F485072

General Info

Members Datasets Scaffolds Average Seq Length
898 288 1796 231

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10311187|Ga0105248_103111871
Length 248
Sequence MNHAKGEATQGAFMKRFISSGLMLAFILSTLVIVAPTTTNGQGAGLVSSVLNRMEKNRQTLKSLRAGISMVKYNSQLGVEDKYAGVVIYLPGAGRQASVRIDWSQPRRETFSVNNNQYTIFRPALGVAYKGAANKMGGKDSKASGLLDMMSMSRQQLEARFQPVKDVREESLWGGVSTIHLTLVPKGNASYKYAEVWIDAGGMPVQVKVVEKNDDSTTMRLTSLEKNQKINQSDFDVKLDSNVKIVKS

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
198 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
203 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
229 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
230 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
231 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
232 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
233 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
234 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
245 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
246 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
247 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
248 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
249 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
250 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
251 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
252 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
253 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
254 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
255 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
256 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
257 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
258 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
259 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
260 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
261 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
262 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
263 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
264 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
265 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
266 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
267 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
268 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
269 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
270 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
271 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
272 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
273 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
274 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
275 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
276 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
277 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
278 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
279 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.45
Rhizosphere 98
Stem 0
Stem Tuber 0
Unclassified 13.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10311187 3300009177 Bacteria 1774
2 SwRhRL2b_contig_930207 2162886007 Unclassified 3598
3 MRS1b_contig_832106 2162886011 Unclassified 1050
4 JGI24737J22298_10055729 3300001990 Bacteria 1195
5 JGI24751J29686_10000003 3300002459 Bacteria 157815
6 Ga0058863_11505722 3300004799 Unclassified 950
7 Ga0058861_11683201 3300004800 Unclassified 1128
8 Ga0058862_12380284 3300004803 Unclassified 1068
9 Ga0065704_10001798 3300005289 Bacteria 6520
10 Ga0065704_10082291 3300005289 Bacteria 3607
11 Ga0065712_10005245 3300005290 Bacteria 4733
12 Ga0065712_10073393 3300005290 Unclassified 4409
13 Ga0065712_10081567 3300005290 Bacteria 2996
14 Ga0065715_10004743 3300005293 Bacteria 4336
15 Ga0065715_10089787 3300005293 Bacteria 8522
16 Ga0065715_10092707 3300005293 Bacteria 4975
17 Ga0065715_10135344 3300005293 Bacteria 1940
18 Ga0065707_10003391 3300005295 Bacteria 3796
19 Ga0065707_10106408 3300005295 Bacteria 2597
20 Ga0065707_10496180 3300005295 Unclassified 761
21 Ga0070676_10021208 3300005328 Bacteria 3636
22 Ga0070676_10158130 3300005328 Bacteria 1456
23 Ga0070690_100004965 3300005330 Bacteria 7443
24 Ga0070690_100006953 3300005330 Bacteria 6440
25 Ga0070690_100113392 3300005330 Bacteria 1811
26 Ga0070690_100310315 3300005330 Bacteria 1134
27 Ga0070670_100000167 3300005331 Bacteria 59452
28 Ga0070670_100029535 3300005331 Bacteria 4720
29 Ga0070670_100099486 3300005331 Bacteria 2502
30 Ga0068869_100009811 3300005334 Bacteria 6219
31 Ga0068869_100011059 3300005334 Bacteria 5910
32 Ga0068869_100029718 3300005334 Bacteria 3832
33 Ga0068869_100063731 3300005334 Bacteria 2709
34 Ga0068869_100074084 3300005334 Bacteria 2526
35 Ga0068869_100110720 3300005334 Unclassified 2089
36 Ga0068869_100128585 3300005334 Bacteria 1945
37 Ga0068869_100393745 3300005334 Bacteria 1138
38 Ga0070666_10112390 3300005335 Bacteria 1884
39 Ga0070666_10224211 3300005335 Unclassified 1326
40 Ga0070680_100001034 3300005336 Bacteria 19934
41 Ga0070680_100015092 3300005336 Bacteria 6049
42 Ga0070680_100039864 3300005336 Unclassified 3801
43 Ga0070682_100000091 3300005337 Bacteria 82460
44 Ga0070682_100003864 3300005337 Bacteria 8315
45 Ga0070682_100005562 3300005337 Bacteria 7019
46 Ga0068868_100004335 3300005338 Bacteria 9945
47 Ga0068868_100032433 3300005338 Bacteria 4018
48 Ga0068868_100342269 3300005338 Bacteria 1279
49 Ga0070660_100094414 3300005339 Bacteria 2363
50 Ga0070689_100001217 3300005340 Bacteria 16325
51 Ga0070689_100015004 3300005340 Bacteria 5641
52 Ga0070687_100010093 3300005343 Bacteria 4067
53 Ga0070687_100023154 3300005343 Bacteria 2948
54 Ga0070687_100035319 3300005343 Bacteria 2481
55 Ga0070687_100117044 3300005343 Bacteria 1518
56 Ga0070692_10022540 3300005345 Bacteria 3076
57 Ga0070692_10068203 3300005345 Bacteria 1889
58 Ga0070692_10303476 3300005345 Unclassified 976
59 Ga0070668_100007396 3300005347 Bacteria 8150
60 Ga0070669_100002809 3300005353 Bacteria 12569
61 Ga0070669_100055936 3300005353 Bacteria 2891
62 Ga0070669_100090175 3300005353 Bacteria 2297
63 Ga0070669_100265443 3300005353 Bacteria 1371
64 Ga0070675_100088824 3300005354 Bacteria 2587
65 Ga0070675_100238304 3300005354 Bacteria 1589
66 Ga0070671_100002409 3300005355 Bacteria 14455
67 Ga0070671_100017845 3300005355 Bacteria 5752
68 Ga0070671_100066742 3300005355 Bacteria 2998
69 Ga0070673_100013703 3300005364 Bacteria 5620
70 Ga0070673_100041285 3300005364 Bacteria 3546
71 Ga0070673_100101009 3300005364 Bacteria 2376
72 Ga0070673_100146222 3300005364 Bacteria 1998
73 Ga0070673_100231082 3300005364 Bacteria 1604
74 Ga0070673_100368893 3300005364 Bacteria 1278
75 Ga0070673_100515720 3300005364 Bacteria 1083
76 Ga0070688_100013752 3300005365 Bacteria 4573
77 Ga0070688_100076258 3300005365 Bacteria 2157
78 Ga0070688_100225920 3300005365 Bacteria 1322
79 Ga0070659_100000353 3300005366 Bacteria 35063
80 Ga0070667_100048799 3300005367 Bacteria 3564
81 Ga0070667_100216183 3300005367 Bacteria 1705
82 Ga0070703_10049886 3300005406 Bacteria 1334
83 Ga0070703_10118888 3300005406 Bacteria 956
84 Ga0070701_10006201 3300005438 Bacteria 5015
85 Ga0070701_10011395 3300005438 Bacteria 3973
86 Ga0070701_10021205 3300005438 Bacteria 3097
87 Ga0070701_10070933 3300005438 Bacteria 1862
88 Ga0070701_10269699 3300005438 Bacteria 1035
89 Ga0070701_10289862 3300005438 Bacteria 1002
90 Ga0070705_100002034 3300005440 Bacteria 10341
91 Ga0070705_100086252 3300005440 Bacteria 1943
92 Ga0070705_100121630 3300005440 Bacteria 1686
93 Ga0070705_100144311 3300005440 Bacteria 1571
94 Ga0070705_100239780 3300005440 Bacteria 1266
95 Ga0070700_100000426 3300005441 Bacteria 21450
96 Ga0070700_100004146 3300005441 Bacteria 7558
97 Ga0070700_100012672 3300005441 Bacteria 4715
98 Ga0070700_100038335 3300005441 Bacteria 2920
99 Ga0070700_100042033 3300005441 Bacteria 2805
100 Ga0070700_100079301 3300005441 Bacteria 2116
101 Ga0070700_100081878 3300005441 Bacteria 2086
102 Ga0070700_100488008 3300005441 Bacteria 945
103 Ga0070694_100009619 3300005444 Bacteria 5932
104 Ga0070694_100022443 3300005444 Bacteria 4043
105 Ga0070694_100055897 3300005444 Bacteria 2678
106 Ga0070694_100094285 3300005444 Unclassified 2105
107 Ga0070694_100137763 3300005444 Unclassified 1770
108 Ga0070694_100196158 3300005444 Bacteria 1502
109 Ga0070694_100208648 3300005444 Bacteria 1460
110 Ga0070694_100277825 3300005444 Bacteria 1276
111 Ga0070708_100002706 3300005445 Bacteria 13739
112 Ga0070708_100063902 3300005445 Bacteria 3296
113 Ga0070708_100103151 3300005445 Bacteria 2614
114 Ga0070708_100406063 3300005445 Bacteria 1285
115 Ga0070662_100097957 3300005457 Bacteria 2214
116 Ga0070662_100139976 3300005457 Bacteria 1874
117 Ga0070662_100327013 3300005457 Bacteria 1251
118 Ga0070662_100660768 3300005457 Unclassified 882
119 Ga0070681_10000103 3300005458 Bacteria 63054
120 Ga0070681_10011795 3300005458 Bacteria 8663
121 Ga0070681_10013042 3300005458 Bacteria 8253
122 Ga0070681_10039556 3300005458 Bacteria 4726
123 Ga0068867_100082804 3300005459 Bacteria 2421
124 Ga0068867_100131406 3300005459 Bacteria 1946
125 Ga0068867_100135510 3300005459 Bacteria 1919
126 Ga0068867_100418993 3300005459 Bacteria 1134
127 Ga0070685_10039702 3300005466 Bacteria 2675
128 Ga0070685_10321407 3300005466 Bacteria 1049
129 Ga0070706_100003593 3300005467 Bacteria 15213
130 Ga0070706_100007385 3300005467 Bacteria 10307
131 Ga0070706_100017443 3300005467 Bacteria 6624
132 Ga0070706_100189330 3300005467 Bacteria 1923
133 Ga0070706_100723007 3300005467 Bacteria 923
134 Ga0070707_100006191 3300005468 Bacteria 11143
135 Ga0070707_100042211 3300005468 Bacteria 4366
136 Ga0070707_100130509 3300005468 Bacteria 2444
137 Ga0070707_100208097 3300005468 Unclassified 1907
138 Ga0070707_100380556 3300005468 Bacteria 1371
139 Ga0070698_100002114 3300005471 Bacteria 22082
140 Ga0070698_100007387 3300005471 Bacteria 11889
141 Ga0070698_100014024 3300005471 Bacteria 8475
142 Ga0070698_100021996 3300005471 Bacteria 6676
143 Ga0070698_100079021 3300005471 Bacteria 3287
144 Ga0070698_100109646 3300005471 Bacteria 2727
145 Ga0070699_100001150 3300005518 Bacteria 24554
146 Ga0070699_100005202 3300005518 Bacteria 11438
147 Ga0070699_100010950 3300005518 Bacteria 7843
148 Ga0070699_100038519 3300005518 Bacteria 4139
149 Ga0070699_100052355 3300005518 Bacteria 3533
150 Ga0070699_100097233 3300005518 Bacteria 2579
151 Ga0070699_100896329 3300005518 Bacteria 812
152 Ga0070679_100000492 3300005530 Bacteria 33622
153 Ga0070679_100013568 3300005530 Bacteria 7808
154 Ga0070697_100000095 3300005536 Bacteria 74109
155 Ga0070697_100000143 3300005536 Bacteria 57751
156 Ga0070697_100001663 3300005536 Bacteria 16961
157 Ga0070697_100154275 3300005536 Unclassified 1937
158 Ga0070697_100319026 3300005536 Unclassified 1338
159 Ga0070697_100461216 3300005536 Bacteria 1107
160 Ga0068853_100075171 3300005539 Bacteria 2948
161 Ga0068853_100169839 3300005539 Bacteria 1973
162 Ga0068853_100671001 3300005539 Bacteria 987
163 Ga0070672_100031067 3300005543 Bacteria 4018
164 Ga0070672_100167841 3300005543 Bacteria 1824
165 Ga0070672_100417213 3300005543 Bacteria 1152
166 Ga0070672_100484398 3300005543 Unclassified 1068
167 Ga0070686_100002485 3300005544 Bacteria 10151
168 Ga0070686_100004419 3300005544 Bacteria 7759
169 Ga0070686_100004724 3300005544 Bacteria 7509
170 Ga0070686_100453840 3300005544 Bacteria 986
171 Ga0070695_100018765 3300005545 Bacteria 4203
172 Ga0070695_100218572 3300005545 Bacteria 1372
173 Ga0070695_100310603 3300005545 Unclassified 1169
174 Ga0070696_100027274 3300005546 Bacteria 3890
175 Ga0070696_100033294 3300005546 Bacteria 3540
176 Ga0070696_100057892 3300005546 Bacteria 2706
177 Ga0070696_100161596 3300005546 Bacteria 1650
178 Ga0070696_100292882 3300005546 Bacteria 1244
179 Ga0070696_100592843 3300005546 Bacteria 893
180 Ga0070693_100000878 3300005547 Bacteria 13388
181 Ga0070693_100009477 3300005547 Bacteria 4844
182 Ga0070693_100026687 3300005547 Bacteria 3120
183 Ga0070693_100034009 3300005547 Bacteria 2818
184 Ga0070693_100117950 3300005547 Unclassified 1642
185 Ga0070693_100127759 3300005547 Bacteria 1585
186 Ga0070693_100284884 3300005547 Bacteria 1108
187 Ga0070704_100012733 3300005549 Bacteria 5204
188 Ga0070704_100030619 3300005549 Bacteria 3608
189 Ga0070704_100084073 3300005549 Bacteria 2352
190 Ga0070704_100095166 3300005549 Bacteria 2230
191 Ga0070704_100110259 3300005549 Bacteria 2093
192 Ga0070704_100163524 3300005549 Bacteria 1762
193 Ga0070704_100164266 3300005549 Bacteria 1759
194 Ga0070704_100167232 3300005549 Unclassified 1745
195 Ga0070704_100292861 3300005549 Unclassified 1353
196 Ga0070704_100318602 3300005549 Bacteria 1302
197 Ga0070704_100356122 3300005549 Bacteria 1237
198 Ga0070704_100420848 3300005549 Bacteria 1144
199 Ga0068855_100718434 3300005563 Bacteria 1068
200 Ga0070664_100000399 3300005564 Bacteria 32416
201 Ga0070664_100056283 3300005564 Bacteria 3342
202 Ga0070664_100154865 3300005564 Unclassified 2025
203 Ga0070664_100304306 3300005564 Bacteria 1441
204 Ga0070664_100672703 3300005564 Bacteria 963
205 Ga0070664_100707937 3300005564 Unclassified 938
206 Ga0068857_100003943 3300005577 Bacteria 12490
207 Ga0068857_100120685 3300005577 Bacteria 2360
208 Ga0068857_100157668 3300005577 Bacteria 2058
209 Ga0068857_100252255 3300005577 Bacteria 1618
210 Ga0068857_100254823 3300005577 Bacteria 1609
211 Ga0068857_100697235 3300005577 Unclassified 964
212 Ga0068854_100044134 3300005578 Bacteria 3163
213 Ga0068854_100044960 3300005578 Bacteria 3137
214 Ga0068854_100200687 3300005578 Bacteria 1568
215 Ga0068854_100264279 3300005578 Bacteria 1379
216 Ga0068856_100001146 3300005614 Bacteria 27859
217 Ga0070702_100024137 3300005615 Bacteria 3240
218 Ga0070702_100040080 3300005615 Bacteria 2618
219 Ga0070702_100058225 3300005615 Bacteria 2238
220 Ga0070702_100139079 3300005615 Bacteria 1544
221 Ga0068852_100521910 3300005616 Bacteria 1185
222 Ga0068852_100898612 3300005616 Unclassified 903
223 Ga0068859_100000994 3300005617 Bacteria 29030
224 Ga0068859_100013713 3300005617 Bacteria 8126
225 Ga0068859_100044302 3300005617 Bacteria 4470
226 Ga0068859_100065972 3300005617 Bacteria 3654
227 Ga0068859_100097141 3300005617 Bacteria 2999
228 Ga0068859_100208009 3300005617 Bacteria 2043
229 Ga0068859_100250319 3300005617 Unclassified 1862
230 Ga0068859_100315042 3300005617 Bacteria 1658
231 Ga0068859_100493414 3300005617 Bacteria 1320
232 Ga0068859_100570339 3300005617 Bacteria 1226
233 Ga0068859_101011640 3300005617 Unclassified 913
234 Ga0068864_100001946 3300005618 Bacteria 16969
235 Ga0068864_100002379 3300005618 Bacteria 15560
236 Ga0068864_100021902 3300005618 Bacteria 5357
237 Ga0068864_100044541 3300005618 Unclassified 3804
238 Ga0068864_100059521 3300005618 Bacteria 3305
239 Ga0068864_100060003 3300005618 Bacteria 3293
240 Ga0068864_100178049 3300005618 Bacteria 1942
241 Ga0068864_100447100 3300005618 Unclassified 1235
242 Ga0068864_100476252 3300005618 Bacteria 1198
243 Ga0068864_100500928 3300005618 Bacteria 1168
244 Ga0068864_100833423 3300005618 Unclassified 908
245 Ga0068864_100897954 3300005618 Bacteria 875
246 Ga0068866_10001172 3300005718 Bacteria 11472
247 Ga0068861_100009256 3300005719 Bacteria 6796
248 Ga0068861_100060259 3300005719 Bacteria 2908
249 Ga0068861_100072235 3300005719 Bacteria 2677
250 Ga0068861_100161442 3300005719 Bacteria 1849
251 Ga0068861_100195647 3300005719 Unclassified 1693
252 Ga0068861_100218251 3300005719 Bacteria 1610
253 Ga0068861_100442467 3300005719 Bacteria 1163
254 Ga0068861_100638981 3300005719 Unclassified 982
255 Ga0068861_100961699 3300005719 Bacteria 813
256 Ga0068851_10002032 3300005834 Bacteria 8924
257 Ga0068870_10020803 3300005840 Bacteria 3201
258 Ga0068870_10035332 3300005840 Bacteria 2563
259 Ga0068870_10066142 3300005840 Bacteria 1957
260 Ga0068870_10121641 3300005840 Unclassified 1504
261 Ga0068870_10334718 3300005840 Bacteria 966
262 Ga0068870_10513250 3300005840 Bacteria 801
263 Ga0068863_100007830 3300005841 Bacteria 10447
264 Ga0068863_100014644 3300005841 Bacteria 7551
265 Ga0068863_100118558 3300005841 Unclassified 2523
266 Ga0068863_100165153 3300005841 Bacteria 2122
267 Ga0068863_100210055 3300005841 Bacteria 1874
268 Ga0068863_100429808 3300005841 Bacteria 1294
269 Ga0068863_100930195 3300005841 Unclassified 870
270 Ga0068863_101072535 3300005841 Bacteria 810
271 Ga0068858_100017012 3300005842 Bacteria 6827
272 Ga0068858_100020383 3300005842 Bacteria 6201
273 Ga0068858_100029631 3300005842 Bacteria 5084
274 Ga0068858_100058718 3300005842 Bacteria 3557
275 Ga0068858_100058924 3300005842 Bacteria 3550
276 Ga0068858_100271064 3300005842 Unclassified 1615
277 Ga0068858_100370018 3300005842 Unclassified 1374
278 Ga0068860_100006429 3300005843 Bacteria 11800
279 Ga0068860_100007591 3300005843 Bacteria 10853
280 Ga0068860_100019122 3300005843 Bacteria 6651
281 Ga0068860_100019966 3300005843 Bacteria 6496
282 Ga0068860_100058864 3300005843 Bacteria 3653
283 Ga0068860_100094765 3300005843 Bacteria 2845
284 Ga0068860_100127128 3300005843 Bacteria 2443
285 Ga0068860_100636504 3300005843 Bacteria 1074
286 Ga0068862_100012348 3300005844 Bacteria 7061
287 Ga0068862_100023418 3300005844 Bacteria 5175
288 Ga0068862_100038231 3300005844 Bacteria 4070
289 Ga0068862_100130907 3300005844 Bacteria 2219
290 Ga0068862_100207913 3300005844 Unclassified 1767
291 Ga0068862_100277291 3300005844 Bacteria 1535
292 Ga0068862_100725023 3300005844 Bacteria 965
293 Ga0068862_100931741 3300005844 Bacteria 856
294 Ga0081455_10110433 3300005937 Bacteria 2186
295 Ga0081539_10001126 3300005985 Bacteria 48444
296 Ga0081539_10002144 3300005985 Bacteria 29163
297 Ga0070715_10158459 3300006163 Bacteria 1116
298 Ga0070716_100039451 3300006173 Unclassified 2621
299 Ga0070716_100100983 3300006173 Bacteria 1768
300 Ga0070716_100307824 3300006173 Bacteria 1105
301 Ga0097621_100002148 3300006237 Unclassified 13491
302 Ga0097621_100013481 3300006237 Bacteria 6094
303 Ga0097621_100049890 3300006237 Bacteria 3402
304 Ga0097621_100087010 3300006237 Bacteria 2608
305 Ga0097621_100104698 3300006237 Bacteria 2385
306 Ga0068871_100001307 3300006358 Bacteria 16665
307 Ga0068871_100015084 3300006358 Bacteria 5776
308 Ga0068871_100045549 3300006358 Bacteria 3531
309 Ga0068871_100202171 3300006358 Bacteria 1715
310 Ga0075428_100048414 3300006844 Bacteria 4665
311 Ga0075428_100346292 3300006844 Bacteria 1595
312 Ga0075428_100404921 3300006844 Unclassified 1462
313 Ga0075428_101394588 3300006844 Bacteria 736
314 Ga0075430_100016493 3300006846 Bacteria 6291
315 Ga0075430_100036344 3300006846 Bacteria 4177
316 Ga0075430_100308415 3300006846 Unclassified 1309
317 Ga0075433_10005899 3300006852 Bacteria 9649
318 Ga0075433_10029153 3300006852 Bacteria 4699
319 Ga0075433_10029652 3300006852 Bacteria 4664
320 Ga0075433_10033398 3300006852 Bacteria 4411
321 Ga0075433_10036887 3300006852 Bacteria 4214
322 Ga0075433_10054727 3300006852 Bacteria 3481
323 Ga0075433_10230484 3300006852 Unclassified 1645
324 Ga0075433_10267439 3300006852 Unclassified 1515
325 Ga0075433_10425801 3300006852 Bacteria 1170
326 Ga0075433_10598180 3300006852 Bacteria 968
327 Ga0075434_100035193 3300006871 Bacteria 4949
328 Ga0075434_100125272 3300006871 Bacteria 2586
329 Ga0075434_100461321 3300006871 Bacteria 1292
330 Ga0075434_100468628 3300006871 Unclassified 1281
331 Ga0075434_100492082 3300006871 Bacteria 1247
332 Ga0075429_100087955 3300006880 Bacteria 2708
333 Ga0075429_100114146 3300006880 Bacteria 2361
334 Ga0075429_100336310 3300006880 Bacteria 1321
335 Ga0068865_100105134 3300006881 Bacteria 2073
336 Ga0068865_100197426 3300006881 Bacteria 1560
337 Ga0075436_100051780 3300006914 Bacteria 2833
338 Ga0097620_100000994 3300006931 Bacteria 29030
339 Ga0097620_100013713 3300006931 Bacteria 8126
340 Ga0097620_100044304 3300006931 Bacteria 4470
341 Ga0097620_100065973 3300006931 Bacteria 3654
342 Ga0097620_100097141 3300006931 Bacteria 2999
343 Ga0097620_100208008 3300006931 Bacteria 2043
344 Ga0097620_100250300 3300006931 Unclassified 1862
345 Ga0097620_100315006 3300006931 Bacteria 1658
346 Ga0097620_100493478 3300006931 Bacteria 1320
347 Ga0097620_100570288 3300006931 Bacteria 1226
348 Ga0097620_101011803 3300006931 Unclassified 913
349 Ga0075435_100199414 3300007076 Bacteria 1695
350 Ga0075435_100275245 3300007076 Unclassified 1436
351 Ga0105244_10082965 3300009036 Bacteria 1585
352 Ga0105240_10040465 3300009093 Bacteria 5960
353 Ga0105240_10290667 3300009093 Bacteria 1874
354 Ga0105240_10379548 3300009093 Bacteria 1597
355 Ga0105240_10771773 3300009093 Unclassified 1043
356 Ga0111539_10001706 3300009094 Bacteria 29249
357 Ga0111539_10021254 3300009094 Bacteria 7990
358 Ga0111539_10190992 3300009094 Bacteria 2390
359 Ga0111539_10290852 3300009094 Bacteria 1901
360 Ga0111539_10354394 3300009094 Bacteria 1708
361 Ga0111539_10667980 3300009094 Bacteria 1210
362 Ga0111539_11153677 3300009094 Bacteria 900
363 Ga0105245_10005694 3300009098 Bacteria 10943
364 Ga0105245_10348305 3300009098 Bacteria 1467
365 Ga0105245_10348560 3300009098 Bacteria 1466
366 Ga0105247_10002274 3300009101 Bacteria 13192
367 Ga0105247_10151370 3300009101 Bacteria 1529
368 Ga0105247_10195748 3300009101 Bacteria 1355
369 Ga0105247_10321811 3300009101 Bacteria 1079
370 Ga0114129_10016614 3300009147 Bacteria 10483
371 Ga0114129_10040881 3300009147 Bacteria 6535
372 Ga0114129_10069585 3300009147 Bacteria 4906
373 Ga0114129_10123089 3300009147 Bacteria 3568
374 Ga0114129_10161948 3300009147 Bacteria 3055
375 Ga0114129_10229584 3300009147 Bacteria 2500
376 Ga0114129_10300328 3300009147 Bacteria 2140
377 Ga0114129_10547611 3300009147 Unclassified 1505
378 Ga0105243_10009281 3300009148 Bacteria 7505
379 Ga0105243_10013270 3300009148 Bacteria 6229
380 Ga0105243_11026014 3300009148 Bacteria 829
381 Ga0105241_10040711 3300009174 Bacteria 3509
382 Ga0105241_10092888 3300009174 Bacteria 2383
383 Ga0105241_10120787 3300009174 Bacteria 2110
384 Ga0105241_10137304 3300009174 Bacteria 1987
385 Ga0105241_10143641 3300009174 Bacteria 1946
386 Ga0105241_10149339 3300009174 Bacteria 1910
387 Ga0105241_10225798 3300009174 Bacteria 1576
388 Ga0105241_10293712 3300009174 Bacteria 1392
389 Ga0105241_10328562 3300009174 Bacteria 1321
390 Ga0105241_10636661 3300009174 Bacteria 967
391 Ga0105242_10005179 3300009176 Bacteria 10063
392 Ga0105242_10143305 3300009176 Bacteria 2076
393 Ga0105248_10005966 3300009177 Bacteria 13384
394 Ga0105248_10120108 3300009177 Bacteria 2965
395 Ga0105248_10131214 3300009177 Bacteria 2827
396 Ga0105248_10373770 3300009177 Bacteria 1605
397 Ga0105248_10396744 3300009177 Bacteria 1553
398 Ga0105248_10483913 3300009177 Bacteria 1395
399 Ga0105248_10617899 3300009177 Bacteria 1223
400 Ga0105248_10815284 3300009177 Bacteria 1053
401 Ga0105237_10006325 3300009545 Bacteria 13163
402 Ga0105237_10010011 3300009545 Bacteria 10116
403 Ga0105237_10128419 3300009545 Bacteria 2529
404 Ga0105238_10005440 3300009551 Bacteria 12583
405 Ga0105249_10000018 3300009553 Bacteria 275907
406 Ga0105249_10092977 3300009553 Bacteria 2824
407 Ga0105249_10172144 3300009553 Bacteria 2101
408 Ga0105249_10417884 3300009553 Bacteria 1374
409 Ga0105249_10498962 3300009553 Unclassified 1262
410 Ga0105239_10058238 3300010375 Bacteria 4239
411 Ga0105239_10064893 3300010375 Bacteria 4008
412 Ga0105239_10138910 3300010375 Bacteria 2707
413 Ga0105246_10078523 3300011119 Bacteria 2344
414 Ga0105246_10097517 3300011119 Bacteria 2133
415 Ga0105246_10315630 3300011119 Bacteria 1268
416 Ga0105246_10500345 3300011119 Unclassified 1032
417 Ga0105246_10615766 3300011119 Unclassified 940
418 Ga0105246_10747857 3300011119 Bacteria 862
419 Ga0157373_10006546 3300013100 Bacteria 8691
420 Ga0157373_10106878 3300013100 Bacteria 1967
421 Ga0157373_10109073 3300013100 Bacteria 1946
422 Ga0157373_10182030 3300013100 Bacteria 1480
423 Ga0157373_10238727 3300013100 Unclassified 1285
424 Ga0157373_10249591 3300013100 Bacteria 1255
425 Ga0157371_10113964 3300013102 Bacteria 1920
426 Ga0157374_10271960 3300013296 Bacteria 1671
427 Ga0157374_10286684 3300013296 Bacteria 1627
428 Ga0157374_10374156 3300013296 Bacteria 1418
429 Ga0157378_10031802 3300013297 Bacteria 4661
430 Ga0157378_10111867 3300013297 Bacteria 2504
431 Ga0157378_10227654 3300013297 Bacteria 1775
432 Ga0157378_10519961 3300013297 Bacteria 1191
433 Ga0157378_10861832 3300013297 Unclassified 935
434 Ga0163162_10000001 3300013306 Bacteria 751833
435 Ga0163162_10001376 3300013306 Bacteria 22623
436 Ga0163162_10005973 3300013306 Bacteria 11787
437 Ga0163162_10023086 3300013306 Bacteria 6136
438 Ga0163162_10062368 3300013306 Bacteria 3768
439 Ga0163162_10119832 3300013306 Bacteria 2735
440 Ga0163162_10128315 3300013306 Bacteria 2644
441 Ga0163162_10333450 3300013306 Unclassified 1649
442 Ga0163162_10378391 3300013306 Bacteria 1549
443 Ga0163162_11218901 3300013306 Unclassified 854
444 Ga0157372_10006380 3300013307 Bacteria 12546
445 Ga0157372_10029226 3300013307 Bacteria 6017
446 Ga0157372_10328183 3300013307 Bacteria 1782
447 Ga0157372_10345442 3300013307 Bacteria 1734
448 Ga0157372_10556751 3300013307 Bacteria 1337
449 Ga0157375_10072836 3300013308 Bacteria 3453
450 Ga0157375_10094751 3300013308 Bacteria 3055
451 Ga0157375_10097288 3300013308 Bacteria 3017
452 Ga0157375_10261853 3300013308 Bacteria 1891
453 Ga0157375_10344444 3300013308 Bacteria 1656
454 Ga0157375_10355180 3300013308 Bacteria 1632
455 Ga0157375_10442749 3300013308 Bacteria 1465
456 Ga0157375_10629854 3300013308 Bacteria 1230
457 Ga0157375_10734422 3300013308 Bacteria 1139
458 Ga0157375_11190044 3300013308 Unclassified 894
459 Ga0163163_10000298 3300014325 Bacteria 49128
460 Ga0163163_10000769 3300014325 Bacteria 27193
461 Ga0163163_10017394 3300014325 Bacteria 6704
462 Ga0163163_10020887 3300014325 Bacteria 6174
463 Ga0163163_10118208 3300014325 Bacteria 2683
464 Ga0163163_10144399 3300014325 Bacteria 2423
465 Ga0163163_10194194 3300014325 Bacteria 2078
466 Ga0163163_10525490 3300014325 Bacteria 1246
467 Ga0163163_10713113 3300014325 Bacteria 1067
468 Ga0157380_10000396 3300014326 Bacteria 26239
469 Ga0157380_10001184 3300014326 Bacteria 16877
470 Ga0157380_10039879 3300014326 Bacteria 3654
471 Ga0157380_10043381 3300014326 Bacteria 3521
472 Ga0157380_10073705 3300014326 Bacteria 2769
473 Ga0157380_10242827 3300014326 Bacteria 1625
474 Ga0157380_10442569 3300014326 Bacteria 1246
475 Ga0157377_10332778 3300014745 Bacteria 1013
476 Ga0157379_10072632 3300014968 Bacteria 3078
477 Ga0157379_10125856 3300014968 Bacteria 2306
478 Ga0157379_10140894 3300014968 Bacteria 2174
479 Ga0157376_10047984 3300014969 Bacteria 3528
480 Ga0157376_10599810 3300014969 Unclassified 1096
481 Ga0182006_1112806 3300015261 Bacteria 952
482 Ga0182007_10025683 3300015262 Bacteria 2049
483 Ga0163161_10023688 3300017792 Bacteria 4333
484 Ga0163161_10053009 3300017792 Bacteria 2941
485 Ga0163161_10275312 3300017792 Bacteria 1318
486 Ga0213876_10035243 3300021384 Bacteria 2640
487 Ga0213876_10058787 3300021384 Bacteria 2029
488 Ga0207656_10149218 3300025321 Unclassified 1106
489 Ga0207653_10041775 3300025885 Bacteria 1507
490 Ga0207653_10073380 3300025885 Unclassified 1173
491 Ga0207710_10000575 3300025900 Bacteria 21826
492 Ga0207710_10035600 3300025900 Bacteria 2191
493 Ga0207688_10035806 3300025901 Bacteria 2750
494 Ga0207688_10422601 3300025901 Bacteria 828
495 Ga0207680_10041453 3300025903 Bacteria 2686
496 Ga0207680_10111950 3300025903 Bacteria 1772
497 Ga0207647_10011682 3300025904 Bacteria 6146
498 Ga0207647_10184847 3300025904 Bacteria 1209
499 Ga0207645_10087304 3300025907 Bacteria 2005
500 Ga0207645_10180754 3300025907 Unclassified 1384
501 Ga0207643_10001070 3300025908 Bacteria 16179
502 Ga0207643_10010513 3300025908 Bacteria 4985
503 Ga0207643_10032351 3300025908 Bacteria 2921
504 Ga0207684_10004145 3300025910 Bacteria 13786
505 Ga0207684_10004659 3300025910 Bacteria 12875
506 Ga0207684_10224353 3300025910 Bacteria 1622
507 Ga0207654_10035589 3300025911 Bacteria 2776
508 Ga0207654_10040027 3300025911 Bacteria 2640
509 Ga0207654_10086387 3300025911 Bacteria 1901
510 Ga0207654_10100596 3300025911 Bacteria 1781
511 Ga0207654_10379440 3300025911 Bacteria 979
512 Ga0207707_10000033 3300025912 Bacteria 158362
513 Ga0207707_10043224 3300025912 Bacteria 3931
514 Ga0207707_10103589 3300025912 Bacteria 2487
515 Ga0207707_10678656 3300025912 Bacteria 866
516 Ga0207695_10170493 3300025913 Bacteria 2102
517 Ga0207695_10550843 3300025913 Unclassified 1035
518 Ga0207695_10651891 3300025913 Bacteria 934
519 Ga0207671_10004666 3300025914 Bacteria 12970
520 Ga0207671_10248701 3300025914 Unclassified 1398
521 Ga0207660_10000364 3300025917 Bacteria 29558
522 Ga0207660_10011501 3300025917 Bacteria 5764
523 Ga0207660_10048302 3300025917 Bacteria 3011
524 Ga0207660_10282124 3300025917 Bacteria 1318
525 Ga0207660_10519729 3300025917 Unclassified 967
526 Ga0207662_10001073 3300025918 Bacteria 12851
527 Ga0207662_10006092 3300025918 Bacteria 6488
528 Ga0207662_10085264 3300025918 Bacteria 1934
529 Ga0207662_10101392 3300025918 Bacteria 1784
530 Ga0207657_10109486 3300025919 Bacteria 2283
531 Ga0207657_10343169 3300025919 Bacteria 1178
532 Ga0207652_10000032 3300025921 Bacteria 143319
533 Ga0207652_10032165 3300025921 Bacteria 4407
534 Ga0207652_10560221 3300025921 Bacteria 1026
535 Ga0207646_10028626 3300025922 Bacteria 5069
536 Ga0207646_10055709 3300025922 Bacteria 3535
537 Ga0207646_10133216 3300025922 Bacteria 2237
538 Ga0207646_10559619 3300025922 Unclassified 1028
539 Ga0207681_10000902 3300025923 Bacteria 19410
540 Ga0207681_10013012 3300025923 Bacteria 5144
541 Ga0207681_10029293 3300025923 Bacteria 3574
542 Ga0207681_10370561 3300025923 Bacteria 1151
543 Ga0207681_10571591 3300025923 Bacteria 932
544 Ga0207694_10003281 3300025924 Bacteria 12887
545 Ga0207694_10059105 3300025924 Bacteria 2982
546 Ga0207650_10000007 3300025925 Bacteria 530810
547 Ga0207650_10000504 3300025925 Bacteria 32594
548 Ga0207650_10585793 3300025925 Bacteria 937
549 Ga0207659_10017617 3300025926 Bacteria 4668
550 Ga0207659_10421944 3300025926 Bacteria 1119
551 Ga0207687_10180522 3300025927 Bacteria 1635
552 Ga0207687_10302484 3300025927 Unclassified 1289
553 Ga0207687_10377959 3300025927 Bacteria 1160
554 Ga0207687_10447351 3300025927 Unclassified 1071
555 Ga0207644_10001852 3300025931 Bacteria 13770
556 Ga0207644_10041064 3300025931 Bacteria 3271
557 Ga0207644_10100865 3300025931 Bacteria 2168
558 Ga0207690_10009856 3300025932 Bacteria 5674
559 Ga0207690_10032550 3300025932 Bacteria 3346
560 Ga0207706_10088666 3300025933 Bacteria 2720
561 Ga0207706_10271333 3300025933 Unclassified 1480
562 Ga0207706_10516315 3300025933 Bacteria 1030
563 Ga0207686_10036511 3300025934 Bacteria 2959
564 Ga0207709_10014659 3300025935 Bacteria 4332
565 Ga0207709_10043350 3300025935 Bacteria 2711
566 Ga0207709_10121866 3300025935 Unclassified 1762
567 Ga0207709_10204453 3300025935 Unclassified 1413
568 Ga0207670_10002610 3300025936 Bacteria 9480
569 Ga0207670_10163386 3300025936 Bacteria 1664
570 Ga0207670_10197232 3300025936 Bacteria 1527
571 Ga0207670_10330643 3300025936 Unclassified 1202
572 Ga0207669_10199309 3300025937 Bacteria 1452
573 Ga0207665_10059739 3300025939 Bacteria 2581
574 Ga0207665_10170296 3300025939 Unclassified 1572
575 Ga0207691_10000991 3300025940 Bacteria 28224
576 Ga0207691_10119902 3300025940 Bacteria 2332
577 Ga0207691_10294565 3300025940 Bacteria 1395
578 Ga0207691_10297382 3300025940 Bacteria 1387
579 Ga0207711_10008234 3300025941 Bacteria 8730
580 Ga0207711_10018504 3300025941 Bacteria 5792
581 Ga0207711_10077281 3300025941 Bacteria 2901
582 Ga0207711_10101750 3300025941 Bacteria 2543
583 Ga0207711_10468683 3300025941 Bacteria 1173
584 Ga0207689_10014349 3300025942 Bacteria 6740
585 Ga0207689_10015735 3300025942 Bacteria 6405
586 Ga0207689_10021620 3300025942 Bacteria 5410
587 Ga0207689_10022598 3300025942 Bacteria 5284
588 Ga0207689_10076606 3300025942 Bacteria 2749
589 Ga0207689_10100799 3300025942 Bacteria 2372
590 Ga0207689_10110174 3300025942 Bacteria 2262
591 Ga0207689_10148402 3300025942 Bacteria 1932
592 Ga0207689_10217748 3300025942 Bacteria 1577
593 Ga0207689_10224691 3300025942 Unclassified 1552
594 Ga0207689_10266735 3300025942 Unclassified 1417
595 Ga0207689_10547712 3300025942 Bacteria 972
596 Ga0207679_10229157 3300025945 Unclassified 1567
597 Ga0207679_10501136 3300025945 Unclassified 1083
598 Ga0207679_10532723 3300025945 Bacteria 1052
599 Ga0207679_10912237 3300025945 Bacteria 804
600 Ga0207667_10226914 3300025949 Bacteria 1913
601 Ga0207667_10664606 3300025949 Bacteria 1046
602 Ga0207651_10019355 3300025960 Bacteria 4077
603 Ga0207651_10087121 3300025960 Bacteria 2272
604 Ga0207651_10118713 3300025960 Bacteria 2001
605 Ga0207651_10128210 3300025960 Bacteria 1937
606 Ga0207651_10346300 3300025960 Bacteria 1250
607 Ga0207712_10000081 3300025961 Bacteria 114043
608 Ga0207712_10004444 3300025961 Bacteria 8855
609 Ga0207712_10429705 3300025961 Bacteria 1116
610 Ga0207668_10004533 3300025972 Bacteria 8172
611 Ga0207640_10092091 3300025981 Bacteria 2102
612 Ga0207640_10192119 3300025981 Bacteria 1540
613 Ga0207640_10230497 3300025981 Bacteria 1424
614 Ga0207640_10662535 3300025981 Unclassified 891
615 Ga0207658_10066099 3300025986 Bacteria 2719
616 Ga0207677_10007186 3300026023 Bacteria 6136
617 Ga0207677_10083524 3300026023 Bacteria 2299
618 Ga0207677_10130902 3300026023 Bacteria 1904
619 Ga0207677_10208511 3300026023 Bacteria 1559
620 Ga0207703_10016670 3300026035 Bacteria 5731
621 Ga0207703_10047051 3300026035 Bacteria 3477
622 Ga0207703_10075478 3300026035 Unclassified 2794
623 Ga0207703_10138943 3300026035 Bacteria 2106
624 Ga0207703_10267112 3300026035 Bacteria 1548
625 Ga0207703_10309253 3300026035 Bacteria 1444
626 Ga0207703_10362003 3300026035 Bacteria 1338
627 Ga0207703_10539269 3300026035 Unclassified 1099
628 Ga0207639_10064225 3300026041 Unclassified 2845
629 Ga0207639_10173307 3300026041 Bacteria 1829
630 Ga0207708_10000096 3300026075 Bacteria 67574
631 Ga0207708_10016590 3300026075 Bacteria 5541
632 Ga0207708_10017440 3300026075 Bacteria 5405
633 Ga0207708_10042706 3300026075 Bacteria 3455
634 Ga0207708_10043899 3300026075 Bacteria 3407
635 Ga0207708_10060669 3300026075 Bacteria 2887
636 Ga0207708_10099937 3300026075 Unclassified 2244
637 Ga0207708_10103755 3300026075 Bacteria 2202
638 Ga0207708_10172037 3300026075 Bacteria 1716
639 Ga0207702_10086434 3300026078 Bacteria 2735
640 Ga0207641_10009016 3300026088 Bacteria 8238
641 Ga0207641_10105030 3300026088 Bacteria 2494
642 Ga0207641_10261382 3300026088 Bacteria 1621
643 Ga0207641_10430469 3300026088 Bacteria 1272
644 Ga0207648_10001293 3300026089 Bacteria 27927
645 Ga0207648_10085218 3300026089 Bacteria 2756
646 Ga0207648_10098714 3300026089 Bacteria 2557
647 Ga0207648_10108117 3300026089 Bacteria 2441
648 Ga0207648_10198133 3300026089 Bacteria 1781
649 Ga0207648_10417463 3300026089 Unclassified 1218
650 Ga0207648_10455037 3300026089 Unclassified 1166
651 Ga0207676_10003315 3300026095 Unclassified 11429
652 Ga0207676_10055935 3300026095 Bacteria 3100
653 Ga0207676_10133047 3300026095 Bacteria 2117
654 Ga0207676_10165189 3300026095 Bacteria 1922
655 Ga0207676_10180216 3300026095 Bacteria 1849
656 Ga0207676_10322039 3300026095 Bacteria 1419
657 Ga0207676_10322425 3300026095 Bacteria 1419
658 Ga0207676_10436324 3300026095 Bacteria 1232
659 Ga0207676_10561554 3300026095 Unclassified 1092
660 Ga0207676_10615387 3300026095 Unclassified 1045
661 Ga0207676_11025341 3300026095 Bacteria 814
662 Ga0207676_11205501 3300026095 Bacteria 750
663 Ga0207674_10000058 3300026116 Bacteria 113012
664 Ga0207674_10106920 3300026116 Bacteria 2775
665 Ga0207674_10162034 3300026116 Bacteria 2191
666 Ga0207674_10213482 3300026116 Bacteria 1878
667 Ga0207674_10400348 3300026116 Bacteria 1327
668 Ga0207674_10599557 3300026116 Bacteria 1064
669 Ga0207675_100001711 3300026118 Bacteria 21971
670 Ga0207675_100005590 3300026118 Bacteria 12033
671 Ga0207675_100024259 3300026118 Bacteria 5640
672 Ga0207675_100051662 3300026118 Bacteria 3836
673 Ga0207675_100066853 3300026118 Bacteria 3360
674 Ga0207675_100243586 3300026118 Bacteria 1738
675 Ga0207675_100287788 3300026118 Bacteria 1598
676 Ga0207675_100371253 3300026118 Bacteria 1405
677 Ga0207675_100748236 3300026118 Unclassified 989
678 Ga0207683_10531837 3300026121 Bacteria 1087
679 Ga0207698_10039989 3300026142 Bacteria 3479
680 Ga0207698_10606270 3300026142 Bacteria 1080
681 Ga0207698_11014019 3300026142 Unclassified 841
682 Ga0207428_10013108 3300027907 Bacteria 7259
683 Ga0207428_10031907 3300027907 Bacteria 4338
684 Ga0207428_10212008 3300027907 Bacteria 1455
685 Ga0268266_10323477 3300028379 Bacteria 1444
686 Ga0268265_10021233 3300028380 Bacteria 4545
687 Ga0268265_10070698 3300028380 Bacteria 2715
688 Ga0268265_10339243 3300028380 Bacteria 1368
689 Ga0268265_10375870 3300028380 Unclassified 1305
690 Ga0268265_10694708 3300028380 Bacteria 982
691 Ga0268265_11224360 3300028380 Unclassified 749
692 Ga0268264_10009577 3300028381 Bacteria 8021
693 Ga0268264_10018974 3300028381 Bacteria 5622
694 Ga0268264_10104585 3300028381 Unclassified 2468
695 Ga0268264_10106489 3300028381 Bacteria 2448
696 Ga0268264_10230059 3300028381 Bacteria 1712
697 Ga0268264_10432546 3300028381 Bacteria 1271
698 Ga0307408_100242156 3300031548 Bacteria 1483
699 Ga0307408_100245694 3300031548 Bacteria 1473
700 Ga0307408_100266253 3300031548 Bacteria 1421
701 Ga0307405_10003341 3300031731 Bacteria 7349
702 Ga0307405_10287576 3300031731 Bacteria 1241
703 Ga0307413_10743295 3300031824 Bacteria 819
704 Ga0307410_10333135 3300031852 Bacteria 1208
705 Ga0307406_10062816 3300031901 Bacteria 2403
706 Ga0307407_10097570 3300031903 Bacteria 1817
707 Ga0307407_10125573 3300031903 Bacteria 1633
708 Ga0307407_10524880 3300031903 Bacteria 871
709 Ga0307412_10002204 3300031911 Bacteria 10817
710 Ga0307412_10214322 3300031911 Bacteria 1472
711 Ga0307409_100046695 3300031995 Bacteria 3281
712 Ga0307409_100079862 3300031995 Bacteria 2638
713 Ga0307416_100131898 3300032002 Bacteria 2251
714 Ga0307416_100392294 3300032002 Bacteria 1422
715 Ga0307416_100757072 3300032002 Bacteria 1064
716 Ga0307414_10002865 3300032004 Bacteria 9109
717 Ga0307414_10151474 3300032004 Bacteria 1830
718 Ga0307411_10015779 3300032005 Bacteria 4255
719 Ga0307415_100040909 3300032126 Bacteria 3074
720 Ga0307415_100604395 3300032126 Bacteria 976
721 Ga0373940_0011177 3300035088 Bacteria 2128
722 Ga0373951_0000344 3300035091 Bacteria 14204
723 Ga0373941_0029872 3300035115 Bacteria 1611
724 Ga0373962_0067709 3300035242 Bacteria 1061
725 Ga0373931_0093776 3300035691 Bacteria 1677
726 Ga0395900_0287242 3300037418 Unclassified 1635
727 Ga0395900_0364302 3300037418 Bacteria 1416
728 Ga0395900_0488728 3300037418 Unclassified 1183
729 Ga0395898_0055324 3300037466 Unclassified 3870
730 Ga0395898_0708375 3300037466 Unclassified 948
731 Ga0395905_0001486 3300037471 Bacteria 28070
732 Ga0395905_0441371 3300037471 Unclassified 1199
733 Ga0436364_1320014 3300037853 Bacteria 1821
734 Ga0395901_0195212 3300038443 Bacteria 2123
735 Ga0395901_0348840 3300038443 Bacteria 1528
736 Ga0395901_0464259 3300038443 Bacteria 1293
737 Ga0395901_0468250 3300038443 Bacteria 1287
738 Ga0395901_1075657 3300038443 Unclassified 776
739 Ga0242422_00204 3300038699 Bacteria 3378
740 Ga0242420_012464 3300038996 Bacteria 1440
741 Ga0242420_013194 3300038996 Bacteria 1406
742 Ga0436365_1215147 3300039437 Bacteria 2614
743 Ga0436365_1445471 3300039437 Bacteria 2469
744 Ga0439453_0026038 3300041408 Bacteria 1083
745 Ga0439448_0010185 3300042005 Bacteria 2782
746 Ga0439462_0039295 3300042015 Bacteria 1261
747 Ga0439458_0004252 3300042157 Bacteria 3305
748 Ga0439464_0003831 3300042439 Bacteria 3826
749 Ga0453683_0345794 3300044673 Bacteria 955
750 Ga0495596_0100230 3300046500 Unclassified 1125
751 Ga0495610_0139434 3300046512 Unclassified 1045
752 Ga0495632_0118832 3300046519 Bacteria 1236
753 Ga0495663_0000086 3300046525 Bacteria 42201
754 Ga0495663_0107358 3300046525 Unclassified 925
755 Ga0495598_0000022 3300046537 Bacteria 24493
756 Ga0495621_0052893 3300046539 Unclassified 1456
757 Ga0495656_0109354 3300046615 Bacteria 1290
758 Ga0495668_0152900 3300046616 Bacteria 1264
759 Ga0495636_0076032 3300047318 Bacteria 1440
760 Ga0495672_0135382 3300047320 Bacteria 1292
761 Ga0496102_0045769 3300048905 Bacteria 3973
762 Ga0496104_0136004 3300048907 Unclassified 2361
763 Ga0496106_0012081 3300048909 Bacteria 6373
764 Ga0496108_0044067 3300048911 Bacteria 3726
765 Ga0496109_0117114 3300048912 Bacteria 2480
766 Ga0496110_0130482 3300048913 Unclassified 2269
767 Ga0496110_0252251 3300048913 Bacteria 1606
768 Ga0496112_0054171 3300048915 Bacteria 3941
769 Ga0496112_0081576 3300048915 Bacteria 3199
770 Ga0496112_0114615 3300048915 Bacteria 2666
771 Ga0496112_0205851 3300048915 Bacteria 1926
772 Ga0496113_0364551 3300048916 Bacteria 1159
773 Ga0496113_0395692 3300048916 Bacteria 1109
774 Ga0501306_008131 3300049127 Bacteria 1274
775 Ga0501343_004355 3300049132 Bacteria 1063
776 Ga0501305_005692 3300049161 Bacteria 1521
777 Ga0501307_019594 3300049162 Bacteria 869
778 Ga0501291_002492 3300049514 Bacteria 2210
779 Ga0501291_010324 3300049514 Bacteria 1327
780 Ga0501292_002980 3300049515 Bacteria 2227
781 Ga0501292_005083 3300049515 Bacteria 1822
782 Ga0501292_016662 3300049515 Bacteria 1157
783 Ga0501293_017122 3300049516 Unclassified 681
784 Ga0501295_044985 3300049518 Bacteria 928
785 Ga0501296_004509 3300049519 Bacteria 1523
786 Ga0501296_011894 3300049519 Bacteria 1045
787 Ga0501297_004732 3300049520 Bacteria 1402
788 Ga0501298_007686 3300049521 Bacteria 1792
789 Ga0501298_031200 3300049521 Bacteria 1046
790 Ga0501299_000659 3300049522 Bacteria 4099
791 Ga0501299_009869 3300049522 Bacteria 1583
792 Ga0501311_005949 3300049527 Bacteria 1357
793 Ga0501311_022835 3300049527 Unclassified 862
794 Ga0501312_006392 3300049528 Bacteria 1469
795 Ga0501313_019300 3300049529 Unclassified 833
796 Ga0501313_035215 3300049529 Bacteria 660
797 Ga0501316_003397 3300049532 Bacteria 1543
798 Ga0501320_003192 3300049536 Bacteria 1374
799 Ga0501038_0005634 3300049574 Bacteria 11618
800 Ga0501072_0050487 3300049588 Bacteria 3275
801 Ga0501076_0245975 3300049592 Unclassified 1463
802 Ga0501198_001047 3300049649 Bacteria 3523
803 Ga0501198_005025 3300049649 Bacteria 1852
804 Ga0501198_017065 3300049649 Unclassified 1127
805 Ga0501198_017364 3300049649 Bacteria 1120
806 Ga0501199_007165 3300049650 Bacteria 1149
807 Ga0501201_013166 3300049651 Unclassified 829
808 Ga0501202_022933 3300049652 Bacteria 1256
809 Ga0501202_024453 3300049652 Bacteria 1225
810 Ga0501208_007645 3300049655 Bacteria 1428
811 Ga0501208_023990 3300049655 Bacteria 1025
812 Ga0501209_003496 3300049656 Bacteria 2603
813 Ga0501216_003936 3300049660 Bacteria 2186
814 Ga0501216_007283 3300049660 Bacteria 1718
815 Ga0501216_014243 3300049660 Bacteria 1327
816 Ga0501217_008880 3300049661 Bacteria 2179
817 Ga0501217_012291 3300049661 Bacteria 1905
818 Ga0501223_010812 3300049663 Bacteria 1833
819 Ga0501223_014111 3300049663 Bacteria 1586
820 Ga0501224_001749 3300049664 Bacteria 2918
821 Ga0501224_006519 3300049664 Bacteria 1692
822 Ga0501224_007072 3300049664 Bacteria 1632
823 Ga0501227_005436 3300049665 Bacteria 2726
824 Ga0501227_021332 3300049665 Bacteria 1493
825 Ga0501227_040010 3300049665 Bacteria 1156
826 Ga0501233_030285 3300049668 Bacteria 1218
827 Ga0501235_005190 3300049669 Bacteria 2832
828 Ga0501235_016444 3300049669 Bacteria 1634
829 Ga0501235_034652 3300049669 Bacteria 1145
830 Ga0501239_021279 3300049672 Unclassified 797
831 Ga0501240_011064 3300049673 Bacteria 1210
832 Ga0501243_001842 3300049675 Bacteria 3079
833 Ga0501243_006519 3300049675 Bacteria 1769
834 Ga0501249_003150 3300049679 Bacteria 3317
835 Ga0501249_008804 3300049679 Bacteria 2097
836 Ga0501249_011562 3300049679 Bacteria 1855
837 Ga0501249_041898 3300049679 Unclassified 1040
838 Ga0501251_029027 3300049681 Unclassified 779
839 Ga0501253_000584 3300049683 Bacteria 3211
840 Ga0501253_004685 3300049683 Bacteria 1744
841 Ga0501253_008131 3300049683 Bacteria 1497
842 Ga0501255_002460 3300049684 Bacteria 1629
843 Ga0501256_001891 3300049685 Bacteria 1610
844 Ga0501257_002806 3300049686 Bacteria 3685
845 Ga0501257_008945 3300049686 Bacteria 2257
846 Ga0501257_015010 3300049686 Bacteria 1787
847 Ga0501258_013753 3300049687 Unclassified 891
848 Ga0501259_004453 3300049688 Bacteria 2233
849 Ga0501259_065733 3300049688 Bacteria 768
850 Ga0501260_001786 3300049689 Bacteria 1811
851 Ga0501260_002832 3300049689 Bacteria 1525
852 Ga0501221_006547 3300049704 Bacteria 1974
853 Ga0501221_026896 3300049704 Bacteria 1172
854 Ga0501221_048231 3300049704 Bacteria 952
855 Ga0501225_0000502 3300049705 Bacteria 12197
856 Ga0501225_0008247 3300049705 Bacteria 2996
857 Ga0501225_0014413 3300049705 Bacteria 2207
858 Ga0501229_007372 3300049706 Bacteria 1369
859 Ga0501234_007500 3300049707 Bacteria 1707
860 Ga0501266_009757 3300049763 Bacteria 1217
861 Ga0501268_041375 3300049765 Unclassified 868
862 Ga0501273_000676 3300049770 Bacteria 2868
863 Ga0501273_006751 3300049770 Bacteria 1336
864 Ga0501278_002309 3300049774 Bacteria 1342
865 Ga0501283_019013 3300049779 Bacteria 1085
866 Ga0501212_024513 3300049851 Bacteria 949
867 Ga0501226_001347 3300049853 Bacteria 3172
868 nmdc:mga05p37_1066236_c1 3300050507 Bacteria 850
869 nmdc:mga05p37_125124_c1 3300050507 Bacteria 3157
870 nmdc:mga05p37_252218_c1 3300050507 Bacteria 2116
871 nmdc:mga05p37_31687_c1 3300050507 Bacteria 6460
872 nmdc:mga05p37_38485_c1 3300050507 Bacteria 5867
873 nmdc:mga05p37_401847_c1 3300050507 Bacteria 1599
874 nmdc:mga05p37_566621_c1 3300050507 Bacteria 1289
875 nmdc:mga05p37_6284_c1 3300050507 Bacteria 13981
876 nmdc:mga05p37_717386_c1 3300050507 Unclassified 1108
877 nmdc:mga09592_285355_c1 3300050508 Bacteria 1431
878 nmdc:mga09592_384497_c1 3300050508 Unclassified 1213
879 nmdc:mga09592_38771_c1 3300050508 Bacteria 4000
880 nmdc:mga08y16_171581_c1 3300050511 Bacteria 2253
881 nmdc:mga08y16_18816_c1 3300050511 Bacteria 7277
882 nmdc:mga08y16_27376_c1 3300050511 Bacteria 6007
883 nmdc:mga08y16_92957_c1 3300050511 Bacteria 3143
884 nmdc:mga0n895_183324_c1 3300050512 Bacteria 2125
885 nmdc:mga0n895_41506_c1 3300050512 Bacteria 4474
886 nmdc:mga0n895_43491_c1 3300050512 Bacteria 4377
887 nmdc:mga0n895_488358_c1 3300050512 Bacteria 1241
888 nmdc:mga08x19_9600_c1 3300050514 Bacteria 5792
889 nmdc:mga0a205_10093_c1 3300050515 Bacteria 8666
890 nmdc:mga0a205_168649_c1 3300050515 Bacteria 2085
891 nmdc:mga0a205_226852_c1 3300050515 Bacteria 1752
892 nmdc:mga0a205_269021_c1 3300050515 Bacteria 1581
893 nmdc:mga0a205_734330_c1 3300050515 Bacteria 836
894 nmdc:mga0a205_89982_c1 3300050515 Bacteria 2966
895 nmdc:mga0a205_9020_c1 3300050515 Bacteria 9090
896 Ga0501084_0491502 3300054114 Unclassified 1037
897 Ga0587073_0076639 3300059492 Unclassified 820
898 Ga0530510_0082574 3300061734 Bacteria 2340
899 Ga0105248_10311187
900 SwRhRL2b_contig_930207
901 MRS1b_contig_832106
902 JGI24737J22298_10055729
903 JGI24751J29686_10000003
904 Ga0058863_11505722
905 Ga0058861_11683201
906 Ga0058862_12380284
907 Ga0065704_10001798
908 Ga0065704_10082291
909 Ga0065712_10005245
910 Ga0065712_10073393
911 Ga0065712_10081567
912 Ga0065715_10004743
913 Ga0065715_10089787
914 Ga0065715_10092707
915 Ga0065715_10135344
916 Ga0065707_10003391
917 Ga0065707_10106408
918 Ga0065707_10496180
919 Ga0070676_10021208
920 Ga0070676_10158130
921 Ga0070690_100004965
922 Ga0070690_100006953
923 Ga0070690_100113392
924 Ga0070690_100310315
925 Ga0070670_100000167
926 Ga0070670_100029535
927 Ga0070670_100099486
928 Ga0068869_100009811
929 Ga0068869_100011059
930 Ga0068869_100029718
931 Ga0068869_100063731
932 Ga0068869_100074084
933 Ga0068869_100110720
934 Ga0068869_100128585
935 Ga0068869_100393745
936 Ga0070666_10112390
937 Ga0070666_10224211
938 Ga0070680_100001034
939 Ga0070680_100015092
940 Ga0070680_100039864
941 Ga0070682_100000091
942 Ga0070682_100003864
943 Ga0070682_100005562
944 Ga0068868_100004335
945 Ga0068868_100032433
946 Ga0068868_100342269
947 Ga0070660_100094414
948 Ga0070689_100001217
949 Ga0070689_100015004
950 Ga0070687_100010093
951 Ga0070687_100023154
952 Ga0070687_100035319
953 Ga0070687_100117044
954 Ga0070692_10022540
955 Ga0070692_10068203
956 Ga0070692_10303476
957 Ga0070668_100007396
958 Ga0070669_100002809
959 Ga0070669_100055936
960 Ga0070669_100090175
961 Ga0070669_100265443
962 Ga0070675_100088824
963 Ga0070675_100238304
964 Ga0070671_100002409
965 Ga0070671_100017845
966 Ga0070671_100066742
967 Ga0070673_100013703
968 Ga0070673_100041285
969 Ga0070673_100101009
970 Ga0070673_100146222
971 Ga0070673_100231082
972 Ga0070673_100368893
973 Ga0070673_100515720
974 Ga0070688_100013752
975 Ga0070688_100076258
976 Ga0070688_100225920
977 Ga0070659_100000353
978 Ga0070667_100048799
979 Ga0070667_100216183
980 Ga0070703_10049886
981 Ga0070703_10118888
982 Ga0070701_10006201
983 Ga0070701_10011395
984 Ga0070701_10021205
985 Ga0070701_10070933
986 Ga0070701_10269699
987 Ga0070701_10289862
988 Ga0070705_100002034
989 Ga0070705_100086252
990 Ga0070705_100121630
991 Ga0070705_100144311
992 Ga0070705_100239780
993 Ga0070700_100000426
994 Ga0070700_100004146
995 Ga0070700_100012672
996 Ga0070700_100038335
997 Ga0070700_100042033
998 Ga0070700_100079301
999 Ga0070700_100081878
1000 Ga0070700_100488008
1001 Ga0070694_100009619
1002 Ga0070694_100022443
1003 Ga0070694_100055897
1004 Ga0070694_100094285
1005 Ga0070694_100137763
1006 Ga0070694_100196158
1007 Ga0070694_100208648
1008 Ga0070694_100277825
1009 Ga0070708_100002706
1010 Ga0070708_100063902
1011 Ga0070708_100103151
1012 Ga0070708_100406063
1013 Ga0070662_100097957
1014 Ga0070662_100139976
1015 Ga0070662_100327013
1016 Ga0070662_100660768
1017 Ga0070681_10000103
1018 Ga0070681_10011795
1019 Ga0070681_10013042
1020 Ga0070681_10039556
1021 Ga0068867_100082804
1022 Ga0068867_100131406
1023 Ga0068867_100135510
1024 Ga0068867_100418993
1025 Ga0070685_10039702
1026 Ga0070685_10321407
1027 Ga0070706_100003593
1028 Ga0070706_100007385
1029 Ga0070706_100017443
1030 Ga0070706_100189330
1031 Ga0070706_100723007
1032 Ga0070707_100006191
1033 Ga0070707_100042211
1034 Ga0070707_100130509
1035 Ga0070707_100208097
1036 Ga0070707_100380556
1037 Ga0070698_100002114
1038 Ga0070698_100007387
1039 Ga0070698_100014024
1040 Ga0070698_100021996
1041 Ga0070698_100079021
1042 Ga0070698_100109646
1043 Ga0070699_100001150
1044 Ga0070699_100005202
1045 Ga0070699_100010950
1046 Ga0070699_100038519
1047 Ga0070699_100052355
1048 Ga0070699_100097233
1049 Ga0070699_100896329
1050 Ga0070679_100000492
1051 Ga0070679_100013568
1052 Ga0070697_100000095
1053 Ga0070697_100000143
1054 Ga0070697_100001663
1055 Ga0070697_100154275
1056 Ga0070697_100319026
1057 Ga0070697_100461216
1058 Ga0068853_100075171
1059 Ga0068853_100169839
1060 Ga0068853_100671001
1061 Ga0070672_100031067
1062 Ga0070672_100167841
1063 Ga0070672_100417213
1064 Ga0070672_100484398
1065 Ga0070686_100002485
1066 Ga0070686_100004419
1067 Ga0070686_100004724
1068 Ga0070686_100453840
1069 Ga0070695_100018765
1070 Ga0070695_100218572
1071 Ga0070695_100310603
1072 Ga0070696_100027274
1073 Ga0070696_100033294
1074 Ga0070696_100057892
1075 Ga0070696_100161596
1076 Ga0070696_100292882
1077 Ga0070696_100592843
1078 Ga0070693_100000878
1079 Ga0070693_100009477
1080 Ga0070693_100026687
1081 Ga0070693_100034009
1082 Ga0070693_100117950
1083 Ga0070693_100127759
1084 Ga0070693_100284884
1085 Ga0070704_100012733
1086 Ga0070704_100030619
1087 Ga0070704_100084073
1088 Ga0070704_100095166
1089 Ga0070704_100110259
1090 Ga0070704_100163524
1091 Ga0070704_100164266
1092 Ga0070704_100167232
1093 Ga0070704_100292861
1094 Ga0070704_100318602
1095 Ga0070704_100356122
1096 Ga0070704_100420848
1097 Ga0068855_100718434
1098 Ga0070664_100000399
1099 Ga0070664_100056283
1100 Ga0070664_100154865
1101 Ga0070664_100304306
1102 Ga0070664_100672703
1103 Ga0070664_100707937
1104 Ga0068857_100003943
1105 Ga0068857_100120685
1106 Ga0068857_100157668
1107 Ga0068857_100252255
1108 Ga0068857_100254823
1109 Ga0068857_100697235
1110 Ga0068854_100044134
1111 Ga0068854_100044960
1112 Ga0068854_100200687
1113 Ga0068854_100264279
1114 Ga0068856_100001146
1115 Ga0070702_100024137
1116 Ga0070702_100040080
1117 Ga0070702_100058225
1118 Ga0070702_100139079
1119 Ga0068852_100521910
1120 Ga0068852_100898612
1121 Ga0068859_100000994
1122 Ga0068859_100013713
1123 Ga0068859_100044302
1124 Ga0068859_100065972
1125 Ga0068859_100097141
1126 Ga0068859_100208009
1127 Ga0068859_100250319
1128 Ga0068859_100315042
1129 Ga0068859_100493414
1130 Ga0068859_100570339
1131 Ga0068859_101011640
1132 Ga0068864_100001946
1133 Ga0068864_100002379
1134 Ga0068864_100021902
1135 Ga0068864_100044541
1136 Ga0068864_100059521
1137 Ga0068864_100060003
1138 Ga0068864_100178049
1139 Ga0068864_100447100
1140 Ga0068864_100476252
1141 Ga0068864_100500928
1142 Ga0068864_100833423
1143 Ga0068864_100897954
1144 Ga0068866_10001172
1145 Ga0068861_100009256
1146 Ga0068861_100060259
1147 Ga0068861_100072235
1148 Ga0068861_100161442
1149 Ga0068861_100195647
1150 Ga0068861_100218251
1151 Ga0068861_100442467
1152 Ga0068861_100638981
1153 Ga0068861_100961699
1154 Ga0068851_10002032
1155 Ga0068870_10020803
1156 Ga0068870_10035332
1157 Ga0068870_10066142
1158 Ga0068870_10121641
1159 Ga0068870_10334718
1160 Ga0068870_10513250
1161 Ga0068863_100007830
1162 Ga0068863_100014644
1163 Ga0068863_100118558
1164 Ga0068863_100165153
1165 Ga0068863_100210055
1166 Ga0068863_100429808
1167 Ga0068863_100930195
1168 Ga0068863_101072535
1169 Ga0068858_100017012
1170 Ga0068858_100020383
1171 Ga0068858_100029631
1172 Ga0068858_100058718
1173 Ga0068858_100058924
1174 Ga0068858_100271064
1175 Ga0068858_100370018
1176 Ga0068860_100006429
1177 Ga0068860_100007591
1178 Ga0068860_100019122
1179 Ga0068860_100019966
1180 Ga0068860_100058864
1181 Ga0068860_100094765
1182 Ga0068860_100127128
1183 Ga0068860_100636504
1184 Ga0068862_100012348
1185 Ga0068862_100023418
1186 Ga0068862_100038231
1187 Ga0068862_100130907
1188 Ga0068862_100207913
1189 Ga0068862_100277291
1190 Ga0068862_100725023
1191 Ga0068862_100931741
1192 Ga0081455_10110433
1193 Ga0081539_10001126
1194 Ga0081539_10002144
1195 Ga0070715_10158459
1196 Ga0070716_100039451
1197 Ga0070716_100100983
1198 Ga0070716_100307824
1199 Ga0097621_100002148
1200 Ga0097621_100013481
1201 Ga0097621_100049890
1202 Ga0097621_100087010
1203 Ga0097621_100104698
1204 Ga0068871_100001307
1205 Ga0068871_100015084
1206 Ga0068871_100045549
1207 Ga0068871_100202171
1208 Ga0075428_100048414
1209 Ga0075428_100346292
1210 Ga0075428_100404921
1211 Ga0075428_101394588
1212 Ga0075430_100016493
1213 Ga0075430_100036344
1214 Ga0075430_100308415
1215 Ga0075433_10005899
1216 Ga0075433_10029153
1217 Ga0075433_10029652
1218 Ga0075433_10033398
1219 Ga0075433_10036887
1220 Ga0075433_10054727
1221 Ga0075433_10230484
1222 Ga0075433_10267439
1223 Ga0075433_10425801
1224 Ga0075433_10598180
1225 Ga0075434_100035193
1226 Ga0075434_100125272
1227 Ga0075434_100461321
1228 Ga0075434_100468628
1229 Ga0075434_100492082
1230 Ga0075429_100087955
1231 Ga0075429_100114146
1232 Ga0075429_100336310
1233 Ga0068865_100105134
1234 Ga0068865_100197426
1235 Ga0075436_100051780
1236 Ga0097620_100000994
1237 Ga0097620_100013713
1238 Ga0097620_100044304
1239 Ga0097620_100065973
1240 Ga0097620_100097141
1241 Ga0097620_100208008
1242 Ga0097620_100250300
1243 Ga0097620_100315006
1244 Ga0097620_100493478
1245 Ga0097620_100570288
1246 Ga0097620_101011803
1247 Ga0075435_100199414
1248 Ga0075435_100275245
1249 Ga0105244_10082965
1250 Ga0105240_10040465
1251 Ga0105240_10290667
1252 Ga0105240_10379548
1253 Ga0105240_10771773
1254 Ga0111539_10001706
1255 Ga0111539_10021254
1256 Ga0111539_10190992
1257 Ga0111539_10290852
1258 Ga0111539_10354394
1259 Ga0111539_10667980
1260 Ga0111539_11153677
1261 Ga0105245_10005694
1262 Ga0105245_10348305
1263 Ga0105245_10348560
1264 Ga0105247_10002274
1265 Ga0105247_10151370
1266 Ga0105247_10195748
1267 Ga0105247_10321811
1268 Ga0114129_10016614
1269 Ga0114129_10040881
1270 Ga0114129_10069585
1271 Ga0114129_10123089
1272 Ga0114129_10161948
1273 Ga0114129_10229584
1274 Ga0114129_10300328
1275 Ga0114129_10547611
1276 Ga0105243_10009281
1277 Ga0105243_10013270
1278 Ga0105243_11026014
1279 Ga0105241_10040711
1280 Ga0105241_10092888
1281 Ga0105241_10120787
1282 Ga0105241_10137304
1283 Ga0105241_10143641
1284 Ga0105241_10149339
1285 Ga0105241_10225798
1286 Ga0105241_10293712
1287 Ga0105241_10328562
1288 Ga0105241_10636661
1289 Ga0105242_10005179
1290 Ga0105242_10143305
1291 Ga0105248_10005966
1292 Ga0105248_10120108
1293 Ga0105248_10131214
1294 Ga0105248_10373770
1295 Ga0105248_10396744
1296 Ga0105248_10483913
1297 Ga0105248_10617899
1298 Ga0105248_10815284
1299 Ga0105237_10006325
1300 Ga0105237_10010011
1301 Ga0105237_10128419
1302 Ga0105238_10005440
1303 Ga0105249_10000018
1304 Ga0105249_10092977
1305 Ga0105249_10172144
1306 Ga0105249_10417884
1307 Ga0105249_10498962
1308 Ga0105239_10058238
1309 Ga0105239_10064893
1310 Ga0105239_10138910
1311 Ga0105246_10078523
1312 Ga0105246_10097517
1313 Ga0105246_10315630
1314 Ga0105246_10500345
1315 Ga0105246_10615766
1316 Ga0105246_10747857
1317 Ga0157373_10006546
1318 Ga0157373_10106878
1319 Ga0157373_10109073
1320 Ga0157373_10182030
1321 Ga0157373_10238727
1322 Ga0157373_10249591
1323 Ga0157371_10113964
1324 Ga0157374_10271960
1325 Ga0157374_10286684
1326 Ga0157374_10374156
1327 Ga0157378_10031802
1328 Ga0157378_10111867
1329 Ga0157378_10227654
1330 Ga0157378_10519961
1331 Ga0157378_10861832
1332 Ga0163162_10000001
1333 Ga0163162_10001376
1334 Ga0163162_10005973
1335 Ga0163162_10023086
1336 Ga0163162_10062368
1337 Ga0163162_10119832
1338 Ga0163162_10128315
1339 Ga0163162_10333450
1340 Ga0163162_10378391
1341 Ga0163162_11218901
1342 Ga0157372_10006380
1343 Ga0157372_10029226
1344 Ga0157372_10328183
1345 Ga0157372_10345442
1346 Ga0157372_10556751
1347 Ga0157375_10072836
1348 Ga0157375_10094751
1349 Ga0157375_10097288
1350 Ga0157375_10261853
1351 Ga0157375_10344444
1352 Ga0157375_10355180
1353 Ga0157375_10442749
1354 Ga0157375_10629854
1355 Ga0157375_10734422
1356 Ga0157375_11190044
1357 Ga0163163_10000298
1358 Ga0163163_10000769
1359 Ga0163163_10017394
1360 Ga0163163_10020887
1361 Ga0163163_10118208
1362 Ga0163163_10144399
1363 Ga0163163_10194194
1364 Ga0163163_10525490
1365 Ga0163163_10713113
1366 Ga0157380_10000396
1367 Ga0157380_10001184
1368 Ga0157380_10039879
1369 Ga0157380_10043381
1370 Ga0157380_10073705
1371 Ga0157380_10242827
1372 Ga0157380_10442569
1373 Ga0157377_10332778
1374 Ga0157379_10072632
1375 Ga0157379_10125856
1376 Ga0157379_10140894
1377 Ga0157376_10047984
1378 Ga0157376_10599810
1379 Ga0182006_1112806
1380 Ga0182007_10025683
1381 Ga0163161_10023688
1382 Ga0163161_10053009
1383 Ga0163161_10275312
1384 Ga0213876_10035243
1385 Ga0213876_10058787
1386 Ga0207656_10149218
1387 Ga0207653_10041775
1388 Ga0207653_10073380
1389 Ga0207710_10000575
1390 Ga0207710_10035600
1391 Ga0207688_10035806
1392 Ga0207688_10422601
1393 Ga0207680_10041453
1394 Ga0207680_10111950
1395 Ga0207647_10011682
1396 Ga0207647_10184847
1397 Ga0207645_10087304
1398 Ga0207645_10180754
1399 Ga0207643_10001070
1400 Ga0207643_10010513
1401 Ga0207643_10032351
1402 Ga0207684_10004145
1403 Ga0207684_10004659
1404 Ga0207684_10224353
1405 Ga0207654_10035589
1406 Ga0207654_10040027
1407 Ga0207654_10086387
1408 Ga0207654_10100596
1409 Ga0207654_10379440
1410 Ga0207707_10000033
1411 Ga0207707_10043224
1412 Ga0207707_10103589
1413 Ga0207707_10678656
1414 Ga0207695_10170493
1415 Ga0207695_10550843
1416 Ga0207695_10651891
1417 Ga0207671_10004666
1418 Ga0207671_10248701
1419 Ga0207660_10000364
1420 Ga0207660_10011501
1421 Ga0207660_10048302
1422 Ga0207660_10282124
1423 Ga0207660_10519729
1424 Ga0207662_10001073
1425 Ga0207662_10006092
1426 Ga0207662_10085264
1427 Ga0207662_10101392
1428 Ga0207657_10109486
1429 Ga0207657_10343169
1430 Ga0207652_10000032
1431 Ga0207652_10032165
1432 Ga0207652_10560221
1433 Ga0207646_10028626
1434 Ga0207646_10055709
1435 Ga0207646_10133216
1436 Ga0207646_10559619
1437 Ga0207681_10000902
1438 Ga0207681_10013012
1439 Ga0207681_10029293
1440 Ga0207681_10370561
1441 Ga0207681_10571591
1442 Ga0207694_10003281
1443 Ga0207694_10059105
1444 Ga0207650_10000007
1445 Ga0207650_10000504
1446 Ga0207650_10585793
1447 Ga0207659_10017617
1448 Ga0207659_10421944
1449 Ga0207687_10180522
1450 Ga0207687_10302484
1451 Ga0207687_10377959
1452 Ga0207687_10447351
1453 Ga0207644_10001852
1454 Ga0207644_10041064
1455 Ga0207644_10100865
1456 Ga0207690_10009856
1457 Ga0207690_10032550
1458 Ga0207706_10088666
1459 Ga0207706_10271333
1460 Ga0207706_10516315
1461 Ga0207686_10036511
1462 Ga0207709_10014659
1463 Ga0207709_10043350
1464 Ga0207709_10121866
1465 Ga0207709_10204453
1466 Ga0207670_10002610
1467 Ga0207670_10163386
1468 Ga0207670_10197232
1469 Ga0207670_10330643
1470 Ga0207669_10199309
1471 Ga0207665_10059739
1472 Ga0207665_10170296
1473 Ga0207691_10000991
1474 Ga0207691_10119902
1475 Ga0207691_10294565
1476 Ga0207691_10297382
1477 Ga0207711_10008234
1478 Ga0207711_10018504
1479 Ga0207711_10077281
1480 Ga0207711_10101750
1481 Ga0207711_10468683
1482 Ga0207689_10014349
1483 Ga0207689_10015735
1484 Ga0207689_10021620
1485 Ga0207689_10022598
1486 Ga0207689_10076606
1487 Ga0207689_10100799
1488 Ga0207689_10110174
1489 Ga0207689_10148402
1490 Ga0207689_10217748
1491 Ga0207689_10224691
1492 Ga0207689_10266735
1493 Ga0207689_10547712
1494 Ga0207679_10229157
1495 Ga0207679_10501136
1496 Ga0207679_10532723
1497 Ga0207679_10912237
1498 Ga0207667_10226914
1499 Ga0207667_10664606
1500 Ga0207651_10019355
1501 Ga0207651_10087121
1502 Ga0207651_10118713
1503 Ga0207651_10128210
1504 Ga0207651_10346300
1505 Ga0207712_10000081
1506 Ga0207712_10004444
1507 Ga0207712_10429705
1508 Ga0207668_10004533
1509 Ga0207640_10092091
1510 Ga0207640_10192119
1511 Ga0207640_10230497
1512 Ga0207640_10662535
1513 Ga0207658_10066099
1514 Ga0207677_10007186
1515 Ga0207677_10083524
1516 Ga0207677_10130902
1517 Ga0207677_10208511
1518 Ga0207703_10016670
1519 Ga0207703_10047051
1520 Ga0207703_10075478
1521 Ga0207703_10138943
1522 Ga0207703_10267112
1523 Ga0207703_10309253
1524 Ga0207703_10362003
1525 Ga0207703_10539269
1526 Ga0207639_10064225
1527 Ga0207639_10173307
1528 Ga0207708_10000096
1529 Ga0207708_10016590
1530 Ga0207708_10017440
1531 Ga0207708_10042706
1532 Ga0207708_10043899
1533 Ga0207708_10060669
1534 Ga0207708_10099937
1535 Ga0207708_10103755
1536 Ga0207708_10172037
1537 Ga0207702_10086434
1538 Ga0207641_10009016
1539 Ga0207641_10105030
1540 Ga0207641_10261382
1541 Ga0207641_10430469
1542 Ga0207648_10001293
1543 Ga0207648_10085218
1544 Ga0207648_10098714
1545 Ga0207648_10108117
1546 Ga0207648_10198133
1547 Ga0207648_10417463
1548 Ga0207648_10455037
1549 Ga0207676_10003315
1550 Ga0207676_10055935
1551 Ga0207676_10133047
1552 Ga0207676_10165189
1553 Ga0207676_10180216
1554 Ga0207676_10322039
1555 Ga0207676_10322425
1556 Ga0207676_10436324
1557 Ga0207676_10561554
1558 Ga0207676_10615387
1559 Ga0207676_11025341
1560 Ga0207676_11205501
1561 Ga0207674_10000058
1562 Ga0207674_10106920
1563 Ga0207674_10162034
1564 Ga0207674_10213482
1565 Ga0207674_10400348
1566 Ga0207674_10599557
1567 Ga0207675_100001711
1568 Ga0207675_100005590
1569 Ga0207675_100024259
1570 Ga0207675_100051662
1571 Ga0207675_100066853
1572 Ga0207675_100243586
1573 Ga0207675_100287788
1574 Ga0207675_100371253
1575 Ga0207675_100748236
1576 Ga0207683_10531837
1577 Ga0207698_10039989
1578 Ga0207698_10606270
1579 Ga0207698_11014019
1580 Ga0207428_10013108
1581 Ga0207428_10031907
1582 Ga0207428_10212008
1583 Ga0268266_10323477
1584 Ga0268265_10021233
1585 Ga0268265_10070698
1586 Ga0268265_10339243
1587 Ga0268265_10375870
1588 Ga0268265_10694708
1589 Ga0268265_11224360
1590 Ga0268264_10009577
1591 Ga0268264_10018974
1592 Ga0268264_10104585
1593 Ga0268264_10106489
1594 Ga0268264_10230059
1595 Ga0268264_10432546
1596 Ga0307408_100242156
1597 Ga0307408_100245694
1598 Ga0307408_100266253
1599 Ga0307405_10003341
1600 Ga0307405_10287576
1601 Ga0307413_10743295
1602 Ga0307410_10333135
1603 Ga0307406_10062816
1604 Ga0307407_10097570
1605 Ga0307407_10125573
1606 Ga0307407_10524880
1607 Ga0307412_10002204
1608 Ga0307412_10214322
1609 Ga0307409_100046695
1610 Ga0307409_100079862
1611 Ga0307416_100131898
1612 Ga0307416_100392294
1613 Ga0307416_100757072
1614 Ga0307414_10002865
1615 Ga0307414_10151474
1616 Ga0307411_10015779
1617 Ga0307415_100040909
1618 Ga0307415_100604395
1619 Ga0373940_0011177
1620 Ga0373951_0000344
1621 Ga0373941_0029872
1622 Ga0373962_0067709
1623 Ga0373931_0093776
1624 Ga0395900_0287242
1625 Ga0395900_0364302
1626 Ga0395900_0488728
1627 Ga0395898_0055324
1628 Ga0395898_0708375
1629 Ga0395905_0001486
1630 Ga0395905_0441371
1631 Ga0436364_1320014
1632 Ga0395901_0195212
1633 Ga0395901_0348840
1634 Ga0395901_0464259
1635 Ga0395901_0468250
1636 Ga0395901_1075657
1637 Ga0242422_00204
1638 Ga0242420_012464
1639 Ga0242420_013194
1640 Ga0436365_1215147
1641 Ga0436365_1445471
1642 Ga0439453_0026038
1643 Ga0439448_0010185
1644 Ga0439462_0039295
1645 Ga0439458_0004252
1646 Ga0439464_0003831
1647 Ga0453683_0345794
1648 Ga0495596_0100230
1649 Ga0495610_0139434
1650 Ga0495632_0118832
1651 Ga0495663_0000086
1652 Ga0495663_0107358
1653 Ga0495598_0000022
1654 Ga0495621_0052893
1655 Ga0495656_0109354
1656 Ga0495668_0152900
1657 Ga0495636_0076032
1658 Ga0495672_0135382
1659 Ga0496102_0045769
1660 Ga0496104_0136004
1661 Ga0496106_0012081
1662 Ga0496108_0044067
1663 Ga0496109_0117114
1664 Ga0496110_0130482
1665 Ga0496110_0252251
1666 Ga0496112_0054171
1667 Ga0496112_0081576
1668 Ga0496112_0114615
1669 Ga0496112_0205851
1670 Ga0496113_0364551
1671 Ga0496113_0395692
1672 Ga0501306_008131
1673 Ga0501343_004355
1674 Ga0501305_005692
1675 Ga0501307_019594
1676 Ga0501291_002492
1677 Ga0501291_010324
1678 Ga0501292_002980
1679 Ga0501292_005083
1680 Ga0501292_016662
1681 Ga0501293_017122
1682 Ga0501295_044985
1683 Ga0501296_004509
1684 Ga0501296_011894
1685 Ga0501297_004732
1686 Ga0501298_007686
1687 Ga0501298_031200
1688 Ga0501299_000659
1689 Ga0501299_009869
1690 Ga0501311_005949
1691 Ga0501311_022835
1692 Ga0501312_006392
1693 Ga0501313_019300
1694 Ga0501313_035215
1695 Ga0501316_003397
1696 Ga0501320_003192
1697 Ga0501038_0005634
1698 Ga0501072_0050487
1699 Ga0501076_0245975
1700 Ga0501198_001047
1701 Ga0501198_005025
1702 Ga0501198_017065
1703 Ga0501198_017364
1704 Ga0501199_007165
1705 Ga0501201_013166
1706 Ga0501202_022933
1707 Ga0501202_024453
1708 Ga0501208_007645
1709 Ga0501208_023990
1710 Ga0501209_003496
1711 Ga0501216_003936
1712 Ga0501216_007283
1713 Ga0501216_014243
1714 Ga0501217_008880
1715 Ga0501217_012291
1716 Ga0501223_010812
1717 Ga0501223_014111
1718 Ga0501224_001749
1719 Ga0501224_006519
1720 Ga0501224_007072
1721 Ga0501227_005436
1722 Ga0501227_021332
1723 Ga0501227_040010
1724 Ga0501233_030285
1725 Ga0501235_005190
1726 Ga0501235_016444
1727 Ga0501235_034652
1728 Ga0501239_021279
1729 Ga0501240_011064
1730 Ga0501243_001842
1731 Ga0501243_006519
1732 Ga0501249_003150
1733 Ga0501249_008804
1734 Ga0501249_011562
1735 Ga0501249_041898
1736 Ga0501251_029027
1737 Ga0501253_000584
1738 Ga0501253_004685
1739 Ga0501253_008131
1740 Ga0501255_002460
1741 Ga0501256_001891
1742 Ga0501257_002806
1743 Ga0501257_008945
1744 Ga0501257_015010
1745 Ga0501258_013753
1746 Ga0501259_004453
1747 Ga0501259_065733
1748 Ga0501260_001786
1749 Ga0501260_002832
1750 Ga0501221_006547
1751 Ga0501221_026896
1752 Ga0501221_048231
1753 Ga0501225_0000502
1754 Ga0501225_0008247
1755 Ga0501225_0014413
1756 Ga0501229_007372
1757 Ga0501234_007500
1758 Ga0501266_009757
1759 Ga0501268_041375
1760 Ga0501273_000676
1761 Ga0501273_006751
1762 Ga0501278_002309
1763 Ga0501283_019013
1764 Ga0501212_024513
1765 Ga0501226_001347
1766 nmdc:mga05p37_1066236_c1
1767 nmdc:mga05p37_125124_c1
1768 nmdc:mga05p37_252218_c1
1769 nmdc:mga05p37_31687_c1
1770 nmdc:mga05p37_38485_c1
1771 nmdc:mga05p37_401847_c1
1772 nmdc:mga05p37_566621_c1
1773 nmdc:mga05p37_6284_c1
1774 nmdc:mga05p37_717386_c1
1775 nmdc:mga09592_285355_c1
1776 nmdc:mga09592_384497_c1
1777 nmdc:mga09592_38771_c1
1778 nmdc:mga08y16_171581_c1
1779 nmdc:mga08y16_18816_c1
1780 nmdc:mga08y16_27376_c1
1781 nmdc:mga08y16_92957_c1
1782 nmdc:mga0n895_183324_c1
1783 nmdc:mga0n895_41506_c1
1784 nmdc:mga0n895_43491_c1
1785 nmdc:mga0n895_488358_c1
1786 nmdc:mga08x19_9600_c1
1787 nmdc:mga0a205_10093_c1
1788 nmdc:mga0a205_168649_c1
1789 nmdc:mga0a205_226852_c1
1790 nmdc:mga0a205_269021_c1
1791 nmdc:mga0a205_734330_c1
1792 nmdc:mga0a205_89982_c1
1793 nmdc:mga0a205_9020_c1
1794 Ga0501084_0491502
1795 Ga0587073_0076639
1796 Ga0530510_0082574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03548

LolA

Outer membrane lipoprotein carrier protein LolA

97

238

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ki3-assembly4.cif.gz_L 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.8066 37 232
4ki3-assembly4.cif.gz_J 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.803 37 232
8chx-assembly1.cif.gz_B structure and function of lola from vibrio cholerae 0.7963 38 232
7arm-assembly1.cif.gz_A lolcde in complex with lipoprotein and lola 0.7932 35 232
4ki3-assembly4.cif.gz_L 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.7905 37 232
ID Description Score Start End Superfamily
af_Q58100_22_207_2.50.20.10 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.8199 35 233 2.50.20.10
af_Q58100_22_207_2.50.20.10 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7915 35 233 2.50.20.10
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7785 37 232 2.50.20.10
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7634 37 232 2.50.20.10
2yzyA00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.76 34 233 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A838RYD7-F1-model_v4 Outer-membrane lipoprotein carrier protein LolA 0.9175 87 233
AF-A0A7V9C3X5-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9133 18 233
AF-A0A838RYD7-F1-model_v4 Outer-membrane lipoprotein carrier protein LolA 0.9115 87 233
AF-A0A7V9C3X5-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9012 18 233
AF-A0A7C3HNL7-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.8997 30 233

Map