2957498199 2957499264 229
473 iso_pu_bacteria 2957505466 2957506017 229
474 iso_pu_bacteria 2960584000 2960584622 229
475 iso_pu_bacteria 2960597568 2960603178 229
476 iso_pu_bacteria 2960603979 2960609368 229
477 iso_pu_bacteria 2960610863 2960615337 229
478 iso_pu_bacteria 2960617483 2960623249 229
479 iso_pu_bacteria 2960624210 2960624825 229
480 iso_pu_bacteria 2960637947 2960638877 229
481 iso_pu_bacteria 2960645483 2960650944 229
482 iso_pu_bacteria 2960652885 2960659365 229
483 iso_pu_bacteria 2960660292 2960666939 229
484 iso_pu_bacteria 2960667422 2960670179 229
485 iso_pu_bacteria 2960674078 2960679550 229
486 iso_pu_bacteria 2960687367 2960693656 229
487 iso_pu_bacteria 2964607997 2964611556 229
488 iso_pu_bacteria 2964615318 2964621555 229
489 iso_pu_bacteria 2964621998 2964622459 229
490 iso_pu_bacteria 2964628898 2964634249 229
491 iso_pu_bacteria 2964636051 2964641419 229
492 iso_pu_bacteria 2964643177 2964644966 229
493 iso_pu_bacteria 2964649959 2964655945 229
494 iso_pu_bacteria 2964656573 2964657017 229
495 iso_pu_bacteria 2964663802 2964670343 229
496 iso_pu_bacteria 2964670856 2964672389 229
497 iso_pu_bacteria 2964678106 2964684543 229
498 iso_pu_bacteria 2964685014 2964685342 229
499 iso_pu_bacteria 2964691889 2964692384 229
500 iso_pu_bacteria 2964698721 2964705397 229
501 iso_pu_bacteria 2964705432 2964708965 229
502 iso_pu_bacteria 2964712639 2964713027 229
503 iso_pu_bacteria 2964719344 2964720285 229
504 iso_pu_bacteria 2967664464 2967665783 229
505 iso_pu_bacteria 2967671571 2967671968 229
506 iso_pu_bacteria 2967678726 2967679120 229
507 iso_pu_bacteria 2967693043 2967695287 229
508 iso_pu_bacteria 2967699805 2967701129 229
509 iso_pu_bacteria 2967706974 2967707694 229
510 iso_pu_bacteria 2967714385 2967720682 229
511 iso_pu_bacteria 2967721400 2967728489 229
512 iso_pu_bacteria 2967735183 2967741114 229
513 iso_pu_bacteria 2967742019 2967742370 229
514 iso_pu_bacteria 2967748971 2967749591 229
515 iso_pu_bacteria 2967755722 2967761949 229
516 iso_pu_bacteria 2967762386 2967768680 229
517 iso_pu_bacteria 2967769361 2967771404 229
518 iso_pu_bacteria 2967775926 2967776559 229
519 iso_pu_bacteria 2970019648 2970020055 229
520 iso_pu_bacteria 2970040964 2970046858 229
521 iso_pu_bacteria 2970047711 2970051846 229
522 iso_pu_bacteria 2970054988 2970060402 229
523 iso_pu_bacteria 2970061556 2970062071 229
524 iso_pu_bacteria 2970076120 2970082276 229
525 iso_pu_bacteria 2970082768 2970087991 229
526 iso_pu_bacteria 2970088815 2970091653 229
527 iso_pu_bacteria 2970095765 2970102493 229
528 iso_pu_bacteria 2970102677 2970108312 229
529 iso_pu_bacteria 2970109326 2970113543 229
530 iso_pu_bacteria 2970116247 2970121994 229
531 iso_pu_bacteria 2970129317 2970135415 229
532 iso_pu_bacteria 2970136068 2970137819 229
533 iso_pu_bacteria 2970149975 2970153611 229
534 iso_pu_bacteria 2970156795 2970157884 229
535 iso_pu_bacteria 2970164137 2970169670 229
536 iso_pu_bacteria 2970170962 2970174044 229
537 iso_pu_bacteria 2970177841 2970182451 229
538 iso_pu_bacteria 2970184632 2970187008 229
539 iso_pu_bacteria 2970191845 2970198645 229
540 iso_pu_bacteria 2977516862 2977517458 229
541 iso_pu_bacteria 2977523885 2977530351 229
542 iso_pu_bacteria 2977537788 2977538610 229
543 iso_pu_bacteria 2977551784 2977554209 229
544 iso_pu_bacteria 2977558990 2977565326 229
545 iso_pu_bacteria 2977565890 2977569975 229
546 iso_pu_bacteria 2977572785 2977579425 229
547 iso_pu_bacteria 2977579622 2977584028 229
548 iso_pu_bacteria 648276728 648736679 229
549 iso_pu_bacteria 8003992118 8003995806 229
550 iso_pu_bacteria 8018150411 8018152823 229
551 iso_pu_bacteria 8049293176 8049296693 229
552 3300003792 Ga0055540_1008648 Ga0055540_10086483 230
553 3300005614 Ga0068856_100976370 Ga0068856_1009763701 230
554 3300006178 Ga0075367_10002953 Ga0075367_1000295310 230
555 3300006178 Ga0075367_10299299 Ga0075367_102992992 230
556 3300006353 Ga0075370_10294165 Ga0075370_102941652 230
557 3300006946 Ga0079104_1006003 Ga0079104_10060033 230
558 3300009545 Ga0105237_10038673 Ga0105237_100386734 230
559 3300009551 Ga0105238_10040306 Ga0105238_100403065 230
560 3300013104 Ga0157370_10593368 Ga0157370_105933682 230
561 3300022739 Ga0228711_1003057 Ga0228711_100305712 230
562 3300022740 Ga0228710_1000004 Ga0228710_10000048 230
563 3300025230 Ga0209563_105661 Ga0209563_1056613 230
564 3300025294 Ga0209025_1040299 Ga0209025_10402993 230
565 3300025297 Ga0209758_1015666 Ga0209758_10156665 230
566 3300025303 Ga0209051_1003420 Ga0209051_10034209 230
567 3300025914 Ga0207671_10618974 Ga0207671_106189741 230
568 3300026116 Ga0207674_10684775 Ga0207674_106847752 230
569 3300027111 Ga0209281_1000134 Ga0209281_100013456 230
570 3300027666 Ga0209282_1000029 Ga0209282_100002924 230
571 3300031967 Ga0315914_1000004 Ga0315914_100000413 230
572 3300033430 Ga0315913_1000370 Ga0315913_100037024 230
573 3300033464 Ga0315915_1000003 Ga0315915_1000003120 230
574 3300037418 Ga0395900_0246407 Ga0395900_0246407_257_967 230
575 3300037418 Ga0395900_0253816 Ga0395900_0253816_933_1640 230
576 3300037471 Ga0395905_0401077 Ga0395905_0401077_25_732 230
577 3300038443 Ga0395901_0062742 Ga0395901_0062742_1401_2126 230
578 3300038443 Ga0395901_0279437 Ga0395901_0279437_338_1048 230
579 3300046492 Ga0495585_0019476 Ga0495585_0019476_2444_3139 230
580 3300046660 Ga0495625_0025984 Ga0495625_0025984_511_1209 230
581 3300046660 Ga0495625_0041200 Ga0495625_0041200_2266_2961 230
582 3300048923 Ga0496120_0002072 Ga0496120_0002072_3618_4325 230
583 3300049568 Ga0501031_0032232 Ga0501031_0032232_1203_1907 230
584 3300049568 Ga0501031_0175768 Ga0501031_0175768_675_1379 230
585 3300049569 Ga0501032_0001866 Ga0501032_0001866_4596_5300 230
586 3300049569 Ga0501032_0051201 Ga0501032_0051201_1547_2251 230
587 3300049570 Ga0501033_0000182 Ga0501033_0000182_28787_29485 230
588 3300049570 Ga0501033_0000818 Ga0501033_0000818_15792_16496 230
589 3300049570 Ga0501033_0133254 Ga0501033_0133254_89_793 230
590 3300049570 Ga0501033_0282180 Ga0501033_0282180_362_1066 230
591 3300049571 Ga0501034_0158900 Ga0501034_0158900_1267_1971 230
592 3300049572 Ga0501036_0030701 Ga0501036_0030701_255_959 230
593 3300049572 Ga0501036_0185647 Ga0501036_0185647_748_1452 230
594 3300049572 Ga0501036_0477232 Ga0501036_0477232_202_906 230
595 3300049573 Ga0501037_0000142 Ga0501037_0000142_26656_27360 230
596 3300049574 Ga0501038_0071504 Ga0501038_0071504_264_968 230
597 3300049574 Ga0501038_0252505 Ga0501038_0252505_32_736 230
598 3300049575 Ga0501039_0605123 Ga0501039_0605123_98_802 230
599 3300049579 Ga0501043_0000066 Ga0501043_0000066_4505_5209 230
600 3300049579 Ga0501043_0332533 Ga0501043_0332533_44_748 230
601 3300049581 Ga0501047_0024880 Ga0501047_0024880_23_727 230
602 3300049581 Ga0501047_0167104 Ga0501047_0167104_608_1312 230
603 3300049584 Ga0501068_0014507 Ga0501068_0014507_398_1102 230
604 3300049584 Ga0501068_0113680 Ga0501068_0113680_930_1634 230
605 3300049585 Ga0501069_0000002 Ga0501069_0000002_87346_88050 230
606 3300049585 Ga0501069_0008770 Ga0501069_0008770_2042_2746 230
607 3300049585 Ga0501069_0048007 Ga0501069_0048007_631_1335 230
608 3300049586 Ga0501070_0000051 Ga0501070_0000051_39891_40595 230
609 3300049586 Ga0501070_0002384 Ga0501070_0002384_13320_14024 230
610 3300049587 Ga0501071_0085231 Ga0501071_0085231_795_1499 230
611 3300049587 Ga0501071_0106162 Ga0501071_0106162_890_1594 230
612 3300049589 Ga0501073_0010824 Ga0501073_0010824_788_1492 230
613 3300049590 Ga0501074_0001350 Ga0501074_0001350_4703_5407 230
614 3300049742 Ga0501080_0001856 Ga0501080_0001856_4417_5121 230
615 3300049742 Ga0501080_0236362 Ga0501080_0236362_585_1289 230
616 3300049744 Ga0501083_0000187 Ga0501083_0000187_20600_21304 230
617 3300049822 Ga0501035_0002215 Ga0501035_0002215_366_1070 230
618 3300049822 Ga0501035_0002554 Ga0501035_0002554_9843_10547 230
619 3300049822 Ga0501035_0002576 Ga0501035_0002576_8011_8709 230
620 3300049822 Ga0501035_0003955 Ga0501035_0003955_4730_5434 230
621 3300049822 Ga0501035_0019856 Ga0501035_0019856_3606_4310 230
622 3300049822 Ga0501035_0045873 Ga0501035_0045873_1311_2015 230
623 3300049822 Ga0501035_0558194 Ga0501035_0558194_103_807 230
624 3300049823 Ga0501044_0007678 Ga0501044_0007678_4703_5407 230
625 3300049823 Ga0501044_0010931 Ga0501044_0010931_3924_4628 230
626 3300049823 Ga0501044_0029897 Ga0501044_0029897_4587_5291 230
627 3300049823 Ga0501044_0517847 Ga0501044_0517847_198_902 230
628 iso_pu_bacteria 2503198000 2503198747 230
629 iso_pu_bacteria 2509276022 2509393634 230
630 iso_pu_bacteria 2515154107 2515607360 230
631 iso_pu_bacteria 2844009547 2844010844 230
632 iso_pu_bacteria 2869169390 2869170896 230
633 iso_pu_bacteria 2869234852 2869235644 230
634 iso_pu_bacteria 2869256925 2869261601 230
635 iso_pu_bacteria 2871435913 2871443221 230
636 iso_pu_bacteria 2871481445 2871484220 230
637 iso_pu_bacteria 2874109183 2874112251 230
638 iso_pu_bacteria 2874116593 2874118167 230
639 iso_pu_bacteria 2876386047 2876390969 230
640 iso_pu_bacteria 2876420981 2876427413 230
641 iso_pu_bacteria 2903513507 2903513887 230
642 iso_pu_bacteria 2904659560 2904663736 230
643 iso_pu_bacteria 2906401398 2906405153 230
644 iso_pu_bacteria 2906427513 2906432854 230
645 iso_pu_bacteria 2924741084 2924747703 230
646 iso_pu_bacteria 2936996657 2936998652 230
647 iso_pu_bacteria 2968138860 2968143086 230
648 iso_pu_bacteria 637000159 637077018 230
649 3300003203 JGI25406J46586_10006406 JGI25406J46586_100064062 231
650 3300003762 Ga0055542_1000618 Ga0055542_100061823 231
651 3300003762 Ga0055542_1001408 Ga0055542_10014085 231
652 3300003763 Ga0055529_1003209 Ga0055529_10032094 231
653 3300005563 Ga0068855_100008160 Ga0068855_10000816011 231
654 3300005985 Ga0081539_10002395 Ga0081539_100023954 231
655 3300006178 Ga0075367_10371192 Ga0075367_103711921 231
656 3300009093 Ga0105240_10249534 Ga0105240_102495341 231
657 3300013104 Ga0157370_10064885 Ga0157370_100648853 231
658 3300013105 Ga0157369_10006251 Ga0157369_100062513 231
659 3300013307 Ga0157372_10022080 Ga0157372_100220802 231
660 3300025254 Ga0209148_1000212 Ga0209148_10002127 231
661 3300025272 Ga0209455_1000170 Ga0209455_100017051 231
662 3300025909 Ga0207705_10010808 Ga0207705_100108082 231
663 3300025949 Ga0207667_10012351 Ga0207667_1001235111 231
664 3300036647 Ga0316582_0067401 Ga0316582_0067401_542_1246 231
665 3300048090 Ga0495615_0103679 Ga0495615_0103679_36_740 231
666 3300049744 Ga0501083_0033156 Ga0501083_0033156_2496_3203 231
667 3300050490 nmdc:mga03n38_49596_c1 nmdc:mga03n38_49596_c1_79_786 231
668 3300050516 nmdc:mga0sz30_57025_c1 nmdc:mga0sz30_57025_c1_139_846 231
669 iso_pu_bacteria 2871495908 2871499836 231
670 iso_pu_bacteria 2876369609 2876373106 231
671 iso_pu_bacteria 2878760144 2878764000 231
672 iso_pu_bacteria 2878767105 2878771030 231
673 iso_pu_bacteria 2903540706 2903544647 231
674 iso_pu_bacteria 2924762789 2924766119 231
675 3300005548 Ga0070665_100303155 Ga0070665_1003031553 232
676 3300006358 Ga0068871_100538950 Ga0068871_1005389502 232
677 3300006946 Ga0079104_1002459 Ga0079104_10024596 232
678 3300009101 Ga0105247_10172516 Ga0105247_101725163 232
679 3300009177 Ga0105248_10012216 Ga0105248_100122166 232
680 3300014325 Ga0163163_10220505 Ga0163163_102205052 232
681 3300014497 Ga0182008_10042226 Ga0182008_100422264 232
682 3300015261 Ga0182006_1047427 Ga0182006_10474272 232
683 3300025941 Ga0207711_10095829 Ga0207711_100958292 232
684 3300027111 Ga0209281_1000445 Ga0209281_100044534 232
685 3300028379 Ga0268266_10012715 Ga0268266_100127159 232
686 3300038443 Ga0395901_0090720 Ga0395901_0090720_2310_3020 232
687 3300046507 Ga0495606_0206785 Ga0495606_0206785_72_812 232
688 3300047443 Ga0495687_063021 Ga0495687_063021_660_1373 232
689 3300047470 Ga0495681_0094339 Ga0495681_0094339_292_1005 232
690 3300048907 Ga0496104_0245332 Ga0496104_0245332_392_1105 232
691 3300048915 Ga0496112_0073729 Ga0496112_0073729_36_749 232
692 3300048916 Ga0496113_0224774 Ga0496113_0224774_431_1144 232
693 3300050491 nmdc:mga00v17_115493_c1 nmdc:mga00v17_115493_c1_512_1225 232
694 3300050492 nmdc:mga0yw44_76772_c1 nmdc:mga0yw44_76772_c1_342_1055 232
695 3300053155 Ga0500620_001452 Ga0500620_001452_3000_3716 232
696 iso_pu_bacteria 2513237305 2514417570 232
697 iso_pu_bacteria 2882632389 2882636790 232
698 3300002705 JGI25156J39149_1013450 JGI25156J39149_10134502 233
699 3300002741 JGI25157J39369_1000555 JGI25157J39369_100055520 233
700 3300025250 Ga0209026_1000118 Ga0209026_1000118108 233
701 3300025256 Ga0209759_1000076 Ga0209759_1000076151 233
702 3300025913 Ga0207695_10461299 Ga0207695_104612992 233
703 3300031548 Ga0307408_100296053 Ga0307408_1002960532 233
704 3300031903 Ga0307407_10305387 Ga0307407_103053872 233
705 3300031911 Ga0307412_10308405 Ga0307412_103084051 233
706 3300032002 Ga0307416_101006405 Ga0307416_1010064051 233
707 3300048928 Ga0496125_0208006 Ga0496125_0208006_59_772 233
708 3300049570 Ga0501033_0022586 Ga0501033_0022586_3532_4245 233
709 3300049572 Ga0501036_0278911 Ga0501036_0278911_249_962 233
710 3300049579 Ga0501043_0009297 Ga0501043_0009297_5336_6049 233
711 3300049581 Ga0501047_0075152 Ga0501047_0075152_739_1452 233
712 3300049586 Ga0501070_0016663 Ga0501070_0016663_5179_5892 233
713 3300049742 Ga0501080_0042886 Ga0501080_0042886_469_1182 233
714 3300049823 Ga0501044_0017045 Ga0501044_0017045_3763_4476 233
715 3300050516 nmdc:mga0sz30_50634_c1 nmdc:mga0sz30_50634_c1_325_1038 233
716 3300053139 Ga0500568_0000010 Ga0500568_0000010_77600_78310 233
717 iso_pu_bacteria 2508501127 2509144411 233
718 iso_pu_bacteria 2512875024 2512962052 233
719 iso_pu_bacteria 2513237164 2514039142 233
720 iso_pu_bacteria 2524023207 2524450898 233
721 iso_pu_bacteria 2597489875 2597810709 233
722 iso_pu_bacteria 2756170246 2756675102 233
723 iso_pu_bacteria 2871451962 2871457001 233
724 iso_pu_bacteria 2924733363 2924734850 233
725 iso_pu_bacteria 2958064165 2958071194 233
726 iso_pu_bacteria 2958071322 2958077376 233
727 iso_pu_bacteria 2970524798 2970526140 233
728 iso_pu_bacteria 3004167301 3004173302 233
729 iso_pu_bacteria 8055617313 8055617952 233
730 3300001989 JGI24739J22299_10028216 JGI24739J22299_100282163 234
731 3300002067 JGI24735J21928_10019579 JGI24735J21928_100195792 234
732 3300003214 JGI25165J46597_1000079 JGI25165J46597_100007964 234
733 3300005539 Ga0068853_100328096 Ga0068853_1003280962 234
734 3300005563 Ga0068855_100463947 Ga0068855_1004639471 234
735 3300005577 Ga0068857_100206963 Ga0068857_1002069632 234
736 3300005616 Ga0068852_100191337 Ga0068852_1001913373 234
737 3300025233 Ga0209437_107127 Ga0209437_1071271 234
738 3300025261 Ga0209233_1000247 Ga0209233_100024726 234
739 3300025261 Ga0209233_1019681 Ga0209233_10196812 234
740 3300025904 Ga0207647_10009305 Ga0207647_100093058 234
741 3300025911 Ga0207654_10390094 Ga0207654_103900942 234
742 3300025913 Ga0207695_10309487 Ga0207695_103094872 234
743 3300025924 Ga0207694_10008166 Ga0207694_100081666 234
744 3300026041 Ga0207639_10149943 Ga0207639_101499432 234
745 3300026116 Ga0207674_10033322 Ga0207674_100333222 234
746 3300037471 Ga0395905_0103827 Ga0395905_0103827_1083_1844 234
747 3300044658 Ga0466972_0082084 Ga0466972_0082084_580_1341 234
748 iso_pu_bacteria 2513237090 2513610502 234
749 iso_pu_bacteria 2588253730 2588519953 234
750 iso_pu_bacteria 2599185301 2599940126 234
751 iso_pu_bacteria 2791355092 2792625275 234
752 iso_pu_bacteria 2876363079 2876363889 234
753 iso_pu_bacteria 2903448605 2903454030 234
754 iso_pu_bacteria 2903521522 2903525952 234
755 iso_pu_bacteria 2903528002 2903532502 234
756 iso_pu_bacteria 2937813078 2937820256 234
757 iso_pu_bacteria 2958041894 2958046639 234
758 iso_pu_bacteria 2958100919 2958106546 234
759 iso_pu_bacteria 2958130278 2958135020 234
760 iso_pu_bacteria 2958172287 2958177138 234
761 iso_pu_bacteria 2958179912 2958184049 234
762 iso_pu_bacteria 2961077736 2961082104 234
763 iso_pu_bacteria 2965119406 2965123609 234
764 iso_pu_bacteria 2968117919 2968122606 234
765 iso_pu_bacteria 2977843712 2977847051 234
766 iso_pu_bacteria 2977942078 2977943294 234
767 iso_pu_bacteria 2977971508 2977976220 234
768 iso_pu_bacteria 2979710463 2979710776 234
769 iso_pu_bacteria 2979742915 2979747025 234
770 iso_pu_bacteria 2987636660 2987641584 234
771 iso_pu_bacteria 2987652177 2987656327 234
772 iso_pu_bacteria 3004203850 3004209605 234
773 iso_pu_bacteria 8004387939 8004392909 234
774 iso_pu_bacteria 8004640170 8004643856 234
775 iso_pu_bacteria 8004714634 8004719696 234
776 3300047472 Ga0495686_0005687 Ga0495686_0005687_4379_5089 235
777 3300048922 Ga0496119_0016320 Ga0496119_0016320_2214_2993 235
778 3300048923 Ga0496120_0023868 Ga0496120_0023868_1718_2497 235
779 iso_pu_bacteria 2937822353 2937822696 235
780 iso_pu_bacteria 2961114664 2961119124 235
781 iso_pu_bacteria 2961170736 2961176230 235
782 iso_pu_bacteria 2968110612 2968114875 235
783 iso_pu_bacteria 2977821940 2977823387 235
784 iso_pu_bacteria 2979808191 2979813580 235
785 iso_pu_bacteria 2987666974 2987667003 235
786 iso_pu_bacteria 8004374579 8004375749 235
787 3300005563 Ga0068855_100310359 Ga0068855_1003103592 236
788 3300006038 Ga0075365_10180082 Ga0075365_101800823 236
789 3300006051 Ga0075364_10270979 Ga0075364_102709792 236
790 3300006177 Ga0075362_10034225 Ga0075362_100342253 236
791 3300009545 Ga0105237_10540323 Ga0105237_105403232 236
792 3300013105 Ga0157369_10059190 Ga0157369_100591904 236
793 3300013307 Ga0157372_10356875 Ga0157372_103568752 236
794 3300025913 Ga0207695_10364520 Ga0207695_103645202 236
795 3300026078 Ga0207702_10071810 Ga0207702_100718104 236
796 3300048918 Ga0496115_0090073 Ga0496115_0090073_628_1407 236
797 3300048929 Ga0496126_0155177 Ga0496126_0155177_991_1719 236
798 3300050493 nmdc:mga0k408_388348_c1 nmdc:mga0k408_388348_c1_46_810 236
799 iso_pu_bacteria 2643221595 2643985819 236
800 iso_pu_bacteria 2643221627 2644157121 236
801 iso_pu_bacteria 2721755686 2723573188 236
802 iso_pu_bacteria 2937861824 2937867692 236
803 iso_pu_bacteria 2937994558 2937998495 236
804 iso_pu_bacteria 2958165035 2958168971 236
805 iso_pu_bacteria 2961163497 2961167433 236
806 iso_pu_bacteria 2961183825 2961187584 236
807 iso_pu_bacteria 2965018300 2965022255 236
808 iso_pu_bacteria 2968171901 2968175840 236
809 iso_pu_bacteria 2970510686 2970517239 236
810 iso_pu_bacteria 2970532167 2970534121 236
811 iso_pu_bacteria 2970554993 2970558844 236
812 iso_pu_bacteria 2970619444 2970621582 236
813 iso_pu_bacteria 2970627176 2970630673 236
814 iso_pu_bacteria 2977851361 2977855810 236
815 iso_pu_bacteria 2977864932 2977868123 236
816 iso_pu_bacteria 2977907340 2977913185 236
817 iso_pu_bacteria 2979764755 2979765957 236
818 iso_pu_bacteria 2987659509 2987663439 236
819 iso_pu_bacteria 2996386984 2996387017 236
820 iso_pu_bacteria 3004188549 3004192498 236
821 iso_pu_bacteria 3004232784 3004233962 236
822 iso_pu_bacteria 3004248173 3004249981 236
823 iso_pu_bacteria 8004727605 8004734668 236
824 3300036647 Ga0316582_0296719 Ga0316582_0296719_348_1097 237
825 3300037471 Ga0395905_0069723 Ga0395905_0069723_1979_2707 238
826 3300005548 Ga0070665_100052306 Ga0070665_1000523063 239
827 3300025302 Ga0207426_1022640 Ga0207426_10226402 239
828 3300028379 Ga0268266_10002316 Ga0268266_100023165 239
829 3300028379 Ga0268266_10279701 Ga0268266_102797012 239
830 3300046522 Ga0495643_0025307 Ga0495643_0025307_685_1419 239
831 3300046660 Ga0495625_0000182 Ga0495625_0000182_85410_86150 239
832 iso_pu_bacteria 2510065059 2510315060 239
833 iso_pu_bacteria 2970489779 2970493686 239
834 iso_pu_bacteria 2977898635 2977899474 239
835 iso_pu_bacteria 8004312739 8004318537 239
836 3300005339 Ga0070660_100209391 Ga0070660_1002093912 240
837 3300005455 Ga0070663_100068052 Ga0070663_1000680522 240
838 3300005548 Ga0070665_100112308 Ga0070665_1001123082 240
839 3300005548 Ga0070665_100628597 Ga0070665_1006285972 240
840 3300005578 Ga0068854_100100728 Ga0068854_1001007281 240
841 3300006038 Ga0075365_10014555 Ga0075365_100145555 240
842 3300006178 Ga0075367_10099335 Ga0075367_100993352 240
843 3300025254 Ga0209148_1005894 Ga0209148_10058942 240
844 3300025909 Ga0207705_10112997 Ga0207705_101129973 240
845 3300025914 Ga0207671_10119104 Ga0207671_101191043 240
846 3300025919 Ga0207657_10056625 Ga0207657_100566254 240
847 3300025920 Ga0207649_10106102 Ga0207649_101061023 240
848 3300025981 Ga0207640_10039683 Ga0207640_100396834 240
849 3300026067 Ga0207678_10036692 Ga0207678_100366923 240
850 3300028379 Ga0268266_10005331 Ga0268266_100053315 240
851 3300046471 Ga0495650_0003032 Ga0495650_0003032_2782_3552 240
852 3300047320 Ga0495672_0067521 Ga0495672_0067521_549_1301 240
853 3300048927 Ga0496124_0166319 Ga0496124_0166319_508_1287 240
854 3300050491 nmdc:mga00v17_12374_c1 nmdc:mga00v17_12374_c1_2451_3230 240
855 iso_pu_bacteria 2508501123 2509114127 240
856 iso_pu_bacteria 2512875016 2512933855 240
857 iso_pu_bacteria 2791355123 2792747241 240
858 iso_pu_bacteria 2937848649 2937850091 240
859 iso_pu_bacteria 2937877337 2937878464 240
860 iso_pu_bacteria 2958034702 2958041359 240
861 iso_pu_bacteria 2958041894 2958042333 240
862 iso_pu_bacteria 2958084443 2958085737 240
863 iso_pu_bacteria 2958144490 2958144747 240
864 iso_pu_bacteria 2963644680 2963645347 240
865 iso_pu_bacteria 2968016561 2968022879 240
866 iso_pu_bacteria 2968083720 2968089756 240
867 iso_pu_bacteria 2970469710 2970475464 240
868 iso_pu_bacteria 2970593180 2970599397 240
869 iso_pu_bacteria 2977922695 2977924551 240
870 iso_pu_bacteria 2977986579 2977992106 240
871 iso_pu_bacteria 2996348954 2996349399 240
872 iso_pu_bacteria 3004211236 3004216956 240
873 iso_pu_bacteria 3004218560 3004225450 240
874 iso_pu_bacteria 3004275668 3004276107 240
875 iso_pu_bacteria 3004334049 3004337242 240
876 3300005327 Ga0070658_10085777 Ga0070658_100857772 241
877 3300025909 Ga0207705_10426788 Ga0207705_104267882 241
878 3300048929 Ga0496126_0003783 Ga0496126_0003783_15477_16205 242
879 3300005548 Ga0070665_100270158 Ga0070665_1002701582 243
880 3300028379 Ga0268266_10684560 Ga0268266_106845601 243
881 3300046543 Ga0495645_0024585 Ga0495645_0024585_2278_3021 243
882 3300028800 Ga0265338_10234800 Ga0265338_102348002 245
883 3300031249 Ga0265339_10030630 Ga0265339_100306304 245
884 3300031344 Ga0265316_10052088 Ga0265316_100520884 245
885 3300009093 Ga0105240_10287399 Ga0105240_102873992 247
886 3300025913 Ga0207695_10235536 Ga0207695_102355362 247
887 3300000546 LJNas_1000120 LJNas_10001203 248
888 3300005355 Ga0070671_100130795 Ga0070671_1001307951 248
889 3300005548 Ga0070665_100079272 Ga0070665_1000792723 248
890 3300009545 Ga0105237_10851545 Ga0105237_108515451 248
891 3300013105 Ga0157369_10021348 Ga0157369_100213484 248
892 3300013296 Ga0157374_10014300 Ga0157374_100143002 248
893 3300014325 Ga0163163_10029885 Ga0163163_100298853 248
894 3300014969 Ga0157376_10037849 Ga0157376_100378492 248
895 3300025904 Ga0207647_10039889 Ga0207647_100398894 248
896 3300025941 Ga0207711_10182891 Ga0207711_101828913 248
897 3300045836 Ga0466958_0020303 Ga0466958_0020303_1860_2624 248
898 3300048911 Ga0496108_0099977 Ga0496108_0099977_1289_2047 248
899 3300048915 Ga0496112_0243971 Ga0496112_0243971_213_971 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00215

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family

60

281

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dbt-assembly2.cif.gz_C-2 crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump 0.9702 17 242
1jjk-assembly1.cif.gz_A selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group 0.9604 19 241
8cso-assembly1.cif.gz_B crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate 0.9581 18 242
3ru6-assembly2.cif.gz_C 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168 0.9505 18 241
3ru6-assembly1.cif.gz_D 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168 0.9457 18 240
ID Description Score Start End Superfamily
1jjkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9476 19 241 3.20.20.70
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9457 18 240 3.20.20.70
3ru6D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9331 18 240 3.20.20.70
2yyuB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9295 18 241 3.20.20.70
1jjkA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9188 19 241 3.20.20.70
ID Description Score Start End GO Terms
AF-Q3AC06-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9825 16 243 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A7C3S5B3-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9784 15 241 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A3D1YY64-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9784 18 244 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A0F0CST2-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9772 15 242 GO:0004590
GO:0005829
GO:0006207
GO:0044205
AF-A0A2V9V226-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9767 13 241 GO:0004590
GO:0005829
GO:0006207
GO:0044205

Feature Viewer

pLDDT pTM Quality
90.58 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map