F485099

General Info

Members Datasets Scaffolds Average Seq Length
899 359 1798 276

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10000350|Ga0099794_100003509
Length 308
Sequence VSARKSPKTKTAKTVSTGKTNAVANPASSSSLGEYERAGEAADFIFSQTALRPRIALVLGSGLGAFADEFADAMKIPYAKIPHFPQSTAIGHAGKLVVGKVGAIPVAGMQGRVHLYEGYSAKEVAFPIRVFARMGVKAVILTNAAGGIKQEFVQGRLVVISDHINLQGVNPLTGPNDERFGLRFHDMTSAYDRSFREMAVGEGKRLGIGLYEGVYAGLLGPSYETPAEIRYLRAIGADLVGMSTVPEVIAARHSGIRVLGISCVTNAAAGILDQPLNHLEVLETAERVKGQFIGLLKAVIPRIAEAIA

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
135 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
136 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
226 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
227 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
228 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
229 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
230 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
251 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
254 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
261 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
282 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
287 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
288 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
329 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
347 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
353 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
354 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
355 2969141011 Bacillus velezensis MH25 Isolate Unclassified
356 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
357 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
358 637000116 Frankia casuarinae CcI3 Isolate Nodule
359 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0.56
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0.11
Rhizoplane 5.34
Rhizosphere 91.55
Stem 0
Stem Tuber 0
Unclassified 11.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10000350 3300007265 Bacteria 15802
2 JGI24752J21851_1000611 3300001976 Bacteria 4765
3 JGI24748J21848_1000012 3300002074 Bacteria 152599
4 JGI24748J21848_1006785 3300002074 Unclassified 1337
5 JGI24034J26672_10000003 3300002239 Bacteria 501747
6 JGI24034J26672_10001087 3300002239 Bacteria 3548
7 JGI24751J29686_10005274 3300002459 Bacteria 2630
8 rootH1_10220322 3300003323 Bacteria 2489
9 JGI25404J52841_10000478 3300003659 Bacteria 5756
10 Ga0065715_10003200 3300005293 Bacteria 5448
11 Ga0065707_10248901 3300005295 Bacteria 1131
12 Ga0070658_10001997 3300005327 Bacteria 17152
13 Ga0070658_10005297 3300005327 Bacteria 10472
14 Ga0070658_10163174 3300005327 Unclassified 1870
15 Ga0070676_10000224 3300005328 Bacteria 24170
16 Ga0070683_100000920 3300005329 Bacteria 21852
17 Ga0070683_100092166 3300005329 Unclassified 2846
18 Ga0070683_100319079 3300005329 Bacteria 1479
19 Ga0070690_100000380 3300005330 Bacteria 22612
20 Ga0070690_100044069 3300005330 Unclassified 2831
21 Ga0070670_100002424 3300005331 Bacteria 15374
22 Ga0070670_100016690 3300005331 Bacteria 6302
23 Ga0070670_100061693 3300005331 Unclassified 3218
24 Ga0070677_10000186 3300005333 Bacteria 21454
25 Ga0068869_100000053 3300005334 Bacteria 50209
26 Ga0068869_100060300 3300005334 Unclassified 2780
27 Ga0068869_100089012 3300005334 Unclassified 2318
28 Ga0068869_100112757 3300005334 Bacteria 2070
29 Ga0070666_10000581 3300005335 Bacteria 22113
30 Ga0070680_100012313 3300005336 Bacteria 6642
31 Ga0070680_100044990 3300005336 Bacteria 3588
32 Ga0070682_100134107 3300005337 Bacteria 1680
33 Ga0068868_100000719 3300005338 Bacteria 22345
34 Ga0070660_100000781 3300005339 Bacteria 21151
35 Ga0070660_100015979 3300005339 Bacteria 5436
36 Ga0070689_100000484 3300005340 Bacteria 23496
37 Ga0070689_100024014 3300005340 Bacteria 4570
38 Ga0070691_10032412 3300005341 Bacteria 2455
39 Ga0070687_100000039 3300005343 Bacteria 41821
40 Ga0070661_100000406 3300005344 Bacteria 33281
41 Ga0070661_100008506 3300005344 Bacteria 7099
42 Ga0070661_100069941 3300005344 Bacteria 2581
43 Ga0070661_100083412 3300005344 Bacteria 2360
44 Ga0070692_10000941 3300005345 Bacteria 9885
45 Ga0070692_10065156 3300005345 Bacteria 1928
46 Ga0070668_100002507 3300005347 Bacteria 13524
47 Ga0070668_100003133 3300005347 Bacteria 12211
48 Ga0070668_100036420 3300005347 Unclassified 3755
49 Ga0070668_100115343 3300005347 Bacteria 2141
50 Ga0070669_100000929 3300005353 Bacteria 21335
51 Ga0070675_100000924 3300005354 Bacteria 20904
52 Ga0070675_100034549 3300005354 Bacteria 4104
53 Ga0070671_100001501 3300005355 Bacteria 17456
54 Ga0070671_100478394 3300005355 Bacteria 1070
55 Ga0070674_100000553 3300005356 Bacteria 18763
56 Ga0070673_100000505 3300005364 Bacteria 20904
57 Ga0070673_100071917 3300005364 Unclassified 2780
58 Ga0070688_100000318 3300005365 Bacteria 24624
59 Ga0070688_100011825 3300005365 Unclassified 4867
60 Ga0070659_100015815 3300005366 Bacteria 5656
61 Ga0070667_100002135 3300005367 Bacteria 17438
62 Ga0070703_10003662 3300005406 Unclassified 4359
63 Ga0070709_10000305 3300005434 Bacteria 31117
64 Ga0070709_10047409 3300005434 Unclassified 2677
65 Ga0070709_10070129 3300005434 Bacteria 2259
66 Ga0070709_10119118 3300005434 Unclassified 1786
67 Ga0070714_100021657 3300005435 Bacteria 5260
68 Ga0070714_100030948 3300005435 Bacteria 4459
69 Ga0070714_100068096 3300005435 Bacteria 3071
70 Ga0070714_100210352 3300005435 Unclassified 1782
71 Ga0070714_100313087 3300005435 Bacteria 1466
72 Ga0070714_100331424 3300005435 Unclassified 1425
73 Ga0070713_100000922 3300005436 Bacteria 18743
74 Ga0070713_100011768 3300005436 Bacteria 6390
75 Ga0070713_100042431 3300005436 Unclassified 3712
76 Ga0070713_100278306 3300005436 Bacteria 1534
77 Ga0070713_100764505 3300005436 Bacteria 925
78 Ga0070710_10002298 3300005437 Bacteria 9045
79 Ga0070710_10117852 3300005437 Unclassified 1603
80 Ga0070711_100004605 3300005439 Bacteria 8164
81 Ga0070711_100017023 3300005439 Unclassified 4623
82 Ga0070711_100026898 3300005439 Unclassified 3772
83 Ga0070711_100215896 3300005439 Bacteria 1488
84 Ga0070711_100331001 3300005439 Bacteria 1219
85 Ga0070711_100356128 3300005439 Bacteria 1178
86 Ga0070705_100000433 3300005440 Bacteria 23997
87 Ga0070705_100004291 3300005440 Bacteria 6953
88 Ga0070705_100123148 3300005440 Bacteria 1678
89 Ga0070700_100002056 3300005441 Bacteria 10225
90 Ga0070694_100119322 3300005444 Bacteria 1890
91 Ga0070694_100379145 3300005444 Bacteria 1102
92 Ga0070708_100002234 3300005445 Bacteria 14975
93 Ga0070708_100007645 3300005445 Bacteria 8657
94 Ga0070708_100009440 3300005445 Bacteria 7864
95 Ga0070708_100013006 3300005445 Bacteria 6801
96 Ga0070708_100051348 3300005445 Bacteria 3653
97 Ga0070708_100080220 3300005445 Unclassified 2953
98 Ga0070708_100111653 3300005445 Bacteria 2513
99 Ga0070708_100167418 3300005445 Unclassified 2050
100 Ga0070708_100170109 3300005445 Unclassified 2034
101 Ga0070708_100550176 3300005445 Bacteria 1089
102 Ga0070663_100001100 3300005455 Bacteria 14847
103 Ga0070663_100055043 3300005455 Unclassified 2846
104 Ga0070663_100126382 3300005455 Bacteria 1937
105 Ga0070678_100000132 3300005456 Bacteria 30106
106 Ga0070678_100219391 3300005456 Bacteria 1580
107 Ga0070678_100233612 3300005456 Bacteria 1534
108 Ga0070678_100396342 3300005456 Bacteria 1198
109 Ga0070662_100002516 3300005457 Bacteria 11296
110 Ga0070681_10022842 3300005458 Bacteria 6286
111 Ga0070681_10131286 3300005458 Bacteria 2437
112 Ga0070681_10154076 3300005458 Bacteria 2224
113 Ga0068867_100002078 3300005459 Bacteria 14030
114 Ga0068867_100036546 3300005459 Unclassified 3566
115 Ga0070685_10000029 3300005466 Bacteria 89387
116 Ga0070706_100006640 3300005467 Bacteria 10916
117 Ga0070706_100018844 3300005467 Bacteria 6365
118 Ga0070706_100022657 3300005467 Bacteria 5783
119 Ga0070706_100043222 3300005467 Bacteria 4164
120 Ga0070706_100048444 3300005467 Bacteria 3921
121 Ga0070706_100355551 3300005467 Bacteria 1365
122 Ga0070707_100001060 3300005468 Bacteria 27175
123 Ga0070707_100007098 3300005468 Bacteria 10386
124 Ga0070707_100083298 3300005468 Bacteria 3090
125 Ga0070707_100088495 3300005468 Bacteria 2996
126 Ga0070707_100460481 3300005468 Bacteria 1232
127 Ga0070707_100578537 3300005468 Bacteria 1085
128 Ga0070698_100000116 3300005471 Bacteria 67960
129 Ga0070698_100002762 3300005471 Bacteria 19296
130 Ga0070698_100005605 3300005471 Bacteria 13728
131 Ga0070698_100026380 3300005471 Bacteria 6047
132 Ga0070698_100054364 3300005471 Bacteria 4065
133 Ga0070698_100065765 3300005471 Bacteria 3650
134 Ga0070698_100483878 3300005471 Bacteria 1175
135 Ga0070699_100020819 3300005518 Bacteria 5656
136 Ga0070699_100031406 3300005518 Bacteria 4584
137 Ga0070699_100128976 3300005518 Bacteria 2229
138 Ga0070699_100239927 3300005518 Bacteria 1617
139 Ga0070699_100278759 3300005518 Unclassified 1497
140 Ga0070699_100282284 3300005518 Bacteria 1487
141 Ga0070699_100715962 3300005518 Bacteria 915
142 Ga0070679_100007536 3300005530 Bacteria 10178
143 Ga0070679_100020487 3300005530 Bacteria 6448
144 Ga0070679_100029487 3300005530 Bacteria 5414
145 Ga0070679_100044745 3300005530 Bacteria 4410
146 Ga0070679_100248293 3300005530 Unclassified 1736
147 Ga0070679_100396512 3300005530 Bacteria 1326
148 Ga0070684_100021199 3300005535 Bacteria 5402
149 Ga0070684_100023361 3300005535 Bacteria 5170
150 Ga0070697_100000015 3300005536 Bacteria 143397
151 Ga0070697_100001417 3300005536 Bacteria 18209
152 Ga0070697_100011368 3300005536 Bacteria 6955
153 Ga0070697_100018316 3300005536 Bacteria 5520
154 Ga0070697_100020654 3300005536 Bacteria 5212
155 Ga0070697_100144922 3300005536 Bacteria 1999
156 Ga0070697_100203748 3300005536 Bacteria 1682
157 Ga0070697_100208043 3300005536 Bacteria 1665
158 Ga0070697_100243479 3300005536 Bacteria 1536
159 Ga0068853_100000650 3300005539 Bacteria 23854
160 Ga0068853_100001250 3300005539 Bacteria 18153
161 Ga0068853_100026872 3300005539 Unclassified 4835
162 Ga0070672_100066887 3300005543 Unclassified 2846
163 Ga0070686_100000095 3300005544 Bacteria 61204
164 Ga0070686_100009761 3300005544 Bacteria 5393
165 Ga0070695_100003672 3300005545 Bacteria 8937
166 Ga0070695_100010890 3300005545 Bacteria 5433
167 Ga0070696_100005712 3300005546 Bacteria 8304
168 Ga0070696_100113766 3300005546 Unclassified 1951
169 Ga0070693_100000899 3300005547 Bacteria 13250
170 Ga0070693_100001944 3300005547 Bacteria 9458
171 Ga0070693_100020623 3300005547 Bacteria 3480
172 Ga0070693_100028332 3300005547 Bacteria 3044
173 Ga0070665_100002353 3300005548 Bacteria 20904
174 Ga0070704_100004916 3300005549 Bacteria 7758
175 Ga0070704_100017886 3300005549 Bacteria 4522
176 Ga0070704_100154503 3300005549 Bacteria 1808
177 Ga0068855_100002236 3300005563 Bacteria 23927
178 Ga0070664_100001138 3300005564 Bacteria 21032
179 Ga0070664_100003918 3300005564 Bacteria 12012
180 Ga0070664_100153985 3300005564 Bacteria 2030
181 Ga0070664_100204896 3300005564 Bacteria 1761
182 Ga0070664_100499049 3300005564 Bacteria 1121
183 Ga0068857_100000229 3300005577 Bacteria 37362
184 Ga0068857_100004575 3300005577 Bacteria 11714
185 Ga0068857_100219934 3300005577 Bacteria 1734
186 Ga0068854_100000510 3300005578 Bacteria 23647
187 Ga0068854_100046221 3300005578 Bacteria 3099
188 Ga0068854_100290086 3300005578 Bacteria 1320
189 Ga0068856_100001505 3300005614 Bacteria 24410
190 Ga0068856_100006218 3300005614 Bacteria 11716
191 Ga0068856_100036574 3300005614 Bacteria 4813
192 Ga0068856_100094376 3300005614 Unclassified 2978
193 Ga0068856_100303978 3300005614 Bacteria 1613
194 Ga0068856_100418836 3300005614 Bacteria 1359
195 Ga0070702_100059445 3300005615 Bacteria 2218
196 Ga0068852_100000737 3300005616 Bacteria 21478
197 Ga0068852_100021336 3300005616 Bacteria 5170
198 Ga0068852_100120552 3300005616 Bacteria 2400
199 Ga0068859_100001887 3300005617 Bacteria 21358
200 Ga0068859_100030266 3300005617 Bacteria 5432
201 Ga0068859_100139723 3300005617 Bacteria 2496
202 Ga0068864_100000515 3300005618 Bacteria 33246
203 Ga0068864_100064009 3300005618 Unclassified 3188
204 Ga0068866_10000163 3300005718 Bacteria 30713
205 Ga0068866_10045896 3300005718 Unclassified 2194
206 Ga0068861_100000627 3300005719 Bacteria 20904
207 Ga0068851_10000655 3300005834 Bacteria 14771
208 Ga0068851_10005056 3300005834 Bacteria 5985
209 Ga0068870_10000020 3300005840 Bacteria 56949
210 Ga0068870_10211187 3300005840 Bacteria 1182
211 Ga0068863_100002050 3300005841 Bacteria 19955
212 Ga0068863_100006327 3300005841 Bacteria 11612
213 Ga0068863_100011083 3300005841 Bacteria 8741
214 Ga0068863_100036143 3300005841 Unclassified 4705
215 Ga0068863_100055906 3300005841 Bacteria 3737
216 Ga0068863_100265908 3300005841 Unclassified 1659
217 Ga0068858_100000052 3300005842 Bacteria 119935
218 Ga0068858_100001984 3300005842 Bacteria 20904
219 Ga0068858_100019166 3300005842 Bacteria 6401
220 Ga0068858_100090583 3300005842 Unclassified 2846
221 Ga0068858_100317856 3300005842 Bacteria 1487
222 Ga0068858_100365590 3300005842 Bacteria 1383
223 Ga0068860_100000901 3300005843 Bacteria 32961
224 Ga0068860_100003570 3300005843 Bacteria 15988
225 Ga0068860_100013865 3300005843 Bacteria 7903
226 Ga0068860_100196583 3300005843 Bacteria 1953
227 Ga0068860_100539167 3300005843 Bacteria 1168
228 Ga0068862_100000692 3300005844 Bacteria 34430
229 Ga0068862_100004205 3300005844 Bacteria 12187
230 Ga0081455_10075554 3300005937 Unclassified 2779
231 Ga0081540_1000073 3300005983 Bacteria 108893
232 Ga0081540_1000209 3300005983 Bacteria 61438
233 Ga0081540_1003942 3300005983 Bacteria 11534
234 Ga0081540_1044270 3300005983 Bacteria 2274
235 Ga0081539_10000156 3300005985 Bacteria 158871
236 Ga0081539_10000915 3300005985 Bacteria 55784
237 Ga0070717_10001271 3300006028 Bacteria 17248
238 Ga0070717_10004006 3300006028 Bacteria 10607
239 Ga0070717_10005880 3300006028 Bacteria 8984
240 Ga0070717_10006876 3300006028 Bacteria 8398
241 Ga0070717_10015963 3300006028 Bacteria 5813
242 Ga0070717_10018743 3300006028 Bacteria 5412
243 Ga0070717_10032056 3300006028 Bacteria 4231
244 Ga0070717_10043134 3300006028 Bacteria 3681
245 Ga0070717_10061399 3300006028 Bacteria 3114
246 Ga0070717_10091930 3300006028 Bacteria 2563
247 Ga0070717_10114509 3300006028 Bacteria 2304
248 Ga0070717_10220737 3300006028 Bacteria 1666
249 Ga0070717_10312201 3300006028 Bacteria 1399
250 Ga0070716_100000077 3300006173 Bacteria 37966
251 Ga0070716_100003912 3300006173 Bacteria 7075
252 Ga0070716_100010734 3300006173 Unclassified 4602
253 Ga0070716_100120766 3300006173 Bacteria 1640
254 Ga0070712_100002274 3300006175 Bacteria 11826
255 Ga0070712_100066055 3300006175 Unclassified 2570
256 Ga0070712_100317440 3300006175 Bacteria 1266
257 Ga0070712_100323571 3300006175 Bacteria 1254
258 Ga0097621_100000516 3300006237 Bacteria 27119
259 Ga0068871_100002377 3300006358 Bacteria 12832
260 Ga0068871_100004618 3300006358 Bacteria 9614
261 Ga0068871_100110200 3300006358 Bacteria 2315
262 Ga0075428_100001171 3300006844 Bacteria 28061
263 Ga0075428_100088747 3300006844 Bacteria 3373
264 Ga0075428_100606358 3300006844 Bacteria 1169
265 Ga0075431_100006607 3300006847 Bacteria 11523
266 Ga0075433_10004048 3300006852 Bacteria 11348
267 Ga0075433_10021471 3300006852 Bacteria 5414
268 Ga0075433_10040628 3300006852 Bacteria 4027
269 Ga0075433_10129670 3300006852 Bacteria 2240
270 Ga0075434_100000857 3300006871 Bacteria 24283
271 Ga0075434_100000998 3300006871 Bacteria 22952
272 Ga0075434_100024391 3300006871 Bacteria 5913
273 Ga0075434_100036771 3300006871 Bacteria 4843
274 Ga0075434_100164494 3300006871 Bacteria 2238
275 Ga0075434_100167424 3300006871 Bacteria 2217
276 Ga0075434_100241405 3300006871 Unclassified 1827
277 Ga0075434_100731001 3300006871 Bacteria 1007
278 Ga0068865_100000545 3300006881 Bacteria 20904
279 Ga0075436_100008041 3300006914 Bacteria 7220
280 Ga0075436_100038031 3300006914 Bacteria 3322
281 Ga0075436_100111704 3300006914 Bacteria 1908
282 Ga0075436_100199547 3300006914 Bacteria 1417
283 Ga0097620_100001887 3300006931 Bacteria 21358
284 Ga0097620_100030267 3300006931 Bacteria 5432
285 Ga0097620_100139732 3300006931 Bacteria 2496
286 Ga0075435_100000556 3300007076 Bacteria 22959
287 Ga0075435_100013847 3300007076 Bacteria 6013
288 Ga0075435_100017964 3300007076 Bacteria 5363
289 Ga0075435_100065237 3300007076 Bacteria 2960
290 Ga0075435_100101680 3300007076 Bacteria 2382
291 Ga0075435_100134133 3300007076 Bacteria 2073
292 Ga0075435_100210029 3300007076 Unclassified 1651
293 Ga0075435_100285546 3300007076 Bacteria 1409
294 Ga0099794_10008967 3300007265 Unclassified 4175
295 Ga0099794_10020363 3300007265 Bacteria 3001
296 Ga0099794_10031940 3300007265 Bacteria 2468
297 Ga0099794_10066220 3300007265 Bacteria 1763
298 Ga0099794_10102664 3300007265 Bacteria 1428
299 Ga0099794_10146586 3300007265 Bacteria 1197
300 Ga0099794_10166100 3300007265 Bacteria 1124
301 Ga0105250_10069540 3300009092 Bacteria 1421
302 Ga0105240_10004283 3300009093 Bacteria 21801
303 Ga0105240_10420990 3300009093 Bacteria 1501
304 Ga0111539_10177758 3300009094 Bacteria 2486
305 Ga0111539_10281818 3300009094 Bacteria 1934
306 Ga0105245_10013162 3300009098 Bacteria 7209
307 Ga0105245_10040190 3300009098 Unclassified 4166
308 Ga0105245_10106560 3300009098 Bacteria 2601
309 Ga0105245_10308489 3300009098 Bacteria 1555
310 Ga0105247_10000003 3300009101 Bacteria 694517
311 Ga0105247_10000214 3300009101 Bacteria 56190
312 Ga0105247_10088721 3300009101 Bacteria 1960
313 Ga0105247_10116497 3300009101 Bacteria 1726
314 Ga0105247_10121114 3300009101 Bacteria 1695
315 Ga0105247_10241556 3300009101 Bacteria 1231
316 Ga0114129_10000201 3300009147 Bacteria 66395
317 Ga0114129_10007058 3300009147 Bacteria 15993
318 Ga0114129_10008742 3300009147 Bacteria 14441
319 Ga0114129_10052936 3300009147 Bacteria 5695
320 Ga0114129_10126174 3300009147 Bacteria 3518
321 Ga0105243_10001203 3300009148 Bacteria 23303
322 Ga0105243_10176501 3300009148 Bacteria 1855
323 Ga0105241_10001583 3300009174 Bacteria 17415
324 Ga0105241_10042177 3300009174 Bacteria 3451
325 Ga0105241_10066264 3300009174 Bacteria 2792
326 Ga0105241_10397922 3300009174 Bacteria 1207
327 Ga0105242_10003402 3300009176 Bacteria 12372
328 Ga0105242_10027989 3300009176 Bacteria 4482
329 Ga0105242_10103390 3300009176 Bacteria 2417
330 Ga0105242_10274504 3300009176 Bacteria 1528
331 Ga0105248_10002038 3300009177 Bacteria 22389
332 Ga0105248_10194132 3300009177 Bacteria 2287
333 Ga0105237_10000421 3300009545 Bacteria 60441
334 Ga0105238_10000359 3300009551 Bacteria 48860
335 Ga0105238_10003254 3300009551 Bacteria 16214
336 Ga0105238_10018855 3300009551 Bacteria 7023
337 Ga0105249_10000494 3300009553 Bacteria 36412
338 Ga0105249_10002142 3300009553 Bacteria 17106
339 Ga0105249_10006198 3300009553 Bacteria 10383
340 Ga0105249_10027248 3300009553 Bacteria 5156
341 Ga0105249_10083789 3300009553 Unclassified 2968
342 Ga0105239_10001190 3300010375 Bacteria 35590
343 Ga0105239_10054754 3300010375 Bacteria 4376
344 Ga0105246_10004738 3300011119 Bacteria 8286
345 Ga0105246_10055158 3300011119 Unclassified 2742
346 Ga0157373_10001697 3300013100 Bacteria 16792
347 Ga0157371_10000366 3300013102 Bacteria 57015
348 Ga0157371_10160541 3300013102 Bacteria 1605
349 Ga0157369_10003549 3300013105 Bacteria 18529
350 Ga0157369_10039939 3300013105 Bacteria 5126
351 Ga0157369_10060727 3300013105 Bacteria 4076
352 Ga0157369_10158543 3300013105 Bacteria 2389
353 Ga0157374_10000753 3300013296 Bacteria 28294
354 Ga0157374_10049507 3300013296 Bacteria 3903
355 Ga0157378_10000538 3300013297 Bacteria 36003
356 Ga0157378_10000791 3300013297 Bacteria 29391
357 Ga0157378_10021440 3300013297 Bacteria 5682
358 Ga0157378_10023477 3300013297 Bacteria 5427
359 Ga0157378_10074664 3300013297 Bacteria 3051
360 Ga0163162_10000023 3300013306 Bacteria 193395
361 Ga0163162_10001463 3300013306 Bacteria 21952
362 Ga0163162_10005173 3300013306 Bacteria 12580
363 Ga0163162_10058772 3300013306 Unclassified 3875
364 Ga0163162_10413574 3300013306 Bacteria 1481
365 Ga0163162_10464291 3300013306 Bacteria 1398
366 Ga0157372_10006351 3300013307 Bacteria 12571
367 Ga0157372_10028369 3300013307 Bacteria 6107
368 Ga0157372_10082436 3300013307 Unclassified 3641
369 Ga0157375_10001223 3300013308 Bacteria 22163
370 Ga0157375_10233394 3300013308 Bacteria 1999
371 Ga0163163_10000844 3300014325 Bacteria 26053
372 Ga0163163_10044651 3300014325 Unclassified 4348
373 Ga0163163_10137725 3300014325 Bacteria 2483
374 Ga0157380_10069116 3300014326 Bacteria 2849
375 Ga0157380_10406002 3300014326 Bacteria 1294
376 Ga0157380_10729320 3300014326 Bacteria 1000
377 Ga0157377_10005614 3300014745 Bacteria 5911
378 Ga0157377_10095983 3300014745 Bacteria 1758
379 Ga0157379_10000868 3300014968 Bacteria 24452
380 Ga0157379_10000892 3300014968 Bacteria 24134
381 Ga0157379_10001230 3300014968 Bacteria 20786
382 Ga0157379_10055638 3300014968 Bacteria 3535
383 Ga0157379_10283883 3300014968 Bacteria 1507
384 Ga0157376_10000032 3300014969 Bacteria 167294
385 Ga0157376_10000590 3300014969 Bacteria 23408
386 Ga0157376_10000629 3300014969 Bacteria 22878
387 Ga0182007_10008481 3300015262 Unclassified 4218
388 Ga0163161_10016205 3300017792 Bacteria 5201
389 Ga0163161_10402941 3300017792 Bacteria 1097
390 Ga0206353_11777813 3300020082 Bacteria 1451
391 Ga0213872_10005062 3300021361 Bacteria 6837
392 Ga0213872_10123175 3300021361 Unclassified 1145
393 Ga0213874_10057603 3300021377 Bacteria 1209
394 Ga0213876_10000282 3300021384 Bacteria 46388
395 Ga0213871_10004327 3300021441 Bacteria 2831
396 Ga0228598_1026488 3300024227 Unclassified 1140
397 Ga0207672_1000061 3300025223 Bacteria 14428
398 Ga0207697_10002581 3300025315 Bacteria 9331
399 Ga0207697_10007233 3300025315 Bacteria 4960
400 Ga0207656_10000118 3300025321 Bacteria 30233
401 Ga0207656_10009662 3300025321 Unclassified 3585
402 Ga0207653_10003573 3300025885 Unclassified 4897
403 Ga0207682_10000028 3300025893 Bacteria 58704
404 Ga0207692_10006538 3300025898 Bacteria 4731
405 Ga0207692_10033574 3300025898 Unclassified 2477
406 Ga0207642_10017845 3300025899 Bacteria 2709
407 Ga0207642_10184173 3300025899 Bacteria 1140
408 Ga0207710_10000001 3300025900 Bacteria 1797433
409 Ga0207710_10000971 3300025900 Bacteria 15075
410 Ga0207710_10083469 3300025900 Bacteria 1485
411 Ga0207688_10007178 3300025901 Bacteria 6060
412 Ga0207688_10074374 3300025901 Bacteria 1932
413 Ga0207680_10001631 3300025903 Bacteria 10613
414 Ga0207680_10012422 3300025903 Bacteria 4335
415 Ga0207647_10015608 3300025904 Bacteria 5202
416 Ga0207647_10051399 3300025904 Bacteria 2547
417 Ga0207685_10114747 3300025905 Bacteria 1173
418 Ga0207699_10002217 3300025906 Bacteria 9162
419 Ga0207699_10031494 3300025906 Unclassified 2978
420 Ga0207699_10157678 3300025906 Bacteria 1508
421 Ga0207699_10173534 3300025906 Bacteria 1444
422 Ga0207645_10000053 3300025907 Bacteria 83208
423 Ga0207645_10001227 3300025907 Bacteria 21125
424 Ga0207645_10051817 3300025907 Bacteria 2623
425 Ga0207643_10000013 3300025908 Bacteria 130464
426 Ga0207643_10006285 3300025908 Bacteria 6358
427 Ga0207705_10015725 3300025909 Bacteria 5433
428 Ga0207705_10077480 3300025909 Bacteria 2418
429 Ga0207684_10002255 3300025910 Bacteria 19641
430 Ga0207684_10020820 3300025910 Bacteria 5603
431 Ga0207684_10033176 3300025910 Bacteria 4391
432 Ga0207684_10039566 3300025910 Bacteria 3998
433 Ga0207684_10040272 3300025910 Bacteria 3962
434 Ga0207684_10094636 3300025910 Bacteria 2548
435 Ga0207684_10300122 3300025910 Bacteria 1385
436 Ga0207684_10366231 3300025910 Bacteria 1240
437 Ga0207654_10020659 3300025911 Bacteria 3495
438 Ga0207654_10056836 3300025911 Bacteria 2272
439 Ga0207707_10068805 3300025912 Bacteria 3085
440 Ga0207707_10131778 3300025912 Bacteria 2186
441 Ga0207707_10133199 3300025912 Bacteria 2174
442 Ga0207707_10182918 3300025912 Bacteria 1829
443 Ga0207695_10004014 3300025913 Bacteria 20254
444 Ga0207671_10000884 3300025914 Bacteria 37963
445 Ga0207693_10000067 3300025915 Bacteria 91025
446 Ga0207693_10018302 3300025915 Bacteria 5582
447 Ga0207693_10023756 3300025915 Bacteria 4865
448 Ga0207693_10024033 3300025915 Bacteria 4838
449 Ga0207693_10053314 3300025915 Bacteria 3173
450 Ga0207693_10097723 3300025915 Bacteria 2302
451 Ga0207693_10108854 3300025915 Bacteria 2174
452 Ga0207693_10209858 3300025915 Bacteria 1531
453 Ga0207693_10358296 3300025915 Bacteria 1141
454 Ga0207663_10013386 3300025916 Unclassified 4458
455 Ga0207663_10019141 3300025916 Bacteria 3850
456 Ga0207663_10063469 3300025916 Unclassified 2352
457 Ga0207663_10164419 3300025916 Unclassified 1570
458 Ga0207663_10176077 3300025916 Bacteria 1524
459 Ga0207663_10258286 3300025916 Bacteria 1285
460 Ga0207660_10008522 3300025917 Bacteria 6633
461 Ga0207660_10021173 3300025917 Bacteria 4371
462 Ga0207660_10219348 3300025917 Bacteria 1492
463 Ga0207662_10000009 3300025918 Bacteria 95358
464 Ga0207662_10002842 3300025918 Bacteria 8753
465 Ga0207662_10044078 3300025918 Bacteria 2633
466 Ga0207657_10000042 3300025919 Bacteria 118735
467 Ga0207657_10023284 3300025919 Bacteria 5771
468 Ga0207657_10047938 3300025919 Bacteria 3732
469 Ga0207649_10001939 3300025920 Bacteria 11784
470 Ga0207649_10002049 3300025920 Bacteria 11461
471 Ga0207652_10013588 3300025921 Bacteria 6583
472 Ga0207652_10053635 3300025921 Bacteria 3464
473 Ga0207646_10000054 3300025922 Bacteria 160414
474 Ga0207646_10000305 3300025922 Bacteria 66759
475 Ga0207646_10036483 3300025922 Bacteria 4437
476 Ga0207646_10040993 3300025922 Bacteria 4163
477 Ga0207646_10077168 3300025922 Bacteria 2978
478 Ga0207646_10170809 3300025922 Bacteria 1963
479 Ga0207646_10231453 3300025922 Unclassified 1669
480 Ga0207646_10283657 3300025922 Bacteria 1497
481 Ga0207681_10000159 3300025923 Bacteria 56045
482 Ga0207681_10259586 3300025923 Bacteria 1360
483 Ga0207694_10000788 3300025924 Bacteria 28497
484 Ga0207694_10113578 3300025924 Bacteria 2157
485 Ga0207694_10620914 3300025924 Bacteria 909
486 Ga0207650_10000152 3300025925 Bacteria 83134
487 Ga0207650_10000445 3300025925 Bacteria 35419
488 Ga0207650_10339148 3300025925 Bacteria 1234
489 Ga0207659_10000098 3300025926 Bacteria 51164
490 Ga0207659_10028596 3300025926 Bacteria 3790
491 Ga0207687_10035721 3300025927 Bacteria 3382
492 Ga0207687_10099369 3300025927 Bacteria 2138
493 Ga0207687_10302840 3300025927 Unclassified 1288
494 Ga0207700_10006884 3300025928 Bacteria 6912
495 Ga0207700_10082658 3300025928 Bacteria 2512
496 Ga0207700_10121754 3300025928 Eukaryota 2117
497 Ga0207664_10095040 3300025929 Bacteria 2451
498 Ga0207664_10208372 3300025929 Bacteria 1690
499 Ga0207664_10250789 3300025929 Unclassified 1545
500 Ga0207644_10000603 3300025931 Bacteria 22852
501 Ga0207644_10001827 3300025931 Bacteria 13817
502 Ga0207644_10015007 3300025931 Bacteria 5195
503 Ga0207690_10002207 3300025932 Bacteria 11874
504 Ga0207690_10024946 3300025932 Bacteria 3748
505 Ga0207690_10034129 3300025932 Bacteria 3276
506 Ga0207706_10000046 3300025933 Bacteria 119273
507 Ga0207706_10000997 3300025933 Bacteria 28833
508 Ga0207706_10024630 3300025933 Bacteria 5394
509 Ga0207686_10026156 3300025934 Bacteria 3403
510 Ga0207686_10027990 3300025934 Bacteria 3307
511 Ga0207686_10206422 3300025934 Bacteria 1410
512 Ga0207709_10002043 3300025935 Bacteria 13060
513 Ga0207670_10000494 3300025936 Bacteria 21764
514 Ga0207670_10028206 3300025936 Bacteria 3560
515 Ga0207669_10000156 3300025937 Bacteria 32361
516 Ga0207704_10000142 3300025938 Bacteria 38359
517 Ga0207665_10000028 3300025939 Bacteria 96657
518 Ga0207665_10002791 3300025939 Bacteria 11705
519 Ga0207665_10010969 3300025939 Bacteria 5948
520 Ga0207665_10014872 3300025939 Bacteria 5114
521 Ga0207665_10024988 3300025939 Bacteria 3939
522 Ga0207665_10108834 3300025939 Bacteria 1945
523 Ga0207665_10155741 3300025939 Bacteria 1640
524 Ga0207665_10193566 3300025939 Unclassified 1478
525 Ga0207665_10196113 3300025939 Bacteria 1469
526 Ga0207691_10000424 3300025940 Bacteria 41981
527 Ga0207691_10080693 3300025940 Unclassified 2925
528 Ga0207711_10000582 3300025941 Bacteria 37108
529 Ga0207711_10005299 3300025941 Bacteria 10933
530 Ga0207689_10000071 3300025942 Bacteria 82580
531 Ga0207689_10010738 3300025942 Bacteria 7880
532 Ga0207689_10019760 3300025942 Bacteria 5675
533 Ga0207689_10099776 3300025942 Unclassified 2386
534 Ga0207661_10001036 3300025944 Bacteria 18457
535 Ga0207661_10003627 3300025944 Bacteria 10749
536 Ga0207661_10275636 3300025944 Bacteria 1502
537 Ga0207661_10443578 3300025944 Bacteria 1181
538 Ga0207679_10000111 3300025945 Bacteria 66057
539 Ga0207679_10000469 3300025945 Bacteria 28287
540 Ga0207679_10141945 3300025945 Bacteria 1943
541 Ga0207667_10001419 3300025949 Bacteria 29991
542 Ga0207651_10000110 3300025960 Bacteria 35015
543 Ga0207712_10000785 3300025961 Bacteria 23685
544 Ga0207712_10000854 3300025961 Bacteria 22213
545 Ga0207712_10519749 3300025961 Unclassified 1020
546 Ga0207668_10000657 3300025972 Bacteria 21213
547 Ga0207668_10001179 3300025972 Bacteria 15521
548 Ga0207668_10009454 3300025972 Bacteria 5844
549 Ga0207640_10000497 3300025981 Bacteria 23939
550 Ga0207640_10298071 3300025981 Bacteria 1274
551 Ga0207640_10318377 3300025981 Unclassified 1237
552 Ga0207658_10000736 3300025986 Bacteria 28243
553 Ga0207658_10041767 3300025986 Unclassified 3322
554 Ga0207658_10251937 3300025986 Bacteria 1501
555 Ga0207677_10000492 3300026023 Bacteria 25634
556 Ga0207677_10078951 3300026023 Bacteria 2352
557 Ga0207677_10449336 3300026023 Bacteria 1104
558 Ga0207703_10000303 3300026035 Bacteria 54018
559 Ga0207703_10000406 3300026035 Bacteria 46246
560 Ga0207703_10014323 3300026035 Bacteria 6186
561 Ga0207703_10019932 3300026035 Bacteria 5241
562 Ga0207639_10000612 3300026041 Bacteria 24578
563 Ga0207639_10005469 3300026041 Bacteria 8583
564 Ga0207639_10012900 3300026041 Bacteria 5830
565 Ga0207678_10001602 3300026067 Bacteria 20820
566 Ga0207678_10010230 3300026067 Bacteria 8236
567 Ga0207678_10089793 3300026067 Bacteria 2626
568 Ga0207708_10025320 3300026075 Bacteria 4488
569 Ga0207708_10252658 3300026075 Unclassified 1421
570 Ga0207702_10006363 3300026078 Bacteria 10195
571 Ga0207702_10012630 3300026078 Bacteria 7031
572 Ga0207702_10024347 3300026078 Bacteria 5023
573 Ga0207702_10038618 3300026078 Bacteria 3998
574 Ga0207702_10040486 3300026078 Bacteria 3906
575 Ga0207702_10299956 3300026078 Bacteria 1525
576 Ga0207641_10000052 3300026088 Bacteria 173672
577 Ga0207641_10000918 3300026088 Bacteria 30377
578 Ga0207641_10001136 3300026088 Bacteria 26731
579 Ga0207641_10008550 3300026088 Bacteria 8456
580 Ga0207641_10054301 3300026088 Bacteria 3399
581 Ga0207641_10079691 3300026088 Bacteria 2840
582 Ga0207648_10000852 3300026089 Bacteria 34458
583 Ga0207648_10001157 3300026089 Bacteria 29556
584 Ga0207676_10000398 3300026095 Bacteria 36746
585 Ga0207676_10001279 3300026095 Bacteria 18699
586 Ga0207674_10000038 3300026116 Bacteria 132350
587 Ga0207674_10033229 3300026116 Bacteria 5402
588 Ga0207674_10098172 3300026116 Bacteria 2913
589 Ga0207675_100000565 3300026118 Bacteria 36276
590 Ga0207675_100017316 3300026118 Bacteria 6728
591 Ga0207675_100118502 3300026118 Bacteria 2503
592 Ga0207683_10000837 3300026121 Bacteria 28145
593 Ga0207683_10000885 3300026121 Bacteria 27525
594 Ga0207683_10078072 3300026121 Bacteria 2933
595 Ga0207698_10000519 3300026142 Bacteria 22380
596 Ga0207698_10044616 3300026142 Unclassified 3333
597 Ga0209995_1018260 3300027471 Bacteria 1156
598 Ga0209983_1003242 3300027665 Bacteria 3490
599 Ga0209588_1001160 3300027671 Bacteria 6798
600 Ga0209588_1003408 3300027671 Bacteria 4409
601 Ga0209588_1007189 3300027671 Bacteria 3266
602 Ga0209588_1019289 3300027671 Unclassified 2128
603 Ga0209971_1000218 3300027682 Bacteria 17035
604 Ga0209998_10004009 3300027717 Bacteria 3156
605 Ga0209974_10000140 3300027876 Bacteria 21625
606 Ga0265354_1003961 3300028016 Bacteria 1598
607 Ga0268266_10000072 3300028379 Bacteria 232245
608 Ga0268266_10000389 3300028379 Bacteria 66723
609 Ga0268265_10000592 3300028380 Bacteria 36516
610 Ga0268265_10018692 3300028380 Bacteria 4805
611 Ga0268265_10042990 3300028380 Unclassified 3355
612 Ga0268264_10000191 3300028381 Bacteria 127257
613 Ga0268264_10002754 3300028381 Bacteria 15352
614 Ga0268264_10028224 3300028381 Bacteria 4588
615 Ga0268264_10047540 3300028381 Bacteria 3568
616 Ga0268264_10158185 3300028381 Bacteria 2038
617 Ga0268264_10262853 3300028381 Bacteria 1608
618 Ga0268264_10586501 3300028381 Bacteria 1097
619 Ga0265334_10040666 3300028573 Bacteria 1820
620 Ga0265338_10002968 3300028800 Bacteria 24614
621 Ga0265338_10057562 3300028800 Bacteria 3438
622 Ga0265338_10063139 3300028800 Bacteria 3232
623 Ga0265338_10430266 3300028800 Bacteria 937
624 Ga0265770_1001131 3300030878 Bacteria 3678
625 Ga0265760_10001557 3300031090 Bacteria 6751
626 Ga0265760_10002657 3300031090 Bacteria 5230
627 Ga0265760_10020155 3300031090 Unclassified 1923
628 Ga0265325_10081168 3300031241 Bacteria 1612
629 Ga0265329_10015457 3300031242 Unclassified 2666
630 Ga0265339_10000995 3300031249 Bacteria 21726
631 Ga0265339_10007220 3300031249 Bacteria 7199
632 Ga0265339_10078526 3300031249 Bacteria 1747
633 Ga0265316_10001965 3300031344 Bacteria 21613
634 Ga0265316_10004297 3300031344 Bacteria 14230
635 Ga0265316_10030725 3300031344 Unclassified 4399
636 Ga0265316_10173604 3300031344 Unclassified 1607
637 Ga0307513_10015270 3300031456 Bacteria 9317
638 Ga0265314_10000011 3300031711 Bacteria 445050
639 Ga0265314_10008888 3300031711 Bacteria 8569
640 Ga0265314_10043416 3300031711 Bacteria 3197
641 Ga0316576_10000948 3300031727 Bacteria 14832
642 Ga0316576_10107849 3300031727 Bacteria 2086
643 Ga0316578_10198760 3300031728 Unclassified 1207
644 Ga0316214_1003527 3300033545 Bacteria 1975
645 Ga0316212_1001460 3300033547 Bacteria 3214
646 Ga0373926_0074133 3300035083 Unclassified 1253
647 Ga0373934_0043047 3300035086 Unclassified 1785
648 Ga0373934_0105464 3300035086 Bacteria 1141
649 Ga0373954_0000232 3300035118 Bacteria 20294
650 Ga0373956_0006050 3300035119 Unclassified 4846
651 Ga0373943_0037050 3300035170 Bacteria 2340
652 Ga0373955_0004388 3300035172 Bacteria 6240
653 Ga0373955_0215764 3300035172 Bacteria 1145
654 Ga0373924_0063399 3300035410 Bacteria 1550
655 Ga0373931_0059161 3300035691 Bacteria 2060
656 Ga0373931_0154992 3300035691 Bacteria 1338
657 Ga0373931_0482736 3300035691 Bacteria 797
658 Ga0373927_0000181 3300035695 Bacteria 49692
659 Ga0373933_0001080 3300035724 Bacteria 16381
660 Ga0373947_0006847 3300035725 Bacteria 6610
661 Ga0373947_0019837 3300035725 Unclassified 3880
662 Ga0373947_0121016 3300035725 Bacteria 1663
663 Ga0373937_0295577 3300036401 Bacteria 1530
664 Ga0316584_0000032 3300036712 Bacteria 49300
665 Ga0373925_0016750 3300037068 Bacteria 5308
666 Ga0373925_0350525 3300037068 Bacteria 1199
667 Ga0395900_0047532 3300037418 Bacteria 4419
668 Ga0436364_1345024 3300037853 Bacteria 6229
669 Ga0400489_81848 3300039093 Bacteria 1651
670 Ga0436365_0740107 3300039437 Bacteria 83165
671 Ga0436365_1419515 3300039437 Unclassified 2637
672 Ga0436360_1132016 3300039438 Bacteria 1450
673 Ga0436361_0004293 3300039447 Bacteria 26289
674 Ga0436361_0365763 3300039447 Bacteria 13534
675 Ga0436361_0706744 3300039447 Bacteria 22706
676 Ga0436363_0846422 3300039450 Bacteria 1291
677 Ga0436363_1072660 3300039450 Bacteria 5649
678 Ga0436362_0975535 3300039453 Unclassified 2777
679 Ga0439455_0005219 3300042012 Bacteria 2624
680 Ga0451577_0015389 3300042876 Bacteria 7118
681 Ga0451577_0080954 3300042876 Bacteria 2896
682 Ga0451577_0096172 3300042876 Bacteria 2644
683 Ga0451577_0191960 3300042876 Bacteria 1842
684 Ga0451577_0580203 3300042876 Bacteria 1018
685 Ga0466972_0136076 3300044658 Bacteria 1157
686 Ga0453683_0011172 3300044673 Bacteria 5935
687 Ga0453683_0023057 3300044673 Bacteria 3967
688 Ga0453683_0038859 3300044673 Bacteria 2992
689 Ga0453683_0090385 3300044673 Bacteria 1919
690 Ga0453683_0130322 3300044673 Bacteria 1584
691 Ga0466966_0156264 3300044684 Bacteria 1389
692 Ga0466964_0076480 3300044706 Unclassified 1427
693 Ga0453684_0010033 3300044712 Bacteria 16299
694 Ga0453684_0147176 3300044712 Bacteria 2804
695 Ga0453684_0239686 3300044712 Bacteria 2088
696 Ga0466968_0053592 3300044735 Unclassified 1728
697 Ga0466957_0092784 3300044842 Bacteria 1894
698 Ga0466960_0051866 3300044901 Bacteria 1983
699 Ga0466959_0009944 3300045049 Bacteria 6781
700 Ga0466959_0269387 3300045049 Unclassified 1171
701 Ga0451576_0020333 3300045051 Bacteria 7231
702 Ga0451576_0184358 3300045051 Bacteria 2179
703 Ga0451576_0237779 3300045051 Unclassified 1902
704 Ga0451576_0561274 3300045051 Bacteria 1199
705 Ga0451576_0905594 3300045051 Bacteria 925
706 Ga0466967_0019685 3300045976 Bacteria 5434
707 Ga0466967_0132192 3300045976 Unclassified 2318
708 Ga0466967_0339289 3300045976 Bacteria 1453
709 Ga0466967_0864593 3300045976 Bacteria 899
710 Ga0495603_0048438 3300046455 Bacteria 2530
711 Ga0495629_0060478 3300046459 Bacteria 2648
712 Ga0495629_0070849 3300046459 Bacteria 2433
713 Ga0495629_0126671 3300046459 Unclassified 1779
714 Ga0495641_0023994 3300046461 Bacteria 3018
715 Ga0495651_0052148 3300046462 Unclassified 3151
716 Ga0495651_0080986 3300046462 Bacteria 2452
717 Ga0495653_0009074 3300046463 Bacteria 8134
718 Ga0495653_0150702 3300046463 Bacteria 1625
719 Ga0495580_0011933 3300046472 Bacteria 6696
720 Ga0495580_0015648 3300046472 Bacteria 5716
721 Ga0495580_0018168 3300046472 Bacteria 5240
722 Ga0495580_0022593 3300046472 Bacteria 4627
723 Ga0495580_0031805 3300046472 Bacteria 3811
724 Ga0495580_0051450 3300046472 Bacteria 2912
725 Ga0495580_0301758 3300046472 Unclassified 1090
726 Ga0495580_0330215 3300046472 Bacteria 1036
727 Ga0495582_0000718 3300046473 Bacteria 18242
728 Ga0495582_0009025 3300046473 Bacteria 5503
729 Ga0495582_0032511 3300046473 Bacteria 2868
730 Ga0495582_0126326 3300046473 Bacteria 1443
731 Ga0495639_0005520 3300046475 Bacteria 5445
732 Ga0495594_0067896 3300046499 Unclassified 1979
733 Ga0495606_0201206 3300046507 Bacteria 1135
734 Ga0495608_0022524 3300046511 Unclassified 4319
735 Ga0495608_0082787 3300046511 Bacteria 2083
736 Ga0495618_0121135 3300046514 Bacteria 1675
737 Ga0495628_0136848 3300046516 Bacteria 1871
738 Ga0495628_0251257 3300046516 Bacteria 1320
739 Ga0495630_0022984 3300046517 Bacteria 4607
740 Ga0495630_0033365 3300046517 Bacteria 3838
741 Ga0495632_0087326 3300046519 Bacteria 1483
742 Ga0495666_0060133 3300046526 Unclassified 1816
743 Ga0495652_0186105 3300046529 Bacteria 1589
744 Ga0495652_0210082 3300046529 Bacteria 1470
745 Ga0495640_0110642 3300046533 Bacteria 1795
746 Ga0495640_0131888 3300046533 Unclassified 1616
747 Ga0495587_0009545 3300046536 Bacteria 6213
748 Ga0495587_0010261 3300046536 Bacteria 5970
749 Ga0495645_0160494 3300046543 Bacteria 1555
750 Ga0495667_0062472 3300046559 Unclassified 2441
751 Ga0495634_0022616 3300046642 Bacteria 4429
752 Ga0495623_0010766 3300046679 Bacteria 5922
753 Ga0495646_0019063 3300046680 Bacteria 4346
754 Ga0495647_0011255 3300046681 Unclassified 3063
755 Ga0495658_0009614 3300046683 Bacteria 4821
756 Ga0495658_0013750 3300046683 Bacteria 4125
757 Ga0495658_0066613 3300046683 Bacteria 2081
758 Ga0495658_0241899 3300046683 Bacteria 1133
759 Ga0495669_0001200 3300046684 Bacteria 10772
760 Ga0495613_0191987 3300046689 Bacteria 1443
761 Ga0495624_0109580 3300046690 Unclassified 1698
762 Ga0495581_0150638 3300047315 Bacteria 1358
763 Ga0495604_0001179 3300047317 Bacteria 21612
764 Ga0495604_0008173 3300047317 Bacteria 8280
765 Ga0495674_0039608 3300047319 Bacteria 4222
766 Ga0495676_0013478 3300047321 Bacteria 7348
767 Ga0495676_0184614 3300047321 Bacteria 1459
768 Ga0495680_0008472 3300047322 Bacteria 9342
769 Ga0495680_0008611 3300047322 Bacteria 9263
770 Ga0495675_0055208 3300047444 Bacteria 2519
771 Ga0495684_0037833 3300047471 Bacteria 3701
772 Ga0495684_0071472 3300047471 Bacteria 2637
773 Ga0495593_0124505 3300047673 Bacteria 1311
774 Ga0495602_0002035 3300048088 Bacteria 20336
775 Ga0495602_0020663 3300048088 Bacteria 6503
776 Ga0495614_0122466 3300048089 Bacteria 1147
777 Ga0496100_0050705 3300048903 Bacteria 2690
778 Ga0496100_0076158 3300048903 Bacteria 2252
779 Ga0496100_0271742 3300048903 Bacteria 1261
780 Ga0496101_0020948 3300048904 Bacteria 4486
781 Ga0496101_0021969 3300048904 Bacteria 4387
782 Ga0496101_0154953 3300048904 Bacteria 1754
783 Ga0496101_0174893 3300048904 Unclassified 1651
784 Ga0496102_0000127 3300048905 Bacteria 104838
785 Ga0496102_0002989 3300048905 Bacteria 14314
786 Ga0496102_0005081 3300048905 Bacteria 11142
787 Ga0496102_0050463 3300048905 Bacteria 3788
788 Ga0496102_0237037 3300048905 Unclassified 1720
789 Ga0496103_0000134 3300048906 Bacteria 77847
790 Ga0496103_0000805 3300048906 Bacteria 23089
791 Ga0496103_0191651 3300048906 Bacteria 1314
792 Ga0496104_0010488 3300048907 Bacteria 8278
793 Ga0496104_0013301 3300048907 Bacteria 7420
794 Ga0496104_0123334 3300048907 Bacteria 2487
795 Ga0496104_0162228 3300048907 Bacteria 2144
796 Ga0496104_0262685 3300048907 Unclassified 1639
797 Ga0496105_0012552 3300048908 Bacteria 6710
798 Ga0496105_0044209 3300048908 Bacteria 3673
799 Ga0496106_0021333 3300048909 Bacteria 4809
800 Ga0496106_0023563 3300048909 Bacteria 4573
801 Ga0496106_0462786 3300048909 Bacteria 1019
802 Ga0496107_0039438 3300048910 Bacteria 3388
803 Ga0496108_0002852 3300048911 Bacteria 13884
804 Ga0496108_0056460 3300048911 Bacteria 3299
805 Ga0496108_0232464 3300048911 Bacteria 1603
806 Ga0496108_0255117 3300048911 Bacteria 1526
807 Ga0496109_0000120 3300048912 Bacteria 81828
808 Ga0496109_0049323 3300048912 Bacteria 3832
809 Ga0496110_0001986 3300048913 Bacteria 15204
810 Ga0496110_0141371 3300048913 Bacteria 2176
811 Ga0496110_0295862 3300048913 Bacteria 1475
812 Ga0496110_0539910 3300048913 Bacteria 1060
813 Ga0496112_0000991 3300048915 Bacteria 20765
814 Ga0496112_0004229 3300048915 Bacteria 12116
815 Ga0496112_0008837 3300048915 Bacteria 9038
816 Ga0496112_0097396 3300048915 Bacteria 2912
817 Ga0496112_0199074 3300048915 Bacteria 1963
818 Ga0496112_0244353 3300048915 Bacteria 1747
819 Ga0496113_0002001 3300048916 Bacteria 11681
820 Ga0496114_0006103 3300048917 Bacteria 9490
821 Ga0496114_0055131 3300048917 Bacteria 3315
822 Ga0496115_0009627 3300048918 Bacteria 7189
823 Ga0496115_0032991 3300048918 Bacteria 4087
824 Ga0496115_0213432 3300048918 Bacteria 1594
825 Ga0496116_0000228 3300048919 Bacteria 104766
826 Ga0496117_0000204 3300048920 Bacteria 116843
827 Ga0496118_0000202 3300048921 Bacteria 104816
828 Ga0496119_0000700 3300048922 Bacteria 44933
829 Ga0496120_0016270 3300048923 Bacteria 4866
830 Ga0496122_0190396 3300048925 Bacteria 1212
831 Ga0496124_0036480 3300048927 Bacteria 4287
832 Ga0496125_0042719 3300048928 Bacteria 3856
833 Ga0496126_0000490 3300048929 Bacteria 77991
834 Ga0501040_0075284 3300049576 Bacteria 2333
835 Ga0501040_0173832 3300049576 Bacteria 1526
836 Ga0501067_0099641 3300049583 Bacteria 1614
837 Ga0501068_0086475 3300049584 Bacteria 1930
838 Ga0501068_0345793 3300049584 Bacteria 955
839 Ga0501074_0156324 3300049590 Bacteria 1629
840 Ga0501075_0093436 3300049591 Bacteria 2283
841 Ga0501075_0278751 3300049591 Bacteria 1274
842 Ga0501076_0016323 3300049592 Bacteria 5630
843 Ga0501076_0097671 3300049592 Bacteria 2366
844 Ga0501079_0035098 3300049741 Bacteria 3859
845 Ga0501079_0191373 3300049741 Bacteria 1597
846 Ga0501079_0297143 3300049741 Bacteria 1263
847 Ga0501079_0297398 3300049741 Bacteria 1263
848 Ga0501080_0510757 3300049742 Bacteria 1073
849 Ga0501081_0031133 3300049743 Bacteria 3615
850 Ga0501081_0207782 3300049743 Bacteria 1421
851 Ga0501045_0048949 3300049824 Bacteria 3081
852 nmdc:mga05p37_10570_c1 3300050507 Bacteria 10944
853 nmdc:mga05p37_18012_c1 3300050507 Bacteria 8529
854 nmdc:mga05p37_189005_c1 3300050507 Bacteria 2502
855 nmdc:mga05p37_25589_c1 3300050507 Bacteria 7179
856 nmdc:mga05p37_28157_c1 3300050507 Bacteria 6849
857 nmdc:mga0qj67_8713_c1 3300050509 Bacteria 7534
858 nmdc:mga06r32_114312_c1 3300050510 Bacteria 2658
859 nmdc:mga06r32_1152_c3 3300050510 Bacteria 6799
860 nmdc:mga08y16_78126_c1 3300050511 Bacteria 3450
861 nmdc:mga0n895_10216_c1 3300050512 Bacteria 8270
862 nmdc:mga0n895_2147_c1 3300050512 Bacteria 15221
863 nmdc:mga0n895_243326_c1 3300050512 Bacteria 1826
864 nmdc:mga0n895_41205_c1 3300050512 Bacteria 4488
865 nmdc:mga0n895_446499_c1 3300050512 Bacteria 1306
866 nmdc:mga0n895_594_c1 3300050512 Bacteria 24988
867 nmdc:mga0n895_665777_c1 3300050512 Bacteria 1039
868 nmdc:mga0rr50_12540_c1 3300050513 Bacteria 5484
869 nmdc:mga0rr50_12933_c1 3300050513 Bacteria 5413
870 nmdc:mga0rr50_17955_c1 3300050513 Bacteria 4739
871 nmdc:mga0rr50_195245_c1 3300050513 Unclassified 1661
872 nmdc:mga0rr50_31091_c1 3300050513 Bacteria 3787
873 nmdc:mga0rr50_356082_c1 3300050513 Bacteria 1231
874 nmdc:mga08x19_15179_c1 3300050514 Bacteria 4683
875 nmdc:mga08x19_180_c1 3300050514 Bacteria 50906
876 nmdc:mga08x19_61528_c1 3300050514 Bacteria 2433
877 nmdc:mga0a205_143611_c1 3300050515 Bacteria 2287
878 nmdc:mga0a205_256208_c1 3300050515 Bacteria 1628
879 nmdc:mga0a205_28347_c1 3300050515 Bacteria 5354
880 nmdc:mga0a205_35122_c1 3300050515 Bacteria 4814
881 nmdc:mga0a205_49879_c1 3300050515 Bacteria 4041
882 nmdc:mga0a205_5672_c1 3300050515 Bacteria 11247
883 Ga0495601_0022318 3300053077 Bacteria 3884
884 Ga0495612_0037252 3300053078 Bacteria 1975
885 Ga0495595_0068907 3300053084 Bacteria 1669
886 Ga0495619_0010995 3300053085 Bacteria 5697
887 Ga0495619_0205609 3300053085 Bacteria 1363
888 Ga0500577_0000159 3300053142 Bacteria 16803
889 Ga0501084_0538089 3300054114 Bacteria 987
890 Ga0501082_0047339 3300060353 Bacteria 3706
891 Ga0501082_0057617 3300060353 Bacteria 3347
892 2817480593 2816332295 Bacteria 4352468
893 2897112090 2897109615 Bacteria 4009619
894 2915358291 2915358134 Bacteria 6050864
895 2969143447 2969141011 Bacteria 4118468
896 3006826840 3006826541 Bacteria 4678913
897 3006860944 3006858327 Bacteria 4317835
898 637878024 637000116 Bacteria 5433628
899 8051955413 8051952484 Bacteria 3926774
900 Ga0099794_10000350
901 JGI24752J21851_1000611
902 JGI24748J21848_1000012
903 JGI24748J21848_1006785
904 JGI24034J26672_10000003
905 JGI24034J26672_10001087
906 JGI24751J29686_10005274
907 rootH1_10220322
908 JGI25404J52841_10000478
909 Ga0065715_10003200
910 Ga0065707_10248901
911 Ga0070658_10001997
912 Ga0070658_10005297
913 Ga0070658_10163174
914 Ga0070676_10000224
915 Ga0070683_100000920
916 Ga0070683_100092166
917 Ga0070683_100319079
918 Ga0070690_100000380
919 Ga0070690_100044069
920 Ga0070670_100002424
921 Ga0070670_100016690
922 Ga0070670_100061693
923 Ga0070677_10000186
924 Ga0068869_100000053
925 Ga0068869_100060300
926 Ga0068869_100089012
927 Ga0068869_100112757
928 Ga0070666_10000581
929 Ga0070680_100012313
930 Ga0070680_100044990
931 Ga0070682_100134107
932 Ga0068868_100000719
933 Ga0070660_100000781
934 Ga0070660_100015979
935 Ga0070689_100000484
936 Ga0070689_100024014
937 Ga0070691_10032412
938 Ga0070687_100000039
939 Ga0070661_100000406
940 Ga0070661_100008506
941 Ga0070661_100069941
942 Ga0070661_100083412
943 Ga0070692_10000941
944 Ga0070692_10065156
945 Ga0070668_100002507
946 Ga0070668_100003133
947 Ga0070668_100036420
948 Ga0070668_100115343
949 Ga0070669_100000929
950 Ga0070675_100000924
951 Ga0070675_100034549
952 Ga0070671_100001501
953 Ga0070671_100478394
954 Ga0070674_100000553
955 Ga0070673_100000505
956 Ga0070673_100071917
957 Ga0070688_100000318
958 Ga0070688_100011825
959 Ga0070659_100015815
960 Ga0070667_100002135
961 Ga0070703_10003662
962 Ga0070709_10000305
963 Ga0070709_10047409
964 Ga0070709_10070129
965 Ga0070709_10119118
966 Ga0070714_100021657
967 Ga0070714_100030948
968 Ga0070714_100068096
969 Ga0070714_100210352
970 Ga0070714_100313087
971 Ga0070714_100331424
972 Ga0070713_100000922
973 Ga0070713_100011768
974 Ga0070713_100042431
975 Ga0070713_100278306
976 Ga0070713_100764505
977 Ga0070710_10002298
978 Ga0070710_10117852
979 Ga0070711_100004605
980 Ga0070711_100017023
981 Ga0070711_100026898
982 Ga0070711_100215896
983 Ga0070711_100331001
984 Ga0070711_100356128
985 Ga0070705_100000433
986 Ga0070705_100004291
987 Ga0070705_100123148
988 Ga0070700_100002056
989 Ga0070694_100119322
990 Ga0070694_100379145
991 Ga0070708_100002234
992 Ga0070708_100007645
993 Ga0070708_100009440
994 Ga0070708_100013006
995 Ga0070708_100051348
996 Ga0070708_100080220
997 Ga0070708_100111653
998 Ga0070708_100167418
999 Ga0070708_100170109
1000 Ga0070708_100550176
1001 Ga0070663_100001100
1002 Ga0070663_100055043
1003 Ga0070663_100126382
1004 Ga0070678_100000132
1005 Ga0070678_100219391
1006 Ga0070678_100233612
1007 Ga0070678_100396342
1008 Ga0070662_100002516
1009 Ga0070681_10022842
1010 Ga0070681_10131286
1011 Ga0070681_10154076
1012 Ga0068867_100002078
1013 Ga0068867_100036546
1014 Ga0070685_10000029
1015 Ga0070706_100006640
1016 Ga0070706_100018844
1017 Ga0070706_100022657
1018 Ga0070706_100043222
1019 Ga0070706_100048444
1020 Ga0070706_100355551
1021 Ga0070707_100001060
1022 Ga0070707_100007098
1023 Ga0070707_100083298
1024 Ga0070707_100088495
1025 Ga0070707_100460481
1026 Ga0070707_100578537
1027 Ga0070698_100000116
1028 Ga0070698_100002762
1029 Ga0070698_100005605
1030 Ga0070698_100026380
1031 Ga0070698_100054364
1032 Ga0070698_100065765
1033 Ga0070698_100483878
1034 Ga0070699_100020819
1035 Ga0070699_100031406
1036 Ga0070699_100128976
1037 Ga0070699_100239927
1038 Ga0070699_100278759
1039 Ga0070699_100282284
1040 Ga0070699_100715962
1041 Ga0070679_100007536
1042 Ga0070679_100020487
1043 Ga0070679_100029487
1044 Ga0070679_100044745
1045 Ga0070679_100248293
1046 Ga0070679_100396512
1047 Ga0070684_100021199
1048 Ga0070684_100023361
1049 Ga0070697_100000015
1050 Ga0070697_100001417
1051 Ga0070697_100011368
1052 Ga0070697_100018316
1053 Ga0070697_100020654
1054 Ga0070697_100144922
1055 Ga0070697_100203748
1056 Ga0070697_100208043
1057 Ga0070697_100243479
1058 Ga0068853_100000650
1059 Ga0068853_100001250
1060 Ga0068853_100026872
1061 Ga0070672_100066887
1062 Ga0070686_100000095
1063 Ga0070686_100009761
1064 Ga0070695_100003672
1065 Ga0070695_100010890
1066 Ga0070696_100005712
1067 Ga0070696_100113766
1068 Ga0070693_100000899
1069 Ga0070693_100001944
1070 Ga0070693_100020623
1071 Ga0070693_100028332
1072 Ga0070665_100002353
1073 Ga0070704_100004916
1074 Ga0070704_100017886
1075 Ga0070704_100154503
1076 Ga0068855_100002236
1077 Ga0070664_100001138
1078 Ga0070664_100003918
1079 Ga0070664_100153985
1080 Ga0070664_100204896
1081 Ga0070664_100499049
1082 Ga0068857_100000229
1083 Ga0068857_100004575
1084 Ga0068857_100219934
1085 Ga0068854_100000510
1086 Ga0068854_100046221
1087 Ga0068854_100290086
1088 Ga0068856_100001505
1089 Ga0068856_100006218
1090 Ga0068856_100036574
1091 Ga0068856_100094376
1092 Ga0068856_100303978
1093 Ga0068856_100418836
1094 Ga0070702_100059445
1095 Ga0068852_100000737
1096 Ga0068852_100021336
1097 Ga0068852_100120552
1098 Ga0068859_100001887
1099 Ga0068859_100030266
1100 Ga0068859_100139723
1101 Ga0068864_100000515
1102 Ga0068864_100064009
1103 Ga0068866_10000163
1104 Ga0068866_10045896
1105 Ga0068861_100000627
1106 Ga0068851_10000655
1107 Ga0068851_10005056
1108 Ga0068870_10000020
1109 Ga0068870_10211187
1110 Ga0068863_100002050
1111 Ga0068863_100006327
1112 Ga0068863_100011083
1113 Ga0068863_100036143
1114 Ga0068863_100055906
1115 Ga0068863_100265908
1116 Ga0068858_100000052
1117 Ga0068858_100001984
1118 Ga0068858_100019166
1119 Ga0068858_100090583
1120 Ga0068858_100317856
1121 Ga0068858_100365590
1122 Ga0068860_100000901
1123 Ga0068860_100003570
1124 Ga0068860_100013865
1125 Ga0068860_100196583
1126 Ga0068860_100539167
1127 Ga0068862_100000692
1128 Ga0068862_100004205
1129 Ga0081455_10075554
1130 Ga0081540_1000073
1131 Ga0081540_1000209
1132 Ga0081540_1003942
1133 Ga0081540_1044270
1134 Ga0081539_10000156
1135 Ga0081539_10000915
1136 Ga0070717_10001271
1137 Ga0070717_10004006
1138 Ga0070717_10005880
1139 Ga0070717_10006876
1140 Ga0070717_10015963
1141 Ga0070717_10018743
1142 Ga0070717_10032056
1143 Ga0070717_10043134
1144 Ga0070717_10061399
1145 Ga0070717_10091930
1146 Ga0070717_10114509
1147 Ga0070717_10220737
1148 Ga0070717_10312201
1149 Ga0070716_100000077
1150 Ga0070716_100003912
1151 Ga0070716_100010734
1152 Ga0070716_100120766
1153 Ga0070712_100002274
1154 Ga0070712_100066055
1155 Ga0070712_100317440
1156 Ga0070712_100323571
1157 Ga0097621_100000516
1158 Ga0068871_100002377
1159 Ga0068871_100004618
1160 Ga0068871_100110200
1161 Ga0075428_100001171
1162 Ga0075428_100088747
1163 Ga0075428_100606358
1164 Ga0075431_100006607
1165 Ga0075433_10004048
1166 Ga0075433_10021471
1167 Ga0075433_10040628
1168 Ga0075433_10129670
1169 Ga0075434_100000857
1170 Ga0075434_100000998
1171 Ga0075434_100024391
1172 Ga0075434_100036771
1173 Ga0075434_100164494
1174 Ga0075434_100167424
1175 Ga0075434_100241405
1176 Ga0075434_100731001
1177 Ga0068865_100000545
1178 Ga0075436_100008041
1179 Ga0075436_100038031
1180 Ga0075436_100111704
1181 Ga0075436_100199547
1182 Ga0097620_100001887
1183 Ga0097620_100030267
1184 Ga0097620_100139732
1185 Ga0075435_100000556
1186 Ga0075435_100013847
1187 Ga0075435_100017964
1188 Ga0075435_100065237
1189 Ga0075435_100101680
1190 Ga0075435_100134133
1191 Ga0075435_100210029
1192 Ga0075435_100285546
1193 Ga0099794_10008967
1194 Ga0099794_10020363
1195 Ga0099794_10031940
1196 Ga0099794_10066220
1197 Ga0099794_10102664
1198 Ga0099794_10146586
1199 Ga0099794_10166100
1200 Ga0105250_10069540
1201 Ga0105240_10004283
1202 Ga0105240_10420990
1203 Ga0111539_10177758
1204 Ga0111539_10281818
1205 Ga0105245_10013162
1206 Ga0105245_10040190
1207 Ga0105245_10106560
1208 Ga0105245_10308489
1209 Ga0105247_10000003
1210 Ga0105247_10000214
1211 Ga0105247_10088721
1212 Ga0105247_10116497
1213 Ga0105247_10121114
1214 Ga0105247_10241556
1215 Ga0114129_10000201
1216 Ga0114129_10007058
1217 Ga0114129_10008742
1218 Ga0114129_10052936
1219 Ga0114129_10126174
1220 Ga0105243_10001203
1221 Ga0105243_10176501
1222 Ga0105241_10001583
1223 Ga0105241_10042177
1224 Ga0105241_10066264
1225 Ga0105241_10397922
1226 Ga0105242_10003402
1227 Ga0105242_10027989
1228 Ga0105242_10103390
1229 Ga0105242_10274504
1230 Ga0105248_10002038
1231 Ga0105248_10194132
1232 Ga0105237_10000421
1233 Ga0105238_10000359
1234 Ga0105238_10003254
1235 Ga0105238_10018855
1236 Ga0105249_10000494
1237 Ga0105249_10002142
1238 Ga0105249_10006198
1239 Ga0105249_10027248
1240 Ga0105249_10083789
1241 Ga0105239_10001190
1242 Ga0105239_10054754
1243 Ga0105246_10004738
1244 Ga0105246_10055158
1245 Ga0157373_10001697
1246 Ga0157371_10000366
1247 Ga0157371_10160541
1248 Ga0157369_10003549
1249 Ga0157369_10039939
1250 Ga0157369_10060727
1251 Ga0157369_10158543
1252 Ga0157374_10000753
1253 Ga0157374_10049507
1254 Ga0157378_10000538
1255 Ga0157378_10000791
1256 Ga0157378_10021440
1257 Ga0157378_10023477
1258 Ga0157378_10074664
1259 Ga0163162_10000023
1260 Ga0163162_10001463
1261 Ga0163162_10005173
1262 Ga0163162_10058772
1263 Ga0163162_10413574
1264 Ga0163162_10464291
1265 Ga0157372_10006351
1266 Ga0157372_10028369
1267 Ga0157372_10082436
1268 Ga0157375_10001223
1269 Ga0157375_10233394
1270 Ga0163163_10000844
1271 Ga0163163_10044651
1272 Ga0163163_10137725
1273 Ga0157380_10069116
1274 Ga0157380_10406002
1275 Ga0157380_10729320
1276 Ga0157377_10005614
1277 Ga0157377_10095983
1278 Ga0157379_10000868
1279 Ga0157379_10000892
1280 Ga0157379_10001230
1281 Ga0157379_10055638
1282 Ga0157379_10283883
1283 Ga0157376_10000032
1284 Ga0157376_10000590
1285 Ga0157376_10000629
1286 Ga0182007_10008481
1287 Ga0163161_10016205
1288 Ga0163161_10402941
1289 Ga0206353_11777813
1290 Ga0213872_10005062
1291 Ga0213872_10123175
1292 Ga0213874_10057603
1293 Ga0213876_10000282
1294 Ga0213871_10004327
1295 Ga0228598_1026488
1296 Ga0207672_1000061
1297 Ga0207697_10002581
1298 Ga0207697_10007233
1299 Ga0207656_10000118
1300 Ga0207656_10009662
1301 Ga0207653_10003573
1302 Ga0207682_10000028
1303 Ga0207692_10006538
1304 Ga0207692_10033574
1305 Ga0207642_10017845
1306 Ga0207642_10184173
1307 Ga0207710_10000001
1308 Ga0207710_10000971
1309 Ga0207710_10083469
1310 Ga0207688_10007178
1311 Ga0207688_10074374
1312 Ga0207680_10001631
1313 Ga0207680_10012422
1314 Ga0207647_10015608
1315 Ga0207647_10051399
1316 Ga0207685_10114747
1317 Ga0207699_10002217
1318 Ga0207699_10031494
1319 Ga0207699_10157678
1320 Ga0207699_10173534
1321 Ga0207645_10000053
1322 Ga0207645_10001227
1323 Ga0207645_10051817
1324 Ga0207643_10000013
1325 Ga0207643_10006285
1326 Ga0207705_10015725
1327 Ga0207705_10077480
1328 Ga0207684_10002255
1329 Ga0207684_10020820
1330 Ga0207684_10033176
1331 Ga0207684_10039566
1332 Ga0207684_10040272
1333 Ga0207684_10094636
1334 Ga0207684_10300122
1335 Ga0207684_10366231
1336 Ga0207654_10020659
1337 Ga0207654_10056836
1338 Ga0207707_10068805
1339 Ga0207707_10131778
1340 Ga0207707_10133199
1341 Ga0207707_10182918
1342 Ga0207695_10004014
1343 Ga0207671_10000884
1344 Ga0207693_10000067
1345 Ga0207693_10018302
1346 Ga0207693_10023756
1347 Ga0207693_10024033
1348 Ga0207693_10053314
1349 Ga0207693_10097723
1350 Ga0207693_10108854
1351 Ga0207693_10209858
1352 Ga0207693_10358296
1353 Ga0207663_10013386
1354 Ga0207663_10019141
1355 Ga0207663_10063469
1356 Ga0207663_10164419
1357 Ga0207663_10176077
1358 Ga0207663_10258286
1359 Ga0207660_10008522
1360 Ga0207660_10021173
1361 Ga0207660_10219348
1362 Ga0207662_10000009
1363 Ga0207662_10002842
1364 Ga0207662_10044078
1365 Ga0207657_10000042
1366 Ga0207657_10023284
1367 Ga0207657_10047938
1368 Ga0207649_10001939
1369 Ga0207649_10002049
1370 Ga0207652_10013588
1371 Ga0207652_10053635
1372 Ga0207646_10000054
1373 Ga0207646_10000305
1374 Ga0207646_10036483
1375 Ga0207646_10040993
1376 Ga0207646_10077168
1377 Ga0207646_10170809
1378 Ga0207646_10231453
1379 Ga0207646_10283657
1380 Ga0207681_10000159
1381 Ga0207681_10259586
1382 Ga0207694_10000788
1383 Ga0207694_10113578
1384 Ga0207694_10620914
1385 Ga0207650_10000152
1386 Ga0207650_10000445
1387 Ga0207650_10339148
1388 Ga0207659_10000098
1389 Ga0207659_10028596
1390 Ga0207687_10035721
1391 Ga0207687_10099369
1392 Ga0207687_10302840
1393 Ga0207700_10006884
1394 Ga0207700_10082658
1395 Ga0207700_10121754
1396 Ga0207664_10095040
1397 Ga0207664_10208372
1398 Ga0207664_10250789
1399 Ga0207644_10000603
1400 Ga0207644_10001827
1401 Ga0207644_10015007
1402 Ga0207690_10002207
1403 Ga0207690_10024946
1404 Ga0207690_10034129
1405 Ga0207706_10000046
1406 Ga0207706_10000997
1407 Ga0207706_10024630
1408 Ga0207686_10026156
1409 Ga0207686_10027990
1410 Ga0207686_10206422
1411 Ga0207709_10002043
1412 Ga0207670_10000494
1413 Ga0207670_10028206
1414 Ga0207669_10000156
1415 Ga0207704_10000142
1416 Ga0207665_10000028
1417 Ga0207665_10002791
1418 Ga0207665_10010969
1419 Ga0207665_10014872
1420 Ga0207665_10024988
1421 Ga0207665_10108834
1422 Ga0207665_10155741
1423 Ga0207665_10193566
1424 Ga0207665_10196113
1425 Ga0207691_10000424
1426 Ga0207691_10080693
1427 Ga0207711_10000582
1428 Ga0207711_10005299
1429 Ga0207689_10000071
1430 Ga0207689_10010738
1431 Ga0207689_10019760
1432 Ga0207689_10099776
1433 Ga0207661_10001036
1434 Ga0207661_10003627
1435 Ga0207661_10275636
1436 Ga0207661_10443578
1437 Ga0207679_10000111
1438 Ga0207679_10000469
1439 Ga0207679_10141945
1440 Ga0207667_10001419
1441 Ga0207651_10000110
1442 Ga0207712_10000785
1443 Ga0207712_10000854
1444 Ga0207712_10519749
1445 Ga0207668_10000657
1446 Ga0207668_10001179
1447 Ga0207668_10009454
1448 Ga0207640_10000497
1449 Ga0207640_10298071
1450 Ga0207640_10318377
1451 Ga0207658_10000736
1452 Ga0207658_10041767
1453 Ga0207658_10251937
1454 Ga0207677_10000492
1455 Ga0207677_10078951
1456 Ga0207677_10449336
1457 Ga0207703_10000303
1458 Ga0207703_10000406
1459 Ga0207703_10014323
1460 Ga0207703_10019932
1461 Ga0207639_10000612
1462 Ga0207639_10005469
1463 Ga0207639_10012900
1464 Ga0207678_10001602
1465 Ga0207678_10010230
1466 Ga0207678_10089793
1467 Ga0207708_10025320
1468 Ga0207708_10252658
1469 Ga0207702_10006363
1470 Ga0207702_10012630
1471 Ga0207702_10024347
1472 Ga0207702_10038618
1473 Ga0207702_10040486
1474 Ga0207702_10299956
1475 Ga0207641_10000052
1476 Ga0207641_10000918
1477 Ga0207641_10001136
1478 Ga0207641_10008550
1479 Ga0207641_10054301
1480 Ga0207641_10079691
1481 Ga0207648_10000852
1482 Ga0207648_10001157
1483 Ga0207676_10000398
1484 Ga0207676_10001279
1485 Ga0207674_10000038
1486 Ga0207674_10033229
1487 Ga0207674_10098172
1488 Ga0207675_100000565
1489 Ga0207675_100017316
1490 Ga0207675_100118502
1491 Ga0207683_10000837
1492 Ga0207683_10000885
1493 Ga0207683_10078072
1494 Ga0207698_10000519
1495 Ga0207698_10044616
1496 Ga0209995_1018260
1497 Ga0209983_1003242
1498 Ga0209588_1001160
1499 Ga0209588_1003408
1500 Ga0209588_1007189
1501 Ga0209588_1019289
1502 Ga0209971_1000218
1503 Ga0209998_10004009
1504 Ga0209974_10000140
1505 Ga0265354_1003961
1506 Ga0268266_10000072
1507 Ga0268266_10000389
1508 Ga0268265_10000592
1509 Ga0268265_10018692
1510 Ga0268265_10042990
1511 Ga0268264_10000191
1512 Ga0268264_10002754
1513 Ga0268264_10028224
1514 Ga0268264_10047540
1515 Ga0268264_10158185
1516 Ga0268264_10262853
1517 Ga0268264_10586501
1518 Ga0265334_10040666
1519 Ga0265338_10002968
1520 Ga0265338_10057562
1521 Ga0265338_10063139
1522 Ga0265338_10430266
1523 Ga0265770_1001131
1524 Ga0265760_10001557
1525 Ga0265760_10002657
1526 Ga0265760_10020155
1527 Ga0265325_10081168
1528 Ga0265329_10015457
1529 Ga0265339_10000995
1530 Ga0265339_10007220
1531 Ga0265339_10078526
1532 Ga0265316_10001965
1533 Ga0265316_10004297
1534 Ga0265316_10030725
1535 Ga0265316_10173604
1536 Ga0307513_10015270
1537 Ga0265314_10000011
1538 Ga0265314_10008888
1539 Ga0265314_10043416
1540 Ga0316576_10000948
1541 Ga0316576_10107849
1542 Ga0316578_10198760
1543 Ga0316214_1003527
1544 Ga0316212_1001460
1545 Ga0373926_0074133
1546 Ga0373934_0043047
1547 Ga0373934_0105464
1548 Ga0373954_0000232
1549 Ga0373956_0006050
1550 Ga0373943_0037050
1551 Ga0373955_0004388
1552 Ga0373955_0215764
1553 Ga0373924_0063399
1554 Ga0373931_0059161
1555 Ga0373931_0154992
1556 Ga0373931_0482736
1557 Ga0373927_0000181
1558 Ga0373933_0001080
1559 Ga0373947_0006847
1560 Ga0373947_0019837
1561 Ga0373947_0121016
1562 Ga0373937_0295577
1563 Ga0316584_0000032
1564 Ga0373925_0016750
1565 Ga0373925_0350525
1566 Ga0395900_0047532
1567 Ga0436364_1345024
1568 Ga0400489_81848
1569 Ga0436365_0740107
1570 Ga0436365_1419515
1571 Ga0436360_1132016
1572 Ga0436361_0004293
1573 Ga0436361_0365763
1574 Ga0436361_0706744
1575 Ga0436363_0846422
1576 Ga0436363_1072660
1577 Ga0436362_0975535
1578 Ga0439455_0005219
1579 Ga0451577_0015389
1580 Ga0451577_0080954
1581 Ga0451577_0096172
1582 Ga0451577_0191960
1583 Ga0451577_0580203
1584 Ga0466972_0136076
1585 Ga0453683_0011172
1586 Ga0453683_0023057
1587 Ga0453683_0038859
1588 Ga0453683_0090385
1589 Ga0453683_0130322
1590 Ga0466966_0156264
1591 Ga0466964_0076480
1592 Ga0453684_0010033
1593 Ga0453684_0147176
1594 Ga0453684_0239686
1595 Ga0466968_0053592
1596 Ga0466957_0092784
1597 Ga0466960_0051866
1598 Ga0466959_0009944
1599 Ga0466959_0269387
1600 Ga0451576_0020333
1601 Ga0451576_0184358
1602 Ga0451576_0237779
1603 Ga0451576_0561274
1604 Ga0451576_0905594
1605 Ga0466967_0019685
1606 Ga0466967_0132192
1607 Ga0466967_0339289
1608 Ga0466967_0864593
1609 Ga0495603_0048438
1610 Ga0495629_0060478
1611 Ga0495629_0070849
1612 Ga0495629_0126671
1613 Ga0495641_0023994
1614 Ga0495651_0052148
1615 Ga0495651_0080986
1616 Ga0495653_0009074
1617 Ga0495653_0150702
1618 Ga0495580_0011933
1619 Ga0495580_0015648
1620 Ga0495580_0018168
1621 Ga0495580_0022593
1622 Ga0495580_0031805
1623 Ga0495580_0051450
1624 Ga0495580_0301758
1625 Ga0495580_0330215
1626 Ga0495582_0000718
1627 Ga0495582_0009025
1628 Ga0495582_0032511
1629 Ga0495582_0126326
1630 Ga0495639_0005520
1631 Ga0495594_0067896
1632 Ga0495606_0201206
1633 Ga0495608_0022524
1634 Ga0495608_0082787
1635 Ga0495618_0121135
1636 Ga0495628_0136848
1637 Ga0495628_0251257
1638 Ga0495630_0022984
1639 Ga0495630_0033365
1640 Ga0495632_0087326
1641 Ga0495666_0060133
1642 Ga0495652_0186105
1643 Ga0495652_0210082
1644 Ga0495640_0110642
1645 Ga0495640_0131888
1646 Ga0495587_0009545
1647 Ga0495587_0010261
1648 Ga0495645_0160494
1649 Ga0495667_0062472
1650 Ga0495634_0022616
1651 Ga0495623_0010766
1652 Ga0495646_0019063
1653 Ga0495647_0011255
1654 Ga0495658_0009614
1655 Ga0495658_0013750
1656 Ga0495658_0066613
1657 Ga0495658_0241899
1658 Ga0495669_0001200
1659 Ga0495613_0191987
1660 Ga0495624_0109580
1661 Ga0495581_0150638
1662 Ga0495604_0001179
1663 Ga0495604_0008173
1664 Ga0495674_0039608
1665 Ga0495676_0013478
1666 Ga0495676_0184614
1667 Ga0495680_0008472
1668 Ga0495680_0008611
1669 Ga0495675_0055208
1670 Ga0495684_0037833
1671 Ga0495684_0071472
1672 Ga0495593_0124505
1673 Ga0495602_0002035
1674 Ga0495602_0020663
1675 Ga0495614_0122466
1676 Ga0496100_0050705
1677 Ga0496100_0076158
1678 Ga0496100_0271742
1679 Ga0496101_0020948
1680 Ga0496101_0021969
1681 Ga0496101_0154953
1682 Ga0496101_0174893
1683 Ga0496102_0000127
1684 Ga0496102_0002989
1685 Ga0496102_0005081
1686 Ga0496102_0050463
1687 Ga0496102_0237037
1688 Ga0496103_0000134
1689 Ga0496103_0000805
1690 Ga0496103_0191651
1691 Ga0496104_0010488
1692 Ga0496104_0013301
1693 Ga0496104_0123334
1694 Ga0496104_0162228
1695 Ga0496104_0262685
1696 Ga0496105_0012552
1697 Ga0496105_0044209
1698 Ga0496106_0021333
1699 Ga0496106_0023563
1700 Ga0496106_0462786
1701 Ga0496107_0039438
1702 Ga0496108_0002852
1703 Ga0496108_0056460
1704 Ga0496108_0232464
1705 Ga0496108_0255117
1706 Ga0496109_0000120
1707 Ga0496109_0049323
1708 Ga0496110_0001986
1709 Ga0496110_0141371
1710 Ga0496110_0295862
1711 Ga0496110_0539910
1712 Ga0496112_0000991
1713 Ga0496112_0004229
1714 Ga0496112_0008837
1715 Ga0496112_0097396
1716 Ga0496112_0199074
1717 Ga0496112_0244353
1718 Ga0496113_0002001
1719 Ga0496114_0006103
1720 Ga0496114_0055131
1721 Ga0496115_0009627
1722 Ga0496115_0032991
1723 Ga0496115_0213432
1724 Ga0496116_0000228
1725 Ga0496117_0000204
1726 Ga0496118_0000202
1727 Ga0496119_0000700
1728 Ga0496120_0016270
1729 Ga0496122_0190396
1730 Ga0496124_0036480
1731 Ga0496125_0042719
1732 Ga0496126_0000490
1733 Ga0501040_0075284
1734 Ga0501040_0173832
1735 Ga0501067_0099641
1736 Ga0501068_0086475
1737 Ga0501068_0345793
1738 Ga0501074_0156324
1739 Ga0501075_0093436
1740 Ga0501075_0278751
1741 Ga0501076_0016323
1742 Ga0501076_0097671
1743 Ga0501079_0035098
1744 Ga0501079_0191373
1745 Ga0501079_0297143
1746 Ga0501079_0297398
1747 Ga0501080_0510757
1748 Ga0501081_0031133
1749 Ga0501081_0207782
1750 Ga0501045_0048949
1751 nmdc:mga05p37_10570_c1
1752 nmdc:mga05p37_18012_c1
1753 nmdc:mga05p37_189005_c1
1754 nmdc:mga05p37_25589_c1
1755 nmdc:mga05p37_28157_c1
1756 nmdc:mga0qj67_8713_c1
1757 nmdc:mga06r32_114312_c1
1758 nmdc:mga06r32_1152_c3
1759 nmdc:mga08y16_78126_c1
1760 nmdc:mga0n895_10216_c1
1761 nmdc:mga0n895_2147_c1
1762 nmdc:mga0n895_243326_c1
1763 nmdc:mga0n895_41205_c1
1764 nmdc:mga0n895_446499_c1
1765 nmdc:mga0n895_594_c1
1766 nmdc:mga0n895_665777_c1
1767 nmdc:mga0rr50_12540_c1
1768 nmdc:mga0rr50_12933_c1
1769 nmdc:mga0rr50_17955_c1
1770 nmdc:mga0rr50_195245_c1
1771 nmdc:mga0rr50_31091_c1
1772 nmdc:mga0rr50_356082_c1
1773 nmdc:mga08x19_15179_c1
1774 nmdc:mga08x19_180_c1
1775 nmdc:mga08x19_61528_c1
1776 nmdc:mga0a205_143611_c1
1777 nmdc:mga0a205_256208_c1
1778 nmdc:mga0a205_28347_c1
1779 nmdc:mga0a205_35122_c1
1780 nmdc:mga0a205_49879_c1
1781 nmdc:mga0a205_5672_c1
1782 Ga0495601_0022318
1783 Ga0495612_0037252
1784 Ga0495595_0068907
1785 Ga0495619_0010995
1786 Ga0495619_0205609
1787 Ga0500577_0000159
1788 Ga0501084_0538089
1789 Ga0501082_0047339
1790 Ga0501082_0057617
1791 2817480593
1792 2897112090
1793 2915358291
1794 2969143447
1795 3006826840
1796 3006860944
1797 637878024
1798 8051955413

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

54

301

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tk9-assembly1.cif.gz_B purine-nucleoside phosphorylase from thermus thermophilus 0.9841 12 276
8swu-assembly1.cif.gz_A structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate 0.9823 9 275
8swu-assembly1.cif.gz_B structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate 0.9818 9 275
8swu-assembly1.cif.gz_C structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate 0.9803 9 275
4m1e-assembly1.cif.gz_B crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364. 0.98 10 278
ID Description Score Start End Superfamily
1yqqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9784 13 279 3.40.50.1580
1yquC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9657 13 279 3.40.50.1580
af_U4PSA1_35_317_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9655 9 275 3.40.50.1580
3la8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9635 9 276 3.40.50.1580
4lnaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9621 12 275 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A645GZB6-F1-model_v4 purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9965 166 278 GO:0004731
GO:0005737
GO:0009116
AF-A0A1H9LTW5-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9961 12 276 GO:0004731
GO:0005737
GO:0009116
AF-A0A1I2EJ84-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9959 12 277 GO:0004731
GO:0005737
GO:0009116
AF-B2A4Z8-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9955 12 276 GO:0004731
GO:0005737
GO:0009116
AF-A0A7W1YD72-F1-model_v4 Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) 0.9954 9 283 GO:0004731
GO:0005737
GO:0009116

Map