F485100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 899 | 736 | 367 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10287399|Ga0105240_102873992 |
| Length | 291 |
| Sequence | MEVCQFDVALNRRALSAKFIRLKTHMRTMRYDSIMPIPERLNPIFANSEPANLRLEQARQRLIIALDVPDAASAVALVDRLEGTCRWCKVGLELFVAAGPAIVEKLSKRGLSIFLDLKFHDIPNTVAGAVRSASALGAKMLTLHAAGGPAMLASAHDAVSQLSDPPQLLAVTVLTSMDKAQLGAVGVKREPGPQVKLLAEMGMAAGLRGFVCSPEEVAELRSLSGQEGVLVVPGIRPAGAAVGDQKRIATPASAIRDGASYLVVGRPISQASNAAAAADAIVHEIAEELSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 8 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 9 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 10 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 11 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 12 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 13 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 14 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 15 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 16 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 17 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 18 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 19 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 20 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 21 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 22 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 23 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 24 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 25 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 26 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 27 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 28 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 29 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 30 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 31 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 32 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 33 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 34 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 35 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 36 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 37 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 38 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 39 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 40 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 41 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 42 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 43 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 44 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 45 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 46 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 47 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 48 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 49 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 50 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 51 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 52 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 53 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 54 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 55 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 56 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 57 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 58 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 59 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 60 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 61 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 62 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 63 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 64 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 65 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 66 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 67 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 68 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 69 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 70 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 71 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 72 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 73 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 74 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 75 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 76 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 77 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 78 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 79 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 80 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 81 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 82 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 83 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 84 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 85 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 86 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 87 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 88 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 89 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 90 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 91 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 92 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 93 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 94 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 95 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 96 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 97 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 98 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 99 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 100 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 101 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 102 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 103 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 104 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 105 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 106 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 107 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 108 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 109 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 110 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 111 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 112 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 113 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 114 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 115 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 116 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 117 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 118 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 119 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 120 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 121 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 122 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 123 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 124 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 125 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 126 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 127 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 128 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 129 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 130 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 131 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 132 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 133 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 134 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 135 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 136 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 137 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 138 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 139 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 140 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 141 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 142 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 143 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 144 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 145 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 146 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 147 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 148 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 149 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 150 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 151 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 152 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 153 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 154 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 155 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 156 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 157 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 158 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 159 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 160 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 161 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 162 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 163 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 164 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 165 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 166 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 167 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 168 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 169 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 170 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 171 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 172 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 173 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 174 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 175 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 176 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 177 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 178 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 179 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 180 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 181 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 182 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 183 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 184 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 185 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 186 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 187 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 188 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 189 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 190 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 191 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 192 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 193 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 194 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 195 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 196 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 197 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 198 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 199 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 200 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 201 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 202 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 203 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 204 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 205 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 206 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 207 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 208 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 209 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 210 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 211 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 212 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 213 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 214 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 215 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 216 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 217 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 218 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 219 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 220 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 221 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 222 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 223 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 224 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 225 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 226 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 227 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 228 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 229 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 230 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 231 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 232 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 233 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 234 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 235 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 236 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 237 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 238 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 239 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 240 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 241 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 242 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 243 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 244 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 245 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 246 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 247 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 248 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 249 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 250 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 251 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 252 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 253 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 254 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 255 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 256 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 257 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 258 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 259 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 260 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 261 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 262 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 263 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 264 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 265 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 266 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 267 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 268 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 269 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 270 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 271 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 272 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 273 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 274 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 275 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 276 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 277 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 278 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 279 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 280 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 281 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 282 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 283 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 284 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 285 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 286 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 287 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 288 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 289 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 290 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 291 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 292 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 293 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 294 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 295 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 296 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 297 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 298 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 299 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 300 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 301 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 302 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 303 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 304 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 305 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 306 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 307 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 308 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 309 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 310 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 311 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 312 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 313 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 314 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 315 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 316 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 317 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 318 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 319 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 320 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 321 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 322 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 323 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 324 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 325 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 326 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 327 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 328 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 329 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 330 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 331 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 332 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 333 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 334 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 335 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 336 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 337 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 338 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 339 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 340 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 341 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 342 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 343 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 344 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 345 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 346 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 347 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 348 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 349 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 350 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 351 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 352 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 353 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 354 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 355 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 356 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 357 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 358 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 359 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 360 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 361 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 362 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 363 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 364 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 365 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 366 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 367 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 368 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 369 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 370 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 371 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 372 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 373 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 374 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 375 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 376 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 377 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 378 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 379 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 380 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 381 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 382 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 383 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 384 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 385 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 386 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 387 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 388 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 389 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 390 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 391 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 392 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 393 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 394 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 395 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 396 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 397 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 398 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 399 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 400 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 401 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 402 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 403 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 404 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 405 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 406 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 407 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 408 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 409 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 410 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 411 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 412 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 413 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 414 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 415 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 416 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 417 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 418 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 419 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 420 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 421 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 422 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 423 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 424 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 425 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 426 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 427 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 428 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 429 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 430 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 431 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 432 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 433 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 434 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 435 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 436 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 437 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 438 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 439 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 440 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 441 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 442 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 443 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 444 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 445 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 446 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 447 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 448 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 449 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 450 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 451 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 452 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 453 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 454 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 455 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 456 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 457 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 458 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 459 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 460 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 461 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 462 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 463 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 464 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 465 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 466 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 467 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 468 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 469 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 470 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 471 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 472 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 473 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 474 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 475 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 476 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 477 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 478 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 479 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 480 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 481 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 482 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 483 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 484 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 485 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 486 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 487 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 488 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 489 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 490 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 491 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 492 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 493 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 494 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 495 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 496 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 497 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 498 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 499 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 500 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 501 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 502 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 503 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 504 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 505 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 506 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 507 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 508 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 509 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 510 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 511 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 512 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 513 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 514 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 515 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 516 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 517 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 518 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 519 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 520 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 521 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 522 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 523 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 524 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 525 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 526 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 527 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 528 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 529 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 530 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 531 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 532 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 533 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 534 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 535 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 536 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 537 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 538 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 539 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 540 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 541 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 542 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 543 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 544 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 545 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 546 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 547 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 548 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 549 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 550 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 551 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 552 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 553 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 554 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 555 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 556 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 557 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 558 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 559 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 560 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 561 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 562 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 563 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 564 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 565 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 566 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 567 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 568 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 569 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 570 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 571 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 572 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 573 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 574 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 575 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 576 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 577 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 578 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 579 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 580 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 581 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 582 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 583 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 584 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 585 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 586 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 587 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 588 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 589 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 590 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 591 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 594 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 595 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 596 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 600 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 602 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 610 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 612 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 614 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 615 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 616 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 617 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 618 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 619 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 620 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 621 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 622 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 623 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 624 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 625 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 626 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 627 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 628 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 629 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 630 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 631 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 632 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 633 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 634 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 635 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 636 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 637 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 638 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 639 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 640 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 654 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 655 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 656 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 657 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 658 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 659 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 660 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 661 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 662 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 663 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 664 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 665 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 666 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 667 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 668 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 669 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 670 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 671 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 672 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 673 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 674 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 675 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 676 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 677 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 678 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 679 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 680 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 681 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 682 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 683 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 684 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 685 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 686 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 687 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 688 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 689 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 690 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 691 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 692 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 693 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 694 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 695 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 696 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 697 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 698 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 699 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 701 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 702 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 703 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 704 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 705 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 706 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 707 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 708 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 709 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 710 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 711 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 712 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 713 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 714 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 715 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 716 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 717 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 718 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 719 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 720 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 721 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 722 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 723 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 724 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 725 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 726 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 727 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 728 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 729 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 730 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 731 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 732 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 733 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 734 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 735 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 736 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 40.71 |
| Metatranscriptomes | 0.11 |
| Isolates | 59.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.46 |
| Nodule | 51.06 |
| Rhizoplane | 1.11 |
| Rhizosphere | 28.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000120 | 3300000546 | Bacteria | 12289 |
| 2 | JGI24740J21852_10003637 | 3300001979 | Bacteria | 6723 |
| 3 | JGI24739J22299_10028216 | 3300001989 | Bacteria | 1958 |
| 4 | JGI24735J21928_10019579 | 3300002067 | Bacteria | 2079 |
| 5 | JGI25156J39149_1013450 | 3300002705 | Bacteria | 1734 |
| 6 | JGI25162J39368_1000244 | 3300002737 | Bacteria | 54424 |
| 7 | JGI25162J39368_1000493 | 3300002737 | Bacteria | 29984 |
| 8 | JGI25158J39367_1000756 | 3300002739 | Bacteria | 6197 |
| 9 | JGI25157J39369_1000555 | 3300002741 | Bacteria | 22318 |
| 10 | JGI25152J39213_1004107 | 3300002773 | Bacteria | 4706 |
| 11 | JGI25159J45721_1000015 | 3300002987 | Bacteria | 142431 |
| 12 | JGI25159J45721_1000338 | 3300002987 | Bacteria | 21677 |
| 13 | JGI25151J46595_10033099 | 3300003187 | Bacteria | 1996 |
| 14 | JGI25406J46586_10006406 | 3300003203 | Bacteria | 5426 |
| 15 | JGI25165J46597_1000079 | 3300003214 | Bacteria | 179163 |
| 16 | JGI25165J46597_1000553 | 3300003214 | Bacteria | 34037 |
| 17 | JGI25165J46597_1000796 | 3300003214 | Bacteria | 23932 |
| 18 | rootH2_10027501 | 3300003320 | Bacteria | 5291 |
| 19 | rootH1_10271729 | 3300003323 | Bacteria | 1405 |
| 20 | JGI25160J50197_1000003 | 3300003354 | Bacteria | 482719 |
| 21 | JGI25160J50197_1000012 | 3300003354 | Bacteria | 267582 |
| 22 | JGI25161J50226_1000002 | 3300003374 | Bacteria | 420324 |
| 23 | JGI25161J50226_1000219 | 3300003374 | Bacteria | 35426 |
| 24 | Ga0055542_1000618 | 3300003762 | Bacteria | 30135 |
| 25 | Ga0055542_1001408 | 3300003762 | Bacteria | 12130 |
| 26 | Ga0055529_1003209 | 3300003763 | Bacteria | 2793 |
| 27 | Ga0055526_1003824 | 3300003771 | Bacteria | 9358 |
| 28 | Ga0055536_1005156 | 3300003781 | Bacteria | 6460 |
| 29 | Ga0055528_1021666 | 3300003790 | Bacteria | 2029 |
| 30 | Ga0055540_1008648 | 3300003792 | Bacteria | 3639 |
| 31 | Ga0055531_10011294 | 3300003794 | Bacteria | 4327 |
| 32 | Ga0055543_1000011 | 3300004625 | Bacteria | 196089 |
| 33 | Ga0055543_1000034 | 3300004625 | Bacteria | 128668 |
| 34 | Ga0065165_1000025 | 3300005262 | Bacteria | 246909 |
| 35 | Ga0065165_1000082 | 3300005262 | Bacteria | 158536 |
| 36 | Ga0070658_10085777 | 3300005327 | Bacteria | 2590 |
| 37 | Ga0070660_100079572 | 3300005339 | Bacteria | 2571 |
| 38 | Ga0070660_100209391 | 3300005339 | Bacteria | 1582 |
| 39 | Ga0070668_100006252 | 3300005347 | Bacteria | 8821 |
| 40 | Ga0070671_100130795 | 3300005355 | Bacteria | 2114 |
| 41 | Ga0070663_100068052 | 3300005455 | Bacteria | 2585 |
| 42 | Ga0068853_100328096 | 3300005539 | Bacteria | 1420 |
| 43 | Ga0070665_100028010 | 3300005548 | Bacteria | 5675 |
| 44 | Ga0070665_100052306 | 3300005548 | Bacteria | 4097 |
| 45 | Ga0070665_100079272 | 3300005548 | Bacteria | 3290 |
| 46 | Ga0070665_100112308 | 3300005548 | Bacteria | 2727 |
| 47 | Ga0070665_100270158 | 3300005548 | Bacteria | 1702 |
| 48 | Ga0070665_100303155 | 3300005548 | Bacteria | 1600 |
| 49 | Ga0070665_100628597 | 3300005548 | Bacteria | 1087 |
| 50 | Ga0068855_100008160 | 3300005563 | Bacteria | 12659 |
| 51 | Ga0068855_100310359 | 3300005563 | Bacteria | 1745 |
| 52 | Ga0068855_100463947 | 3300005563 | Bacteria | 1381 |
| 53 | Ga0068857_100206963 | 3300005577 | Bacteria | 1790 |
| 54 | Ga0068854_100100728 | 3300005578 | Bacteria | 2166 |
| 55 | Ga0068856_100976370 | 3300005614 | Bacteria | 865 |
| 56 | Ga0068852_100191337 | 3300005616 | Bacteria | 1931 |
| 57 | Ga0081540_1009710 | 3300005983 | Bacteria | 6604 |
| 58 | Ga0081539_10002395 | 3300005985 | Bacteria | 26644 |
| 59 | Ga0075365_10014555 | 3300006038 | Bacteria | 4736 |
| 60 | Ga0075365_10154229 | 3300006038 | Bacteria | 1598 |
| 61 | Ga0075365_10180082 | 3300006038 | Bacteria | 1477 |
| 62 | Ga0075368_10016651 | 3300006042 | Bacteria | 2741 |
| 63 | Ga0075364_10270979 | 3300006051 | Bacteria | 1155 |
| 64 | Ga0075362_10034225 | 3300006177 | Bacteria | 2213 |
| 65 | Ga0075367_10002953 | 3300006178 | Bacteria | 7945 |
| 66 | Ga0075367_10099335 | 3300006178 | Bacteria | 1778 |
| 67 | Ga0075367_10299299 | 3300006178 | Bacteria | 1012 |
| 68 | Ga0075367_10371192 | 3300006178 | Bacteria | 904 |
| 69 | Ga0075370_10147872 | 3300006353 | Bacteria | 1376 |
| 70 | Ga0075370_10294165 | 3300006353 | Bacteria | 965 |
| 71 | Ga0068871_100538950 | 3300006358 | Bacteria | 1056 |
| 72 | Ga0079104_1002459 | 3300006946 | Bacteria | 9964 |
| 73 | Ga0079104_1006003 | 3300006946 | Bacteria | 4704 |
| 74 | Ga0105251_10009293 | 3300009011 | Bacteria | 5819 |
| 75 | Ga0105240_10249534 | 3300009093 | Bacteria | 2053 |
| 76 | Ga0105240_10287399 | 3300009093 | Bacteria | 1887 |
| 77 | Ga0105247_10172516 | 3300009101 | Bacteria | 1439 |
| 78 | Ga0105248_10012216 | 3300009177 | Bacteria | 9469 |
| 79 | Ga0105237_10038673 | 3300009545 | Bacteria | 4817 |
| 80 | Ga0105237_10540323 | 3300009545 | Bacteria | 1172 |
| 81 | Ga0105237_10851545 | 3300009545 | Bacteria | 918 |
| 82 | Ga0105238_10040306 | 3300009551 | Bacteria | 4733 |
| 83 | Ga0105239_10127612 | 3300010375 | Bacteria | 2828 |
| 84 | Ga0157370_10064885 | 3300013104 | Bacteria | 3455 |
| 85 | Ga0157370_10593368 | 3300013104 | Bacteria | 1014 |
| 86 | Ga0157369_10006251 | 3300013105 | Bacteria | 13822 |
| 87 | Ga0157369_10021348 | 3300013105 | Bacteria | 7241 |
| 88 | Ga0157369_10059190 | 3300013105 | Bacteria | 4131 |
| 89 | Ga0157374_10014300 | 3300013296 | Bacteria | 6945 |
| 90 | Ga0157372_10022080 | 3300013307 | Bacteria | 6883 |
| 91 | Ga0157372_10356875 | 3300013307 | Bacteria | 1703 |
| 92 | Ga0163163_10029885 | 3300014325 | Bacteria | 5244 |
| 93 | Ga0163163_10220505 | 3300014325 | Bacteria | 1945 |
| 94 | Ga0182008_10042226 | 3300014497 | Bacteria | 2272 |
| 95 | Ga0157376_10037849 | 3300014969 | Bacteria | 3921 |
| 96 | Ga0182006_1047427 | 3300015261 | Bacteria | 1665 |
| 97 | Ga0182007_10004110 | 3300015262 | Bacteria | 6690 |
| 98 | Ga0182005_1007445 | 3300015265 | Bacteria | 3283 |
| 99 | Ga0228711_1003057 | 3300022739 | Bacteria | 25943 |
| 100 | Ga0228710_1000004 | 3300022740 | Bacteria | 250560 |
| 101 | Ga0209760_101730 | 3300025207 | Bacteria | 2200 |
| 102 | Ga0209436_100767 | 3300025208 | Bacteria | 13307 |
| 103 | Ga0209436_115828 | 3300025208 | Bacteria | 1151 |
| 104 | Ga0209563_105661 | 3300025230 | Bacteria | 2234 |
| 105 | Ga0209437_100050 | 3300025233 | Bacteria | 394010 |
| 106 | Ga0209437_100056 | 3300025233 | Bacteria | 363071 |
| 107 | Ga0209437_107127 | 3300025233 | Bacteria | 1833 |
| 108 | Ga0207425_1014638 | 3300025245 | Bacteria | 1777 |
| 109 | Ga0209026_1000118 | 3300025250 | Bacteria | 130611 |
| 110 | Ga0209677_102979 | 3300025253 | Bacteria | 5879 |
| 111 | Ga0209148_1000212 | 3300025254 | Bacteria | 101454 |
| 112 | Ga0209148_1005894 | 3300025254 | Bacteria | 2729 |
| 113 | Ga0209759_1000076 | 3300025256 | Bacteria | 175911 |
| 114 | Ga0209129_1001420 | 3300025258 | Bacteria | 13383 |
| 115 | Ga0209233_1000037 | 3300025261 | Bacteria | 554620 |
| 116 | Ga0209233_1000071 | 3300025261 | Bacteria | 363290 |
| 117 | Ga0209233_1000236 | 3300025261 | Bacteria | 92446 |
| 118 | Ga0209233_1000247 | 3300025261 | Bacteria | 87890 |
| 119 | Ga0209233_1009599 | 3300025261 | Bacteria | 2938 |
| 120 | Ga0209233_1019681 | 3300025261 | Bacteria | 1788 |
| 121 | Ga0209455_1000170 | 3300025272 | Bacteria | 110681 |
| 122 | Ga0209455_1021969 | 3300025272 | Bacteria | 1226 |
| 123 | Ga0209673_1006659 | 3300025273 | Bacteria | 5518 |
| 124 | Ga0209130_1000005 | 3300025284 | Bacteria | 599620 |
| 125 | Ga0209130_1000028 | 3300025284 | Bacteria | 325668 |
| 126 | Ga0209676_1003201 | 3300025292 | Bacteria | 10368 |
| 127 | Ga0209025_1000105 | 3300025294 | Bacteria | 224157 |
| 128 | Ga0209025_1040299 | 3300025294 | Bacteria | 2023 |
| 129 | Ga0209564_1000113 | 3300025295 | Bacteria | 211564 |
| 130 | Ga0209564_1009543 | 3300025295 | Bacteria | 4601 |
| 131 | Ga0209758_1015666 | 3300025297 | Bacteria | 3908 |
| 132 | Ga0209050_1000773 | 3300025298 | Bacteria | 45942 |
| 133 | Ga0209256_1004283 | 3300025299 | Bacteria | 9094 |
| 134 | Ga0209256_1019044 | 3300025299 | Bacteria | 2202 |
| 135 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 136 | Ga0207426_1000015 | 3300025302 | Bacteria | 599316 |
| 137 | Ga0207426_1003762 | 3300025302 | Bacteria | 7907 |
| 138 | Ga0207426_1022640 | 3300025302 | Bacteria | 2153 |
| 139 | Ga0209051_1003420 | 3300025303 | Bacteria | 10421 |
| 140 | Ga0209257_1002062 | 3300025304 | Bacteria | 21252 |
| 141 | Ga0207713_1052608 | 3300025735 | Bacteria | 1610 |
| 142 | Ga0207647_10009305 | 3300025904 | Bacteria | 6984 |
| 143 | Ga0207647_10039889 | 3300025904 | Bacteria | 2960 |
| 144 | Ga0207705_10010808 | 3300025909 | Bacteria | 6627 |
| 145 | Ga0207705_10112997 | 3300025909 | Bacteria | 2008 |
| 146 | Ga0207705_10426788 | 3300025909 | Bacteria | 1027 |
| 147 | Ga0207654_10390094 | 3300025911 | Bacteria | 966 |
| 148 | Ga0207695_10235536 | 3300025913 | Bacteria | 1733 |
| 149 | Ga0207695_10309487 | 3300025913 | Bacteria | 1470 |
| 150 | Ga0207695_10364520 | 3300025913 | Bacteria | 1331 |
| 151 | Ga0207695_10461299 | 3300025913 | Bacteria | 1153 |
| 152 | Ga0207671_10119104 | 3300025914 | Bacteria | 2017 |
| 153 | Ga0207671_10618974 | 3300025914 | Bacteria | 863 |
| 154 | Ga0207657_10056625 | 3300025919 | Bacteria | 3381 |
| 155 | Ga0207649_10106102 | 3300025920 | Bacteria | 1868 |
| 156 | Ga0207694_10008166 | 3300025924 | Bacteria | 7909 |
| 157 | Ga0207659_10173312 | 3300025926 | Bacteria | 1703 |
| 158 | Ga0207711_10095829 | 3300025941 | Bacteria | 2618 |
| 159 | Ga0207711_10182891 | 3300025941 | Bacteria | 1907 |
| 160 | Ga0207667_10012351 | 3300025949 | Bacteria | 9847 |
| 161 | Ga0207668_10039475 | 3300025972 | Bacteria | 3178 |
| 162 | Ga0207640_10039683 | 3300025981 | Bacteria | 2982 |
| 163 | Ga0207639_10149943 | 3300026041 | Bacteria | 1952 |
| 164 | Ga0207678_10036692 | 3300026067 | Bacteria | 4267 |
| 165 | Ga0207702_10071810 | 3300026078 | Bacteria | 2982 |
| 166 | Ga0207674_10033322 | 3300026116 | Bacteria | 5394 |
| 167 | Ga0207674_10684775 | 3300026116 | Bacteria | 990 |
| 168 | Ga0209281_1000134 | 3300027111 | Bacteria | 185406 |
| 169 | Ga0209281_1000445 | 3300027111 | Bacteria | 59209 |
| 170 | Ga0209371_1004523 | 3300027312 | Bacteria | 5986 |
| 171 | Ga0209282_1000029 | 3300027666 | Bacteria | 157883 |
| 172 | Ga0268266_10002316 | 3300028379 | Bacteria | 20650 |
| 173 | Ga0268266_10005331 | 3300028379 | Bacteria | 12041 |
| 174 | Ga0268266_10012715 | 3300028379 | Bacteria | 7274 |
| 175 | Ga0268266_10018558 | 3300028379 | Bacteria | 5928 |
| 176 | Ga0268266_10022478 | 3300028379 | Bacteria | 5374 |
| 177 | Ga0268266_10279701 | 3300028379 | Bacteria | 1551 |
| 178 | Ga0268266_10684560 | 3300028379 | Bacteria | 988 |
| 179 | Ga0265338_10234800 | 3300028800 | Bacteria | 1362 |
| 180 | Ga0268256_1003507 | 3300030500 | Bacteria | 7043 |
| 181 | Ga0265339_10030630 | 3300031249 | Bacteria | 3046 |
| 182 | Ga0265316_10052088 | 3300031344 | Bacteria | 3212 |
| 183 | Ga0307513_10104308 | 3300031456 | Bacteria | 2849 |
| 184 | Ga0307408_100296053 | 3300031548 | Bacteria | 1353 |
| 185 | Ga0307405_10379387 | 3300031731 | Bacteria | 1100 |
| 186 | Ga0307413_10193624 | 3300031824 | Bacteria | 1462 |
| 187 | Ga0307406_10520473 | 3300031901 | Bacteria | 968 |
| 188 | Ga0307407_10305387 | 3300031903 | Bacteria | 1111 |
| 189 | Ga0307412_10308405 | 3300031911 | Bacteria | 1254 |
| 190 | Ga0315914_1000004 | 3300031967 | Bacteria | 288534 |
| 191 | Ga0307416_100824385 | 3300032002 | Bacteria | 1025 |
| 192 | Ga0307416_101006405 | 3300032002 | Bacteria | 936 |
| 193 | Ga0307414_10591751 | 3300032004 | Bacteria | 994 |
| 194 | Ga0315913_1000370 | 3300033430 | Bacteria | 38384 |
| 195 | Ga0315915_1000003 | 3300033464 | Bacteria | 407996 |
| 196 | Ga0373926_0084441 | 3300035083 | Bacteria | 1177 |
| 197 | Ga0373927_0000144 | 3300035695 | Bacteria | 55726 |
| 198 | Ga0373947_0100887 | 3300035725 | Bacteria | 1814 |
| 199 | Ga0316582_0067401 | 3300036647 | Bacteria | 2309 |
| 200 | Ga0316582_0296719 | 3300036647 | Bacteria | 1110 |
| 201 | Ga0373925_0000481 | 3300037068 | Bacteria | 39959 |
| 202 | Ga0395900_0246407 | 3300037418 | Bacteria | 1790 |
| 203 | Ga0395900_0253816 | 3300037418 | Bacteria | 1759 |
| 204 | Ga0395905_0069723 | 3300037471 | Bacteria | 3293 |
| 205 | Ga0395905_0103827 | 3300037471 | Bacteria | 2668 |
| 206 | Ga0395905_0401077 | 3300037471 | Bacteria | 1266 |
| 207 | Ga0395905_0642189 | 3300037471 | Bacteria | 963 |
| 208 | Ga0395901_0062742 | 3300038443 | Bacteria | 3867 |
| 209 | Ga0395901_0090720 | 3300038443 | Bacteria | 3199 |
| 210 | Ga0395901_0279437 | 3300038443 | Bacteria | 1735 |
| 211 | Ga0466972_0082084 | 3300044658 | Bacteria | 1534 |
| 212 | Ga0466965_0215208 | 3300044683 | Bacteria | 1023 |
| 213 | Ga0466958_0020303 | 3300045836 | Bacteria | 3873 |
| 214 | Ga0495638_0002052 | 3300046460 | Bacteria | 17104 |
| 215 | Ga0495650_0003032 | 3300046471 | Bacteria | 12678 |
| 216 | Ga0495585_0019476 | 3300046492 | Bacteria | 3912 |
| 217 | Ga0495606_0206785 | 3300046507 | Bacteria | 1115 |
| 218 | Ga0495643_0025307 | 3300046522 | Bacteria | 3359 |
| 219 | Ga0495645_0024585 | 3300046543 | Bacteria | 4372 |
| 220 | Ga0495625_0000182 | 3300046660 | Bacteria | 98244 |
| 221 | Ga0495625_0005589 | 3300046660 | Bacteria | 11404 |
| 222 | Ga0495625_0025984 | 3300046660 | Bacteria | 4430 |
| 223 | Ga0495625_0041200 | 3300046660 | Bacteria | 3363 |
| 224 | Ga0495660_0159642 | 3300046810 | Bacteria | 1107 |
| 225 | Ga0495672_0067521 | 3300047320 | Bacteria | 2036 |
| 226 | Ga0495687_063021 | 3300047443 | Bacteria | 1520 |
| 227 | Ga0495681_0094339 | 3300047470 | Bacteria | 1317 |
| 228 | Ga0495686_0005687 | 3300047472 | Bacteria | 9748 |
| 229 | Ga0495615_0103679 | 3300048090 | Bacteria | 806 |
| 230 | Ga0496102_0373845 | 3300048905 | Bacteria | 1341 |
| 231 | Ga0496104_0245332 | 3300048907 | Bacteria | 1704 |
| 232 | Ga0496108_0099977 | 3300048911 | Bacteria | 2473 |
| 233 | Ga0496112_0073729 | 3300048915 | Bacteria | 3374 |
| 234 | Ga0496112_0243971 | 3300048915 | Bacteria | 1748 |
| 235 | Ga0496113_0224774 | 3300048916 | Bacteria | 1496 |
| 236 | Ga0496115_0090073 | 3300048918 | Bacteria | 2506 |
| 237 | Ga0496116_0014048 | 3300048919 | Bacteria | 6414 |
| 238 | Ga0496116_0145175 | 3300048919 | Bacteria | 1327 |
| 239 | Ga0496119_0016320 | 3300048922 | Bacteria | 5659 |
| 240 | Ga0496120_0002072 | 3300048923 | Bacteria | 21552 |
| 241 | Ga0496120_0023868 | 3300048923 | Bacteria | 3822 |
| 242 | Ga0496122_0082939 | 3300048925 | Bacteria | 2225 |
| 243 | Ga0496123_0029128 | 3300048926 | Bacteria | 4075 |
| 244 | Ga0496124_0166319 | 3300048927 | Bacteria | 1714 |
| 245 | Ga0496125_0075313 | 3300048928 | Bacteria | 2613 |
| 246 | Ga0496125_0208006 | 3300048928 | Bacteria | 1274 |
| 247 | Ga0496126_0003783 | 3300048929 | Bacteria | 18780 |
| 248 | Ga0496126_0155177 | 3300048929 | Bacteria | 1960 |
| 249 | Ga0501031_0000002 | 3300049568 | Bacteria | 217588 |
| 250 | Ga0501031_0010981 | 3300049568 | Bacteria | 5901 |
| 251 | Ga0501031_0032232 | 3300049568 | Bacteria | 3417 |
| 252 | Ga0501031_0175768 | 3300049568 | Bacteria | 1399 |
| 253 | Ga0501031_0259214 | 3300049568 | Bacteria | 1130 |
| 254 | Ga0501032_0000004 | 3300049569 | Bacteria | 310855 |
| 255 | Ga0501032_0001866 | 3300049569 | Bacteria | 16660 |
| 256 | Ga0501032_0051201 | 3300049569 | Bacteria | 2785 |
| 257 | Ga0501033_0000016 | 3300049570 | Bacteria | 217458 |
| 258 | Ga0501033_0000182 | 3300049570 | Bacteria | 60298 |
| 259 | Ga0501033_0000818 | 3300049570 | Bacteria | 28395 |
| 260 | Ga0501033_0009577 | 3300049570 | Bacteria | 7452 |
| 261 | Ga0501033_0022586 | 3300049570 | Bacteria | 4746 |
| 262 | Ga0501033_0042065 | 3300049570 | Bacteria | 3407 |
| 263 | Ga0501033_0133254 | 3300049570 | Bacteria | 1799 |
| 264 | Ga0501033_0282180 | 3300049570 | Bacteria | 1172 |
| 265 | Ga0501034_0000011 | 3300049571 | Bacteria | 310855 |
| 266 | Ga0501034_0001712 | 3300049571 | Bacteria | 28224 |
| 267 | Ga0501034_0007755 | 3300049571 | Bacteria | 11413 |
| 268 | Ga0501034_0158900 | 3300049571 | Bacteria | 2233 |
| 269 | Ga0501036_0000001 | 3300049572 | Bacteria | 310855 |
| 270 | Ga0501036_0006422 | 3300049572 | Bacteria | 9544 |
| 271 | Ga0501036_0030701 | 3300049572 | Bacteria | 4539 |
| 272 | Ga0501036_0185647 | 3300049572 | Bacteria | 1750 |
| 273 | Ga0501036_0278911 | 3300049572 | Bacteria | 1399 |
| 274 | Ga0501036_0467918 | 3300049572 | Bacteria | 1050 |
| 275 | Ga0501036_0477232 | 3300049572 | Bacteria | 1038 |
| 276 | Ga0501037_0000006 | 3300049573 | Bacteria | 217461 |
| 277 | Ga0501037_0000142 | 3300049573 | Bacteria | 66550 |
| 278 | Ga0501038_0000003 | 3300049574 | Bacteria | 310855 |
| 279 | Ga0501038_0000979 | 3300049574 | Bacteria | 25625 |
| 280 | Ga0501038_0071504 | 3300049574 | Bacteria | 2943 |
| 281 | Ga0501038_0148296 | 3300049574 | Bacteria | 1914 |
| 282 | Ga0501038_0252505 | 3300049574 | Bacteria | 1396 |
| 283 | Ga0501039_0000004 | 3300049575 | Bacteria | 310855 |
| 284 | Ga0501039_0070449 | 3300049575 | Bacteria | 2716 |
| 285 | Ga0501039_0605123 | 3300049575 | Bacteria | 859 |
| 286 | Ga0501040_0004502 | 3300049576 | Bacteria | 9045 |
| 287 | Ga0501042_0068089 | 3300049578 | Bacteria | 2545 |
| 288 | Ga0501043_0000066 | 3300049579 | Bacteria | 93258 |
| 289 | Ga0501043_0000588 | 3300049579 | Bacteria | 32210 |
| 290 | Ga0501043_0009297 | 3300049579 | Bacteria | 7723 |
| 291 | Ga0501043_0332533 | 3300049579 | Bacteria | 1157 |
| 292 | Ga0501046_0015684 | 3300049580 | Bacteria | 6360 |
| 293 | Ga0501046_0096005 | 3300049580 | Bacteria | 2277 |
| 294 | Ga0501047_0011488 | 3300049581 | Bacteria | 8382 |
| 295 | Ga0501047_0024880 | 3300049581 | Bacteria | 5749 |
| 296 | Ga0501047_0030377 | 3300049581 | Bacteria | 5209 |
| 297 | Ga0501047_0075152 | 3300049581 | Bacteria | 3251 |
| 298 | Ga0501047_0167104 | 3300049581 | Bacteria | 2070 |
| 299 | Ga0501047_0423512 | 3300049581 | Bacteria | 1162 |
| 300 | Ga0501048_0005100 | 3300049582 | Bacteria | 10007 |
| 301 | Ga0501067_0029599 | 3300049583 | Bacteria | 3035 |
| 302 | Ga0501067_0074703 | 3300049583 | Bacteria | 1878 |
| 303 | Ga0501068_0005415 | 3300049584 | Bacteria | 6984 |
| 304 | Ga0501068_0014507 | 3300049584 | Bacteria | 4505 |
| 305 | Ga0501068_0113680 | 3300049584 | Bacteria | 1685 |
| 306 | Ga0501069_0000002 | 3300049585 | Bacteria | 269636 |
| 307 | Ga0501069_0008770 | 3300049585 | Bacteria | 5324 |
| 308 | Ga0501069_0048007 | 3300049585 | Bacteria | 2370 |
| 309 | Ga0501069_0106949 | 3300049585 | Bacteria | 1591 |
| 310 | Ga0501070_0000051 | 3300049586 | Bacteria | 101897 |
| 311 | Ga0501070_0002384 | 3300049586 | Bacteria | 16474 |
| 312 | Ga0501070_0004526 | 3300049586 | Bacteria | 11930 |
| 313 | Ga0501070_0006025 | 3300049586 | Bacteria | 10327 |
| 314 | Ga0501070_0016663 | 3300049586 | Bacteria | 6172 |
| 315 | Ga0501071_0085231 | 3300049587 | Bacteria | 2316 |
| 316 | Ga0501071_0106162 | 3300049587 | Bacteria | 2074 |
| 317 | Ga0501073_0006953 | 3300049589 | Bacteria | 8425 |
| 318 | Ga0501073_0010824 | 3300049589 | Bacteria | 6680 |
| 319 | Ga0501074_0001350 | 3300049590 | Bacteria | 16259 |
| 320 | Ga0501074_0227658 | 3300049590 | Bacteria | 1327 |
| 321 | Ga0501080_0001856 | 3300049742 | Bacteria | 18153 |
| 322 | Ga0501080_0007434 | 3300049742 | Bacteria | 9889 |
| 323 | Ga0501080_0042886 | 3300049742 | Bacteria | 4212 |
| 324 | Ga0501080_0236362 | 3300049742 | Bacteria | 1669 |
| 325 | Ga0501083_0000187 | 3300049744 | Bacteria | 39905 |
| 326 | Ga0501083_0033156 | 3300049744 | Bacteria | 3538 |
| 327 | Ga0501083_0110715 | 3300049744 | Bacteria | 1806 |
| 328 | Ga0501035_0000009 | 3300049822 | Bacteria | 310827 |
| 329 | Ga0501035_0002215 | 3300049822 | Bacteria | 19311 |
| 330 | Ga0501035_0002554 | 3300049822 | Bacteria | 17805 |
| 331 | Ga0501035_0002576 | 3300049822 | Bacteria | 17719 |
| 332 | Ga0501035_0003955 | 3300049822 | Bacteria | 14136 |
| 333 | Ga0501035_0007237 | 3300049822 | Bacteria | 10383 |
| 334 | Ga0501035_0019856 | 3300049822 | Bacteria | 6172 |
| 335 | Ga0501035_0045873 | 3300049822 | Bacteria | 3931 |
| 336 | Ga0501035_0216599 | 3300049822 | Bacteria | 1636 |
| 337 | Ga0501035_0369045 | 3300049822 | Bacteria | 1198 |
| 338 | Ga0501035_0558194 | 3300049822 | Bacteria | 937 |
| 339 | Ga0501044_0000005 | 3300049823 | Bacteria | 310855 |
| 340 | Ga0501044_0000923 | 3300049823 | Bacteria | 35383 |
| 341 | Ga0501044_0007678 | 3300049823 | Bacteria | 11859 |
| 342 | Ga0501044_0010931 | 3300049823 | Bacteria | 9853 |
| 343 | Ga0501044_0017045 | 3300049823 | Bacteria | 7795 |
| 344 | Ga0501044_0029897 | 3300049823 | Bacteria | 5744 |
| 345 | Ga0501044_0157203 | 3300049823 | Bacteria | 2252 |
| 346 | Ga0501044_0517847 | 3300049823 | Bacteria | 1093 |
| 347 | Ga0501045_0015261 | 3300049824 | Bacteria | 5452 |
| 348 | nmdc:mga03683_7962_c1 | 3300050489 | Bacteria | 3705 |
| 349 | nmdc:mga03n38_49596_c1 | 3300050490 | Bacteria | 1867 |
| 350 | nmdc:mga03n38_7203_c1 | 3300050490 | Bacteria | 3921 |
| 351 | nmdc:mga00v17_115493_c1 | 3300050491 | Bacteria | 1706 |
| 352 | nmdc:mga00v17_12374_c1 | 3300050491 | Bacteria | 4707 |
| 353 | nmdc:mga0yw44_149407_c1 | 3300050492 | Bacteria | 1523 |
| 354 | nmdc:mga0yw44_76772_c1 | 3300050492 | Bacteria | 2086 |
| 355 | nmdc:mga0k408_388348_c1 | 3300050493 | Bacteria | 831 |
| 356 | nmdc:mga0sz30_50634_c1 | 3300050516 | Bacteria | 1761 |
| 357 | nmdc:mga0sz30_57025_c1 | 3300050516 | Bacteria | 1664 |
| 358 | Ga0495612_0085143 | 3300053078 | Bacteria | 1332 |
| 359 | Ga0500559_0001518 | 3300053136 | Bacteria | 13013 |
| 360 | Ga0500568_0000010 | 3300053139 | Bacteria | 249043 |
| 361 | Ga0500604_0038969 | 3300053151 | Bacteria | 1427 |
| 362 | Ga0500616_0070377 | 3300053153 | Bacteria | 1786 |
| 363 | Ga0500616_0216385 | 3300053153 | Bacteria | 838 |
| 364 | Ga0500620_001452 | 3300053155 | Bacteria | 4384 |
| 365 | Ga0500627_0210728 | 3300053158 | Bacteria | 869 |
| 366 | Ga0500611_004053 | 3300053727 | Bacteria | 1940 |
| 367 | Ga0587083_0014694 | 3300059505 | Bacteria | 1353 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053078 | Ga0495612_0085143 | Ga0495612_0085143_668_1315 | 211 |
| 2 | 3300006038 | Ga0075365_10154229 | Ga0075365_101542293 | 216 |
| 3 | 3300050492 | nmdc:mga0yw44_149407_c1 | nmdc:mga0yw44_149407_c1_751_1464 | 216 |
| 4 | 3300002739 | JGI25158J39367_1000756 | JGI25158J39367_10007565 | 217 |
| 5 | 3300002987 | JGI25159J45721_1000015 | JGI25159J45721_100001545 | 217 |
| 6 | 3300003187 | JGI25151J46595_10033099 | JGI25151J46595_100330991 | 217 |
| 7 | 3300003354 | JGI25160J50197_1000003 | JGI25160J50197_1000003139 | 217 |
| 8 | 3300003374 | JGI25161J50226_1000219 | JGI25161J50226_100021921 | 217 |
| 9 | 3300003771 | Ga0055526_1003824 | Ga0055526_10038244 | 217 |
| 10 | 3300003781 | Ga0055536_1005156 | Ga0055536_10051563 | 217 |
| 11 | 3300003794 | Ga0055531_10011294 | Ga0055531_100112945 | 217 |
| 12 | 3300004625 | Ga0055543_1000034 | Ga0055543_100003415 | 217 |
| 13 | 3300005262 | Ga0065165_1000025 | Ga0065165_1000025193 | 217 |
| 14 | 3300025208 | Ga0209436_100767 | Ga0209436_1007677 | 217 |
| 15 | 3300025245 | Ga0207425_1014638 | Ga0207425_10146383 | 217 |
| 16 | 3300025284 | Ga0209130_1000005 | Ga0209130_1000005342 | 217 |
| 17 | 3300025292 | Ga0209676_1003201 | Ga0209676_100320110 | 217 |
| 18 | 3300025294 | Ga0209025_1000105 | Ga0209025_100010575 | 217 |
| 19 | 3300025295 | Ga0209564_1000113 | Ga0209564_100011330 | 217 |
| 20 | 3300025298 | Ga0209050_1000773 | Ga0209050_10007737 | 217 |
| 21 | 3300025299 | Ga0209256_1004283 | Ga0209256_100428310 | 217 |
| 22 | 3300025302 | Ga0207426_1000015 | Ga0207426_1000015257 | 217 |
| 23 | 3300025304 | Ga0209257_1002062 | Ga0209257_100206210 | 217 |
| 24 | 3300049568 | Ga0501031_0000002 | Ga0501031_0000002_124491_125189 | 221 |
| 25 | 3300049570 | Ga0501033_0000016 | Ga0501033_0000016_124363_125061 | 221 |
| 26 | 3300049573 | Ga0501037_0000006 | Ga0501037_0000006_124330_125028 | 221 |
| 27 | 3300049579 | Ga0501043_0000588 | Ga0501043_0000588_26127_26825 | 221 |
| 28 | 3300049580 | Ga0501046_0096005 | Ga0501046_0096005_833_1531 | 221 |
| 29 | 3300049581 | Ga0501047_0011488 | Ga0501047_0011488_4916_5614 | 221 |
| 30 | 3300049822 | Ga0501035_0000009 | Ga0501035_0000009_217696_218394 | 221 |
| 31 | iso_pu_bacteria | 2693429783 | 2694627774 | 222 |
| 32 | iso_pu_bacteria | 2693429784 | 2694636047 | 222 |
| 33 | iso_pu_bacteria | 2693429784 | 2694636888 | 222 |
| 34 | iso_pu_bacteria | 2856320880 | 2856323815 | 222 |
| 35 | iso_pu_bacteria | 2869278585 | 2869284786 | 222 |
| 36 | iso_pu_bacteria | 2874139085 | 2874142893 | 222 |
| 37 | iso_pu_bacteria | 2874168670 | 2874172496 | 222 |
| 38 | iso_pu_bacteria | 2876392853 | 2876396982 | 222 |
| 39 | iso_pu_bacteria | 2878738818 | 2878741037 | 222 |
| 40 | iso_pu_bacteria | 2881161766 | 2881165039 | 222 |
| 41 | iso_pu_bacteria | 2888350351 | 2888353129 | 222 |
| 42 | iso_pu_bacteria | 2889010040 | 2889014975 | 222 |
| 43 | iso_pu_bacteria | 2889016732 | 2889019955 | 222 |
| 44 | iso_pu_bacteria | 2906354277 | 2906355873 | 222 |
| 45 | iso_pu_bacteria | 2922130491 | 2922134635 | 222 |
| 46 | iso_pu_bacteria | 2922185730 | 2922188853 | 222 |
| 47 | iso_pu_bacteria | 2924718760 | 2924720569 | 222 |
| 48 | iso_pu_bacteria | 2924776078 | 2924778638 | 222 |
| 49 | iso_pu_bacteria | 2937972304 | 2937974305 | 222 |
| 50 | iso_pu_bacteria | 2996336353 | 2996341488 | 222 |
| 51 | iso_pu_bacteria | 3004268573 | 3004271818 | 222 |
| 52 | 3300031731 | Ga0307405_10379387 | Ga0307405_103793872 | 223 |
| 53 | 3300031824 | Ga0307413_10193624 | Ga0307413_101936241 | 223 |
| 54 | 3300031901 | Ga0307406_10520473 | Ga0307406_105204732 | 223 |
| 55 | iso_pu_bacteria | 2551306089 | 2551709248 | 223 |
| 56 | 3300025261 | Ga0209233_1009599 | Ga0209233_10095992 | 224 |
| 57 | 3300037471 | Ga0395905_0642189 | Ga0395905_0642189_23_706 | 224 |
| 58 | 3300049571 | Ga0501034_0007755 | Ga0501034_0007755_2841_3608 | 224 |
| 59 | 3300049581 | Ga0501047_0423512 | Ga0501047_0423512_16_783 | 224 |
| 60 | 3300005548 | Ga0070665_100028010 | Ga0070665_1000280104 | 225 |
| 61 | 3300028379 | Ga0268266_10018558 | Ga0268266_100185585 | 225 |
| 62 | iso_pu_bacteria | 2510917022 | 2511137143 | 225 |
| 63 | iso_pu_bacteria | 2513237144 | 2513911075 | 225 |
| 64 | iso_pu_bacteria | 2513237146 | 2513924407 | 225 |
| 65 | iso_pu_bacteria | 2524023209 | 2524458030 | 225 |
| 66 | iso_pu_bacteria | 2582581307 | 2585273604 | 225 |
| 67 | iso_pu_bacteria | 2582581315 | 2585326311 | 225 |
| 68 | iso_pu_bacteria | 2582581316 | 2585330477 | 225 |
| 69 | iso_pu_bacteria | 2585427527 | 2585533831 | 225 |
| 70 | iso_pu_bacteria | 2585427530 | 2585553424 | 225 |
| 71 | iso_pu_bacteria | 2585427531 | 2585559777 | 225 |
| 72 | iso_pu_bacteria | 2585427608 | 2585900465 | 225 |
| 73 | iso_pu_bacteria | 2585427609 | 2585906043 | 225 |
| 74 | iso_pu_bacteria | 2585428125 | 2587978842 | 225 |
| 75 | iso_pu_bacteria | 2599185170 | 2599419634 | 225 |
| 76 | iso_pu_bacteria | 2615840698 | 2616556220 | 225 |
| 77 | iso_pu_bacteria | 2617270742 | 2617380582 | 225 |
| 78 | iso_pu_bacteria | 2667528174 | 2671113994 | 225 |
| 79 | iso_pu_bacteria | 2738541317 | 2738947736 | 225 |
| 80 | iso_pu_bacteria | 2775507266 | 2778173839 | 225 |
| 81 | iso_pu_bacteria | 2818991448 | 2819608735 | 225 |
| 82 | iso_pu_bacteria | 2818991453 | 2819640844 | 225 |
| 83 | iso_pu_bacteria | 2838029111 | 2838029626 | 225 |
| 84 | iso_pu_bacteria | 2838035591 | 2838039834 | 225 |
| 85 | iso_pu_bacteria | 2842298080 | 2842299788 | 225 |
| 86 | iso_pu_bacteria | 2842357229 | 2842359690 | 225 |
| 87 | iso_pu_bacteria | 2842475841 | 2842475944 | 225 |
| 88 | iso_pu_bacteria | 2842482326 | 2842486027 | 225 |
| 89 | iso_pu_bacteria | 2842502639 | 2842503154 | 225 |
| 90 | iso_pu_bacteria | 2842509118 | 2842513022 | 225 |
| 91 | iso_pu_bacteria | 2913308742 | 2913311610 | 225 |
| 92 | iso_pu_bacteria | 2919408235 | 2919408464 | 225 |
| 93 | iso_pu_bacteria | 3005409236 | 3005410736 | 225 |
| 94 | iso_pu_bacteria | 3005416602 | 3005423150 | 225 |
| 95 | iso_pu_bacteria | 8005314921 | 8005315477 | 225 |
| 96 | iso_pu_bacteria | 8005484373 | 8005484615 | 225 |
| 97 | iso_pu_bacteria | 8005645114 | 8005649308 | 225 |
| 98 | iso_pu_bacteria | 8005658619 | 8005661606 | 225 |
| 99 | iso_pu_bacteria | 8005682033 | 8005685455 | 225 |
| 100 | iso_pu_bacteria | 8046767195 | 8046769623 | 225 |
| 101 | iso_pu_bacteria | 8057575449 | 8057580338 | 225 |
| 102 | 3300049569 | Ga0501032_0000004 | Ga0501032_0000004_92386_93132 | 226 |
| 103 | 3300049571 | Ga0501034_0000011 | Ga0501034_0000011_92386_93132 | 226 |
| 104 | 3300049572 | Ga0501036_0000001 | Ga0501036_0000001_92386_93132 | 226 |
| 105 | 3300049574 | Ga0501038_0000003 | Ga0501038_0000003_92386_93132 | 226 |
| 106 | 3300049575 | Ga0501039_0000004 | Ga0501039_0000004_92386_93132 | 226 |
| 107 | 3300049576 | Ga0501040_0004502 | Ga0501040_0004502_3354_4100 | 226 |
| 108 | 3300049583 | Ga0501067_0029599 | Ga0501067_0029599_425_1108 | 226 |
| 109 | 3300049583 | Ga0501067_0074703 | Ga0501067_0074703_233_916 | 226 |
| 110 | 3300049586 | Ga0501070_0006025 | Ga0501070_0006025_4560_5306 | 226 |
| 111 | 3300049744 | Ga0501083_0110715 | Ga0501083_0110715_963_1646 | 226 |
| 112 | 3300049822 | Ga0501035_0216599 | Ga0501035_0216599_786_1469 | 226 |
| 113 | 3300049823 | Ga0501044_0000005 | Ga0501044_0000005_92386_93132 | 226 |
| 114 | 3300053153 | Ga0500616_0070377 | Ga0500616_0070377_266_949 | 226 |
| 115 | 3300053153 | Ga0500616_0216385 | Ga0500616_0216385_17_715 | 226 |
| 116 | iso_pu_bacteria | 2513237138 | 2513870246 | 226 |
| 117 | iso_pu_bacteria | 2534681796 | 2535514690 | 226 |
| 118 | iso_pu_bacteria | 2582581867 | 2585398968 | 226 |
| 119 | iso_pu_bacteria | 2585427590 | 2585818911 | 226 |
| 120 | iso_pu_bacteria | 2643221599 | 2644004532 | 226 |
| 121 | iso_pu_bacteria | 2643221634 | 2644196955 | 226 |
| 122 | iso_pu_bacteria | 2923556063 | 2923556304 | 226 |
| 123 | iso_pu_bacteria | 2996887358 | 2996888092 | 226 |
| 124 | iso_pu_bacteria | 3000135777 | 3000137400 | 226 |
| 125 | iso_pu_bacteria | 3005452660 | 3005456484 | 226 |
| 126 | iso_pu_bacteria | 8005321885 | 8005322619 | 226 |
| 127 | iso_pu_bacteria | 8005542996 | 8005543358 | 226 |
| 128 | 3300005983 | Ga0081540_1009710 | Ga0081540_10097104 | 227 |
| 129 | 3300046460 | Ga0495638_0002052 | Ga0495638_0002052_7910_8617 | 227 |
| 130 | iso_pu_bacteria | 2509276018 | 2509368776 | 227 |
| 131 | iso_pu_bacteria | 2512875026 | 2512973105 | 227 |
| 132 | iso_pu_bacteria | 2513237089 | 2513604314 | 227 |
| 133 | iso_pu_bacteria | 2513237160 | 2514008172 | 227 |
| 134 | iso_pu_bacteria | 2517487022 | 2517571895 | 227 |
| 135 | iso_pu_bacteria | 2582581283 | 2585164521 | 227 |
| 136 | iso_pu_bacteria | 2582581865 | 2585386114 | 227 |
| 137 | iso_pu_bacteria | 2643221623 | 2644134020 | 227 |
| 138 | iso_pu_bacteria | 2687453392 | 2688596031 | 227 |
| 139 | iso_pu_bacteria | 2738543024 | 2739309892 | 227 |
| 140 | iso_pu_bacteria | 2775506902 | 2776269449 | 227 |
| 141 | iso_pu_bacteria | 2775506904 | 2776282379 | 227 |
| 142 | iso_pu_bacteria | 2802428858 | 2802718672 | 227 |
| 143 | iso_pu_bacteria | 2802428859 | 2802724352 | 227 |
| 144 | iso_pu_bacteria | 2802428860 | 2802729986 | 227 |
| 145 | iso_pu_bacteria | 2802428861 | 2802737329 | 227 |
| 146 | iso_pu_bacteria | 2802428862 | 2802742245 | 227 |
| 147 | iso_pu_bacteria | 2802428863 | 2802748927 | 227 |
| 148 | iso_pu_bacteria | 2844002411 | 2844003406 | 227 |
| 149 | iso_pu_bacteria | 2856328259 | 2856332484 | 227 |
| 150 | iso_pu_bacteria | 2856334872 | 2856337387 | 227 |
| 151 | iso_pu_bacteria | 2857367948 | 2857370485 | 227 |
| 152 | iso_pu_bacteria | 2869249662 | 2869252877 | 227 |
| 153 | iso_pu_bacteria | 2869264136 | 2869267939 | 227 |
| 154 | iso_pu_bacteria | 2869271264 | 2869272818 | 227 |
| 155 | iso_pu_bacteria | 2871459585 | 2871462355 | 227 |
| 156 | iso_pu_bacteria | 2871466892 | 2871471713 | 227 |
| 157 | iso_pu_bacteria | 2874131515 | 2874131936 | 227 |
| 158 | iso_pu_bacteria | 2874162495 | 2874165960 | 227 |
| 159 | iso_pu_bacteria | 2876399893 | 2876400159 | 227 |
| 160 | iso_pu_bacteria | 2876406927 | 2876413444 | 227 |
| 161 | iso_pu_bacteria | 2878774303 | 2878777743 | 227 |
| 162 | iso_pu_bacteria | 2878781027 | 2878785704 | 227 |
| 163 | iso_pu_bacteria | 2881147464 | 2881148256 | 227 |
| 164 | iso_pu_bacteria | 2888337043 | 2888343352 | 227 |
| 165 | iso_pu_bacteria | 2906363423 | 2906367797 | 227 |
| 166 | iso_pu_bacteria | 2906370794 | 2906371268 | 227 |
| 167 | iso_pu_bacteria | 2906378014 | 2906382012 | 227 |
| 168 | iso_pu_bacteria | 2906386501 | 2906390073 | 227 |
| 169 | iso_pu_bacteria | 2906393657 | 2906399367 | 227 |
| 170 | iso_pu_bacteria | 2906408224 | 2906413864 | 227 |
| 171 | iso_pu_bacteria | 2915980308 | 2915986596 | 227 |
| 172 | iso_pu_bacteria | 2916061851 | 2916065888 | 227 |
| 173 | iso_pu_bacteria | 2921250672 | 2921254873 | 227 |
| 174 | iso_pu_bacteria | 2922151315 | 2922157629 | 227 |
| 175 | iso_pu_bacteria | 2922172374 | 2922175649 | 227 |
| 176 | iso_pu_bacteria | 2922178524 | 2922183223 | 227 |
| 177 | iso_pu_bacteria | 2924710171 | 2924710593 | 227 |
| 178 | iso_pu_bacteria | 2924748358 | 2924752954 | 227 |
| 179 | iso_pu_bacteria | 2937029754 | 2937033613 | 227 |
| 180 | iso_pu_bacteria | 2937036028 | 2937040351 | 227 |
| 181 | iso_pu_bacteria | 2937078374 | 2937082702 | 227 |
| 182 | iso_pu_bacteria | 2937084907 | 2937088639 | 227 |
| 183 | iso_pu_bacteria | 2937868953 | 2937870478 | 227 |
| 184 | iso_pu_bacteria | 2957375807 | 2957377919 | 227 |
| 185 | iso_pu_bacteria | 2957437181 | 2957437540 | 227 |
| 186 | iso_pu_bacteria | 2958122699 | 2958123987 | 227 |
| 187 | iso_pu_bacteria | 2958137437 | 2958141397 | 227 |
| 188 | iso_pu_bacteria | 2958158011 | 2958164386 | 227 |
| 189 | iso_pu_bacteria | 2960591022 | 2960593265 | 227 |
| 190 | iso_pu_bacteria | 2960631154 | 2960637051 | 227 |
| 191 | iso_pu_bacteria | 2960680706 | 2960685247 | 227 |
| 192 | iso_pu_bacteria | 2960693952 | 2960697376 | 227 |
| 193 | iso_pu_bacteria | 2961136820 | 2961139603 | 227 |
| 194 | iso_pu_bacteria | 2965025482 | 2965029932 | 227 |
| 195 | iso_pu_bacteria | 2965032056 | 2965035993 | 227 |
| 196 | iso_pu_bacteria | 2965040258 | 2965044239 | 227 |
| 197 | iso_pu_bacteria | 2965047637 | 2965052391 | 227 |
| 198 | iso_pu_bacteria | 2965089291 | 2965094816 | 227 |
| 199 | iso_pu_bacteria | 2965102966 | 2965105261 | 227 |
| 200 | iso_pu_bacteria | 2965110997 | 2965115722 | 227 |
| 201 | iso_pu_bacteria | 2967686174 | 2967689917 | 227 |
| 202 | iso_pu_bacteria | 2967728569 | 2967732787 | 227 |
| 203 | iso_pu_bacteria | 2970026789 | 2970031055 | 227 |
| 204 | iso_pu_bacteria | 2970122695 | 2970128607 | 227 |
| 205 | iso_pu_bacteria | 2970143518 | 2970149322 | 227 |
| 206 | iso_pu_bacteria | 2970547951 | 2970553232 | 227 |
| 207 | iso_pu_bacteria | 2977530762 | 2977530996 | 227 |
| 208 | iso_pu_bacteria | 2977544691 | 2977548645 | 227 |
| 209 | iso_pu_bacteria | 2977872689 | 2977875957 | 227 |
| 210 | iso_pu_bacteria | 2977915119 | 2977920181 | 227 |
| 211 | iso_pu_bacteria | 2977935797 | 2977941145 | 227 |
| 212 | iso_pu_bacteria | 2977950692 | 2977952899 | 227 |
| 213 | iso_pu_bacteria | 2977957713 | 2977962248 | 227 |
| 214 | iso_pu_bacteria | 2979793036 | 2979794125 | 227 |
| 215 | iso_pu_bacteria | 2987645492 | 2987650523 | 227 |
| 216 | iso_pu_bacteria | 2987673487 | 2987678534 | 227 |
| 217 | iso_pu_bacteria | 2996310559 | 2996311558 | 227 |
| 218 | iso_pu_bacteria | 3004195979 | 3004202459 | 227 |
| 219 | iso_pu_bacteria | 3004239961 | 3004240854 | 227 |
| 220 | iso_pu_bacteria | 649633066 | 649870598 | 227 |
| 221 | iso_pu_bacteria | 8003999396 | 8004003566 | 227 |
| 222 | iso_pu_bacteria | 8004300914 | 8004306371 | 227 |
| 223 | iso_pu_bacteria | 8004361976 | 8004363092 | 227 |
| 224 | iso_pu_bacteria | 8004695233 | 8004699362 | 227 |
| 225 | 3300006042 | Ga0075368_10016651 | Ga0075368_100166513 | 228 |
| 226 | 3300025926 | Ga0207659_10173312 | Ga0207659_101733122 | 228 |
| 227 | 3300032004 | Ga0307414_10591751 | Ga0307414_105917511 | 228 |
| 228 | 3300044683 | Ga0466965_0215208 | Ga0466965_0215208_37_726 | 228 |
| 229 | 3300050489 | nmdc:mga03683_7962_c1 | nmdc:mga03683_7962_c1_986_1690 | 228 |
| 230 | 3300050490 | nmdc:mga03n38_7203_c1 | nmdc:mga03n38_7203_c1_2786_3490 | 228 |
| 231 | iso_pu_bacteria | 2643221550 | 2643773368 | 228 |
| 232 | iso_pu_bacteria | 2643221564 | 2643839500 | 228 |
| 233 | iso_pu_bacteria | 2841734538 | 2841736421 | 228 |
| 234 | iso_pu_bacteria | 2847686936 | 2847689996 | 228 |
| 235 | iso_pu_bacteria | 2856342000 | 2856347486 | 228 |
| 236 | iso_pu_bacteria | 2856349417 | 2856350804 | 228 |
| 237 | iso_pu_bacteria | 2856356410 | 2856358208 | 228 |
| 238 | iso_pu_bacteria | 2871474448 | 2871477215 | 228 |
| 239 | iso_pu_bacteria | 2871488783 | 2871489792 | 228 |
| 240 | iso_pu_bacteria | 2874102143 | 2874107208 | 228 |
| 241 | iso_pu_bacteria | 2874123672 | 2874128388 | 228 |
| 242 | iso_pu_bacteria | 2874146452 | 2874153937 | 228 |
| 243 | iso_pu_bacteria | 2878753008 | 2878754172 | 228 |
| 244 | iso_pu_bacteria | 2878788777 | 2878788966 | 228 |
| 245 | iso_pu_bacteria | 2881155292 | 2881159339 | 228 |
| 246 | iso_pu_bacteria | 2881845957 | 2881847566 | 228 |
| 247 | iso_pu_bacteria | 2881853255 | 2881855859 | 228 |
| 248 | iso_pu_bacteria | 2881861095 | 2881864554 | 228 |
| 249 | iso_pu_bacteria | 2882912400 | 2882915899 | 228 |
| 250 | iso_pu_bacteria | 2885305155 | 2885306907 | 228 |
| 251 | iso_pu_bacteria | 2885312484 | 2885314086 | 228 |
| 252 | iso_pu_bacteria | 2885318864 | 2885320096 | 228 |
| 253 | iso_pu_bacteria | 2885334103 | 2885335464 | 228 |
| 254 | iso_pu_bacteria | 2885342637 | 2885344996 | 228 |
| 255 | iso_pu_bacteria | 2885350715 | 2885352925 | 228 |
| 256 | iso_pu_bacteria | 2888343758 | 2888344425 | 228 |
| 257 | iso_pu_bacteria | 2903492973 | 2903497513 | 228 |
| 258 | iso_pu_bacteria | 2906328253 | 2906334142 | 228 |
| 259 | iso_pu_bacteria | 2922158528 | 2922162016 | 228 |
| 260 | iso_pu_bacteria | 2924726620 | 2924731419 | 228 |
| 261 | iso_pu_bacteria | 2924754689 | 2924760814 | 228 |
| 262 | iso_pu_bacteria | 2924784321 | 2924784860 | 228 |
| 263 | iso_pu_bacteria | 2937891427 | 2937892671 | 228 |
| 264 | iso_pu_bacteria | 2958115193 | 2958119124 | 228 |
| 265 | iso_pu_bacteria | 2961127735 | 2961129713 | 228 |
| 266 | iso_pu_bacteria | 2965062239 | 2965064143 | 228 |
| 267 | iso_pu_bacteria | 2967996073 | 2967996855 | 228 |
| 268 | iso_pu_bacteria | 2968003550 | 2968004918 | 228 |
| 269 | iso_pu_bacteria | 2968091066 | 2968093553 | 228 |
| 270 | iso_pu_bacteria | 2968097103 | 2968101402 | 228 |
| 271 | iso_pu_bacteria | 2968128360 | 2968134018 | 228 |
| 272 | iso_pu_bacteria | 2970503327 | 2970508901 | 228 |
| 273 | iso_pu_bacteria | 2977828996 | 2977835456 | 228 |
| 274 | iso_pu_bacteria | 2977858184 | 2977864191 | 228 |
| 275 | iso_pu_bacteria | 2979779861 | 2979786418 | 228 |
| 276 | iso_pu_bacteria | 2996341866 | 2996341921 | 228 |
| 277 | iso_pu_bacteria | 8002285264 | 8002286423 | 228 |
| 278 | iso_pu_bacteria | 8004445564 | 8004449476 | 228 |
| 279 | iso_pu_bacteria | 8004703790 | 8004706707 | 228 |
| 280 | 3300001979 | JGI24740J21852_10003637 | JGI24740J21852_100036379 | 229 |
| 281 | 3300002737 | JGI25162J39368_1000244 | JGI25162J39368_100024419 | 229 |
| 282 | 3300002737 | JGI25162J39368_1000493 | JGI25162J39368_100049323 | 229 |
| 283 | 3300002773 | JGI25152J39213_1004107 | JGI25152J39213_10041073 | 229 |
| 284 | 3300002987 | JGI25159J45721_1000338 | JGI25159J45721_100033820 | 229 |
| 285 | 3300003214 | JGI25165J46597_1000553 | JGI25165J46597_100055319 | 229 |
| 286 | 3300003214 | JGI25165J46597_1000796 | JGI25165J46597_100079626 | 229 |
| 287 | 3300003320 | rootH2_10027501 | rootH2_100275015 | 229 |
| 288 | 3300003323 | rootH1_10271729 | rootH1_102717292 | 229 |
| 289 | 3300003354 | JGI25160J50197_1000012 | JGI25160J50197_1000012178 | 229 |
| 290 | 3300003374 | JGI25161J50226_1000002 | JGI25161J50226_1000002330 | 229 |
| 291 | 3300003790 | Ga0055528_1021666 | Ga0055528_10216663 | 229 |
| 292 | 3300004625 | Ga0055543_1000011 | Ga0055543_100001183 | 229 |
| 293 | 3300005262 | Ga0065165_1000082 | Ga0065165_100008247 | 229 |
| 294 | 3300005339 | Ga0070660_100079572 | Ga0070660_1000795722 | 229 |
| 295 | 3300005347 | Ga0070668_100006252 | Ga0070668_1000062528 | 229 |
| 296 | 3300006353 | Ga0075370_10147872 | Ga0075370_101478722 | 229 |
| 297 | 3300009011 | Ga0105251_10009293 | Ga0105251_100092935 | 229 |
| 298 | 3300010375 | Ga0105239_10127612 | Ga0105239_101276124 | 229 |
| 299 | 3300015262 | Ga0182007_10004110 | Ga0182007_100041103 | 229 |
| 300 | 3300015265 | Ga0182005_1007445 | Ga0182005_10074455 | 229 |
| 301 | 3300025207 | Ga0209760_101730 | Ga0209760_1017303 | 229 |
| 302 | 3300025208 | Ga0209436_115828 | Ga0209436_1158281 | 229 |
| 303 | 3300025233 | Ga0209437_100050 | Ga0209437_100050213 | 229 |
| 304 | 3300025233 | Ga0209437_100056 | Ga0209437_100056302 | 229 |
| 305 | 3300025253 | Ga0209677_102979 | Ga0209677_1029797 | 229 |
| 306 | 3300025258 | Ga0209129_1001420 | Ga0209129_10014208 | 229 |
| 307 | 3300025261 | Ga0209233_1000037 | Ga0209233_1000037255 | 229 |
| 308 | 3300025261 | Ga0209233_1000071 | Ga0209233_1000071302 | 229 |
| 309 | 3300025261 | Ga0209233_1000236 | Ga0209233_100023659 | 229 |
| 310 | 3300025272 | Ga0209455_1021969 | Ga0209455_10219692 | 229 |
| 311 | 3300025273 | Ga0209673_1006659 | Ga0209673_10066597 | 229 |
| 312 | 3300025284 | Ga0209130_1000028 | Ga0209130_1000028120 | 229 |
| 313 | 3300025295 | Ga0209564_1009543 | Ga0209564_10095436 | 229 |
| 314 | 3300025299 | Ga0209256_1019044 | Ga0209256_10190443 | 229 |
| 315 | 3300025302 | Ga0207426_1000012 | Ga0207426_1000012461 | 229 |
| 316 | 3300025302 | Ga0207426_1003762 | Ga0207426_10037623 | 229 |
| 317 | 3300025735 | Ga0207713_1052608 | Ga0207713_10526082 | 229 |
| 318 | 3300025972 | Ga0207668_10039475 | Ga0207668_100394752 | 229 |
| 319 | 3300027312 | Ga0209371_1004523 | Ga0209371_10045236 | 229 |
| 320 | 3300028379 | Ga0268266_10022478 | Ga0268266_100224787 | 229 |
| 321 | 3300030500 | Ga0268256_1003507 | Ga0268256_10035074 | 229 |
| 322 | 3300031456 | Ga0307513_10104308 | Ga0307513_101043083 | 229 |
| 323 | 3300032002 | Ga0307416_100824385 | Ga0307416_1008243852 | 229 |
| 324 | 3300035083 | Ga0373926_0084441 | Ga0373926_0084441_86_778 | 229 |
| 325 | 3300035695 | Ga0373927_0000144 | Ga0373927_0000144_14160_14852 | 229 |
| 326 | 3300035725 | Ga0373947_0100887 | Ga0373947_0100887_728_1420 | 229 |
| 327 | 3300037068 | Ga0373925_0000481 | Ga0373925_0000481_4161_4853 | 229 |
| 328 | 3300046660 | Ga0495625_0005589 | Ga0495625_0005589_471_1172 | 229 |
| 329 | 3300046810 | Ga0495660_0159642 | Ga0495660_0159642_119_820 | 229 |
| 330 | 3300048905 | Ga0496102_0373845 | Ga0496102_0373845_85_783 | 229 |
| 331 | 3300048919 | Ga0496116_0014048 | Ga0496116_0014048_3972_4664 | 229 |
| 332 | 3300048919 | Ga0496116_0145175 | Ga0496116_0145175_593_1285 | 229 |
| 333 | 3300048925 | Ga0496122_0082939 | Ga0496122_0082939_497_1189 | 229 |
| 334 | 3300048926 | Ga0496123_0029128 | Ga0496123_0029128_1126_1818 | 229 |
| 335 | 3300048928 | Ga0496125_0075313 | Ga0496125_0075313_208_900 | 229 |
| 336 | 3300049568 | Ga0501031_0010981 | Ga0501031_0010981_4796_5494 | 229 |
| 337 | 3300049568 | Ga0501031_0259214 | Ga0501031_0259214_172_873 | 229 |
| 338 | 3300049570 | Ga0501033_0009577 | Ga0501033_0009577_3285_3983 | 229 |
| 339 | 3300049570 | Ga0501033_0042065 | Ga0501033_0042065_1283_1984 | 229 |
| 340 | 3300049571 | Ga0501034_0001712 | Ga0501034_0001712_6481_7179 | 229 |
| 341 | 3300049572 | Ga0501036_0006422 | Ga0501036_0006422_3581_4279 | 229 |
| 342 | 3300049572 | Ga0501036_0467918 | Ga0501036_0467918_208_909 | 229 |
| 343 | 3300049574 | Ga0501038_0000979 | Ga0501038_0000979_3340_4038 | 229 |
| 344 | 3300049574 | Ga0501038_0148296 | Ga0501038_0148296_321_1022 | 229 |
| 345 | 3300049575 | Ga0501039_0070449 | Ga0501039_0070449_977_1675 | 229 |
| 346 | 3300049578 | Ga0501042_0068089 | Ga0501042_0068089_407_1105 | 229 |
| 347 | 3300049580 | Ga0501046_0015684 | Ga0501046_0015684_4832_5530 | 229 |
| 348 | 3300049581 | Ga0501047_0030377 | Ga0501047_0030377_1042_1740 | 229 |
| 349 | 3300049582 | Ga0501048_0005100 | Ga0501048_0005100_5240_5938 | 229 |
| 350 | 3300049584 | Ga0501068_0005415 | Ga0501068_0005415_3039_3737 | 229 |
| 351 | 3300049585 | Ga0501069_0106949 | Ga0501069_0106949_691_1389 | 229 |
| 352 | 3300049586 | Ga0501070_0004526 | Ga0501070_0004526_4155_4853 | 229 |
| 353 | 3300049589 | Ga0501073_0006953 | Ga0501073_0006953_3991_4689 | 229 |
| 354 | 3300049590 | Ga0501074_0227658 | Ga0501074_0227658_173_871 | 229 |
| 355 | 3300049742 | Ga0501080_0007434 | Ga0501080_0007434_3709_4407 | 229 |
| 356 | 3300049822 | Ga0501035_0007237 | Ga0501035_0007237_2584_3282 | 229 |
| 357 | 3300049822 | Ga0501035_0369045 | Ga0501035_0369045_310_1011 | 229 |
| 358 | 3300049823 | Ga0501044_0000923 | Ga0501044_0000923_3285_3983 | 229 |
| 359 | 3300049823 | Ga0501044_0157203 | Ga0501044_0157203_668_1369 | 229 |
| 360 | 3300049824 | Ga0501045_0015261 | Ga0501045_0015261_4729_5427 | 229 |
| 361 | 3300053136 | Ga0500559_0001518 | Ga0500559_0001518_10385_11077 | 229 |
| 362 | 3300053151 | Ga0500604_0038969 | Ga0500604_0038969_694_1395 | 229 |
| 363 | 3300053158 | Ga0500627_0210728 | Ga0500627_0210728_34_735 | 229 |
| 364 | 3300053727 | Ga0500611_004053 | Ga0500611_004053_16_717 | 229 |
| 365 | 3300059505 | Ga0587083_0014694 | Ga0587083_0014694_586_1278 | 229 |
| 366 | iso_pu_bacteria | 2510065057 | 2510308163 | 229 |
| 367 | iso_pu_bacteria | 2511231052 | 2511498942 | 229 |
| 368 | iso_pu_bacteria | 2513237086 | 2513587210 | 229 |
| 369 | iso_pu_bacteria | 2513237091 | 2513616200 | 229 |
| 370 | iso_pu_bacteria | 2513237140 | 2513882647 | 229 |
| 371 | iso_pu_bacteria | 2513237143 | 2513904630 | 229 |
| 372 | iso_pu_bacteria | 2516653046 | 2516895218 | 229 |
| 373 | iso_pu_bacteria | 2551306084 | 2551675220 | 229 |
| 374 | iso_pu_bacteria | 2551306085 | 2551686967 | 229 |
| 375 | iso_pu_bacteria | 2551306093 | 2551743146 | 229 |
| 376 | iso_pu_bacteria | 2599185352 | 2600197546 | 229 |
| 377 | iso_pu_bacteria | 2643221626 | 2644144561 | 229 |
| 378 | iso_pu_bacteria | 2643221655 | 2644306612 | 229 |
| 379 | iso_pu_bacteria | 2643221659 | 2644330802 | 229 |
| 380 | iso_pu_bacteria | 2643221698 | 2644542392 | 229 |
| 381 | iso_pu_bacteria | 2643221712 | 2644612223 | 229 |
| 382 | iso_pu_bacteria | 2643221723 | 2644671579 | 229 |
| 383 | iso_pu_bacteria | 2690316117 | 2692317657 | 229 |
| 384 | iso_pu_bacteria | 2791355082 | 2792583338 | 229 |
| 385 | iso_pu_bacteria | 2844163670 | 2844170042 | 229 |
| 386 | iso_pu_bacteria | 2847417321 | 2847421363 | 229 |
| 387 | iso_pu_bacteria | 2847670302 | 2847673487 | 229 |
| 388 | iso_pu_bacteria | 2855825444 | 2855827856 | 229 |
| 389 | iso_pu_bacteria | 2855839649 | 2855843224 | 229 |
| 390 | iso_pu_bacteria | 2856314179 | 2856319044 | 229 |
| 391 | iso_pu_bacteria | 2856364286 | 2856369813 | 229 |
| 392 | iso_pu_bacteria | 2857349434 | 2857352991 | 229 |
| 393 | iso_pu_bacteria | 2858800743 | 2858802952 | 229 |
| 394 | iso_pu_bacteria | 2869162929 | 2869166073 | 229 |
| 395 | iso_pu_bacteria | 2869285874 | 2869290620 | 229 |
| 396 | iso_pu_bacteria | 2871429161 | 2871432902 | 229 |
| 397 | iso_pu_bacteria | 2874155637 | 2874158625 | 229 |
| 398 | iso_pu_bacteria | 2876377896 | 2876379261 | 229 |
| 399 | iso_pu_bacteria | 2876413966 | 2876419242 | 229 |
| 400 | iso_pu_bacteria | 2878035449 | 2878039433 | 229 |
| 401 | iso_pu_bacteria | 2878745973 | 2878750515 | 229 |
| 402 | iso_pu_bacteria | 2903492973 | 2903499639 | 229 |
| 403 | iso_pu_bacteria | 2906308376 | 2906313440 | 229 |
| 404 | iso_pu_bacteria | 2906321335 | 2906326149 | 229 |
| 405 | iso_pu_bacteria | 2906414383 | 2906419115 | 229 |
| 406 | iso_pu_bacteria | 2915986958 | 2915993660 | 229 |
| 407 | iso_pu_bacteria | 2915993759 | 2915994196 | 229 |
| 408 | iso_pu_bacteria | 2916000859 | 2916004902 | 229 |
| 409 | iso_pu_bacteria | 2916007675 | 2916008305 | 229 |
| 410 | iso_pu_bacteria | 2916014648 | 2916015124 | 229 |
| 411 | iso_pu_bacteria | 2916021584 | 2916026181 | 229 |
| 412 | iso_pu_bacteria | 2916028427 | 2916035163 | 229 |
| 413 | iso_pu_bacteria | 2916035215 | 2916041532 | 229 |
| 414 | iso_pu_bacteria | 2916041962 | 2916047426 | 229 |
| 415 | iso_pu_bacteria | 2916048683 | 2916054837 | 229 |
| 416 | iso_pu_bacteria | 2916055098 | 2916058943 | 229 |
| 417 | iso_pu_bacteria | 2916068649 | 2916071699 | 229 |
| 418 | iso_pu_bacteria | 2916076590 | 2916077278 | 229 |
| 419 | iso_pu_bacteria | 2921201388 | 2921202469 | 229 |
| 420 | iso_pu_bacteria | 2921208531 | 2921209226 | 229 |
| 421 | iso_pu_bacteria | 2921237296 | 2921237611 | 229 |
| 422 | iso_pu_bacteria | 2921244191 | 2921249756 | 229 |
| 423 | iso_pu_bacteria | 2921257292 | 2921263866 | 229 |
| 424 | iso_pu_bacteria | 2921263974 | 2921270529 | 229 |
| 425 | iso_pu_bacteria | 2921282425 | 2921283121 | 229 |
| 426 | iso_pu_bacteria | 2921289301 | 2921290001 | 229 |
| 427 | iso_pu_bacteria | 2921296804 | 2921301751 | 229 |
| 428 | iso_pu_bacteria | 2924144063 | 2924146146 | 229 |
| 429 | iso_pu_bacteria | 2924150972 | 2924158219 | 229 |
| 430 | iso_pu_bacteria | 2924158325 | 2924164548 | 229 |
| 431 | iso_pu_bacteria | 2924165586 | 2924171361 | 229 |
| 432 | iso_pu_bacteria | 2924172951 | 2924179621 | 229 |
| 433 | iso_pu_bacteria | 2924179722 | 2924180045 | 229 |
| 434 | iso_pu_bacteria | 2924186466 | 2924186811 | 229 |
| 435 | iso_pu_bacteria | 2924193448 | 2924200286 | 229 |
| 436 | iso_pu_bacteria | 2924200457 | 2924202603 | 229 |
| 437 | iso_pu_bacteria | 2924207177 | 2924209452 | 229 |
| 438 | iso_pu_bacteria | 2924214083 | 2924216663 | 229 |
| 439 | iso_pu_bacteria | 2924221636 | 2924227049 | 229 |
| 440 | iso_pu_bacteria | 2924228884 | 2924234751 | 229 |
| 441 | iso_pu_bacteria | 2937002841 | 2937006328 | 229 |
| 442 | iso_pu_bacteria | 2937009748 | 2937011686 | 229 |
| 443 | iso_pu_bacteria | 2937016420 | 2937018392 | 229 |
| 444 | iso_pu_bacteria | 2937023124 | 2937025734 | 229 |
| 445 | iso_pu_bacteria | 2937042894 | 2937044593 | 229 |
| 446 | iso_pu_bacteria | 2937049772 | 2937055983 | 229 |
| 447 | iso_pu_bacteria | 2937056579 | 2937057231 | 229 |
| 448 | iso_pu_bacteria | 2937063883 | 2937069957 | 229 |
| 449 | iso_pu_bacteria | 2937071275 | 2937078325 | 229 |
| 450 | iso_pu_bacteria | 2937091812 | 2937092589 | 229 |
| 451 | iso_pu_bacteria | 2937098957 | 2937106313 | 229 |
| 452 | iso_pu_bacteria | 2937106411 | 2937108289 | 229 |
| 453 | iso_pu_bacteria | 2937113482 | 2937118678 | 229 |
| 454 | iso_pu_bacteria | 2937119839 | 2937121877 | 229 |
| 455 | iso_pu_bacteria | 2937126314 | 2937129665 | 229 |
| 456 | iso_pu_bacteria | 2957382221 | 2957384337 | 229 |
| 457 | iso_pu_bacteria | 2957388812 | 2957393787 | 229 |
| 458 | iso_pu_bacteria | 2957395598 | 2957396037 | 229 |
| 459 | iso_pu_bacteria | 2957402308 | 2957405590 | 229 |
| 460 | iso_pu_bacteria | 2957408893 | 2957413517 | 229 |
| 461 | iso_pu_bacteria | 2957415311 | 2957422284 | 229 |
| 462 | iso_pu_bacteria | 2957422303 | 2957425509 | 229 |
| 463 | iso_pu_bacteria | 2957430029 | 2957434343 | 229 |
| 464 | iso_pu_bacteria | 2957443900 | 2957450150 | 229 |
| 465 | iso_pu_bacteria | 2957450854 | 2957452830 | 229 |
| 466 | iso_pu_bacteria | 2957457609 | 2957458223 | 229 |
| 467 | iso_pu_bacteria | 2957464669 | 2957466299 | 229 |
| 468 | iso_pu_bacteria | 2957471148 | 2957474681 | 229 |
| 469 | iso_pu_bacteria | 2957478035 | 2957484092 | 229 |
| 470 | iso_pu_bacteria | 2957484790 | 2957485215 | 229 |
| 471 | iso_pu_bacteria | 2957491536 | 2957493785 | 229 |
| 472 | iso_pu_bacteria | 2957498199 | 2957499264 | 229 |
| 473 | iso_pu_bacteria | 2957505466 | 2957506017 | 229 |
| 474 | iso_pu_bacteria | 2960584000 | 2960584622 | 229 |
| 475 | iso_pu_bacteria | 2960597568 | 2960603178 | 229 |
| 476 | iso_pu_bacteria | 2960603979 | 2960609368 | 229 |
| 477 | iso_pu_bacteria | 2960610863 | 2960615337 | 229 |
| 478 | iso_pu_bacteria | 2960617483 | 2960623249 | 229 |
| 479 | iso_pu_bacteria | 2960624210 | 2960624825 | 229 |
| 480 | iso_pu_bacteria | 2960637947 | 2960638877 | 229 |
| 481 | iso_pu_bacteria | 2960645483 | 2960650944 | 229 |
| 482 | iso_pu_bacteria | 2960652885 | 2960659365 | 229 |
| 483 | iso_pu_bacteria | 2960660292 | 2960666939 | 229 |
| 484 | iso_pu_bacteria | 2960667422 | 2960670179 | 229 |
| 485 | iso_pu_bacteria | 2960674078 | 2960679550 | 229 |
| 486 | iso_pu_bacteria | 2960687367 | 2960693656 | 229 |
| 487 | iso_pu_bacteria | 2964607997 | 2964611556 | 229 |
| 488 | iso_pu_bacteria | 2964615318 | 2964621555 | 229 |
| 489 | iso_pu_bacteria | 2964621998 | 2964622459 | 229 |
| 490 | iso_pu_bacteria | 2964628898 | 2964634249 | 229 |
| 491 | iso_pu_bacteria | 2964636051 | 2964641419 | 229 |
| 492 | iso_pu_bacteria | 2964643177 | 2964644966 | 229 |
| 493 | iso_pu_bacteria | 2964649959 | 2964655945 | 229 |
| 494 | iso_pu_bacteria | 2964656573 | 2964657017 | 229 |
| 495 | iso_pu_bacteria | 2964663802 | 2964670343 | 229 |
| 496 | iso_pu_bacteria | 2964670856 | 2964672389 | 229 |
| 497 | iso_pu_bacteria | 2964678106 | 2964684543 | 229 |
| 498 | iso_pu_bacteria | 2964685014 | 2964685342 | 229 |
| 499 | iso_pu_bacteria | 2964691889 | 2964692384 | 229 |
| 500 | iso_pu_bacteria | 2964698721 | 2964705397 | 229 |
| 501 | iso_pu_bacteria | 2964705432 | 2964708965 | 229 |
| 502 | iso_pu_bacteria | 2964712639 | 2964713027 | 229 |
| 503 | iso_pu_bacteria | 2964719344 | 2964720285 | 229 |
| 504 | iso_pu_bacteria | 2967664464 | 2967665783 | 229 |
| 505 | iso_pu_bacteria | 2967671571 | 2967671968 | 229 |
| 506 | iso_pu_bacteria | 2967678726 | 2967679120 | 229 |
| 507 | iso_pu_bacteria | 2967693043 | 2967695287 | 229 |
| 508 | iso_pu_bacteria | 2967699805 | 2967701129 | 229 |
| 509 | iso_pu_bacteria | 2967706974 | 2967707694 | 229 |
| 510 | iso_pu_bacteria | 2967714385 | 2967720682 | 229 |
| 511 | iso_pu_bacteria | 2967721400 | 2967728489 | 229 |
| 512 | iso_pu_bacteria | 2967735183 | 2967741114 | 229 |
| 513 | iso_pu_bacteria | 2967742019 | 2967742370 | 229 |
| 514 | iso_pu_bacteria | 2967748971 | 2967749591 | 229 |
| 515 | iso_pu_bacteria | 2967755722 | 2967761949 | 229 |
| 516 | iso_pu_bacteria | 2967762386 | 2967768680 | 229 |
| 517 | iso_pu_bacteria | 2967769361 | 2967771404 | 229 |
| 518 | iso_pu_bacteria | 2967775926 | 2967776559 | 229 |
| 519 | iso_pu_bacteria | 2970019648 | 2970020055 | 229 |
| 520 | iso_pu_bacteria | 2970040964 | 2970046858 | 229 |
| 521 | iso_pu_bacteria | 2970047711 | 2970051846 | 229 |
| 522 | iso_pu_bacteria | 2970054988 | 2970060402 | 229 |
| 523 | iso_pu_bacteria | 2970061556 | 2970062071 | 229 |
| 524 | iso_pu_bacteria | 2970076120 | 2970082276 | 229 |
| 525 | iso_pu_bacteria | 2970082768 | 2970087991 | 229 |
| 526 | iso_pu_bacteria | 2970088815 | 2970091653 | 229 |
| 527 | iso_pu_bacteria | 2970095765 | 2970102493 | 229 |
| 528 | iso_pu_bacteria | 2970102677 | 2970108312 | 229 |
| 529 | iso_pu_bacteria | 2970109326 | 2970113543 | 229 |
| 530 | iso_pu_bacteria | 2970116247 | 2970121994 | 229 |
| 531 | iso_pu_bacteria | 2970129317 | 2970135415 | 229 |
| 532 | iso_pu_bacteria | 2970136068 | 2970137819 | 229 |
| 533 | iso_pu_bacteria | 2970149975 | 2970153611 | 229 |
| 534 | iso_pu_bacteria | 2970156795 | 2970157884 | 229 |
| 535 | iso_pu_bacteria | 2970164137 | 2970169670 | 229 |
| 536 | iso_pu_bacteria | 2970170962 | 2970174044 | 229 |
| 537 | iso_pu_bacteria | 2970177841 | 2970182451 | 229 |
| 538 | iso_pu_bacteria | 2970184632 | 2970187008 | 229 |
| 539 | iso_pu_bacteria | 2970191845 | 2970198645 | 229 |
| 540 | iso_pu_bacteria | 2977516862 | 2977517458 | 229 |
| 541 | iso_pu_bacteria | 2977523885 | 2977530351 | 229 |
| 542 | iso_pu_bacteria | 2977537788 | 2977538610 | 229 |
| 543 | iso_pu_bacteria | 2977551784 | 2977554209 | 229 |
| 544 | iso_pu_bacteria | 2977558990 | 2977565326 | 229 |
| 545 | iso_pu_bacteria | 2977565890 | 2977569975 | 229 |
| 546 | iso_pu_bacteria | 2977572785 | 2977579425 | 229 |
| 547 | iso_pu_bacteria | 2977579622 | 2977584028 | 229 |
| 548 | iso_pu_bacteria | 648276728 | 648736679 | 229 |
| 549 | iso_pu_bacteria | 8003992118 | 8003995806 | 229 |
| 550 | iso_pu_bacteria | 8018150411 | 8018152823 | 229 |
| 551 | iso_pu_bacteria | 8049293176 | 8049296693 | 229 |
| 552 | 3300003792 | Ga0055540_1008648 | Ga0055540_10086483 | 230 |
| 553 | 3300005614 | Ga0068856_100976370 | Ga0068856_1009763701 | 230 |
| 554 | 3300006178 | Ga0075367_10002953 | Ga0075367_1000295310 | 230 |
| 555 | 3300006178 | Ga0075367_10299299 | Ga0075367_102992992 | 230 |
| 556 | 3300006353 | Ga0075370_10294165 | Ga0075370_102941652 | 230 |
| 557 | 3300006946 | Ga0079104_1006003 | Ga0079104_10060033 | 230 |
| 558 | 3300009545 | Ga0105237_10038673 | Ga0105237_100386734 | 230 |
| 559 | 3300009551 | Ga0105238_10040306 | Ga0105238_100403065 | 230 |
| 560 | 3300013104 | Ga0157370_10593368 | Ga0157370_105933682 | 230 |
| 561 | 3300022739 | Ga0228711_1003057 | Ga0228711_100305712 | 230 |
| 562 | 3300022740 | Ga0228710_1000004 | Ga0228710_10000048 | 230 |
| 563 | 3300025230 | Ga0209563_105661 | Ga0209563_1056613 | 230 |
| 564 | 3300025294 | Ga0209025_1040299 | Ga0209025_10402993 | 230 |
| 565 | 3300025297 | Ga0209758_1015666 | Ga0209758_10156665 | 230 |
| 566 | 3300025303 | Ga0209051_1003420 | Ga0209051_10034209 | 230 |
| 567 | 3300025914 | Ga0207671_10618974 | Ga0207671_106189741 | 230 |
| 568 | 3300026116 | Ga0207674_10684775 | Ga0207674_106847752 | 230 |
| 569 | 3300027111 | Ga0209281_1000134 | Ga0209281_100013456 | 230 |
| 570 | 3300027666 | Ga0209282_1000029 | Ga0209282_100002924 | 230 |
| 571 | 3300031967 | Ga0315914_1000004 | Ga0315914_100000413 | 230 |
| 572 | 3300033430 | Ga0315913_1000370 | Ga0315913_100037024 | 230 |
| 573 | 3300033464 | Ga0315915_1000003 | Ga0315915_1000003120 | 230 |
| 574 | 3300037418 | Ga0395900_0246407 | Ga0395900_0246407_257_967 | 230 |
| 575 | 3300037418 | Ga0395900_0253816 | Ga0395900_0253816_933_1640 | 230 |
| 576 | 3300037471 | Ga0395905_0401077 | Ga0395905_0401077_25_732 | 230 |
| 577 | 3300038443 | Ga0395901_0062742 | Ga0395901_0062742_1401_2126 | 230 |
| 578 | 3300038443 | Ga0395901_0279437 | Ga0395901_0279437_338_1048 | 230 |
| 579 | 3300046492 | Ga0495585_0019476 | Ga0495585_0019476_2444_3139 | 230 |
| 580 | 3300046660 | Ga0495625_0025984 | Ga0495625_0025984_511_1209 | 230 |
| 581 | 3300046660 | Ga0495625_0041200 | Ga0495625_0041200_2266_2961 | 230 |
| 582 | 3300048923 | Ga0496120_0002072 | Ga0496120_0002072_3618_4325 | 230 |
| 583 | 3300049568 | Ga0501031_0032232 | Ga0501031_0032232_1203_1907 | 230 |
| 584 | 3300049568 | Ga0501031_0175768 | Ga0501031_0175768_675_1379 | 230 |
| 585 | 3300049569 | Ga0501032_0001866 | Ga0501032_0001866_4596_5300 | 230 |
| 586 | 3300049569 | Ga0501032_0051201 | Ga0501032_0051201_1547_2251 | 230 |
| 587 | 3300049570 | Ga0501033_0000182 | Ga0501033_0000182_28787_29485 | 230 |
| 588 | 3300049570 | Ga0501033_0000818 | Ga0501033_0000818_15792_16496 | 230 |
| 589 | 3300049570 | Ga0501033_0133254 | Ga0501033_0133254_89_793 | 230 |
| 590 | 3300049570 | Ga0501033_0282180 | Ga0501033_0282180_362_1066 | 230 |
| 591 | 3300049571 | Ga0501034_0158900 | Ga0501034_0158900_1267_1971 | 230 |
| 592 | 3300049572 | Ga0501036_0030701 | Ga0501036_0030701_255_959 | 230 |
| 593 | 3300049572 | Ga0501036_0185647 | Ga0501036_0185647_748_1452 | 230 |
| 594 | 3300049572 | Ga0501036_0477232 | Ga0501036_0477232_202_906 | 230 |
| 595 | 3300049573 | Ga0501037_0000142 | Ga0501037_0000142_26656_27360 | 230 |
| 596 | 3300049574 | Ga0501038_0071504 | Ga0501038_0071504_264_968 | 230 |
| 597 | 3300049574 | Ga0501038_0252505 | Ga0501038_0252505_32_736 | 230 |
| 598 | 3300049575 | Ga0501039_0605123 | Ga0501039_0605123_98_802 | 230 |
| 599 | 3300049579 | Ga0501043_0000066 | Ga0501043_0000066_4505_5209 | 230 |
| 600 | 3300049579 | Ga0501043_0332533 | Ga0501043_0332533_44_748 | 230 |
| 601 | 3300049581 | Ga0501047_0024880 | Ga0501047_0024880_23_727 | 230 |
| 602 | 3300049581 | Ga0501047_0167104 | Ga0501047_0167104_608_1312 | 230 |
| 603 | 3300049584 | Ga0501068_0014507 | Ga0501068_0014507_398_1102 | 230 |
| 604 | 3300049584 | Ga0501068_0113680 | Ga0501068_0113680_930_1634 | 230 |
| 605 | 3300049585 | Ga0501069_0000002 | Ga0501069_0000002_87346_88050 | 230 |
| 606 | 3300049585 | Ga0501069_0008770 | Ga0501069_0008770_2042_2746 | 230 |
| 607 | 3300049585 | Ga0501069_0048007 | Ga0501069_0048007_631_1335 | 230 |
| 608 | 3300049586 | Ga0501070_0000051 | Ga0501070_0000051_39891_40595 | 230 |
| 609 | 3300049586 | Ga0501070_0002384 | Ga0501070_0002384_13320_14024 | 230 |
| 610 | 3300049587 | Ga0501071_0085231 | Ga0501071_0085231_795_1499 | 230 |
| 611 | 3300049587 | Ga0501071_0106162 | Ga0501071_0106162_890_1594 | 230 |
| 612 | 3300049589 | Ga0501073_0010824 | Ga0501073_0010824_788_1492 | 230 |
| 613 | 3300049590 | Ga0501074_0001350 | Ga0501074_0001350_4703_5407 | 230 |
| 614 | 3300049742 | Ga0501080_0001856 | Ga0501080_0001856_4417_5121 | 230 |
| 615 | 3300049742 | Ga0501080_0236362 | Ga0501080_0236362_585_1289 | 230 |
| 616 | 3300049744 | Ga0501083_0000187 | Ga0501083_0000187_20600_21304 | 230 |
| 617 | 3300049822 | Ga0501035_0002215 | Ga0501035_0002215_366_1070 | 230 |
| 618 | 3300049822 | Ga0501035_0002554 | Ga0501035_0002554_9843_10547 | 230 |
| 619 | 3300049822 | Ga0501035_0002576 | Ga0501035_0002576_8011_8709 | 230 |
| 620 | 3300049822 | Ga0501035_0003955 | Ga0501035_0003955_4730_5434 | 230 |
| 621 | 3300049822 | Ga0501035_0019856 | Ga0501035_0019856_3606_4310 | 230 |
| 622 | 3300049822 | Ga0501035_0045873 | Ga0501035_0045873_1311_2015 | 230 |
| 623 | 3300049822 | Ga0501035_0558194 | Ga0501035_0558194_103_807 | 230 |
| 624 | 3300049823 | Ga0501044_0007678 | Ga0501044_0007678_4703_5407 | 230 |
| 625 | 3300049823 | Ga0501044_0010931 | Ga0501044_0010931_3924_4628 | 230 |
| 626 | 3300049823 | Ga0501044_0029897 | Ga0501044_0029897_4587_5291 | 230 |
| 627 | 3300049823 | Ga0501044_0517847 | Ga0501044_0517847_198_902 | 230 |
| 628 | iso_pu_bacteria | 2503198000 | 2503198747 | 230 |
| 629 | iso_pu_bacteria | 2509276022 | 2509393634 | 230 |
| 630 | iso_pu_bacteria | 2515154107 | 2515607360 | 230 |
| 631 | iso_pu_bacteria | 2844009547 | 2844010844 | 230 |
| 632 | iso_pu_bacteria | 2869169390 | 2869170896 | 230 |
| 633 | iso_pu_bacteria | 2869234852 | 2869235644 | 230 |
| 634 | iso_pu_bacteria | 2869256925 | 2869261601 | 230 |
| 635 | iso_pu_bacteria | 2871435913 | 2871443221 | 230 |
| 636 | iso_pu_bacteria | 2871481445 | 2871484220 | 230 |
| 637 | iso_pu_bacteria | 2874109183 | 2874112251 | 230 |
| 638 | iso_pu_bacteria | 2874116593 | 2874118167 | 230 |
| 639 | iso_pu_bacteria | 2876386047 | 2876390969 | 230 |
| 640 | iso_pu_bacteria | 2876420981 | 2876427413 | 230 |
| 641 | iso_pu_bacteria | 2903513507 | 2903513887 | 230 |
| 642 | iso_pu_bacteria | 2904659560 | 2904663736 | 230 |
| 643 | iso_pu_bacteria | 2906401398 | 2906405153 | 230 |
| 644 | iso_pu_bacteria | 2906427513 | 2906432854 | 230 |
| 645 | iso_pu_bacteria | 2924741084 | 2924747703 | 230 |
| 646 | iso_pu_bacteria | 2936996657 | 2936998652 | 230 |
| 647 | iso_pu_bacteria | 2968138860 | 2968143086 | 230 |
| 648 | iso_pu_bacteria | 637000159 | 637077018 | 230 |
| 649 | 3300003203 | JGI25406J46586_10006406 | JGI25406J46586_100064062 | 231 |
| 650 | 3300003762 | Ga0055542_1000618 | Ga0055542_100061823 | 231 |
| 651 | 3300003762 | Ga0055542_1001408 | Ga0055542_10014085 | 231 |
| 652 | 3300003763 | Ga0055529_1003209 | Ga0055529_10032094 | 231 |
| 653 | 3300005563 | Ga0068855_100008160 | Ga0068855_10000816011 | 231 |
| 654 | 3300005985 | Ga0081539_10002395 | Ga0081539_100023954 | 231 |
| 655 | 3300006178 | Ga0075367_10371192 | Ga0075367_103711921 | 231 |
| 656 | 3300009093 | Ga0105240_10249534 | Ga0105240_102495341 | 231 |
| 657 | 3300013104 | Ga0157370_10064885 | Ga0157370_100648853 | 231 |
| 658 | 3300013105 | Ga0157369_10006251 | Ga0157369_100062513 | 231 |
| 659 | 3300013307 | Ga0157372_10022080 | Ga0157372_100220802 | 231 |
| 660 | 3300025254 | Ga0209148_1000212 | Ga0209148_10002127 | 231 |
| 661 | 3300025272 | Ga0209455_1000170 | Ga0209455_100017051 | 231 |
| 662 | 3300025909 | Ga0207705_10010808 | Ga0207705_100108082 | 231 |
| 663 | 3300025949 | Ga0207667_10012351 | Ga0207667_1001235111 | 231 |
| 664 | 3300036647 | Ga0316582_0067401 | Ga0316582_0067401_542_1246 | 231 |
| 665 | 3300048090 | Ga0495615_0103679 | Ga0495615_0103679_36_740 | 231 |
| 666 | 3300049744 | Ga0501083_0033156 | Ga0501083_0033156_2496_3203 | 231 |
| 667 | 3300050490 | nmdc:mga03n38_49596_c1 | nmdc:mga03n38_49596_c1_79_786 | 231 |
| 668 | 3300050516 | nmdc:mga0sz30_57025_c1 | nmdc:mga0sz30_57025_c1_139_846 | 231 |
| 669 | iso_pu_bacteria | 2871495908 | 2871499836 | 231 |
| 670 | iso_pu_bacteria | 2876369609 | 2876373106 | 231 |
| 671 | iso_pu_bacteria | 2878760144 | 2878764000 | 231 |
| 672 | iso_pu_bacteria | 2878767105 | 2878771030 | 231 |
| 673 | iso_pu_bacteria | 2903540706 | 2903544647 | 231 |
| 674 | iso_pu_bacteria | 2924762789 | 2924766119 | 231 |
| 675 | 3300005548 | Ga0070665_100303155 | Ga0070665_1003031553 | 232 |
| 676 | 3300006358 | Ga0068871_100538950 | Ga0068871_1005389502 | 232 |
| 677 | 3300006946 | Ga0079104_1002459 | Ga0079104_10024596 | 232 |
| 678 | 3300009101 | Ga0105247_10172516 | Ga0105247_101725163 | 232 |
| 679 | 3300009177 | Ga0105248_10012216 | Ga0105248_100122166 | 232 |
| 680 | 3300014325 | Ga0163163_10220505 | Ga0163163_102205052 | 232 |
| 681 | 3300014497 | Ga0182008_10042226 | Ga0182008_100422264 | 232 |
| 682 | 3300015261 | Ga0182006_1047427 | Ga0182006_10474272 | 232 |
| 683 | 3300025941 | Ga0207711_10095829 | Ga0207711_100958292 | 232 |
| 684 | 3300027111 | Ga0209281_1000445 | Ga0209281_100044534 | 232 |
| 685 | 3300028379 | Ga0268266_10012715 | Ga0268266_100127159 | 232 |
| 686 | 3300038443 | Ga0395901_0090720 | Ga0395901_0090720_2310_3020 | 232 |
| 687 | 3300046507 | Ga0495606_0206785 | Ga0495606_0206785_72_812 | 232 |
| 688 | 3300047443 | Ga0495687_063021 | Ga0495687_063021_660_1373 | 232 |
| 689 | 3300047470 | Ga0495681_0094339 | Ga0495681_0094339_292_1005 | 232 |
| 690 | 3300048907 | Ga0496104_0245332 | Ga0496104_0245332_392_1105 | 232 |
| 691 | 3300048915 | Ga0496112_0073729 | Ga0496112_0073729_36_749 | 232 |
| 692 | 3300048916 | Ga0496113_0224774 | Ga0496113_0224774_431_1144 | 232 |
| 693 | 3300050491 | nmdc:mga00v17_115493_c1 | nmdc:mga00v17_115493_c1_512_1225 | 232 |
| 694 | 3300050492 | nmdc:mga0yw44_76772_c1 | nmdc:mga0yw44_76772_c1_342_1055 | 232 |
| 695 | 3300053155 | Ga0500620_001452 | Ga0500620_001452_3000_3716 | 232 |
| 696 | iso_pu_bacteria | 2513237305 | 2514417570 | 232 |
| 697 | iso_pu_bacteria | 2882632389 | 2882636790 | 232 |
| 698 | 3300002705 | JGI25156J39149_1013450 | JGI25156J39149_10134502 | 233 |
| 699 | 3300002741 | JGI25157J39369_1000555 | JGI25157J39369_100055520 | 233 |
| 700 | 3300025250 | Ga0209026_1000118 | Ga0209026_1000118108 | 233 |
| 701 | 3300025256 | Ga0209759_1000076 | Ga0209759_1000076151 | 233 |
| 702 | 3300025913 | Ga0207695_10461299 | Ga0207695_104612992 | 233 |
| 703 | 3300031548 | Ga0307408_100296053 | Ga0307408_1002960532 | 233 |
| 704 | 3300031903 | Ga0307407_10305387 | Ga0307407_103053872 | 233 |
| 705 | 3300031911 | Ga0307412_10308405 | Ga0307412_103084051 | 233 |
| 706 | 3300032002 | Ga0307416_101006405 | Ga0307416_1010064051 | 233 |
| 707 | 3300048928 | Ga0496125_0208006 | Ga0496125_0208006_59_772 | 233 |
| 708 | 3300049570 | Ga0501033_0022586 | Ga0501033_0022586_3532_4245 | 233 |
| 709 | 3300049572 | Ga0501036_0278911 | Ga0501036_0278911_249_962 | 233 |
| 710 | 3300049579 | Ga0501043_0009297 | Ga0501043_0009297_5336_6049 | 233 |
| 711 | 3300049581 | Ga0501047_0075152 | Ga0501047_0075152_739_1452 | 233 |
| 712 | 3300049586 | Ga0501070_0016663 | Ga0501070_0016663_5179_5892 | 233 |
| 713 | 3300049742 | Ga0501080_0042886 | Ga0501080_0042886_469_1182 | 233 |
| 714 | 3300049823 | Ga0501044_0017045 | Ga0501044_0017045_3763_4476 | 233 |
| 715 | 3300050516 | nmdc:mga0sz30_50634_c1 | nmdc:mga0sz30_50634_c1_325_1038 | 233 |
| 716 | 3300053139 | Ga0500568_0000010 | Ga0500568_0000010_77600_78310 | 233 |
| 717 | iso_pu_bacteria | 2508501127 | 2509144411 | 233 |
| 718 | iso_pu_bacteria | 2512875024 | 2512962052 | 233 |
| 719 | iso_pu_bacteria | 2513237164 | 2514039142 | 233 |
| 720 | iso_pu_bacteria | 2524023207 | 2524450898 | 233 |
| 721 | iso_pu_bacteria | 2597489875 | 2597810709 | 233 |
| 722 | iso_pu_bacteria | 2756170246 | 2756675102 | 233 |
| 723 | iso_pu_bacteria | 2871451962 | 2871457001 | 233 |
| 724 | iso_pu_bacteria | 2924733363 | 2924734850 | 233 |
| 725 | iso_pu_bacteria | 2958064165 | 2958071194 | 233 |
| 726 | iso_pu_bacteria | 2958071322 | 2958077376 | 233 |
| 727 | iso_pu_bacteria | 2970524798 | 2970526140 | 233 |
| 728 | iso_pu_bacteria | 3004167301 | 3004173302 | 233 |
| 729 | iso_pu_bacteria | 8055617313 | 8055617952 | 233 |
| 730 | 3300001989 | JGI24739J22299_10028216 | JGI24739J22299_100282163 | 234 |
| 731 | 3300002067 | JGI24735J21928_10019579 | JGI24735J21928_100195792 | 234 |
| 732 | 3300003214 | JGI25165J46597_1000079 | JGI25165J46597_100007964 | 234 |
| 733 | 3300005539 | Ga0068853_100328096 | Ga0068853_1003280962 | 234 |
| 734 | 3300005563 | Ga0068855_100463947 | Ga0068855_1004639471 | 234 |
| 735 | 3300005577 | Ga0068857_100206963 | Ga0068857_1002069632 | 234 |
| 736 | 3300005616 | Ga0068852_100191337 | Ga0068852_1001913373 | 234 |
| 737 | 3300025233 | Ga0209437_107127 | Ga0209437_1071271 | 234 |
| 738 | 3300025261 | Ga0209233_1000247 | Ga0209233_100024726 | 234 |
| 739 | 3300025261 | Ga0209233_1019681 | Ga0209233_10196812 | 234 |
| 740 | 3300025904 | Ga0207647_10009305 | Ga0207647_100093058 | 234 |
| 741 | 3300025911 | Ga0207654_10390094 | Ga0207654_103900942 | 234 |
| 742 | 3300025913 | Ga0207695_10309487 | Ga0207695_103094872 | 234 |
| 743 | 3300025924 | Ga0207694_10008166 | Ga0207694_100081666 | 234 |
| 744 | 3300026041 | Ga0207639_10149943 | Ga0207639_101499432 | 234 |
| 745 | 3300026116 | Ga0207674_10033322 | Ga0207674_100333222 | 234 |
| 746 | 3300037471 | Ga0395905_0103827 | Ga0395905_0103827_1083_1844 | 234 |
| 747 | 3300044658 | Ga0466972_0082084 | Ga0466972_0082084_580_1341 | 234 |
| 748 | iso_pu_bacteria | 2513237090 | 2513610502 | 234 |
| 749 | iso_pu_bacteria | 2588253730 | 2588519953 | 234 |
| 750 | iso_pu_bacteria | 2599185301 | 2599940126 | 234 |
| 751 | iso_pu_bacteria | 2791355092 | 2792625275 | 234 |
| 752 | iso_pu_bacteria | 2876363079 | 2876363889 | 234 |
| 753 | iso_pu_bacteria | 2903448605 | 2903454030 | 234 |
| 754 | iso_pu_bacteria | 2903521522 | 2903525952 | 234 |
| 755 | iso_pu_bacteria | 2903528002 | 2903532502 | 234 |
| 756 | iso_pu_bacteria | 2937813078 | 2937820256 | 234 |
| 757 | iso_pu_bacteria | 2958041894 | 2958046639 | 234 |
| 758 | iso_pu_bacteria | 2958100919 | 2958106546 | 234 |
| 759 | iso_pu_bacteria | 2958130278 | 2958135020 | 234 |
| 760 | iso_pu_bacteria | 2958172287 | 2958177138 | 234 |
| 761 | iso_pu_bacteria | 2958179912 | 2958184049 | 234 |
| 762 | iso_pu_bacteria | 2961077736 | 2961082104 | 234 |
| 763 | iso_pu_bacteria | 2965119406 | 2965123609 | 234 |
| 764 | iso_pu_bacteria | 2968117919 | 2968122606 | 234 |
| 765 | iso_pu_bacteria | 2977843712 | 2977847051 | 234 |
| 766 | iso_pu_bacteria | 2977942078 | 2977943294 | 234 |
| 767 | iso_pu_bacteria | 2977971508 | 2977976220 | 234 |
| 768 | iso_pu_bacteria | 2979710463 | 2979710776 | 234 |
| 769 | iso_pu_bacteria | 2979742915 | 2979747025 | 234 |
| 770 | iso_pu_bacteria | 2987636660 | 2987641584 | 234 |
| 771 | iso_pu_bacteria | 2987652177 | 2987656327 | 234 |
| 772 | iso_pu_bacteria | 3004203850 | 3004209605 | 234 |
| 773 | iso_pu_bacteria | 8004387939 | 8004392909 | 234 |
| 774 | iso_pu_bacteria | 8004640170 | 8004643856 | 234 |
| 775 | iso_pu_bacteria | 8004714634 | 8004719696 | 234 |
| 776 | 3300047472 | Ga0495686_0005687 | Ga0495686_0005687_4379_5089 | 235 |
| 777 | 3300048922 | Ga0496119_0016320 | Ga0496119_0016320_2214_2993 | 235 |
| 778 | 3300048923 | Ga0496120_0023868 | Ga0496120_0023868_1718_2497 | 235 |
| 779 | iso_pu_bacteria | 2937822353 | 2937822696 | 235 |
| 780 | iso_pu_bacteria | 2961114664 | 2961119124 | 235 |
| 781 | iso_pu_bacteria | 2961170736 | 2961176230 | 235 |
| 782 | iso_pu_bacteria | 2968110612 | 2968114875 | 235 |
| 783 | iso_pu_bacteria | 2977821940 | 2977823387 | 235 |
| 784 | iso_pu_bacteria | 2979808191 | 2979813580 | 235 |
| 785 | iso_pu_bacteria | 2987666974 | 2987667003 | 235 |
| 786 | iso_pu_bacteria | 8004374579 | 8004375749 | 235 |
| 787 | 3300005563 | Ga0068855_100310359 | Ga0068855_1003103592 | 236 |
| 788 | 3300006038 | Ga0075365_10180082 | Ga0075365_101800823 | 236 |
| 789 | 3300006051 | Ga0075364_10270979 | Ga0075364_102709792 | 236 |
| 790 | 3300006177 | Ga0075362_10034225 | Ga0075362_100342253 | 236 |
| 791 | 3300009545 | Ga0105237_10540323 | Ga0105237_105403232 | 236 |
| 792 | 3300013105 | Ga0157369_10059190 | Ga0157369_100591904 | 236 |
| 793 | 3300013307 | Ga0157372_10356875 | Ga0157372_103568752 | 236 |
| 794 | 3300025913 | Ga0207695_10364520 | Ga0207695_103645202 | 236 |
| 795 | 3300026078 | Ga0207702_10071810 | Ga0207702_100718104 | 236 |
| 796 | 3300048918 | Ga0496115_0090073 | Ga0496115_0090073_628_1407 | 236 |
| 797 | 3300048929 | Ga0496126_0155177 | Ga0496126_0155177_991_1719 | 236 |
| 798 | 3300050493 | nmdc:mga0k408_388348_c1 | nmdc:mga0k408_388348_c1_46_810 | 236 |
| 799 | iso_pu_bacteria | 2643221595 | 2643985819 | 236 |
| 800 | iso_pu_bacteria | 2643221627 | 2644157121 | 236 |
| 801 | iso_pu_bacteria | 2721755686 | 2723573188 | 236 |
| 802 | iso_pu_bacteria | 2937861824 | 2937867692 | 236 |
| 803 | iso_pu_bacteria | 2937994558 | 2937998495 | 236 |
| 804 | iso_pu_bacteria | 2958165035 | 2958168971 | 236 |
| 805 | iso_pu_bacteria | 2961163497 | 2961167433 | 236 |
| 806 | iso_pu_bacteria | 2961183825 | 2961187584 | 236 |
| 807 | iso_pu_bacteria | 2965018300 | 2965022255 | 236 |
| 808 | iso_pu_bacteria | 2968171901 | 2968175840 | 236 |
| 809 | iso_pu_bacteria | 2970510686 | 2970517239 | 236 |
| 810 | iso_pu_bacteria | 2970532167 | 2970534121 | 236 |
| 811 | iso_pu_bacteria | 2970554993 | 2970558844 | 236 |
| 812 | iso_pu_bacteria | 2970619444 | 2970621582 | 236 |
| 813 | iso_pu_bacteria | 2970627176 | 2970630673 | 236 |
| 814 | iso_pu_bacteria | 2977851361 | 2977855810 | 236 |
| 815 | iso_pu_bacteria | 2977864932 | 2977868123 | 236 |
| 816 | iso_pu_bacteria | 2977907340 | 2977913185 | 236 |
| 817 | iso_pu_bacteria | 2979764755 | 2979765957 | 236 |
| 818 | iso_pu_bacteria | 2987659509 | 2987663439 | 236 |
| 819 | iso_pu_bacteria | 2996386984 | 2996387017 | 236 |
| 820 | iso_pu_bacteria | 3004188549 | 3004192498 | 236 |
| 821 | iso_pu_bacteria | 3004232784 | 3004233962 | 236 |
| 822 | iso_pu_bacteria | 3004248173 | 3004249981 | 236 |
| 823 | iso_pu_bacteria | 8004727605 | 8004734668 | 236 |
| 824 | 3300036647 | Ga0316582_0296719 | Ga0316582_0296719_348_1097 | 237 |
| 825 | 3300037471 | Ga0395905_0069723 | Ga0395905_0069723_1979_2707 | 238 |
| 826 | 3300005548 | Ga0070665_100052306 | Ga0070665_1000523063 | 239 |
| 827 | 3300025302 | Ga0207426_1022640 | Ga0207426_10226402 | 239 |
| 828 | 3300028379 | Ga0268266_10002316 | Ga0268266_100023165 | 239 |
| 829 | 3300028379 | Ga0268266_10279701 | Ga0268266_102797012 | 239 |
| 830 | 3300046522 | Ga0495643_0025307 | Ga0495643_0025307_685_1419 | 239 |
| 831 | 3300046660 | Ga0495625_0000182 | Ga0495625_0000182_85410_86150 | 239 |
| 832 | iso_pu_bacteria | 2510065059 | 2510315060 | 239 |
| 833 | iso_pu_bacteria | 2970489779 | 2970493686 | 239 |
| 834 | iso_pu_bacteria | 2977898635 | 2977899474 | 239 |
| 835 | iso_pu_bacteria | 8004312739 | 8004318537 | 239 |
| 836 | 3300005339 | Ga0070660_100209391 | Ga0070660_1002093912 | 240 |
| 837 | 3300005455 | Ga0070663_100068052 | Ga0070663_1000680522 | 240 |
| 838 | 3300005548 | Ga0070665_100112308 | Ga0070665_1001123082 | 240 |
| 839 | 3300005548 | Ga0070665_100628597 | Ga0070665_1006285972 | 240 |
| 840 | 3300005578 | Ga0068854_100100728 | Ga0068854_1001007281 | 240 |
| 841 | 3300006038 | Ga0075365_10014555 | Ga0075365_100145555 | 240 |
| 842 | 3300006178 | Ga0075367_10099335 | Ga0075367_100993352 | 240 |
| 843 | 3300025254 | Ga0209148_1005894 | Ga0209148_10058942 | 240 |
| 844 | 3300025909 | Ga0207705_10112997 | Ga0207705_101129973 | 240 |
| 845 | 3300025914 | Ga0207671_10119104 | Ga0207671_101191043 | 240 |
| 846 | 3300025919 | Ga0207657_10056625 | Ga0207657_100566254 | 240 |
| 847 | 3300025920 | Ga0207649_10106102 | Ga0207649_101061023 | 240 |
| 848 | 3300025981 | Ga0207640_10039683 | Ga0207640_100396834 | 240 |
| 849 | 3300026067 | Ga0207678_10036692 | Ga0207678_100366923 | 240 |
| 850 | 3300028379 | Ga0268266_10005331 | Ga0268266_100053315 | 240 |
| 851 | 3300046471 | Ga0495650_0003032 | Ga0495650_0003032_2782_3552 | 240 |
| 852 | 3300047320 | Ga0495672_0067521 | Ga0495672_0067521_549_1301 | 240 |
| 853 | 3300048927 | Ga0496124_0166319 | Ga0496124_0166319_508_1287 | 240 |
| 854 | 3300050491 | nmdc:mga00v17_12374_c1 | nmdc:mga00v17_12374_c1_2451_3230 | 240 |
| 855 | iso_pu_bacteria | 2508501123 | 2509114127 | 240 |
| 856 | iso_pu_bacteria | 2512875016 | 2512933855 | 240 |
| 857 | iso_pu_bacteria | 2791355123 | 2792747241 | 240 |
| 858 | iso_pu_bacteria | 2937848649 | 2937850091 | 240 |
| 859 | iso_pu_bacteria | 2937877337 | 2937878464 | 240 |
| 860 | iso_pu_bacteria | 2958034702 | 2958041359 | 240 |
| 861 | iso_pu_bacteria | 2958041894 | 2958042333 | 240 |
| 862 | iso_pu_bacteria | 2958084443 | 2958085737 | 240 |
| 863 | iso_pu_bacteria | 2958144490 | 2958144747 | 240 |
| 864 | iso_pu_bacteria | 2963644680 | 2963645347 | 240 |
| 865 | iso_pu_bacteria | 2968016561 | 2968022879 | 240 |
| 866 | iso_pu_bacteria | 2968083720 | 2968089756 | 240 |
| 867 | iso_pu_bacteria | 2970469710 | 2970475464 | 240 |
| 868 | iso_pu_bacteria | 2970593180 | 2970599397 | 240 |
| 869 | iso_pu_bacteria | 2977922695 | 2977924551 | 240 |
| 870 | iso_pu_bacteria | 2977986579 | 2977992106 | 240 |
| 871 | iso_pu_bacteria | 2996348954 | 2996349399 | 240 |
| 872 | iso_pu_bacteria | 3004211236 | 3004216956 | 240 |
| 873 | iso_pu_bacteria | 3004218560 | 3004225450 | 240 |
| 874 | iso_pu_bacteria | 3004275668 | 3004276107 | 240 |
| 875 | iso_pu_bacteria | 3004334049 | 3004337242 | 240 |
| 876 | 3300005327 | Ga0070658_10085777 | Ga0070658_100857772 | 241 |
| 877 | 3300025909 | Ga0207705_10426788 | Ga0207705_104267882 | 241 |
| 878 | 3300048929 | Ga0496126_0003783 | Ga0496126_0003783_15477_16205 | 242 |
| 879 | 3300005548 | Ga0070665_100270158 | Ga0070665_1002701582 | 243 |
| 880 | 3300028379 | Ga0268266_10684560 | Ga0268266_106845601 | 243 |
| 881 | 3300046543 | Ga0495645_0024585 | Ga0495645_0024585_2278_3021 | 243 |
| 882 | 3300028800 | Ga0265338_10234800 | Ga0265338_102348002 | 245 |
| 883 | 3300031249 | Ga0265339_10030630 | Ga0265339_100306304 | 245 |
| 884 | 3300031344 | Ga0265316_10052088 | Ga0265316_100520884 | 245 |
| 885 | 3300009093 | Ga0105240_10287399 | Ga0105240_102873992 | 247 |
| 886 | 3300025913 | Ga0207695_10235536 | Ga0207695_102355362 | 247 |
| 887 | 3300000546 | LJNas_1000120 | LJNas_10001203 | 248 |
| 888 | 3300005355 | Ga0070671_100130795 | Ga0070671_1001307951 | 248 |
| 889 | 3300005548 | Ga0070665_100079272 | Ga0070665_1000792723 | 248 |
| 890 | 3300009545 | Ga0105237_10851545 | Ga0105237_108515451 | 248 |
| 891 | 3300013105 | Ga0157369_10021348 | Ga0157369_100213484 | 248 |
| 892 | 3300013296 | Ga0157374_10014300 | Ga0157374_100143002 | 248 |
| 893 | 3300014325 | Ga0163163_10029885 | Ga0163163_100298853 | 248 |
| 894 | 3300014969 | Ga0157376_10037849 | Ga0157376_100378492 | 248 |
| 895 | 3300025904 | Ga0207647_10039889 | Ga0207647_100398894 | 248 |
| 896 | 3300025941 | Ga0207711_10182891 | Ga0207711_101828913 | 248 |
| 897 | 3300045836 | Ga0466958_0020303 | Ga0466958_0020303_1860_2624 | 248 |
| 898 | 3300048911 | Ga0496108_0099977 | Ga0496108_0099977_1289_2047 | 248 |
| 899 | 3300048915 | Ga0496112_0243971 | Ga0496112_0243971_213_971 | 248 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dbt-assembly2.cif.gz_C-2 | crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump | 0.9702 | 17 | 242 |
| 1jjk-assembly1.cif.gz_A | selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group | 0.9604 | 19 | 241 |
| 8cso-assembly1.cif.gz_B | crystal structure of orotidine 5'-phosphate decarboxylase from klebsiella pneumoniae in complex with uridine-5'-monophosphate | 0.9581 | 18 | 242 |
| 3ru6-assembly2.cif.gz_C | 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168 | 0.9505 | 18 | 241 |
| 3ru6-assembly1.cif.gz_D | 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168 | 0.9457 | 18 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jjkA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9476 | 19 | 241 | 3.20.20.70 |
| 3ru6D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9457 | 18 | 240 | 3.20.20.70 |
| 3ru6D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9331 | 18 | 240 | 3.20.20.70 |
| 2yyuB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9295 | 18 | 241 | 3.20.20.70 |
| 1jjkA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9188 | 19 | 241 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q3AC06-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9825 | 16 | 243 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A7C3S5B3-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9784 | 15 | 241 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A3D1YY64-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9784 | 18 | 244 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A0F0CST2-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9772 | 15 | 242 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
| AF-A0A2V9V226-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) | 0.9767 | 13 | 241 |
GO:0004590
GO:0005829 GO:0006207 GO:0044205 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar