F485099
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 899 | 359 | 1798 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10000350|Ga0099794_100003509 |
| Length | 308 |
| Sequence | VSARKSPKTKTAKTVSTGKTNAVANPASSSSLGEYERAGEAADFIFSQTALRPRIALVLGSGLGAFADEFADAMKIPYAKIPHFPQSTAIGHAGKLVVGKVGAIPVAGMQGRVHLYEGYSAKEVAFPIRVFARMGVKAVILTNAAGGIKQEFVQGRLVVISDHINLQGVNPLTGPNDERFGLRFHDMTSAYDRSFREMAVGEGKRLGIGLYEGVYAGLLGPSYETPAEIRYLRAIGADLVGMSTVPEVIAARHSGIRVLGISCVTNAAAGILDQPLNHLEVLETAERVKGQFIGLLKAVIPRIAEAIA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 135 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 136 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 226 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 227 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 228 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 229 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 230 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 246 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 247 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 248 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 249 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 250 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 251 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 254 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 255 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 256 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 261 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 353 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 354 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 355 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 356 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 357 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 358 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 359 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.55 |
| Metatranscriptomes | 0.56 |
| Isolates | 0.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0.11 |
| Rhizoplane | 5.34 |
| Rhizosphere | 91.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0099794_10000350 | 3300007265 | Bacteria | 15802 |
| 2 | JGI24752J21851_1000611 | 3300001976 | Bacteria | 4765 |
| 3 | JGI24748J21848_1000012 | 3300002074 | Bacteria | 152599 |
| 4 | JGI24748J21848_1006785 | 3300002074 | Unclassified | 1337 |
| 5 | JGI24034J26672_10000003 | 3300002239 | Bacteria | 501747 |
| 6 | JGI24034J26672_10001087 | 3300002239 | Bacteria | 3548 |
| 7 | JGI24751J29686_10005274 | 3300002459 | Bacteria | 2630 |
| 8 | rootH1_10220322 | 3300003323 | Bacteria | 2489 |
| 9 | JGI25404J52841_10000478 | 3300003659 | Bacteria | 5756 |
| 10 | Ga0065715_10003200 | 3300005293 | Bacteria | 5448 |
| 11 | Ga0065707_10248901 | 3300005295 | Bacteria | 1131 |
| 12 | Ga0070658_10001997 | 3300005327 | Bacteria | 17152 |
| 13 | Ga0070658_10005297 | 3300005327 | Bacteria | 10472 |
| 14 | Ga0070658_10163174 | 3300005327 | Unclassified | 1870 |
| 15 | Ga0070676_10000224 | 3300005328 | Bacteria | 24170 |
| 16 | Ga0070683_100000920 | 3300005329 | Bacteria | 21852 |
| 17 | Ga0070683_100092166 | 3300005329 | Unclassified | 2846 |
| 18 | Ga0070683_100319079 | 3300005329 | Bacteria | 1479 |
| 19 | Ga0070690_100000380 | 3300005330 | Bacteria | 22612 |
| 20 | Ga0070690_100044069 | 3300005330 | Unclassified | 2831 |
| 21 | Ga0070670_100002424 | 3300005331 | Bacteria | 15374 |
| 22 | Ga0070670_100016690 | 3300005331 | Bacteria | 6302 |
| 23 | Ga0070670_100061693 | 3300005331 | Unclassified | 3218 |
| 24 | Ga0070677_10000186 | 3300005333 | Bacteria | 21454 |
| 25 | Ga0068869_100000053 | 3300005334 | Bacteria | 50209 |
| 26 | Ga0068869_100060300 | 3300005334 | Unclassified | 2780 |
| 27 | Ga0068869_100089012 | 3300005334 | Unclassified | 2318 |
| 28 | Ga0068869_100112757 | 3300005334 | Bacteria | 2070 |
| 29 | Ga0070666_10000581 | 3300005335 | Bacteria | 22113 |
| 30 | Ga0070680_100012313 | 3300005336 | Bacteria | 6642 |
| 31 | Ga0070680_100044990 | 3300005336 | Bacteria | 3588 |
| 32 | Ga0070682_100134107 | 3300005337 | Bacteria | 1680 |
| 33 | Ga0068868_100000719 | 3300005338 | Bacteria | 22345 |
| 34 | Ga0070660_100000781 | 3300005339 | Bacteria | 21151 |
| 35 | Ga0070660_100015979 | 3300005339 | Bacteria | 5436 |
| 36 | Ga0070689_100000484 | 3300005340 | Bacteria | 23496 |
| 37 | Ga0070689_100024014 | 3300005340 | Bacteria | 4570 |
| 38 | Ga0070691_10032412 | 3300005341 | Bacteria | 2455 |
| 39 | Ga0070687_100000039 | 3300005343 | Bacteria | 41821 |
| 40 | Ga0070661_100000406 | 3300005344 | Bacteria | 33281 |
| 41 | Ga0070661_100008506 | 3300005344 | Bacteria | 7099 |
| 42 | Ga0070661_100069941 | 3300005344 | Bacteria | 2581 |
| 43 | Ga0070661_100083412 | 3300005344 | Bacteria | 2360 |
| 44 | Ga0070692_10000941 | 3300005345 | Bacteria | 9885 |
| 45 | Ga0070692_10065156 | 3300005345 | Bacteria | 1928 |
| 46 | Ga0070668_100002507 | 3300005347 | Bacteria | 13524 |
| 47 | Ga0070668_100003133 | 3300005347 | Bacteria | 12211 |
| 48 | Ga0070668_100036420 | 3300005347 | Unclassified | 3755 |
| 49 | Ga0070668_100115343 | 3300005347 | Bacteria | 2141 |
| 50 | Ga0070669_100000929 | 3300005353 | Bacteria | 21335 |
| 51 | Ga0070675_100000924 | 3300005354 | Bacteria | 20904 |
| 52 | Ga0070675_100034549 | 3300005354 | Bacteria | 4104 |
| 53 | Ga0070671_100001501 | 3300005355 | Bacteria | 17456 |
| 54 | Ga0070671_100478394 | 3300005355 | Bacteria | 1070 |
| 55 | Ga0070674_100000553 | 3300005356 | Bacteria | 18763 |
| 56 | Ga0070673_100000505 | 3300005364 | Bacteria | 20904 |
| 57 | Ga0070673_100071917 | 3300005364 | Unclassified | 2780 |
| 58 | Ga0070688_100000318 | 3300005365 | Bacteria | 24624 |
| 59 | Ga0070688_100011825 | 3300005365 | Unclassified | 4867 |
| 60 | Ga0070659_100015815 | 3300005366 | Bacteria | 5656 |
| 61 | Ga0070667_100002135 | 3300005367 | Bacteria | 17438 |
| 62 | Ga0070703_10003662 | 3300005406 | Unclassified | 4359 |
| 63 | Ga0070709_10000305 | 3300005434 | Bacteria | 31117 |
| 64 | Ga0070709_10047409 | 3300005434 | Unclassified | 2677 |
| 65 | Ga0070709_10070129 | 3300005434 | Bacteria | 2259 |
| 66 | Ga0070709_10119118 | 3300005434 | Unclassified | 1786 |
| 67 | Ga0070714_100021657 | 3300005435 | Bacteria | 5260 |
| 68 | Ga0070714_100030948 | 3300005435 | Bacteria | 4459 |
| 69 | Ga0070714_100068096 | 3300005435 | Bacteria | 3071 |
| 70 | Ga0070714_100210352 | 3300005435 | Unclassified | 1782 |
| 71 | Ga0070714_100313087 | 3300005435 | Bacteria | 1466 |
| 72 | Ga0070714_100331424 | 3300005435 | Unclassified | 1425 |
| 73 | Ga0070713_100000922 | 3300005436 | Bacteria | 18743 |
| 74 | Ga0070713_100011768 | 3300005436 | Bacteria | 6390 |
| 75 | Ga0070713_100042431 | 3300005436 | Unclassified | 3712 |
| 76 | Ga0070713_100278306 | 3300005436 | Bacteria | 1534 |
| 77 | Ga0070713_100764505 | 3300005436 | Bacteria | 925 |
| 78 | Ga0070710_10002298 | 3300005437 | Bacteria | 9045 |
| 79 | Ga0070710_10117852 | 3300005437 | Unclassified | 1603 |
| 80 | Ga0070711_100004605 | 3300005439 | Bacteria | 8164 |
| 81 | Ga0070711_100017023 | 3300005439 | Unclassified | 4623 |
| 82 | Ga0070711_100026898 | 3300005439 | Unclassified | 3772 |
| 83 | Ga0070711_100215896 | 3300005439 | Bacteria | 1488 |
| 84 | Ga0070711_100331001 | 3300005439 | Bacteria | 1219 |
| 85 | Ga0070711_100356128 | 3300005439 | Bacteria | 1178 |
| 86 | Ga0070705_100000433 | 3300005440 | Bacteria | 23997 |
| 87 | Ga0070705_100004291 | 3300005440 | Bacteria | 6953 |
| 88 | Ga0070705_100123148 | 3300005440 | Bacteria | 1678 |
| 89 | Ga0070700_100002056 | 3300005441 | Bacteria | 10225 |
| 90 | Ga0070694_100119322 | 3300005444 | Bacteria | 1890 |
| 91 | Ga0070694_100379145 | 3300005444 | Bacteria | 1102 |
| 92 | Ga0070708_100002234 | 3300005445 | Bacteria | 14975 |
| 93 | Ga0070708_100007645 | 3300005445 | Bacteria | 8657 |
| 94 | Ga0070708_100009440 | 3300005445 | Bacteria | 7864 |
| 95 | Ga0070708_100013006 | 3300005445 | Bacteria | 6801 |
| 96 | Ga0070708_100051348 | 3300005445 | Bacteria | 3653 |
| 97 | Ga0070708_100080220 | 3300005445 | Unclassified | 2953 |
| 98 | Ga0070708_100111653 | 3300005445 | Bacteria | 2513 |
| 99 | Ga0070708_100167418 | 3300005445 | Unclassified | 2050 |
| 100 | Ga0070708_100170109 | 3300005445 | Unclassified | 2034 |
| 101 | Ga0070708_100550176 | 3300005445 | Bacteria | 1089 |
| 102 | Ga0070663_100001100 | 3300005455 | Bacteria | 14847 |
| 103 | Ga0070663_100055043 | 3300005455 | Unclassified | 2846 |
| 104 | Ga0070663_100126382 | 3300005455 | Bacteria | 1937 |
| 105 | Ga0070678_100000132 | 3300005456 | Bacteria | 30106 |
| 106 | Ga0070678_100219391 | 3300005456 | Bacteria | 1580 |
| 107 | Ga0070678_100233612 | 3300005456 | Bacteria | 1534 |
| 108 | Ga0070678_100396342 | 3300005456 | Bacteria | 1198 |
| 109 | Ga0070662_100002516 | 3300005457 | Bacteria | 11296 |
| 110 | Ga0070681_10022842 | 3300005458 | Bacteria | 6286 |
| 111 | Ga0070681_10131286 | 3300005458 | Bacteria | 2437 |
| 112 | Ga0070681_10154076 | 3300005458 | Bacteria | 2224 |
| 113 | Ga0068867_100002078 | 3300005459 | Bacteria | 14030 |
| 114 | Ga0068867_100036546 | 3300005459 | Unclassified | 3566 |
| 115 | Ga0070685_10000029 | 3300005466 | Bacteria | 89387 |
| 116 | Ga0070706_100006640 | 3300005467 | Bacteria | 10916 |
| 117 | Ga0070706_100018844 | 3300005467 | Bacteria | 6365 |
| 118 | Ga0070706_100022657 | 3300005467 | Bacteria | 5783 |
| 119 | Ga0070706_100043222 | 3300005467 | Bacteria | 4164 |
| 120 | Ga0070706_100048444 | 3300005467 | Bacteria | 3921 |
| 121 | Ga0070706_100355551 | 3300005467 | Bacteria | 1365 |
| 122 | Ga0070707_100001060 | 3300005468 | Bacteria | 27175 |
| 123 | Ga0070707_100007098 | 3300005468 | Bacteria | 10386 |
| 124 | Ga0070707_100083298 | 3300005468 | Bacteria | 3090 |
| 125 | Ga0070707_100088495 | 3300005468 | Bacteria | 2996 |
| 126 | Ga0070707_100460481 | 3300005468 | Bacteria | 1232 |
| 127 | Ga0070707_100578537 | 3300005468 | Bacteria | 1085 |
| 128 | Ga0070698_100000116 | 3300005471 | Bacteria | 67960 |
| 129 | Ga0070698_100002762 | 3300005471 | Bacteria | 19296 |
| 130 | Ga0070698_100005605 | 3300005471 | Bacteria | 13728 |
| 131 | Ga0070698_100026380 | 3300005471 | Bacteria | 6047 |
| 132 | Ga0070698_100054364 | 3300005471 | Bacteria | 4065 |
| 133 | Ga0070698_100065765 | 3300005471 | Bacteria | 3650 |
| 134 | Ga0070698_100483878 | 3300005471 | Bacteria | 1175 |
| 135 | Ga0070699_100020819 | 3300005518 | Bacteria | 5656 |
| 136 | Ga0070699_100031406 | 3300005518 | Bacteria | 4584 |
| 137 | Ga0070699_100128976 | 3300005518 | Bacteria | 2229 |
| 138 | Ga0070699_100239927 | 3300005518 | Bacteria | 1617 |
| 139 | Ga0070699_100278759 | 3300005518 | Unclassified | 1497 |
| 140 | Ga0070699_100282284 | 3300005518 | Bacteria | 1487 |
| 141 | Ga0070699_100715962 | 3300005518 | Bacteria | 915 |
| 142 | Ga0070679_100007536 | 3300005530 | Bacteria | 10178 |
| 143 | Ga0070679_100020487 | 3300005530 | Bacteria | 6448 |
| 144 | Ga0070679_100029487 | 3300005530 | Bacteria | 5414 |
| 145 | Ga0070679_100044745 | 3300005530 | Bacteria | 4410 |
| 146 | Ga0070679_100248293 | 3300005530 | Unclassified | 1736 |
| 147 | Ga0070679_100396512 | 3300005530 | Bacteria | 1326 |
| 148 | Ga0070684_100021199 | 3300005535 | Bacteria | 5402 |
| 149 | Ga0070684_100023361 | 3300005535 | Bacteria | 5170 |
| 150 | Ga0070697_100000015 | 3300005536 | Bacteria | 143397 |
| 151 | Ga0070697_100001417 | 3300005536 | Bacteria | 18209 |
| 152 | Ga0070697_100011368 | 3300005536 | Bacteria | 6955 |
| 153 | Ga0070697_100018316 | 3300005536 | Bacteria | 5520 |
| 154 | Ga0070697_100020654 | 3300005536 | Bacteria | 5212 |
| 155 | Ga0070697_100144922 | 3300005536 | Bacteria | 1999 |
| 156 | Ga0070697_100203748 | 3300005536 | Bacteria | 1682 |
| 157 | Ga0070697_100208043 | 3300005536 | Bacteria | 1665 |
| 158 | Ga0070697_100243479 | 3300005536 | Bacteria | 1536 |
| 159 | Ga0068853_100000650 | 3300005539 | Bacteria | 23854 |
| 160 | Ga0068853_100001250 | 3300005539 | Bacteria | 18153 |
| 161 | Ga0068853_100026872 | 3300005539 | Unclassified | 4835 |
| 162 | Ga0070672_100066887 | 3300005543 | Unclassified | 2846 |
| 163 | Ga0070686_100000095 | 3300005544 | Bacteria | 61204 |
| 164 | Ga0070686_100009761 | 3300005544 | Bacteria | 5393 |
| 165 | Ga0070695_100003672 | 3300005545 | Bacteria | 8937 |
| 166 | Ga0070695_100010890 | 3300005545 | Bacteria | 5433 |
| 167 | Ga0070696_100005712 | 3300005546 | Bacteria | 8304 |
| 168 | Ga0070696_100113766 | 3300005546 | Unclassified | 1951 |
| 169 | Ga0070693_100000899 | 3300005547 | Bacteria | 13250 |
| 170 | Ga0070693_100001944 | 3300005547 | Bacteria | 9458 |
| 171 | Ga0070693_100020623 | 3300005547 | Bacteria | 3480 |
| 172 | Ga0070693_100028332 | 3300005547 | Bacteria | 3044 |
| 173 | Ga0070665_100002353 | 3300005548 | Bacteria | 20904 |
| 174 | Ga0070704_100004916 | 3300005549 | Bacteria | 7758 |
| 175 | Ga0070704_100017886 | 3300005549 | Bacteria | 4522 |
| 176 | Ga0070704_100154503 | 3300005549 | Bacteria | 1808 |
| 177 | Ga0068855_100002236 | 3300005563 | Bacteria | 23927 |
| 178 | Ga0070664_100001138 | 3300005564 | Bacteria | 21032 |
| 179 | Ga0070664_100003918 | 3300005564 | Bacteria | 12012 |
| 180 | Ga0070664_100153985 | 3300005564 | Bacteria | 2030 |
| 181 | Ga0070664_100204896 | 3300005564 | Bacteria | 1761 |
| 182 | Ga0070664_100499049 | 3300005564 | Bacteria | 1121 |
| 183 | Ga0068857_100000229 | 3300005577 | Bacteria | 37362 |
| 184 | Ga0068857_100004575 | 3300005577 | Bacteria | 11714 |
| 185 | Ga0068857_100219934 | 3300005577 | Bacteria | 1734 |
| 186 | Ga0068854_100000510 | 3300005578 | Bacteria | 23647 |
| 187 | Ga0068854_100046221 | 3300005578 | Bacteria | 3099 |
| 188 | Ga0068854_100290086 | 3300005578 | Bacteria | 1320 |
| 189 | Ga0068856_100001505 | 3300005614 | Bacteria | 24410 |
| 190 | Ga0068856_100006218 | 3300005614 | Bacteria | 11716 |
| 191 | Ga0068856_100036574 | 3300005614 | Bacteria | 4813 |
| 192 | Ga0068856_100094376 | 3300005614 | Unclassified | 2978 |
| 193 | Ga0068856_100303978 | 3300005614 | Bacteria | 1613 |
| 194 | Ga0068856_100418836 | 3300005614 | Bacteria | 1359 |
| 195 | Ga0070702_100059445 | 3300005615 | Bacteria | 2218 |
| 196 | Ga0068852_100000737 | 3300005616 | Bacteria | 21478 |
| 197 | Ga0068852_100021336 | 3300005616 | Bacteria | 5170 |
| 198 | Ga0068852_100120552 | 3300005616 | Bacteria | 2400 |
| 199 | Ga0068859_100001887 | 3300005617 | Bacteria | 21358 |
| 200 | Ga0068859_100030266 | 3300005617 | Bacteria | 5432 |
| 201 | Ga0068859_100139723 | 3300005617 | Bacteria | 2496 |
| 202 | Ga0068864_100000515 | 3300005618 | Bacteria | 33246 |
| 203 | Ga0068864_100064009 | 3300005618 | Unclassified | 3188 |
| 204 | Ga0068866_10000163 | 3300005718 | Bacteria | 30713 |
| 205 | Ga0068866_10045896 | 3300005718 | Unclassified | 2194 |
| 206 | Ga0068861_100000627 | 3300005719 | Bacteria | 20904 |
| 207 | Ga0068851_10000655 | 3300005834 | Bacteria | 14771 |
| 208 | Ga0068851_10005056 | 3300005834 | Bacteria | 5985 |
| 209 | Ga0068870_10000020 | 3300005840 | Bacteria | 56949 |
| 210 | Ga0068870_10211187 | 3300005840 | Bacteria | 1182 |
| 211 | Ga0068863_100002050 | 3300005841 | Bacteria | 19955 |
| 212 | Ga0068863_100006327 | 3300005841 | Bacteria | 11612 |
| 213 | Ga0068863_100011083 | 3300005841 | Bacteria | 8741 |
| 214 | Ga0068863_100036143 | 3300005841 | Unclassified | 4705 |
| 215 | Ga0068863_100055906 | 3300005841 | Bacteria | 3737 |
| 216 | Ga0068863_100265908 | 3300005841 | Unclassified | 1659 |
| 217 | Ga0068858_100000052 | 3300005842 | Bacteria | 119935 |
| 218 | Ga0068858_100001984 | 3300005842 | Bacteria | 20904 |
| 219 | Ga0068858_100019166 | 3300005842 | Bacteria | 6401 |
| 220 | Ga0068858_100090583 | 3300005842 | Unclassified | 2846 |
| 221 | Ga0068858_100317856 | 3300005842 | Bacteria | 1487 |
| 222 | Ga0068858_100365590 | 3300005842 | Bacteria | 1383 |
| 223 | Ga0068860_100000901 | 3300005843 | Bacteria | 32961 |
| 224 | Ga0068860_100003570 | 3300005843 | Bacteria | 15988 |
| 225 | Ga0068860_100013865 | 3300005843 | Bacteria | 7903 |
| 226 | Ga0068860_100196583 | 3300005843 | Bacteria | 1953 |
| 227 | Ga0068860_100539167 | 3300005843 | Bacteria | 1168 |
| 228 | Ga0068862_100000692 | 3300005844 | Bacteria | 34430 |
| 229 | Ga0068862_100004205 | 3300005844 | Bacteria | 12187 |
| 230 | Ga0081455_10075554 | 3300005937 | Unclassified | 2779 |
| 231 | Ga0081540_1000073 | 3300005983 | Bacteria | 108893 |
| 232 | Ga0081540_1000209 | 3300005983 | Bacteria | 61438 |
| 233 | Ga0081540_1003942 | 3300005983 | Bacteria | 11534 |
| 234 | Ga0081540_1044270 | 3300005983 | Bacteria | 2274 |
| 235 | Ga0081539_10000156 | 3300005985 | Bacteria | 158871 |
| 236 | Ga0081539_10000915 | 3300005985 | Bacteria | 55784 |
| 237 | Ga0070717_10001271 | 3300006028 | Bacteria | 17248 |
| 238 | Ga0070717_10004006 | 3300006028 | Bacteria | 10607 |
| 239 | Ga0070717_10005880 | 3300006028 | Bacteria | 8984 |
| 240 | Ga0070717_10006876 | 3300006028 | Bacteria | 8398 |
| 241 | Ga0070717_10015963 | 3300006028 | Bacteria | 5813 |
| 242 | Ga0070717_10018743 | 3300006028 | Bacteria | 5412 |
| 243 | Ga0070717_10032056 | 3300006028 | Bacteria | 4231 |
| 244 | Ga0070717_10043134 | 3300006028 | Bacteria | 3681 |
| 245 | Ga0070717_10061399 | 3300006028 | Bacteria | 3114 |
| 246 | Ga0070717_10091930 | 3300006028 | Bacteria | 2563 |
| 247 | Ga0070717_10114509 | 3300006028 | Bacteria | 2304 |
| 248 | Ga0070717_10220737 | 3300006028 | Bacteria | 1666 |
| 249 | Ga0070717_10312201 | 3300006028 | Bacteria | 1399 |
| 250 | Ga0070716_100000077 | 3300006173 | Bacteria | 37966 |
| 251 | Ga0070716_100003912 | 3300006173 | Bacteria | 7075 |
| 252 | Ga0070716_100010734 | 3300006173 | Unclassified | 4602 |
| 253 | Ga0070716_100120766 | 3300006173 | Bacteria | 1640 |
| 254 | Ga0070712_100002274 | 3300006175 | Bacteria | 11826 |
| 255 | Ga0070712_100066055 | 3300006175 | Unclassified | 2570 |
| 256 | Ga0070712_100317440 | 3300006175 | Bacteria | 1266 |
| 257 | Ga0070712_100323571 | 3300006175 | Bacteria | 1254 |
| 258 | Ga0097621_100000516 | 3300006237 | Bacteria | 27119 |
| 259 | Ga0068871_100002377 | 3300006358 | Bacteria | 12832 |
| 260 | Ga0068871_100004618 | 3300006358 | Bacteria | 9614 |
| 261 | Ga0068871_100110200 | 3300006358 | Bacteria | 2315 |
| 262 | Ga0075428_100001171 | 3300006844 | Bacteria | 28061 |
| 263 | Ga0075428_100088747 | 3300006844 | Bacteria | 3373 |
| 264 | Ga0075428_100606358 | 3300006844 | Bacteria | 1169 |
| 265 | Ga0075431_100006607 | 3300006847 | Bacteria | 11523 |
| 266 | Ga0075433_10004048 | 3300006852 | Bacteria | 11348 |
| 267 | Ga0075433_10021471 | 3300006852 | Bacteria | 5414 |
| 268 | Ga0075433_10040628 | 3300006852 | Bacteria | 4027 |
| 269 | Ga0075433_10129670 | 3300006852 | Bacteria | 2240 |
| 270 | Ga0075434_100000857 | 3300006871 | Bacteria | 24283 |
| 271 | Ga0075434_100000998 | 3300006871 | Bacteria | 22952 |
| 272 | Ga0075434_100024391 | 3300006871 | Bacteria | 5913 |
| 273 | Ga0075434_100036771 | 3300006871 | Bacteria | 4843 |
| 274 | Ga0075434_100164494 | 3300006871 | Bacteria | 2238 |
| 275 | Ga0075434_100167424 | 3300006871 | Bacteria | 2217 |
| 276 | Ga0075434_100241405 | 3300006871 | Unclassified | 1827 |
| 277 | Ga0075434_100731001 | 3300006871 | Bacteria | 1007 |
| 278 | Ga0068865_100000545 | 3300006881 | Bacteria | 20904 |
| 279 | Ga0075436_100008041 | 3300006914 | Bacteria | 7220 |
| 280 | Ga0075436_100038031 | 3300006914 | Bacteria | 3322 |
| 281 | Ga0075436_100111704 | 3300006914 | Bacteria | 1908 |
| 282 | Ga0075436_100199547 | 3300006914 | Bacteria | 1417 |
| 283 | Ga0097620_100001887 | 3300006931 | Bacteria | 21358 |
| 284 | Ga0097620_100030267 | 3300006931 | Bacteria | 5432 |
| 285 | Ga0097620_100139732 | 3300006931 | Bacteria | 2496 |
| 286 | Ga0075435_100000556 | 3300007076 | Bacteria | 22959 |
| 287 | Ga0075435_100013847 | 3300007076 | Bacteria | 6013 |
| 288 | Ga0075435_100017964 | 3300007076 | Bacteria | 5363 |
| 289 | Ga0075435_100065237 | 3300007076 | Bacteria | 2960 |
| 290 | Ga0075435_100101680 | 3300007076 | Bacteria | 2382 |
| 291 | Ga0075435_100134133 | 3300007076 | Bacteria | 2073 |
| 292 | Ga0075435_100210029 | 3300007076 | Unclassified | 1651 |
| 293 | Ga0075435_100285546 | 3300007076 | Bacteria | 1409 |
| 294 | Ga0099794_10008967 | 3300007265 | Unclassified | 4175 |
| 295 | Ga0099794_10020363 | 3300007265 | Bacteria | 3001 |
| 296 | Ga0099794_10031940 | 3300007265 | Bacteria | 2468 |
| 297 | Ga0099794_10066220 | 3300007265 | Bacteria | 1763 |
| 298 | Ga0099794_10102664 | 3300007265 | Bacteria | 1428 |
| 299 | Ga0099794_10146586 | 3300007265 | Bacteria | 1197 |
| 300 | Ga0099794_10166100 | 3300007265 | Bacteria | 1124 |
| 301 | Ga0105250_10069540 | 3300009092 | Bacteria | 1421 |
| 302 | Ga0105240_10004283 | 3300009093 | Bacteria | 21801 |
| 303 | Ga0105240_10420990 | 3300009093 | Bacteria | 1501 |
| 304 | Ga0111539_10177758 | 3300009094 | Bacteria | 2486 |
| 305 | Ga0111539_10281818 | 3300009094 | Bacteria | 1934 |
| 306 | Ga0105245_10013162 | 3300009098 | Bacteria | 7209 |
| 307 | Ga0105245_10040190 | 3300009098 | Unclassified | 4166 |
| 308 | Ga0105245_10106560 | 3300009098 | Bacteria | 2601 |
| 309 | Ga0105245_10308489 | 3300009098 | Bacteria | 1555 |
| 310 | Ga0105247_10000003 | 3300009101 | Bacteria | 694517 |
| 311 | Ga0105247_10000214 | 3300009101 | Bacteria | 56190 |
| 312 | Ga0105247_10088721 | 3300009101 | Bacteria | 1960 |
| 313 | Ga0105247_10116497 | 3300009101 | Bacteria | 1726 |
| 314 | Ga0105247_10121114 | 3300009101 | Bacteria | 1695 |
| 315 | Ga0105247_10241556 | 3300009101 | Bacteria | 1231 |
| 316 | Ga0114129_10000201 | 3300009147 | Bacteria | 66395 |
| 317 | Ga0114129_10007058 | 3300009147 | Bacteria | 15993 |
| 318 | Ga0114129_10008742 | 3300009147 | Bacteria | 14441 |
| 319 | Ga0114129_10052936 | 3300009147 | Bacteria | 5695 |
| 320 | Ga0114129_10126174 | 3300009147 | Bacteria | 3518 |
| 321 | Ga0105243_10001203 | 3300009148 | Bacteria | 23303 |
| 322 | Ga0105243_10176501 | 3300009148 | Bacteria | 1855 |
| 323 | Ga0105241_10001583 | 3300009174 | Bacteria | 17415 |
| 324 | Ga0105241_10042177 | 3300009174 | Bacteria | 3451 |
| 325 | Ga0105241_10066264 | 3300009174 | Bacteria | 2792 |
| 326 | Ga0105241_10397922 | 3300009174 | Bacteria | 1207 |
| 327 | Ga0105242_10003402 | 3300009176 | Bacteria | 12372 |
| 328 | Ga0105242_10027989 | 3300009176 | Bacteria | 4482 |
| 329 | Ga0105242_10103390 | 3300009176 | Bacteria | 2417 |
| 330 | Ga0105242_10274504 | 3300009176 | Bacteria | 1528 |
| 331 | Ga0105248_10002038 | 3300009177 | Bacteria | 22389 |
| 332 | Ga0105248_10194132 | 3300009177 | Bacteria | 2287 |
| 333 | Ga0105237_10000421 | 3300009545 | Bacteria | 60441 |
| 334 | Ga0105238_10000359 | 3300009551 | Bacteria | 48860 |
| 335 | Ga0105238_10003254 | 3300009551 | Bacteria | 16214 |
| 336 | Ga0105238_10018855 | 3300009551 | Bacteria | 7023 |
| 337 | Ga0105249_10000494 | 3300009553 | Bacteria | 36412 |
| 338 | Ga0105249_10002142 | 3300009553 | Bacteria | 17106 |
| 339 | Ga0105249_10006198 | 3300009553 | Bacteria | 10383 |
| 340 | Ga0105249_10027248 | 3300009553 | Bacteria | 5156 |
| 341 | Ga0105249_10083789 | 3300009553 | Unclassified | 2968 |
| 342 | Ga0105239_10001190 | 3300010375 | Bacteria | 35590 |
| 343 | Ga0105239_10054754 | 3300010375 | Bacteria | 4376 |
| 344 | Ga0105246_10004738 | 3300011119 | Bacteria | 8286 |
| 345 | Ga0105246_10055158 | 3300011119 | Unclassified | 2742 |
| 346 | Ga0157373_10001697 | 3300013100 | Bacteria | 16792 |
| 347 | Ga0157371_10000366 | 3300013102 | Bacteria | 57015 |
| 348 | Ga0157371_10160541 | 3300013102 | Bacteria | 1605 |
| 349 | Ga0157369_10003549 | 3300013105 | Bacteria | 18529 |
| 350 | Ga0157369_10039939 | 3300013105 | Bacteria | 5126 |
| 351 | Ga0157369_10060727 | 3300013105 | Bacteria | 4076 |
| 352 | Ga0157369_10158543 | 3300013105 | Bacteria | 2389 |
| 353 | Ga0157374_10000753 | 3300013296 | Bacteria | 28294 |
| 354 | Ga0157374_10049507 | 3300013296 | Bacteria | 3903 |
| 355 | Ga0157378_10000538 | 3300013297 | Bacteria | 36003 |
| 356 | Ga0157378_10000791 | 3300013297 | Bacteria | 29391 |
| 357 | Ga0157378_10021440 | 3300013297 | Bacteria | 5682 |
| 358 | Ga0157378_10023477 | 3300013297 | Bacteria | 5427 |
| 359 | Ga0157378_10074664 | 3300013297 | Bacteria | 3051 |
| 360 | Ga0163162_10000023 | 3300013306 | Bacteria | 193395 |
| 361 | Ga0163162_10001463 | 3300013306 | Bacteria | 21952 |
| 362 | Ga0163162_10005173 | 3300013306 | Bacteria | 12580 |
| 363 | Ga0163162_10058772 | 3300013306 | Unclassified | 3875 |
| 364 | Ga0163162_10413574 | 3300013306 | Bacteria | 1481 |
| 365 | Ga0163162_10464291 | 3300013306 | Bacteria | 1398 |
| 366 | Ga0157372_10006351 | 3300013307 | Bacteria | 12571 |
| 367 | Ga0157372_10028369 | 3300013307 | Bacteria | 6107 |
| 368 | Ga0157372_10082436 | 3300013307 | Unclassified | 3641 |
| 369 | Ga0157375_10001223 | 3300013308 | Bacteria | 22163 |
| 370 | Ga0157375_10233394 | 3300013308 | Bacteria | 1999 |
| 371 | Ga0163163_10000844 | 3300014325 | Bacteria | 26053 |
| 372 | Ga0163163_10044651 | 3300014325 | Unclassified | 4348 |
| 373 | Ga0163163_10137725 | 3300014325 | Bacteria | 2483 |
| 374 | Ga0157380_10069116 | 3300014326 | Bacteria | 2849 |
| 375 | Ga0157380_10406002 | 3300014326 | Bacteria | 1294 |
| 376 | Ga0157380_10729320 | 3300014326 | Bacteria | 1000 |
| 377 | Ga0157377_10005614 | 3300014745 | Bacteria | 5911 |
| 378 | Ga0157377_10095983 | 3300014745 | Bacteria | 1758 |
| 379 | Ga0157379_10000868 | 3300014968 | Bacteria | 24452 |
| 380 | Ga0157379_10000892 | 3300014968 | Bacteria | 24134 |
| 381 | Ga0157379_10001230 | 3300014968 | Bacteria | 20786 |
| 382 | Ga0157379_10055638 | 3300014968 | Bacteria | 3535 |
| 383 | Ga0157379_10283883 | 3300014968 | Bacteria | 1507 |
| 384 | Ga0157376_10000032 | 3300014969 | Bacteria | 167294 |
| 385 | Ga0157376_10000590 | 3300014969 | Bacteria | 23408 |
| 386 | Ga0157376_10000629 | 3300014969 | Bacteria | 22878 |
| 387 | Ga0182007_10008481 | 3300015262 | Unclassified | 4218 |
| 388 | Ga0163161_10016205 | 3300017792 | Bacteria | 5201 |
| 389 | Ga0163161_10402941 | 3300017792 | Bacteria | 1097 |
| 390 | Ga0206353_11777813 | 3300020082 | Bacteria | 1451 |
| 391 | Ga0213872_10005062 | 3300021361 | Bacteria | 6837 |
| 392 | Ga0213872_10123175 | 3300021361 | Unclassified | 1145 |
| 393 | Ga0213874_10057603 | 3300021377 | Bacteria | 1209 |
| 394 | Ga0213876_10000282 | 3300021384 | Bacteria | 46388 |
| 395 | Ga0213871_10004327 | 3300021441 | Bacteria | 2831 |
| 396 | Ga0228598_1026488 | 3300024227 | Unclassified | 1140 |
| 397 | Ga0207672_1000061 | 3300025223 | Bacteria | 14428 |
| 398 | Ga0207697_10002581 | 3300025315 | Bacteria | 9331 |
| 399 | Ga0207697_10007233 | 3300025315 | Bacteria | 4960 |
| 400 | Ga0207656_10000118 | 3300025321 | Bacteria | 30233 |
| 401 | Ga0207656_10009662 | 3300025321 | Unclassified | 3585 |
| 402 | Ga0207653_10003573 | 3300025885 | Unclassified | 4897 |
| 403 | Ga0207682_10000028 | 3300025893 | Bacteria | 58704 |
| 404 | Ga0207692_10006538 | 3300025898 | Bacteria | 4731 |
| 405 | Ga0207692_10033574 | 3300025898 | Unclassified | 2477 |
| 406 | Ga0207642_10017845 | 3300025899 | Bacteria | 2709 |
| 407 | Ga0207642_10184173 | 3300025899 | Bacteria | 1140 |
| 408 | Ga0207710_10000001 | 3300025900 | Bacteria | 1797433 |
| 409 | Ga0207710_10000971 | 3300025900 | Bacteria | 15075 |
| 410 | Ga0207710_10083469 | 3300025900 | Bacteria | 1485 |
| 411 | Ga0207688_10007178 | 3300025901 | Bacteria | 6060 |
| 412 | Ga0207688_10074374 | 3300025901 | Bacteria | 1932 |
| 413 | Ga0207680_10001631 | 3300025903 | Bacteria | 10613 |
| 414 | Ga0207680_10012422 | 3300025903 | Bacteria | 4335 |
| 415 | Ga0207647_10015608 | 3300025904 | Bacteria | 5202 |
| 416 | Ga0207647_10051399 | 3300025904 | Bacteria | 2547 |
| 417 | Ga0207685_10114747 | 3300025905 | Bacteria | 1173 |
| 418 | Ga0207699_10002217 | 3300025906 | Bacteria | 9162 |
| 419 | Ga0207699_10031494 | 3300025906 | Unclassified | 2978 |
| 420 | Ga0207699_10157678 | 3300025906 | Bacteria | 1508 |
| 421 | Ga0207699_10173534 | 3300025906 | Bacteria | 1444 |
| 422 | Ga0207645_10000053 | 3300025907 | Bacteria | 83208 |
| 423 | Ga0207645_10001227 | 3300025907 | Bacteria | 21125 |
| 424 | Ga0207645_10051817 | 3300025907 | Bacteria | 2623 |
| 425 | Ga0207643_10000013 | 3300025908 | Bacteria | 130464 |
| 426 | Ga0207643_10006285 | 3300025908 | Bacteria | 6358 |
| 427 | Ga0207705_10015725 | 3300025909 | Bacteria | 5433 |
| 428 | Ga0207705_10077480 | 3300025909 | Bacteria | 2418 |
| 429 | Ga0207684_10002255 | 3300025910 | Bacteria | 19641 |
| 430 | Ga0207684_10020820 | 3300025910 | Bacteria | 5603 |
| 431 | Ga0207684_10033176 | 3300025910 | Bacteria | 4391 |
| 432 | Ga0207684_10039566 | 3300025910 | Bacteria | 3998 |
| 433 | Ga0207684_10040272 | 3300025910 | Bacteria | 3962 |
| 434 | Ga0207684_10094636 | 3300025910 | Bacteria | 2548 |
| 435 | Ga0207684_10300122 | 3300025910 | Bacteria | 1385 |
| 436 | Ga0207684_10366231 | 3300025910 | Bacteria | 1240 |
| 437 | Ga0207654_10020659 | 3300025911 | Bacteria | 3495 |
| 438 | Ga0207654_10056836 | 3300025911 | Bacteria | 2272 |
| 439 | Ga0207707_10068805 | 3300025912 | Bacteria | 3085 |
| 440 | Ga0207707_10131778 | 3300025912 | Bacteria | 2186 |
| 441 | Ga0207707_10133199 | 3300025912 | Bacteria | 2174 |
| 442 | Ga0207707_10182918 | 3300025912 | Bacteria | 1829 |
| 443 | Ga0207695_10004014 | 3300025913 | Bacteria | 20254 |
| 444 | Ga0207671_10000884 | 3300025914 | Bacteria | 37963 |
| 445 | Ga0207693_10000067 | 3300025915 | Bacteria | 91025 |
| 446 | Ga0207693_10018302 | 3300025915 | Bacteria | 5582 |
| 447 | Ga0207693_10023756 | 3300025915 | Bacteria | 4865 |
| 448 | Ga0207693_10024033 | 3300025915 | Bacteria | 4838 |
| 449 | Ga0207693_10053314 | 3300025915 | Bacteria | 3173 |
| 450 | Ga0207693_10097723 | 3300025915 | Bacteria | 2302 |
| 451 | Ga0207693_10108854 | 3300025915 | Bacteria | 2174 |
| 452 | Ga0207693_10209858 | 3300025915 | Bacteria | 1531 |
| 453 | Ga0207693_10358296 | 3300025915 | Bacteria | 1141 |
| 454 | Ga0207663_10013386 | 3300025916 | Unclassified | 4458 |
| 455 | Ga0207663_10019141 | 3300025916 | Bacteria | 3850 |
| 456 | Ga0207663_10063469 | 3300025916 | Unclassified | 2352 |
| 457 | Ga0207663_10164419 | 3300025916 | Unclassified | 1570 |
| 458 | Ga0207663_10176077 | 3300025916 | Bacteria | 1524 |
| 459 | Ga0207663_10258286 | 3300025916 | Bacteria | 1285 |
| 460 | Ga0207660_10008522 | 3300025917 | Bacteria | 6633 |
| 461 | Ga0207660_10021173 | 3300025917 | Bacteria | 4371 |
| 462 | Ga0207660_10219348 | 3300025917 | Bacteria | 1492 |
| 463 | Ga0207662_10000009 | 3300025918 | Bacteria | 95358 |
| 464 | Ga0207662_10002842 | 3300025918 | Bacteria | 8753 |
| 465 | Ga0207662_10044078 | 3300025918 | Bacteria | 2633 |
| 466 | Ga0207657_10000042 | 3300025919 | Bacteria | 118735 |
| 467 | Ga0207657_10023284 | 3300025919 | Bacteria | 5771 |
| 468 | Ga0207657_10047938 | 3300025919 | Bacteria | 3732 |
| 469 | Ga0207649_10001939 | 3300025920 | Bacteria | 11784 |
| 470 | Ga0207649_10002049 | 3300025920 | Bacteria | 11461 |
| 471 | Ga0207652_10013588 | 3300025921 | Bacteria | 6583 |
| 472 | Ga0207652_10053635 | 3300025921 | Bacteria | 3464 |
| 473 | Ga0207646_10000054 | 3300025922 | Bacteria | 160414 |
| 474 | Ga0207646_10000305 | 3300025922 | Bacteria | 66759 |
| 475 | Ga0207646_10036483 | 3300025922 | Bacteria | 4437 |
| 476 | Ga0207646_10040993 | 3300025922 | Bacteria | 4163 |
| 477 | Ga0207646_10077168 | 3300025922 | Bacteria | 2978 |
| 478 | Ga0207646_10170809 | 3300025922 | Bacteria | 1963 |
| 479 | Ga0207646_10231453 | 3300025922 | Unclassified | 1669 |
| 480 | Ga0207646_10283657 | 3300025922 | Bacteria | 1497 |
| 481 | Ga0207681_10000159 | 3300025923 | Bacteria | 56045 |
| 482 | Ga0207681_10259586 | 3300025923 | Bacteria | 1360 |
| 483 | Ga0207694_10000788 | 3300025924 | Bacteria | 28497 |
| 484 | Ga0207694_10113578 | 3300025924 | Bacteria | 2157 |
| 485 | Ga0207694_10620914 | 3300025924 | Bacteria | 909 |
| 486 | Ga0207650_10000152 | 3300025925 | Bacteria | 83134 |
| 487 | Ga0207650_10000445 | 3300025925 | Bacteria | 35419 |
| 488 | Ga0207650_10339148 | 3300025925 | Bacteria | 1234 |
| 489 | Ga0207659_10000098 | 3300025926 | Bacteria | 51164 |
| 490 | Ga0207659_10028596 | 3300025926 | Bacteria | 3790 |
| 491 | Ga0207687_10035721 | 3300025927 | Bacteria | 3382 |
| 492 | Ga0207687_10099369 | 3300025927 | Bacteria | 2138 |
| 493 | Ga0207687_10302840 | 3300025927 | Unclassified | 1288 |
| 494 | Ga0207700_10006884 | 3300025928 | Bacteria | 6912 |
| 495 | Ga0207700_10082658 | 3300025928 | Bacteria | 2512 |
| 496 | Ga0207700_10121754 | 3300025928 | Eukaryota | 2117 |
| 497 | Ga0207664_10095040 | 3300025929 | Bacteria | 2451 |
| 498 | Ga0207664_10208372 | 3300025929 | Bacteria | 1690 |
| 499 | Ga0207664_10250789 | 3300025929 | Unclassified | 1545 |
| 500 | Ga0207644_10000603 | 3300025931 | Bacteria | 22852 |
| 501 | Ga0207644_10001827 | 3300025931 | Bacteria | 13817 |
| 502 | Ga0207644_10015007 | 3300025931 | Bacteria | 5195 |
| 503 | Ga0207690_10002207 | 3300025932 | Bacteria | 11874 |
| 504 | Ga0207690_10024946 | 3300025932 | Bacteria | 3748 |
| 505 | Ga0207690_10034129 | 3300025932 | Bacteria | 3276 |
| 506 | Ga0207706_10000046 | 3300025933 | Bacteria | 119273 |
| 507 | Ga0207706_10000997 | 3300025933 | Bacteria | 28833 |
| 508 | Ga0207706_10024630 | 3300025933 | Bacteria | 5394 |
| 509 | Ga0207686_10026156 | 3300025934 | Bacteria | 3403 |
| 510 | Ga0207686_10027990 | 3300025934 | Bacteria | 3307 |
| 511 | Ga0207686_10206422 | 3300025934 | Bacteria | 1410 |
| 512 | Ga0207709_10002043 | 3300025935 | Bacteria | 13060 |
| 513 | Ga0207670_10000494 | 3300025936 | Bacteria | 21764 |
| 514 | Ga0207670_10028206 | 3300025936 | Bacteria | 3560 |
| 515 | Ga0207669_10000156 | 3300025937 | Bacteria | 32361 |
| 516 | Ga0207704_10000142 | 3300025938 | Bacteria | 38359 |
| 517 | Ga0207665_10000028 | 3300025939 | Bacteria | 96657 |
| 518 | Ga0207665_10002791 | 3300025939 | Bacteria | 11705 |
| 519 | Ga0207665_10010969 | 3300025939 | Bacteria | 5948 |
| 520 | Ga0207665_10014872 | 3300025939 | Bacteria | 5114 |
| 521 | Ga0207665_10024988 | 3300025939 | Bacteria | 3939 |
| 522 | Ga0207665_10108834 | 3300025939 | Bacteria | 1945 |
| 523 | Ga0207665_10155741 | 3300025939 | Bacteria | 1640 |
| 524 | Ga0207665_10193566 | 3300025939 | Unclassified | 1478 |
| 525 | Ga0207665_10196113 | 3300025939 | Bacteria | 1469 |
| 526 | Ga0207691_10000424 | 3300025940 | Bacteria | 41981 |
| 527 | Ga0207691_10080693 | 3300025940 | Unclassified | 2925 |
| 528 | Ga0207711_10000582 | 3300025941 | Bacteria | 37108 |
| 529 | Ga0207711_10005299 | 3300025941 | Bacteria | 10933 |
| 530 | Ga0207689_10000071 | 3300025942 | Bacteria | 82580 |
| 531 | Ga0207689_10010738 | 3300025942 | Bacteria | 7880 |
| 532 | Ga0207689_10019760 | 3300025942 | Bacteria | 5675 |
| 533 | Ga0207689_10099776 | 3300025942 | Unclassified | 2386 |
| 534 | Ga0207661_10001036 | 3300025944 | Bacteria | 18457 |
| 535 | Ga0207661_10003627 | 3300025944 | Bacteria | 10749 |
| 536 | Ga0207661_10275636 | 3300025944 | Bacteria | 1502 |
| 537 | Ga0207661_10443578 | 3300025944 | Bacteria | 1181 |
| 538 | Ga0207679_10000111 | 3300025945 | Bacteria | 66057 |
| 539 | Ga0207679_10000469 | 3300025945 | Bacteria | 28287 |
| 540 | Ga0207679_10141945 | 3300025945 | Bacteria | 1943 |
| 541 | Ga0207667_10001419 | 3300025949 | Bacteria | 29991 |
| 542 | Ga0207651_10000110 | 3300025960 | Bacteria | 35015 |
| 543 | Ga0207712_10000785 | 3300025961 | Bacteria | 23685 |
| 544 | Ga0207712_10000854 | 3300025961 | Bacteria | 22213 |
| 545 | Ga0207712_10519749 | 3300025961 | Unclassified | 1020 |
| 546 | Ga0207668_10000657 | 3300025972 | Bacteria | 21213 |
| 547 | Ga0207668_10001179 | 3300025972 | Bacteria | 15521 |
| 548 | Ga0207668_10009454 | 3300025972 | Bacteria | 5844 |
| 549 | Ga0207640_10000497 | 3300025981 | Bacteria | 23939 |
| 550 | Ga0207640_10298071 | 3300025981 | Bacteria | 1274 |
| 551 | Ga0207640_10318377 | 3300025981 | Unclassified | 1237 |
| 552 | Ga0207658_10000736 | 3300025986 | Bacteria | 28243 |
| 553 | Ga0207658_10041767 | 3300025986 | Unclassified | 3322 |
| 554 | Ga0207658_10251937 | 3300025986 | Bacteria | 1501 |
| 555 | Ga0207677_10000492 | 3300026023 | Bacteria | 25634 |
| 556 | Ga0207677_10078951 | 3300026023 | Bacteria | 2352 |
| 557 | Ga0207677_10449336 | 3300026023 | Bacteria | 1104 |
| 558 | Ga0207703_10000303 | 3300026035 | Bacteria | 54018 |
| 559 | Ga0207703_10000406 | 3300026035 | Bacteria | 46246 |
| 560 | Ga0207703_10014323 | 3300026035 | Bacteria | 6186 |
| 561 | Ga0207703_10019932 | 3300026035 | Bacteria | 5241 |
| 562 | Ga0207639_10000612 | 3300026041 | Bacteria | 24578 |
| 563 | Ga0207639_10005469 | 3300026041 | Bacteria | 8583 |
| 564 | Ga0207639_10012900 | 3300026041 | Bacteria | 5830 |
| 565 | Ga0207678_10001602 | 3300026067 | Bacteria | 20820 |
| 566 | Ga0207678_10010230 | 3300026067 | Bacteria | 8236 |
| 567 | Ga0207678_10089793 | 3300026067 | Bacteria | 2626 |
| 568 | Ga0207708_10025320 | 3300026075 | Bacteria | 4488 |
| 569 | Ga0207708_10252658 | 3300026075 | Unclassified | 1421 |
| 570 | Ga0207702_10006363 | 3300026078 | Bacteria | 10195 |
| 571 | Ga0207702_10012630 | 3300026078 | Bacteria | 7031 |
| 572 | Ga0207702_10024347 | 3300026078 | Bacteria | 5023 |
| 573 | Ga0207702_10038618 | 3300026078 | Bacteria | 3998 |
| 574 | Ga0207702_10040486 | 3300026078 | Bacteria | 3906 |
| 575 | Ga0207702_10299956 | 3300026078 | Bacteria | 1525 |
| 576 | Ga0207641_10000052 | 3300026088 | Bacteria | 173672 |
| 577 | Ga0207641_10000918 | 3300026088 | Bacteria | 30377 |
| 578 | Ga0207641_10001136 | 3300026088 | Bacteria | 26731 |
| 579 | Ga0207641_10008550 | 3300026088 | Bacteria | 8456 |
| 580 | Ga0207641_10054301 | 3300026088 | Bacteria | 3399 |
| 581 | Ga0207641_10079691 | 3300026088 | Bacteria | 2840 |
| 582 | Ga0207648_10000852 | 3300026089 | Bacteria | 34458 |
| 583 | Ga0207648_10001157 | 3300026089 | Bacteria | 29556 |
| 584 | Ga0207676_10000398 | 3300026095 | Bacteria | 36746 |
| 585 | Ga0207676_10001279 | 3300026095 | Bacteria | 18699 |
| 586 | Ga0207674_10000038 | 3300026116 | Bacteria | 132350 |
| 587 | Ga0207674_10033229 | 3300026116 | Bacteria | 5402 |
| 588 | Ga0207674_10098172 | 3300026116 | Bacteria | 2913 |
| 589 | Ga0207675_100000565 | 3300026118 | Bacteria | 36276 |
| 590 | Ga0207675_100017316 | 3300026118 | Bacteria | 6728 |
| 591 | Ga0207675_100118502 | 3300026118 | Bacteria | 2503 |
| 592 | Ga0207683_10000837 | 3300026121 | Bacteria | 28145 |
| 593 | Ga0207683_10000885 | 3300026121 | Bacteria | 27525 |
| 594 | Ga0207683_10078072 | 3300026121 | Bacteria | 2933 |
| 595 | Ga0207698_10000519 | 3300026142 | Bacteria | 22380 |
| 596 | Ga0207698_10044616 | 3300026142 | Unclassified | 3333 |
| 597 | Ga0209995_1018260 | 3300027471 | Bacteria | 1156 |
| 598 | Ga0209983_1003242 | 3300027665 | Bacteria | 3490 |
| 599 | Ga0209588_1001160 | 3300027671 | Bacteria | 6798 |
| 600 | Ga0209588_1003408 | 3300027671 | Bacteria | 4409 |
| 601 | Ga0209588_1007189 | 3300027671 | Bacteria | 3266 |
| 602 | Ga0209588_1019289 | 3300027671 | Unclassified | 2128 |
| 603 | Ga0209971_1000218 | 3300027682 | Bacteria | 17035 |
| 604 | Ga0209998_10004009 | 3300027717 | Bacteria | 3156 |
| 605 | Ga0209974_10000140 | 3300027876 | Bacteria | 21625 |
| 606 | Ga0265354_1003961 | 3300028016 | Bacteria | 1598 |
| 607 | Ga0268266_10000072 | 3300028379 | Bacteria | 232245 |
| 608 | Ga0268266_10000389 | 3300028379 | Bacteria | 66723 |
| 609 | Ga0268265_10000592 | 3300028380 | Bacteria | 36516 |
| 610 | Ga0268265_10018692 | 3300028380 | Bacteria | 4805 |
| 611 | Ga0268265_10042990 | 3300028380 | Unclassified | 3355 |
| 612 | Ga0268264_10000191 | 3300028381 | Bacteria | 127257 |
| 613 | Ga0268264_10002754 | 3300028381 | Bacteria | 15352 |
| 614 | Ga0268264_10028224 | 3300028381 | Bacteria | 4588 |
| 615 | Ga0268264_10047540 | 3300028381 | Bacteria | 3568 |
| 616 | Ga0268264_10158185 | 3300028381 | Bacteria | 2038 |
| 617 | Ga0268264_10262853 | 3300028381 | Bacteria | 1608 |
| 618 | Ga0268264_10586501 | 3300028381 | Bacteria | 1097 |
| 619 | Ga0265334_10040666 | 3300028573 | Bacteria | 1820 |
| 620 | Ga0265338_10002968 | 3300028800 | Bacteria | 24614 |
| 621 | Ga0265338_10057562 | 3300028800 | Bacteria | 3438 |
| 622 | Ga0265338_10063139 | 3300028800 | Bacteria | 3232 |
| 623 | Ga0265338_10430266 | 3300028800 | Bacteria | 937 |
| 624 | Ga0265770_1001131 | 3300030878 | Bacteria | 3678 |
| 625 | Ga0265760_10001557 | 3300031090 | Bacteria | 6751 |
| 626 | Ga0265760_10002657 | 3300031090 | Bacteria | 5230 |
| 627 | Ga0265760_10020155 | 3300031090 | Unclassified | 1923 |
| 628 | Ga0265325_10081168 | 3300031241 | Bacteria | 1612 |
| 629 | Ga0265329_10015457 | 3300031242 | Unclassified | 2666 |
| 630 | Ga0265339_10000995 | 3300031249 | Bacteria | 21726 |
| 631 | Ga0265339_10007220 | 3300031249 | Bacteria | 7199 |
| 632 | Ga0265339_10078526 | 3300031249 | Bacteria | 1747 |
| 633 | Ga0265316_10001965 | 3300031344 | Bacteria | 21613 |
| 634 | Ga0265316_10004297 | 3300031344 | Bacteria | 14230 |
| 635 | Ga0265316_10030725 | 3300031344 | Unclassified | 4399 |
| 636 | Ga0265316_10173604 | 3300031344 | Unclassified | 1607 |
| 637 | Ga0307513_10015270 | 3300031456 | Bacteria | 9317 |
| 638 | Ga0265314_10000011 | 3300031711 | Bacteria | 445050 |
| 639 | Ga0265314_10008888 | 3300031711 | Bacteria | 8569 |
| 640 | Ga0265314_10043416 | 3300031711 | Bacteria | 3197 |
| 641 | Ga0316576_10000948 | 3300031727 | Bacteria | 14832 |
| 642 | Ga0316576_10107849 | 3300031727 | Bacteria | 2086 |
| 643 | Ga0316578_10198760 | 3300031728 | Unclassified | 1207 |
| 644 | Ga0316214_1003527 | 3300033545 | Bacteria | 1975 |
| 645 | Ga0316212_1001460 | 3300033547 | Bacteria | 3214 |
| 646 | Ga0373926_0074133 | 3300035083 | Unclassified | 1253 |
| 647 | Ga0373934_0043047 | 3300035086 | Unclassified | 1785 |
| 648 | Ga0373934_0105464 | 3300035086 | Bacteria | 1141 |
| 649 | Ga0373954_0000232 | 3300035118 | Bacteria | 20294 |
| 650 | Ga0373956_0006050 | 3300035119 | Unclassified | 4846 |
| 651 | Ga0373943_0037050 | 3300035170 | Bacteria | 2340 |
| 652 | Ga0373955_0004388 | 3300035172 | Bacteria | 6240 |
| 653 | Ga0373955_0215764 | 3300035172 | Bacteria | 1145 |
| 654 | Ga0373924_0063399 | 3300035410 | Bacteria | 1550 |
| 655 | Ga0373931_0059161 | 3300035691 | Bacteria | 2060 |
| 656 | Ga0373931_0154992 | 3300035691 | Bacteria | 1338 |
| 657 | Ga0373931_0482736 | 3300035691 | Bacteria | 797 |
| 658 | Ga0373927_0000181 | 3300035695 | Bacteria | 49692 |
| 659 | Ga0373933_0001080 | 3300035724 | Bacteria | 16381 |
| 660 | Ga0373947_0006847 | 3300035725 | Bacteria | 6610 |
| 661 | Ga0373947_0019837 | 3300035725 | Unclassified | 3880 |
| 662 | Ga0373947_0121016 | 3300035725 | Bacteria | 1663 |
| 663 | Ga0373937_0295577 | 3300036401 | Bacteria | 1530 |
| 664 | Ga0316584_0000032 | 3300036712 | Bacteria | 49300 |
| 665 | Ga0373925_0016750 | 3300037068 | Bacteria | 5308 |
| 666 | Ga0373925_0350525 | 3300037068 | Bacteria | 1199 |
| 667 | Ga0395900_0047532 | 3300037418 | Bacteria | 4419 |
| 668 | Ga0436364_1345024 | 3300037853 | Bacteria | 6229 |
| 669 | Ga0400489_81848 | 3300039093 | Bacteria | 1651 |
| 670 | Ga0436365_0740107 | 3300039437 | Bacteria | 83165 |
| 671 | Ga0436365_1419515 | 3300039437 | Unclassified | 2637 |
| 672 | Ga0436360_1132016 | 3300039438 | Bacteria | 1450 |
| 673 | Ga0436361_0004293 | 3300039447 | Bacteria | 26289 |
| 674 | Ga0436361_0365763 | 3300039447 | Bacteria | 13534 |
| 675 | Ga0436361_0706744 | 3300039447 | Bacteria | 22706 |
| 676 | Ga0436363_0846422 | 3300039450 | Bacteria | 1291 |
| 677 | Ga0436363_1072660 | 3300039450 | Bacteria | 5649 |
| 678 | Ga0436362_0975535 | 3300039453 | Unclassified | 2777 |
| 679 | Ga0439455_0005219 | 3300042012 | Bacteria | 2624 |
| 680 | Ga0451577_0015389 | 3300042876 | Bacteria | 7118 |
| 681 | Ga0451577_0080954 | 3300042876 | Bacteria | 2896 |
| 682 | Ga0451577_0096172 | 3300042876 | Bacteria | 2644 |
| 683 | Ga0451577_0191960 | 3300042876 | Bacteria | 1842 |
| 684 | Ga0451577_0580203 | 3300042876 | Bacteria | 1018 |
| 685 | Ga0466972_0136076 | 3300044658 | Bacteria | 1157 |
| 686 | Ga0453683_0011172 | 3300044673 | Bacteria | 5935 |
| 687 | Ga0453683_0023057 | 3300044673 | Bacteria | 3967 |
| 688 | Ga0453683_0038859 | 3300044673 | Bacteria | 2992 |
| 689 | Ga0453683_0090385 | 3300044673 | Bacteria | 1919 |
| 690 | Ga0453683_0130322 | 3300044673 | Bacteria | 1584 |
| 691 | Ga0466966_0156264 | 3300044684 | Bacteria | 1389 |
| 692 | Ga0466964_0076480 | 3300044706 | Unclassified | 1427 |
| 693 | Ga0453684_0010033 | 3300044712 | Bacteria | 16299 |
| 694 | Ga0453684_0147176 | 3300044712 | Bacteria | 2804 |
| 695 | Ga0453684_0239686 | 3300044712 | Bacteria | 2088 |
| 696 | Ga0466968_0053592 | 3300044735 | Unclassified | 1728 |
| 697 | Ga0466957_0092784 | 3300044842 | Bacteria | 1894 |
| 698 | Ga0466960_0051866 | 3300044901 | Bacteria | 1983 |
| 699 | Ga0466959_0009944 | 3300045049 | Bacteria | 6781 |
| 700 | Ga0466959_0269387 | 3300045049 | Unclassified | 1171 |
| 701 | Ga0451576_0020333 | 3300045051 | Bacteria | 7231 |
| 702 | Ga0451576_0184358 | 3300045051 | Bacteria | 2179 |
| 703 | Ga0451576_0237779 | 3300045051 | Unclassified | 1902 |
| 704 | Ga0451576_0561274 | 3300045051 | Bacteria | 1199 |
| 705 | Ga0451576_0905594 | 3300045051 | Bacteria | 925 |
| 706 | Ga0466967_0019685 | 3300045976 | Bacteria | 5434 |
| 707 | Ga0466967_0132192 | 3300045976 | Unclassified | 2318 |
| 708 | Ga0466967_0339289 | 3300045976 | Bacteria | 1453 |
| 709 | Ga0466967_0864593 | 3300045976 | Bacteria | 899 |
| 710 | Ga0495603_0048438 | 3300046455 | Bacteria | 2530 |
| 711 | Ga0495629_0060478 | 3300046459 | Bacteria | 2648 |
| 712 | Ga0495629_0070849 | 3300046459 | Bacteria | 2433 |
| 713 | Ga0495629_0126671 | 3300046459 | Unclassified | 1779 |
| 714 | Ga0495641_0023994 | 3300046461 | Bacteria | 3018 |
| 715 | Ga0495651_0052148 | 3300046462 | Unclassified | 3151 |
| 716 | Ga0495651_0080986 | 3300046462 | Bacteria | 2452 |
| 717 | Ga0495653_0009074 | 3300046463 | Bacteria | 8134 |
| 718 | Ga0495653_0150702 | 3300046463 | Bacteria | 1625 |
| 719 | Ga0495580_0011933 | 3300046472 | Bacteria | 6696 |
| 720 | Ga0495580_0015648 | 3300046472 | Bacteria | 5716 |
| 721 | Ga0495580_0018168 | 3300046472 | Bacteria | 5240 |
| 722 | Ga0495580_0022593 | 3300046472 | Bacteria | 4627 |
| 723 | Ga0495580_0031805 | 3300046472 | Bacteria | 3811 |
| 724 | Ga0495580_0051450 | 3300046472 | Bacteria | 2912 |
| 725 | Ga0495580_0301758 | 3300046472 | Unclassified | 1090 |
| 726 | Ga0495580_0330215 | 3300046472 | Bacteria | 1036 |
| 727 | Ga0495582_0000718 | 3300046473 | Bacteria | 18242 |
| 728 | Ga0495582_0009025 | 3300046473 | Bacteria | 5503 |
| 729 | Ga0495582_0032511 | 3300046473 | Bacteria | 2868 |
| 730 | Ga0495582_0126326 | 3300046473 | Bacteria | 1443 |
| 731 | Ga0495639_0005520 | 3300046475 | Bacteria | 5445 |
| 732 | Ga0495594_0067896 | 3300046499 | Unclassified | 1979 |
| 733 | Ga0495606_0201206 | 3300046507 | Bacteria | 1135 |
| 734 | Ga0495608_0022524 | 3300046511 | Unclassified | 4319 |
| 735 | Ga0495608_0082787 | 3300046511 | Bacteria | 2083 |
| 736 | Ga0495618_0121135 | 3300046514 | Bacteria | 1675 |
| 737 | Ga0495628_0136848 | 3300046516 | Bacteria | 1871 |
| 738 | Ga0495628_0251257 | 3300046516 | Bacteria | 1320 |
| 739 | Ga0495630_0022984 | 3300046517 | Bacteria | 4607 |
| 740 | Ga0495630_0033365 | 3300046517 | Bacteria | 3838 |
| 741 | Ga0495632_0087326 | 3300046519 | Bacteria | 1483 |
| 742 | Ga0495666_0060133 | 3300046526 | Unclassified | 1816 |
| 743 | Ga0495652_0186105 | 3300046529 | Bacteria | 1589 |
| 744 | Ga0495652_0210082 | 3300046529 | Bacteria | 1470 |
| 745 | Ga0495640_0110642 | 3300046533 | Bacteria | 1795 |
| 746 | Ga0495640_0131888 | 3300046533 | Unclassified | 1616 |
| 747 | Ga0495587_0009545 | 3300046536 | Bacteria | 6213 |
| 748 | Ga0495587_0010261 | 3300046536 | Bacteria | 5970 |
| 749 | Ga0495645_0160494 | 3300046543 | Bacteria | 1555 |
| 750 | Ga0495667_0062472 | 3300046559 | Unclassified | 2441 |
| 751 | Ga0495634_0022616 | 3300046642 | Bacteria | 4429 |
| 752 | Ga0495623_0010766 | 3300046679 | Bacteria | 5922 |
| 753 | Ga0495646_0019063 | 3300046680 | Bacteria | 4346 |
| 754 | Ga0495647_0011255 | 3300046681 | Unclassified | 3063 |
| 755 | Ga0495658_0009614 | 3300046683 | Bacteria | 4821 |
| 756 | Ga0495658_0013750 | 3300046683 | Bacteria | 4125 |
| 757 | Ga0495658_0066613 | 3300046683 | Bacteria | 2081 |
| 758 | Ga0495658_0241899 | 3300046683 | Bacteria | 1133 |
| 759 | Ga0495669_0001200 | 3300046684 | Bacteria | 10772 |
| 760 | Ga0495613_0191987 | 3300046689 | Bacteria | 1443 |
| 761 | Ga0495624_0109580 | 3300046690 | Unclassified | 1698 |
| 762 | Ga0495581_0150638 | 3300047315 | Bacteria | 1358 |
| 763 | Ga0495604_0001179 | 3300047317 | Bacteria | 21612 |
| 764 | Ga0495604_0008173 | 3300047317 | Bacteria | 8280 |
| 765 | Ga0495674_0039608 | 3300047319 | Bacteria | 4222 |
| 766 | Ga0495676_0013478 | 3300047321 | Bacteria | 7348 |
| 767 | Ga0495676_0184614 | 3300047321 | Bacteria | 1459 |
| 768 | Ga0495680_0008472 | 3300047322 | Bacteria | 9342 |
| 769 | Ga0495680_0008611 | 3300047322 | Bacteria | 9263 |
| 770 | Ga0495675_0055208 | 3300047444 | Bacteria | 2519 |
| 771 | Ga0495684_0037833 | 3300047471 | Bacteria | 3701 |
| 772 | Ga0495684_0071472 | 3300047471 | Bacteria | 2637 |
| 773 | Ga0495593_0124505 | 3300047673 | Bacteria | 1311 |
| 774 | Ga0495602_0002035 | 3300048088 | Bacteria | 20336 |
| 775 | Ga0495602_0020663 | 3300048088 | Bacteria | 6503 |
| 776 | Ga0495614_0122466 | 3300048089 | Bacteria | 1147 |
| 777 | Ga0496100_0050705 | 3300048903 | Bacteria | 2690 |
| 778 | Ga0496100_0076158 | 3300048903 | Bacteria | 2252 |
| 779 | Ga0496100_0271742 | 3300048903 | Bacteria | 1261 |
| 780 | Ga0496101_0020948 | 3300048904 | Bacteria | 4486 |
| 781 | Ga0496101_0021969 | 3300048904 | Bacteria | 4387 |
| 782 | Ga0496101_0154953 | 3300048904 | Bacteria | 1754 |
| 783 | Ga0496101_0174893 | 3300048904 | Unclassified | 1651 |
| 784 | Ga0496102_0000127 | 3300048905 | Bacteria | 104838 |
| 785 | Ga0496102_0002989 | 3300048905 | Bacteria | 14314 |
| 786 | Ga0496102_0005081 | 3300048905 | Bacteria | 11142 |
| 787 | Ga0496102_0050463 | 3300048905 | Bacteria | 3788 |
| 788 | Ga0496102_0237037 | 3300048905 | Unclassified | 1720 |
| 789 | Ga0496103_0000134 | 3300048906 | Bacteria | 77847 |
| 790 | Ga0496103_0000805 | 3300048906 | Bacteria | 23089 |
| 791 | Ga0496103_0191651 | 3300048906 | Bacteria | 1314 |
| 792 | Ga0496104_0010488 | 3300048907 | Bacteria | 8278 |
| 793 | Ga0496104_0013301 | 3300048907 | Bacteria | 7420 |
| 794 | Ga0496104_0123334 | 3300048907 | Bacteria | 2487 |
| 795 | Ga0496104_0162228 | 3300048907 | Bacteria | 2144 |
| 796 | Ga0496104_0262685 | 3300048907 | Unclassified | 1639 |
| 797 | Ga0496105_0012552 | 3300048908 | Bacteria | 6710 |
| 798 | Ga0496105_0044209 | 3300048908 | Bacteria | 3673 |
| 799 | Ga0496106_0021333 | 3300048909 | Bacteria | 4809 |
| 800 | Ga0496106_0023563 | 3300048909 | Bacteria | 4573 |
| 801 | Ga0496106_0462786 | 3300048909 | Bacteria | 1019 |
| 802 | Ga0496107_0039438 | 3300048910 | Bacteria | 3388 |
| 803 | Ga0496108_0002852 | 3300048911 | Bacteria | 13884 |
| 804 | Ga0496108_0056460 | 3300048911 | Bacteria | 3299 |
| 805 | Ga0496108_0232464 | 3300048911 | Bacteria | 1603 |
| 806 | Ga0496108_0255117 | 3300048911 | Bacteria | 1526 |
| 807 | Ga0496109_0000120 | 3300048912 | Bacteria | 81828 |
| 808 | Ga0496109_0049323 | 3300048912 | Bacteria | 3832 |
| 809 | Ga0496110_0001986 | 3300048913 | Bacteria | 15204 |
| 810 | Ga0496110_0141371 | 3300048913 | Bacteria | 2176 |
| 811 | Ga0496110_0295862 | 3300048913 | Bacteria | 1475 |
| 812 | Ga0496110_0539910 | 3300048913 | Bacteria | 1060 |
| 813 | Ga0496112_0000991 | 3300048915 | Bacteria | 20765 |
| 814 | Ga0496112_0004229 | 3300048915 | Bacteria | 12116 |
| 815 | Ga0496112_0008837 | 3300048915 | Bacteria | 9038 |
| 816 | Ga0496112_0097396 | 3300048915 | Bacteria | 2912 |
| 817 | Ga0496112_0199074 | 3300048915 | Bacteria | 1963 |
| 818 | Ga0496112_0244353 | 3300048915 | Bacteria | 1747 |
| 819 | Ga0496113_0002001 | 3300048916 | Bacteria | 11681 |
| 820 | Ga0496114_0006103 | 3300048917 | Bacteria | 9490 |
| 821 | Ga0496114_0055131 | 3300048917 | Bacteria | 3315 |
| 822 | Ga0496115_0009627 | 3300048918 | Bacteria | 7189 |
| 823 | Ga0496115_0032991 | 3300048918 | Bacteria | 4087 |
| 824 | Ga0496115_0213432 | 3300048918 | Bacteria | 1594 |
| 825 | Ga0496116_0000228 | 3300048919 | Bacteria | 104766 |
| 826 | Ga0496117_0000204 | 3300048920 | Bacteria | 116843 |
| 827 | Ga0496118_0000202 | 3300048921 | Bacteria | 104816 |
| 828 | Ga0496119_0000700 | 3300048922 | Bacteria | 44933 |
| 829 | Ga0496120_0016270 | 3300048923 | Bacteria | 4866 |
| 830 | Ga0496122_0190396 | 3300048925 | Bacteria | 1212 |
| 831 | Ga0496124_0036480 | 3300048927 | Bacteria | 4287 |
| 832 | Ga0496125_0042719 | 3300048928 | Bacteria | 3856 |
| 833 | Ga0496126_0000490 | 3300048929 | Bacteria | 77991 |
| 834 | Ga0501040_0075284 | 3300049576 | Bacteria | 2333 |
| 835 | Ga0501040_0173832 | 3300049576 | Bacteria | 1526 |
| 836 | Ga0501067_0099641 | 3300049583 | Bacteria | 1614 |
| 837 | Ga0501068_0086475 | 3300049584 | Bacteria | 1930 |
| 838 | Ga0501068_0345793 | 3300049584 | Bacteria | 955 |
| 839 | Ga0501074_0156324 | 3300049590 | Bacteria | 1629 |
| 840 | Ga0501075_0093436 | 3300049591 | Bacteria | 2283 |
| 841 | Ga0501075_0278751 | 3300049591 | Bacteria | 1274 |
| 842 | Ga0501076_0016323 | 3300049592 | Bacteria | 5630 |
| 843 | Ga0501076_0097671 | 3300049592 | Bacteria | 2366 |
| 844 | Ga0501079_0035098 | 3300049741 | Bacteria | 3859 |
| 845 | Ga0501079_0191373 | 3300049741 | Bacteria | 1597 |
| 846 | Ga0501079_0297143 | 3300049741 | Bacteria | 1263 |
| 847 | Ga0501079_0297398 | 3300049741 | Bacteria | 1263 |
| 848 | Ga0501080_0510757 | 3300049742 | Bacteria | 1073 |
| 849 | Ga0501081_0031133 | 3300049743 | Bacteria | 3615 |
| 850 | Ga0501081_0207782 | 3300049743 | Bacteria | 1421 |
| 851 | Ga0501045_0048949 | 3300049824 | Bacteria | 3081 |
| 852 | nmdc:mga05p37_10570_c1 | 3300050507 | Bacteria | 10944 |
| 853 | nmdc:mga05p37_18012_c1 | 3300050507 | Bacteria | 8529 |
| 854 | nmdc:mga05p37_189005_c1 | 3300050507 | Bacteria | 2502 |
| 855 | nmdc:mga05p37_25589_c1 | 3300050507 | Bacteria | 7179 |
| 856 | nmdc:mga05p37_28157_c1 | 3300050507 | Bacteria | 6849 |
| 857 | nmdc:mga0qj67_8713_c1 | 3300050509 | Bacteria | 7534 |
| 858 | nmdc:mga06r32_114312_c1 | 3300050510 | Bacteria | 2658 |
| 859 | nmdc:mga06r32_1152_c3 | 3300050510 | Bacteria | 6799 |
| 860 | nmdc:mga08y16_78126_c1 | 3300050511 | Bacteria | 3450 |
| 861 | nmdc:mga0n895_10216_c1 | 3300050512 | Bacteria | 8270 |
| 862 | nmdc:mga0n895_2147_c1 | 3300050512 | Bacteria | 15221 |
| 863 | nmdc:mga0n895_243326_c1 | 3300050512 | Bacteria | 1826 |
| 864 | nmdc:mga0n895_41205_c1 | 3300050512 | Bacteria | 4488 |
| 865 | nmdc:mga0n895_446499_c1 | 3300050512 | Bacteria | 1306 |
| 866 | nmdc:mga0n895_594_c1 | 3300050512 | Bacteria | 24988 |
| 867 | nmdc:mga0n895_665777_c1 | 3300050512 | Bacteria | 1039 |
| 868 | nmdc:mga0rr50_12540_c1 | 3300050513 | Bacteria | 5484 |
| 869 | nmdc:mga0rr50_12933_c1 | 3300050513 | Bacteria | 5413 |
| 870 | nmdc:mga0rr50_17955_c1 | 3300050513 | Bacteria | 4739 |
| 871 | nmdc:mga0rr50_195245_c1 | 3300050513 | Unclassified | 1661 |
| 872 | nmdc:mga0rr50_31091_c1 | 3300050513 | Bacteria | 3787 |
| 873 | nmdc:mga0rr50_356082_c1 | 3300050513 | Bacteria | 1231 |
| 874 | nmdc:mga08x19_15179_c1 | 3300050514 | Bacteria | 4683 |
| 875 | nmdc:mga08x19_180_c1 | 3300050514 | Bacteria | 50906 |
| 876 | nmdc:mga08x19_61528_c1 | 3300050514 | Bacteria | 2433 |
| 877 | nmdc:mga0a205_143611_c1 | 3300050515 | Bacteria | 2287 |
| 878 | nmdc:mga0a205_256208_c1 | 3300050515 | Bacteria | 1628 |
| 879 | nmdc:mga0a205_28347_c1 | 3300050515 | Bacteria | 5354 |
| 880 | nmdc:mga0a205_35122_c1 | 3300050515 | Bacteria | 4814 |
| 881 | nmdc:mga0a205_49879_c1 | 3300050515 | Bacteria | 4041 |
| 882 | nmdc:mga0a205_5672_c1 | 3300050515 | Bacteria | 11247 |
| 883 | Ga0495601_0022318 | 3300053077 | Bacteria | 3884 |
| 884 | Ga0495612_0037252 | 3300053078 | Bacteria | 1975 |
| 885 | Ga0495595_0068907 | 3300053084 | Bacteria | 1669 |
| 886 | Ga0495619_0010995 | 3300053085 | Bacteria | 5697 |
| 887 | Ga0495619_0205609 | 3300053085 | Bacteria | 1363 |
| 888 | Ga0500577_0000159 | 3300053142 | Bacteria | 16803 |
| 889 | Ga0501084_0538089 | 3300054114 | Bacteria | 987 |
| 890 | Ga0501082_0047339 | 3300060353 | Bacteria | 3706 |
| 891 | Ga0501082_0057617 | 3300060353 | Bacteria | 3347 |
| 892 | 2817480593 | 2816332295 | Bacteria | 4352468 |
| 893 | 2897112090 | 2897109615 | Bacteria | 4009619 |
| 894 | 2915358291 | 2915358134 | Bacteria | 6050864 |
| 895 | 2969143447 | 2969141011 | Bacteria | 4118468 |
| 896 | 3006826840 | 3006826541 | Bacteria | 4678913 |
| 897 | 3006860944 | 3006858327 | Bacteria | 4317835 |
| 898 | 637878024 | 637000116 | Bacteria | 5433628 |
| 899 | 8051955413 | 8051952484 | Bacteria | 3926774 |
| 900 | Ga0099794_10000350 | |||
| 901 | JGI24752J21851_1000611 | |||
| 902 | JGI24748J21848_1000012 | |||
| 903 | JGI24748J21848_1006785 | |||
| 904 | JGI24034J26672_10000003 | |||
| 905 | JGI24034J26672_10001087 | |||
| 906 | JGI24751J29686_10005274 | |||
| 907 | rootH1_10220322 | |||
| 908 | JGI25404J52841_10000478 | |||
| 909 | Ga0065715_10003200 | |||
| 910 | Ga0065707_10248901 | |||
| 911 | Ga0070658_10001997 | |||
| 912 | Ga0070658_10005297 | |||
| 913 | Ga0070658_10163174 | |||
| 914 | Ga0070676_10000224 | |||
| 915 | Ga0070683_100000920 | |||
| 916 | Ga0070683_100092166 | |||
| 917 | Ga0070683_100319079 | |||
| 918 | Ga0070690_100000380 | |||
| 919 | Ga0070690_100044069 | |||
| 920 | Ga0070670_100002424 | |||
| 921 | Ga0070670_100016690 | |||
| 922 | Ga0070670_100061693 | |||
| 923 | Ga0070677_10000186 | |||
| 924 | Ga0068869_100000053 | |||
| 925 | Ga0068869_100060300 | |||
| 926 | Ga0068869_100089012 | |||
| 927 | Ga0068869_100112757 | |||
| 928 | Ga0070666_10000581 | |||
| 929 | Ga0070680_100012313 | |||
| 930 | Ga0070680_100044990 | |||
| 931 | Ga0070682_100134107 | |||
| 932 | Ga0068868_100000719 | |||
| 933 | Ga0070660_100000781 | |||
| 934 | Ga0070660_100015979 | |||
| 935 | Ga0070689_100000484 | |||
| 936 | Ga0070689_100024014 | |||
| 937 | Ga0070691_10032412 | |||
| 938 | Ga0070687_100000039 | |||
| 939 | Ga0070661_100000406 | |||
| 940 | Ga0070661_100008506 | |||
| 941 | Ga0070661_100069941 | |||
| 942 | Ga0070661_100083412 | |||
| 943 | Ga0070692_10000941 | |||
| 944 | Ga0070692_10065156 | |||
| 945 | Ga0070668_100002507 | |||
| 946 | Ga0070668_100003133 | |||
| 947 | Ga0070668_100036420 | |||
| 948 | Ga0070668_100115343 | |||
| 949 | Ga0070669_100000929 | |||
| 950 | Ga0070675_100000924 | |||
| 951 | Ga0070675_100034549 | |||
| 952 | Ga0070671_100001501 | |||
| 953 | Ga0070671_100478394 | |||
| 954 | Ga0070674_100000553 | |||
| 955 | Ga0070673_100000505 | |||
| 956 | Ga0070673_100071917 | |||
| 957 | Ga0070688_100000318 | |||
| 958 | Ga0070688_100011825 | |||
| 959 | Ga0070659_100015815 | |||
| 960 | Ga0070667_100002135 | |||
| 961 | Ga0070703_10003662 | |||
| 962 | Ga0070709_10000305 | |||
| 963 | Ga0070709_10047409 | |||
| 964 | Ga0070709_10070129 | |||
| 965 | Ga0070709_10119118 | |||
| 966 | Ga0070714_100021657 | |||
| 967 | Ga0070714_100030948 | |||
| 968 | Ga0070714_100068096 | |||
| 969 | Ga0070714_100210352 | |||
| 970 | Ga0070714_100313087 | |||
| 971 | Ga0070714_100331424 | |||
| 972 | Ga0070713_100000922 | |||
| 973 | Ga0070713_100011768 | |||
| 974 | Ga0070713_100042431 | |||
| 975 | Ga0070713_100278306 | |||
| 976 | Ga0070713_100764505 | |||
| 977 | Ga0070710_10002298 | |||
| 978 | Ga0070710_10117852 | |||
| 979 | Ga0070711_100004605 | |||
| 980 | Ga0070711_100017023 | |||
| 981 | Ga0070711_100026898 | |||
| 982 | Ga0070711_100215896 | |||
| 983 | Ga0070711_100331001 | |||
| 984 | Ga0070711_100356128 | |||
| 985 | Ga0070705_100000433 | |||
| 986 | Ga0070705_100004291 | |||
| 987 | Ga0070705_100123148 | |||
| 988 | Ga0070700_100002056 | |||
| 989 | Ga0070694_100119322 | |||
| 990 | Ga0070694_100379145 | |||
| 991 | Ga0070708_100002234 | |||
| 992 | Ga0070708_100007645 | |||
| 993 | Ga0070708_100009440 | |||
| 994 | Ga0070708_100013006 | |||
| 995 | Ga0070708_100051348 | |||
| 996 | Ga0070708_100080220 | |||
| 997 | Ga0070708_100111653 | |||
| 998 | Ga0070708_100167418 | |||
| 999 | Ga0070708_100170109 | |||
| 1000 | Ga0070708_100550176 | |||
| 1001 | Ga0070663_100001100 | |||
| 1002 | Ga0070663_100055043 | |||
| 1003 | Ga0070663_100126382 | |||
| 1004 | Ga0070678_100000132 | |||
| 1005 | Ga0070678_100219391 | |||
| 1006 | Ga0070678_100233612 | |||
| 1007 | Ga0070678_100396342 | |||
| 1008 | Ga0070662_100002516 | |||
| 1009 | Ga0070681_10022842 | |||
| 1010 | Ga0070681_10131286 | |||
| 1011 | Ga0070681_10154076 | |||
| 1012 | Ga0068867_100002078 | |||
| 1013 | Ga0068867_100036546 | |||
| 1014 | Ga0070685_10000029 | |||
| 1015 | Ga0070706_100006640 | |||
| 1016 | Ga0070706_100018844 | |||
| 1017 | Ga0070706_100022657 | |||
| 1018 | Ga0070706_100043222 | |||
| 1019 | Ga0070706_100048444 | |||
| 1020 | Ga0070706_100355551 | |||
| 1021 | Ga0070707_100001060 | |||
| 1022 | Ga0070707_100007098 | |||
| 1023 | Ga0070707_100083298 | |||
| 1024 | Ga0070707_100088495 | |||
| 1025 | Ga0070707_100460481 | |||
| 1026 | Ga0070707_100578537 | |||
| 1027 | Ga0070698_100000116 | |||
| 1028 | Ga0070698_100002762 | |||
| 1029 | Ga0070698_100005605 | |||
| 1030 | Ga0070698_100026380 | |||
| 1031 | Ga0070698_100054364 | |||
| 1032 | Ga0070698_100065765 | |||
| 1033 | Ga0070698_100483878 | |||
| 1034 | Ga0070699_100020819 | |||
| 1035 | Ga0070699_100031406 | |||
| 1036 | Ga0070699_100128976 | |||
| 1037 | Ga0070699_100239927 | |||
| 1038 | Ga0070699_100278759 | |||
| 1039 | Ga0070699_100282284 | |||
| 1040 | Ga0070699_100715962 | |||
| 1041 | Ga0070679_100007536 | |||
| 1042 | Ga0070679_100020487 | |||
| 1043 | Ga0070679_100029487 | |||
| 1044 | Ga0070679_100044745 | |||
| 1045 | Ga0070679_100248293 | |||
| 1046 | Ga0070679_100396512 | |||
| 1047 | Ga0070684_100021199 | |||
| 1048 | Ga0070684_100023361 | |||
| 1049 | Ga0070697_100000015 | |||
| 1050 | Ga0070697_100001417 | |||
| 1051 | Ga0070697_100011368 | |||
| 1052 | Ga0070697_100018316 | |||
| 1053 | Ga0070697_100020654 | |||
| 1054 | Ga0070697_100144922 | |||
| 1055 | Ga0070697_100203748 | |||
| 1056 | Ga0070697_100208043 | |||
| 1057 | Ga0070697_100243479 | |||
| 1058 | Ga0068853_100000650 | |||
| 1059 | Ga0068853_100001250 | |||
| 1060 | Ga0068853_100026872 | |||
| 1061 | Ga0070672_100066887 | |||
| 1062 | Ga0070686_100000095 | |||
| 1063 | Ga0070686_100009761 | |||
| 1064 | Ga0070695_100003672 | |||
| 1065 | Ga0070695_100010890 | |||
| 1066 | Ga0070696_100005712 | |||
| 1067 | Ga0070696_100113766 | |||
| 1068 | Ga0070693_100000899 | |||
| 1069 | Ga0070693_100001944 | |||
| 1070 | Ga0070693_100020623 | |||
| 1071 | Ga0070693_100028332 | |||
| 1072 | Ga0070665_100002353 | |||
| 1073 | Ga0070704_100004916 | |||
| 1074 | Ga0070704_100017886 | |||
| 1075 | Ga0070704_100154503 | |||
| 1076 | Ga0068855_100002236 | |||
| 1077 | Ga0070664_100001138 | |||
| 1078 | Ga0070664_100003918 | |||
| 1079 | Ga0070664_100153985 | |||
| 1080 | Ga0070664_100204896 | |||
| 1081 | Ga0070664_100499049 | |||
| 1082 | Ga0068857_100000229 | |||
| 1083 | Ga0068857_100004575 | |||
| 1084 | Ga0068857_100219934 | |||
| 1085 | Ga0068854_100000510 | |||
| 1086 | Ga0068854_100046221 | |||
| 1087 | Ga0068854_100290086 | |||
| 1088 | Ga0068856_100001505 | |||
| 1089 | Ga0068856_100006218 | |||
| 1090 | Ga0068856_100036574 | |||
| 1091 | Ga0068856_100094376 | |||
| 1092 | Ga0068856_100303978 | |||
| 1093 | Ga0068856_100418836 | |||
| 1094 | Ga0070702_100059445 | |||
| 1095 | Ga0068852_100000737 | |||
| 1096 | Ga0068852_100021336 | |||
| 1097 | Ga0068852_100120552 | |||
| 1098 | Ga0068859_100001887 | |||
| 1099 | Ga0068859_100030266 | |||
| 1100 | Ga0068859_100139723 | |||
| 1101 | Ga0068864_100000515 | |||
| 1102 | Ga0068864_100064009 | |||
| 1103 | Ga0068866_10000163 | |||
| 1104 | Ga0068866_10045896 | |||
| 1105 | Ga0068861_100000627 | |||
| 1106 | Ga0068851_10000655 | |||
| 1107 | Ga0068851_10005056 | |||
| 1108 | Ga0068870_10000020 | |||
| 1109 | Ga0068870_10211187 | |||
| 1110 | Ga0068863_100002050 | |||
| 1111 | Ga0068863_100006327 | |||
| 1112 | Ga0068863_100011083 | |||
| 1113 | Ga0068863_100036143 | |||
| 1114 | Ga0068863_100055906 | |||
| 1115 | Ga0068863_100265908 | |||
| 1116 | Ga0068858_100000052 | |||
| 1117 | Ga0068858_100001984 | |||
| 1118 | Ga0068858_100019166 | |||
| 1119 | Ga0068858_100090583 | |||
| 1120 | Ga0068858_100317856 | |||
| 1121 | Ga0068858_100365590 | |||
| 1122 | Ga0068860_100000901 | |||
| 1123 | Ga0068860_100003570 | |||
| 1124 | Ga0068860_100013865 | |||
| 1125 | Ga0068860_100196583 | |||
| 1126 | Ga0068860_100539167 | |||
| 1127 | Ga0068862_100000692 | |||
| 1128 | Ga0068862_100004205 | |||
| 1129 | Ga0081455_10075554 | |||
| 1130 | Ga0081540_1000073 | |||
| 1131 | Ga0081540_1000209 | |||
| 1132 | Ga0081540_1003942 | |||
| 1133 | Ga0081540_1044270 | |||
| 1134 | Ga0081539_10000156 | |||
| 1135 | Ga0081539_10000915 | |||
| 1136 | Ga0070717_10001271 | |||
| 1137 | Ga0070717_10004006 | |||
| 1138 | Ga0070717_10005880 | |||
| 1139 | Ga0070717_10006876 | |||
| 1140 | Ga0070717_10015963 | |||
| 1141 | Ga0070717_10018743 | |||
| 1142 | Ga0070717_10032056 | |||
| 1143 | Ga0070717_10043134 | |||
| 1144 | Ga0070717_10061399 | |||
| 1145 | Ga0070717_10091930 | |||
| 1146 | Ga0070717_10114509 | |||
| 1147 | Ga0070717_10220737 | |||
| 1148 | Ga0070717_10312201 | |||
| 1149 | Ga0070716_100000077 | |||
| 1150 | Ga0070716_100003912 | |||
| 1151 | Ga0070716_100010734 | |||
| 1152 | Ga0070716_100120766 | |||
| 1153 | Ga0070712_100002274 | |||
| 1154 | Ga0070712_100066055 | |||
| 1155 | Ga0070712_100317440 | |||
| 1156 | Ga0070712_100323571 | |||
| 1157 | Ga0097621_100000516 | |||
| 1158 | Ga0068871_100002377 | |||
| 1159 | Ga0068871_100004618 | |||
| 1160 | Ga0068871_100110200 | |||
| 1161 | Ga0075428_100001171 | |||
| 1162 | Ga0075428_100088747 | |||
| 1163 | Ga0075428_100606358 | |||
| 1164 | Ga0075431_100006607 | |||
| 1165 | Ga0075433_10004048 | |||
| 1166 | Ga0075433_10021471 | |||
| 1167 | Ga0075433_10040628 | |||
| 1168 | Ga0075433_10129670 | |||
| 1169 | Ga0075434_100000857 | |||
| 1170 | Ga0075434_100000998 | |||
| 1171 | Ga0075434_100024391 | |||
| 1172 | Ga0075434_100036771 | |||
| 1173 | Ga0075434_100164494 | |||
| 1174 | Ga0075434_100167424 | |||
| 1175 | Ga0075434_100241405 | |||
| 1176 | Ga0075434_100731001 | |||
| 1177 | Ga0068865_100000545 | |||
| 1178 | Ga0075436_100008041 | |||
| 1179 | Ga0075436_100038031 | |||
| 1180 | Ga0075436_100111704 | |||
| 1181 | Ga0075436_100199547 | |||
| 1182 | Ga0097620_100001887 | |||
| 1183 | Ga0097620_100030267 | |||
| 1184 | Ga0097620_100139732 | |||
| 1185 | Ga0075435_100000556 | |||
| 1186 | Ga0075435_100013847 | |||
| 1187 | Ga0075435_100017964 | |||
| 1188 | Ga0075435_100065237 | |||
| 1189 | Ga0075435_100101680 | |||
| 1190 | Ga0075435_100134133 | |||
| 1191 | Ga0075435_100210029 | |||
| 1192 | Ga0075435_100285546 | |||
| 1193 | Ga0099794_10008967 | |||
| 1194 | Ga0099794_10020363 | |||
| 1195 | Ga0099794_10031940 | |||
| 1196 | Ga0099794_10066220 | |||
| 1197 | Ga0099794_10102664 | |||
| 1198 | Ga0099794_10146586 | |||
| 1199 | Ga0099794_10166100 | |||
| 1200 | Ga0105250_10069540 | |||
| 1201 | Ga0105240_10004283 | |||
| 1202 | Ga0105240_10420990 | |||
| 1203 | Ga0111539_10177758 | |||
| 1204 | Ga0111539_10281818 | |||
| 1205 | Ga0105245_10013162 | |||
| 1206 | Ga0105245_10040190 | |||
| 1207 | Ga0105245_10106560 | |||
| 1208 | Ga0105245_10308489 | |||
| 1209 | Ga0105247_10000003 | |||
| 1210 | Ga0105247_10000214 | |||
| 1211 | Ga0105247_10088721 | |||
| 1212 | Ga0105247_10116497 | |||
| 1213 | Ga0105247_10121114 | |||
| 1214 | Ga0105247_10241556 | |||
| 1215 | Ga0114129_10000201 | |||
| 1216 | Ga0114129_10007058 | |||
| 1217 | Ga0114129_10008742 | |||
| 1218 | Ga0114129_10052936 | |||
| 1219 | Ga0114129_10126174 | |||
| 1220 | Ga0105243_10001203 | |||
| 1221 | Ga0105243_10176501 | |||
| 1222 | Ga0105241_10001583 | |||
| 1223 | Ga0105241_10042177 | |||
| 1224 | Ga0105241_10066264 | |||
| 1225 | Ga0105241_10397922 | |||
| 1226 | Ga0105242_10003402 | |||
| 1227 | Ga0105242_10027989 | |||
| 1228 | Ga0105242_10103390 | |||
| 1229 | Ga0105242_10274504 | |||
| 1230 | Ga0105248_10002038 | |||
| 1231 | Ga0105248_10194132 | |||
| 1232 | Ga0105237_10000421 | |||
| 1233 | Ga0105238_10000359 | |||
| 1234 | Ga0105238_10003254 | |||
| 1235 | Ga0105238_10018855 | |||
| 1236 | Ga0105249_10000494 | |||
| 1237 | Ga0105249_10002142 | |||
| 1238 | Ga0105249_10006198 | |||
| 1239 | Ga0105249_10027248 | |||
| 1240 | Ga0105249_10083789 | |||
| 1241 | Ga0105239_10001190 | |||
| 1242 | Ga0105239_10054754 | |||
| 1243 | Ga0105246_10004738 | |||
| 1244 | Ga0105246_10055158 | |||
| 1245 | Ga0157373_10001697 | |||
| 1246 | Ga0157371_10000366 | |||
| 1247 | Ga0157371_10160541 | |||
| 1248 | Ga0157369_10003549 | |||
| 1249 | Ga0157369_10039939 | |||
| 1250 | Ga0157369_10060727 | |||
| 1251 | Ga0157369_10158543 | |||
| 1252 | Ga0157374_10000753 | |||
| 1253 | Ga0157374_10049507 | |||
| 1254 | Ga0157378_10000538 | |||
| 1255 | Ga0157378_10000791 | |||
| 1256 | Ga0157378_10021440 | |||
| 1257 | Ga0157378_10023477 | |||
| 1258 | Ga0157378_10074664 | |||
| 1259 | Ga0163162_10000023 | |||
| 1260 | Ga0163162_10001463 | |||
| 1261 | Ga0163162_10005173 | |||
| 1262 | Ga0163162_10058772 | |||
| 1263 | Ga0163162_10413574 | |||
| 1264 | Ga0163162_10464291 | |||
| 1265 | Ga0157372_10006351 | |||
| 1266 | Ga0157372_10028369 | |||
| 1267 | Ga0157372_10082436 | |||
| 1268 | Ga0157375_10001223 | |||
| 1269 | Ga0157375_10233394 | |||
| 1270 | Ga0163163_10000844 | |||
| 1271 | Ga0163163_10044651 | |||
| 1272 | Ga0163163_10137725 | |||
| 1273 | Ga0157380_10069116 | |||
| 1274 | Ga0157380_10406002 | |||
| 1275 | Ga0157380_10729320 | |||
| 1276 | Ga0157377_10005614 | |||
| 1277 | Ga0157377_10095983 | |||
| 1278 | Ga0157379_10000868 | |||
| 1279 | Ga0157379_10000892 | |||
| 1280 | Ga0157379_10001230 | |||
| 1281 | Ga0157379_10055638 | |||
| 1282 | Ga0157379_10283883 | |||
| 1283 | Ga0157376_10000032 | |||
| 1284 | Ga0157376_10000590 | |||
| 1285 | Ga0157376_10000629 | |||
| 1286 | Ga0182007_10008481 | |||
| 1287 | Ga0163161_10016205 | |||
| 1288 | Ga0163161_10402941 | |||
| 1289 | Ga0206353_11777813 | |||
| 1290 | Ga0213872_10005062 | |||
| 1291 | Ga0213872_10123175 | |||
| 1292 | Ga0213874_10057603 | |||
| 1293 | Ga0213876_10000282 | |||
| 1294 | Ga0213871_10004327 | |||
| 1295 | Ga0228598_1026488 | |||
| 1296 | Ga0207672_1000061 | |||
| 1297 | Ga0207697_10002581 | |||
| 1298 | Ga0207697_10007233 | |||
| 1299 | Ga0207656_10000118 | |||
| 1300 | Ga0207656_10009662 | |||
| 1301 | Ga0207653_10003573 | |||
| 1302 | Ga0207682_10000028 | |||
| 1303 | Ga0207692_10006538 | |||
| 1304 | Ga0207692_10033574 | |||
| 1305 | Ga0207642_10017845 | |||
| 1306 | Ga0207642_10184173 | |||
| 1307 | Ga0207710_10000001 | |||
| 1308 | Ga0207710_10000971 | |||
| 1309 | Ga0207710_10083469 | |||
| 1310 | Ga0207688_10007178 | |||
| 1311 | Ga0207688_10074374 | |||
| 1312 | Ga0207680_10001631 | |||
| 1313 | Ga0207680_10012422 | |||
| 1314 | Ga0207647_10015608 | |||
| 1315 | Ga0207647_10051399 | |||
| 1316 | Ga0207685_10114747 | |||
| 1317 | Ga0207699_10002217 | |||
| 1318 | Ga0207699_10031494 | |||
| 1319 | Ga0207699_10157678 | |||
| 1320 | Ga0207699_10173534 | |||
| 1321 | Ga0207645_10000053 | |||
| 1322 | Ga0207645_10001227 | |||
| 1323 | Ga0207645_10051817 | |||
| 1324 | Ga0207643_10000013 | |||
| 1325 | Ga0207643_10006285 | |||
| 1326 | Ga0207705_10015725 | |||
| 1327 | Ga0207705_10077480 | |||
| 1328 | Ga0207684_10002255 | |||
| 1329 | Ga0207684_10020820 | |||
| 1330 | Ga0207684_10033176 | |||
| 1331 | Ga0207684_10039566 | |||
| 1332 | Ga0207684_10040272 | |||
| 1333 | Ga0207684_10094636 | |||
| 1334 | Ga0207684_10300122 | |||
| 1335 | Ga0207684_10366231 | |||
| 1336 | Ga0207654_10020659 | |||
| 1337 | Ga0207654_10056836 | |||
| 1338 | Ga0207707_10068805 | |||
| 1339 | Ga0207707_10131778 | |||
| 1340 | Ga0207707_10133199 | |||
| 1341 | Ga0207707_10182918 | |||
| 1342 | Ga0207695_10004014 | |||
| 1343 | Ga0207671_10000884 | |||
| 1344 | Ga0207693_10000067 | |||
| 1345 | Ga0207693_10018302 | |||
| 1346 | Ga0207693_10023756 | |||
| 1347 | Ga0207693_10024033 | |||
| 1348 | Ga0207693_10053314 | |||
| 1349 | Ga0207693_10097723 | |||
| 1350 | Ga0207693_10108854 | |||
| 1351 | Ga0207693_10209858 | |||
| 1352 | Ga0207693_10358296 | |||
| 1353 | Ga0207663_10013386 | |||
| 1354 | Ga0207663_10019141 | |||
| 1355 | Ga0207663_10063469 | |||
| 1356 | Ga0207663_10164419 | |||
| 1357 | Ga0207663_10176077 | |||
| 1358 | Ga0207663_10258286 | |||
| 1359 | Ga0207660_10008522 | |||
| 1360 | Ga0207660_10021173 | |||
| 1361 | Ga0207660_10219348 | |||
| 1362 | Ga0207662_10000009 | |||
| 1363 | Ga0207662_10002842 | |||
| 1364 | Ga0207662_10044078 | |||
| 1365 | Ga0207657_10000042 | |||
| 1366 | Ga0207657_10023284 | |||
| 1367 | Ga0207657_10047938 | |||
| 1368 | Ga0207649_10001939 | |||
| 1369 | Ga0207649_10002049 | |||
| 1370 | Ga0207652_10013588 | |||
| 1371 | Ga0207652_10053635 | |||
| 1372 | Ga0207646_10000054 | |||
| 1373 | Ga0207646_10000305 | |||
| 1374 | Ga0207646_10036483 | |||
| 1375 | Ga0207646_10040993 | |||
| 1376 | Ga0207646_10077168 | |||
| 1377 | Ga0207646_10170809 | |||
| 1378 | Ga0207646_10231453 | |||
| 1379 | Ga0207646_10283657 | |||
| 1380 | Ga0207681_10000159 | |||
| 1381 | Ga0207681_10259586 | |||
| 1382 | Ga0207694_10000788 | |||
| 1383 | Ga0207694_10113578 | |||
| 1384 | Ga0207694_10620914 | |||
| 1385 | Ga0207650_10000152 | |||
| 1386 | Ga0207650_10000445 | |||
| 1387 | Ga0207650_10339148 | |||
| 1388 | Ga0207659_10000098 | |||
| 1389 | Ga0207659_10028596 | |||
| 1390 | Ga0207687_10035721 | |||
| 1391 | Ga0207687_10099369 | |||
| 1392 | Ga0207687_10302840 | |||
| 1393 | Ga0207700_10006884 | |||
| 1394 | Ga0207700_10082658 | |||
| 1395 | Ga0207700_10121754 | |||
| 1396 | Ga0207664_10095040 | |||
| 1397 | Ga0207664_10208372 | |||
| 1398 | Ga0207664_10250789 | |||
| 1399 | Ga0207644_10000603 | |||
| 1400 | Ga0207644_10001827 | |||
| 1401 | Ga0207644_10015007 | |||
| 1402 | Ga0207690_10002207 | |||
| 1403 | Ga0207690_10024946 | |||
| 1404 | Ga0207690_10034129 | |||
| 1405 | Ga0207706_10000046 | |||
| 1406 | Ga0207706_10000997 | |||
| 1407 | Ga0207706_10024630 | |||
| 1408 | Ga0207686_10026156 | |||
| 1409 | Ga0207686_10027990 | |||
| 1410 | Ga0207686_10206422 | |||
| 1411 | Ga0207709_10002043 | |||
| 1412 | Ga0207670_10000494 | |||
| 1413 | Ga0207670_10028206 | |||
| 1414 | Ga0207669_10000156 | |||
| 1415 | Ga0207704_10000142 | |||
| 1416 | Ga0207665_10000028 | |||
| 1417 | Ga0207665_10002791 | |||
| 1418 | Ga0207665_10010969 | |||
| 1419 | Ga0207665_10014872 | |||
| 1420 | Ga0207665_10024988 | |||
| 1421 | Ga0207665_10108834 | |||
| 1422 | Ga0207665_10155741 | |||
| 1423 | Ga0207665_10193566 | |||
| 1424 | Ga0207665_10196113 | |||
| 1425 | Ga0207691_10000424 | |||
| 1426 | Ga0207691_10080693 | |||
| 1427 | Ga0207711_10000582 | |||
| 1428 | Ga0207711_10005299 | |||
| 1429 | Ga0207689_10000071 | |||
| 1430 | Ga0207689_10010738 | |||
| 1431 | Ga0207689_10019760 | |||
| 1432 | Ga0207689_10099776 | |||
| 1433 | Ga0207661_10001036 | |||
| 1434 | Ga0207661_10003627 | |||
| 1435 | Ga0207661_10275636 | |||
| 1436 | Ga0207661_10443578 | |||
| 1437 | Ga0207679_10000111 | |||
| 1438 | Ga0207679_10000469 | |||
| 1439 | Ga0207679_10141945 | |||
| 1440 | Ga0207667_10001419 | |||
| 1441 | Ga0207651_10000110 | |||
| 1442 | Ga0207712_10000785 | |||
| 1443 | Ga0207712_10000854 | |||
| 1444 | Ga0207712_10519749 | |||
| 1445 | Ga0207668_10000657 | |||
| 1446 | Ga0207668_10001179 | |||
| 1447 | Ga0207668_10009454 | |||
| 1448 | Ga0207640_10000497 | |||
| 1449 | Ga0207640_10298071 | |||
| 1450 | Ga0207640_10318377 | |||
| 1451 | Ga0207658_10000736 | |||
| 1452 | Ga0207658_10041767 | |||
| 1453 | Ga0207658_10251937 | |||
| 1454 | Ga0207677_10000492 | |||
| 1455 | Ga0207677_10078951 | |||
| 1456 | Ga0207677_10449336 | |||
| 1457 | Ga0207703_10000303 | |||
| 1458 | Ga0207703_10000406 | |||
| 1459 | Ga0207703_10014323 | |||
| 1460 | Ga0207703_10019932 | |||
| 1461 | Ga0207639_10000612 | |||
| 1462 | Ga0207639_10005469 | |||
| 1463 | Ga0207639_10012900 | |||
| 1464 | Ga0207678_10001602 | |||
| 1465 | Ga0207678_10010230 | |||
| 1466 | Ga0207678_10089793 | |||
| 1467 | Ga0207708_10025320 | |||
| 1468 | Ga0207708_10252658 | |||
| 1469 | Ga0207702_10006363 | |||
| 1470 | Ga0207702_10012630 | |||
| 1471 | Ga0207702_10024347 | |||
| 1472 | Ga0207702_10038618 | |||
| 1473 | Ga0207702_10040486 | |||
| 1474 | Ga0207702_10299956 | |||
| 1475 | Ga0207641_10000052 | |||
| 1476 | Ga0207641_10000918 | |||
| 1477 | Ga0207641_10001136 | |||
| 1478 | Ga0207641_10008550 | |||
| 1479 | Ga0207641_10054301 | |||
| 1480 | Ga0207641_10079691 | |||
| 1481 | Ga0207648_10000852 | |||
| 1482 | Ga0207648_10001157 | |||
| 1483 | Ga0207676_10000398 | |||
| 1484 | Ga0207676_10001279 | |||
| 1485 | Ga0207674_10000038 | |||
| 1486 | Ga0207674_10033229 | |||
| 1487 | Ga0207674_10098172 | |||
| 1488 | Ga0207675_100000565 | |||
| 1489 | Ga0207675_100017316 | |||
| 1490 | Ga0207675_100118502 | |||
| 1491 | Ga0207683_10000837 | |||
| 1492 | Ga0207683_10000885 | |||
| 1493 | Ga0207683_10078072 | |||
| 1494 | Ga0207698_10000519 | |||
| 1495 | Ga0207698_10044616 | |||
| 1496 | Ga0209995_1018260 | |||
| 1497 | Ga0209983_1003242 | |||
| 1498 | Ga0209588_1001160 | |||
| 1499 | Ga0209588_1003408 | |||
| 1500 | Ga0209588_1007189 | |||
| 1501 | Ga0209588_1019289 | |||
| 1502 | Ga0209971_1000218 | |||
| 1503 | Ga0209998_10004009 | |||
| 1504 | Ga0209974_10000140 | |||
| 1505 | Ga0265354_1003961 | |||
| 1506 | Ga0268266_10000072 | |||
| 1507 | Ga0268266_10000389 | |||
| 1508 | Ga0268265_10000592 | |||
| 1509 | Ga0268265_10018692 | |||
| 1510 | Ga0268265_10042990 | |||
| 1511 | Ga0268264_10000191 | |||
| 1512 | Ga0268264_10002754 | |||
| 1513 | Ga0268264_10028224 | |||
| 1514 | Ga0268264_10047540 | |||
| 1515 | Ga0268264_10158185 | |||
| 1516 | Ga0268264_10262853 | |||
| 1517 | Ga0268264_10586501 | |||
| 1518 | Ga0265334_10040666 | |||
| 1519 | Ga0265338_10002968 | |||
| 1520 | Ga0265338_10057562 | |||
| 1521 | Ga0265338_10063139 | |||
| 1522 | Ga0265338_10430266 | |||
| 1523 | Ga0265770_1001131 | |||
| 1524 | Ga0265760_10001557 | |||
| 1525 | Ga0265760_10002657 | |||
| 1526 | Ga0265760_10020155 | |||
| 1527 | Ga0265325_10081168 | |||
| 1528 | Ga0265329_10015457 | |||
| 1529 | Ga0265339_10000995 | |||
| 1530 | Ga0265339_10007220 | |||
| 1531 | Ga0265339_10078526 | |||
| 1532 | Ga0265316_10001965 | |||
| 1533 | Ga0265316_10004297 | |||
| 1534 | Ga0265316_10030725 | |||
| 1535 | Ga0265316_10173604 | |||
| 1536 | Ga0307513_10015270 | |||
| 1537 | Ga0265314_10000011 | |||
| 1538 | Ga0265314_10008888 | |||
| 1539 | Ga0265314_10043416 | |||
| 1540 | Ga0316576_10000948 | |||
| 1541 | Ga0316576_10107849 | |||
| 1542 | Ga0316578_10198760 | |||
| 1543 | Ga0316214_1003527 | |||
| 1544 | Ga0316212_1001460 | |||
| 1545 | Ga0373926_0074133 | |||
| 1546 | Ga0373934_0043047 | |||
| 1547 | Ga0373934_0105464 | |||
| 1548 | Ga0373954_0000232 | |||
| 1549 | Ga0373956_0006050 | |||
| 1550 | Ga0373943_0037050 | |||
| 1551 | Ga0373955_0004388 | |||
| 1552 | Ga0373955_0215764 | |||
| 1553 | Ga0373924_0063399 | |||
| 1554 | Ga0373931_0059161 | |||
| 1555 | Ga0373931_0154992 | |||
| 1556 | Ga0373931_0482736 | |||
| 1557 | Ga0373927_0000181 | |||
| 1558 | Ga0373933_0001080 | |||
| 1559 | Ga0373947_0006847 | |||
| 1560 | Ga0373947_0019837 | |||
| 1561 | Ga0373947_0121016 | |||
| 1562 | Ga0373937_0295577 | |||
| 1563 | Ga0316584_0000032 | |||
| 1564 | Ga0373925_0016750 | |||
| 1565 | Ga0373925_0350525 | |||
| 1566 | Ga0395900_0047532 | |||
| 1567 | Ga0436364_1345024 | |||
| 1568 | Ga0400489_81848 | |||
| 1569 | Ga0436365_0740107 | |||
| 1570 | Ga0436365_1419515 | |||
| 1571 | Ga0436360_1132016 | |||
| 1572 | Ga0436361_0004293 | |||
| 1573 | Ga0436361_0365763 | |||
| 1574 | Ga0436361_0706744 | |||
| 1575 | Ga0436363_0846422 | |||
| 1576 | Ga0436363_1072660 | |||
| 1577 | Ga0436362_0975535 | |||
| 1578 | Ga0439455_0005219 | |||
| 1579 | Ga0451577_0015389 | |||
| 1580 | Ga0451577_0080954 | |||
| 1581 | Ga0451577_0096172 | |||
| 1582 | Ga0451577_0191960 | |||
| 1583 | Ga0451577_0580203 | |||
| 1584 | Ga0466972_0136076 | |||
| 1585 | Ga0453683_0011172 | |||
| 1586 | Ga0453683_0023057 | |||
| 1587 | Ga0453683_0038859 | |||
| 1588 | Ga0453683_0090385 | |||
| 1589 | Ga0453683_0130322 | |||
| 1590 | Ga0466966_0156264 | |||
| 1591 | Ga0466964_0076480 | |||
| 1592 | Ga0453684_0010033 | |||
| 1593 | Ga0453684_0147176 | |||
| 1594 | Ga0453684_0239686 | |||
| 1595 | Ga0466968_0053592 | |||
| 1596 | Ga0466957_0092784 | |||
| 1597 | Ga0466960_0051866 | |||
| 1598 | Ga0466959_0009944 | |||
| 1599 | Ga0466959_0269387 | |||
| 1600 | Ga0451576_0020333 | |||
| 1601 | Ga0451576_0184358 | |||
| 1602 | Ga0451576_0237779 | |||
| 1603 | Ga0451576_0561274 | |||
| 1604 | Ga0451576_0905594 | |||
| 1605 | Ga0466967_0019685 | |||
| 1606 | Ga0466967_0132192 | |||
| 1607 | Ga0466967_0339289 | |||
| 1608 | Ga0466967_0864593 | |||
| 1609 | Ga0495603_0048438 | |||
| 1610 | Ga0495629_0060478 | |||
| 1611 | Ga0495629_0070849 | |||
| 1612 | Ga0495629_0126671 | |||
| 1613 | Ga0495641_0023994 | |||
| 1614 | Ga0495651_0052148 | |||
| 1615 | Ga0495651_0080986 | |||
| 1616 | Ga0495653_0009074 | |||
| 1617 | Ga0495653_0150702 | |||
| 1618 | Ga0495580_0011933 | |||
| 1619 | Ga0495580_0015648 | |||
| 1620 | Ga0495580_0018168 | |||
| 1621 | Ga0495580_0022593 | |||
| 1622 | Ga0495580_0031805 | |||
| 1623 | Ga0495580_0051450 | |||
| 1624 | Ga0495580_0301758 | |||
| 1625 | Ga0495580_0330215 | |||
| 1626 | Ga0495582_0000718 | |||
| 1627 | Ga0495582_0009025 | |||
| 1628 | Ga0495582_0032511 | |||
| 1629 | Ga0495582_0126326 | |||
| 1630 | Ga0495639_0005520 | |||
| 1631 | Ga0495594_0067896 | |||
| 1632 | Ga0495606_0201206 | |||
| 1633 | Ga0495608_0022524 | |||
| 1634 | Ga0495608_0082787 | |||
| 1635 | Ga0495618_0121135 | |||
| 1636 | Ga0495628_0136848 | |||
| 1637 | Ga0495628_0251257 | |||
| 1638 | Ga0495630_0022984 | |||
| 1639 | Ga0495630_0033365 | |||
| 1640 | Ga0495632_0087326 | |||
| 1641 | Ga0495666_0060133 | |||
| 1642 | Ga0495652_0186105 | |||
| 1643 | Ga0495652_0210082 | |||
| 1644 | Ga0495640_0110642 | |||
| 1645 | Ga0495640_0131888 | |||
| 1646 | Ga0495587_0009545 | |||
| 1647 | Ga0495587_0010261 | |||
| 1648 | Ga0495645_0160494 | |||
| 1649 | Ga0495667_0062472 | |||
| 1650 | Ga0495634_0022616 | |||
| 1651 | Ga0495623_0010766 | |||
| 1652 | Ga0495646_0019063 | |||
| 1653 | Ga0495647_0011255 | |||
| 1654 | Ga0495658_0009614 | |||
| 1655 | Ga0495658_0013750 | |||
| 1656 | Ga0495658_0066613 | |||
| 1657 | Ga0495658_0241899 | |||
| 1658 | Ga0495669_0001200 | |||
| 1659 | Ga0495613_0191987 | |||
| 1660 | Ga0495624_0109580 | |||
| 1661 | Ga0495581_0150638 | |||
| 1662 | Ga0495604_0001179 | |||
| 1663 | Ga0495604_0008173 | |||
| 1664 | Ga0495674_0039608 | |||
| 1665 | Ga0495676_0013478 | |||
| 1666 | Ga0495676_0184614 | |||
| 1667 | Ga0495680_0008472 | |||
| 1668 | Ga0495680_0008611 | |||
| 1669 | Ga0495675_0055208 | |||
| 1670 | Ga0495684_0037833 | |||
| 1671 | Ga0495684_0071472 | |||
| 1672 | Ga0495593_0124505 | |||
| 1673 | Ga0495602_0002035 | |||
| 1674 | Ga0495602_0020663 | |||
| 1675 | Ga0495614_0122466 | |||
| 1676 | Ga0496100_0050705 | |||
| 1677 | Ga0496100_0076158 | |||
| 1678 | Ga0496100_0271742 | |||
| 1679 | Ga0496101_0020948 | |||
| 1680 | Ga0496101_0021969 | |||
| 1681 | Ga0496101_0154953 | |||
| 1682 | Ga0496101_0174893 | |||
| 1683 | Ga0496102_0000127 | |||
| 1684 | Ga0496102_0002989 | |||
| 1685 | Ga0496102_0005081 | |||
| 1686 | Ga0496102_0050463 | |||
| 1687 | Ga0496102_0237037 | |||
| 1688 | Ga0496103_0000134 | |||
| 1689 | Ga0496103_0000805 | |||
| 1690 | Ga0496103_0191651 | |||
| 1691 | Ga0496104_0010488 | |||
| 1692 | Ga0496104_0013301 | |||
| 1693 | Ga0496104_0123334 | |||
| 1694 | Ga0496104_0162228 | |||
| 1695 | Ga0496104_0262685 | |||
| 1696 | Ga0496105_0012552 | |||
| 1697 | Ga0496105_0044209 | |||
| 1698 | Ga0496106_0021333 | |||
| 1699 | Ga0496106_0023563 | |||
| 1700 | Ga0496106_0462786 | |||
| 1701 | Ga0496107_0039438 | |||
| 1702 | Ga0496108_0002852 | |||
| 1703 | Ga0496108_0056460 | |||
| 1704 | Ga0496108_0232464 | |||
| 1705 | Ga0496108_0255117 | |||
| 1706 | Ga0496109_0000120 | |||
| 1707 | Ga0496109_0049323 | |||
| 1708 | Ga0496110_0001986 | |||
| 1709 | Ga0496110_0141371 | |||
| 1710 | Ga0496110_0295862 | |||
| 1711 | Ga0496110_0539910 | |||
| 1712 | Ga0496112_0000991 | |||
| 1713 | Ga0496112_0004229 | |||
| 1714 | Ga0496112_0008837 | |||
| 1715 | Ga0496112_0097396 | |||
| 1716 | Ga0496112_0199074 | |||
| 1717 | Ga0496112_0244353 | |||
| 1718 | Ga0496113_0002001 | |||
| 1719 | Ga0496114_0006103 | |||
| 1720 | Ga0496114_0055131 | |||
| 1721 | Ga0496115_0009627 | |||
| 1722 | Ga0496115_0032991 | |||
| 1723 | Ga0496115_0213432 | |||
| 1724 | Ga0496116_0000228 | |||
| 1725 | Ga0496117_0000204 | |||
| 1726 | Ga0496118_0000202 | |||
| 1727 | Ga0496119_0000700 | |||
| 1728 | Ga0496120_0016270 | |||
| 1729 | Ga0496122_0190396 | |||
| 1730 | Ga0496124_0036480 | |||
| 1731 | Ga0496125_0042719 | |||
| 1732 | Ga0496126_0000490 | |||
| 1733 | Ga0501040_0075284 | |||
| 1734 | Ga0501040_0173832 | |||
| 1735 | Ga0501067_0099641 | |||
| 1736 | Ga0501068_0086475 | |||
| 1737 | Ga0501068_0345793 | |||
| 1738 | Ga0501074_0156324 | |||
| 1739 | Ga0501075_0093436 | |||
| 1740 | Ga0501075_0278751 | |||
| 1741 | Ga0501076_0016323 | |||
| 1742 | Ga0501076_0097671 | |||
| 1743 | Ga0501079_0035098 | |||
| 1744 | Ga0501079_0191373 | |||
| 1745 | Ga0501079_0297143 | |||
| 1746 | Ga0501079_0297398 | |||
| 1747 | Ga0501080_0510757 | |||
| 1748 | Ga0501081_0031133 | |||
| 1749 | Ga0501081_0207782 | |||
| 1750 | Ga0501045_0048949 | |||
| 1751 | nmdc:mga05p37_10570_c1 | |||
| 1752 | nmdc:mga05p37_18012_c1 | |||
| 1753 | nmdc:mga05p37_189005_c1 | |||
| 1754 | nmdc:mga05p37_25589_c1 | |||
| 1755 | nmdc:mga05p37_28157_c1 | |||
| 1756 | nmdc:mga0qj67_8713_c1 | |||
| 1757 | nmdc:mga06r32_114312_c1 | |||
| 1758 | nmdc:mga06r32_1152_c3 | |||
| 1759 | nmdc:mga08y16_78126_c1 | |||
| 1760 | nmdc:mga0n895_10216_c1 | |||
| 1761 | nmdc:mga0n895_2147_c1 | |||
| 1762 | nmdc:mga0n895_243326_c1 | |||
| 1763 | nmdc:mga0n895_41205_c1 | |||
| 1764 | nmdc:mga0n895_446499_c1 | |||
| 1765 | nmdc:mga0n895_594_c1 | |||
| 1766 | nmdc:mga0n895_665777_c1 | |||
| 1767 | nmdc:mga0rr50_12540_c1 | |||
| 1768 | nmdc:mga0rr50_12933_c1 | |||
| 1769 | nmdc:mga0rr50_17955_c1 | |||
| 1770 | nmdc:mga0rr50_195245_c1 | |||
| 1771 | nmdc:mga0rr50_31091_c1 | |||
| 1772 | nmdc:mga0rr50_356082_c1 | |||
| 1773 | nmdc:mga08x19_15179_c1 | |||
| 1774 | nmdc:mga08x19_180_c1 | |||
| 1775 | nmdc:mga08x19_61528_c1 | |||
| 1776 | nmdc:mga0a205_143611_c1 | |||
| 1777 | nmdc:mga0a205_256208_c1 | |||
| 1778 | nmdc:mga0a205_28347_c1 | |||
| 1779 | nmdc:mga0a205_35122_c1 | |||
| 1780 | nmdc:mga0a205_49879_c1 | |||
| 1781 | nmdc:mga0a205_5672_c1 | |||
| 1782 | Ga0495601_0022318 | |||
| 1783 | Ga0495612_0037252 | |||
| 1784 | Ga0495595_0068907 | |||
| 1785 | Ga0495619_0010995 | |||
| 1786 | Ga0495619_0205609 | |||
| 1787 | Ga0500577_0000159 | |||
| 1788 | Ga0501084_0538089 | |||
| 1789 | Ga0501082_0047339 | |||
| 1790 | Ga0501082_0057617 | |||
| 1791 | 2817480593 | |||
| 1792 | 2897112090 | |||
| 1793 | 2915358291 | |||
| 1794 | 2969143447 | |||
| 1795 | 3006826840 | |||
| 1796 | 3006860944 | |||
| 1797 | 637878024 | |||
| 1798 | 8051955413 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6tk9-assembly1.cif.gz_B | purine-nucleoside phosphorylase from thermus thermophilus | 0.9841 | 12 | 276 |
| 8swu-assembly1.cif.gz_A | structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate | 0.9823 | 9 | 275 |
| 8swu-assembly1.cif.gz_B | structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate | 0.9818 | 9 | 275 |
| 8swu-assembly1.cif.gz_C | structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate | 0.9803 | 9 | 275 |
| 4m1e-assembly1.cif.gz_B | crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364. | 0.98 | 10 | 278 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yqqA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9784 | 13 | 279 | 3.40.50.1580 |
| 1yquC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9657 | 13 | 279 | 3.40.50.1580 |
| af_U4PSA1_35_317_3.40.50.1580 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9655 | 9 | 275 | 3.40.50.1580 |
| 3la8A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9635 | 9 | 276 | 3.40.50.1580 |
| 4lnaA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9621 | 12 | 275 | 3.40.50.1580 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645GZB6-F1-model_v4 | purine-nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9965 | 166 | 278 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-A0A1H9LTW5-F1-model_v4 | Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9961 | 12 | 276 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-A0A1I2EJ84-F1-model_v4 | Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9959 | 12 | 277 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-B2A4Z8-F1-model_v4 | Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9955 | 12 | 276 |
GO:0004731
GO:0005737 GO:0009116 |
| AF-A0A7W1YD72-F1-model_v4 | Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine-guanosine phosphorylase) | 0.9954 | 9 | 283 |
GO:0004731
GO:0005737 GO:0009116 |