F485045

General Info

Members Datasets Scaffolds Average Seq Length
897 275 1794 331

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10293079|Ga0105238_102930791
Length 370
Sequence VSPDDDVSVPVRALSMLTAYRNIAHRPSASIVRQKCGEIGASLMSVHLVFLGCGFITAVHSRHMKALRGDISCSYASRDRDRAESFRRRFAGARSYGSYRDALDDPSVDAVVVAVPPNLHRGLALDALAAGKHVLVEKPAFPGIADYEAVREARDRARRVVLVGENDHYKPLAVALRRLLASGAIGQMVFAHFTTIARRFKTADDWRNDETVAGGDAFFEEGIHWLHIASSLGPAITSATGFRPSLSPEGPDRRAKSMLVAFRYDNGAVGSLYYSREVPSLLKGMRLSKIFGRDGVITFESNGLFILTRGSGLPRFTLPGFYDFRGYRAMYRDFLASMREGRAPEMSLERAMDDQRLMEQIYTTLGASGQ

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
188 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
189 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 1.11
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 6.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10293079 3300009551 Bacteria 1610
2 SwRhRL3b_contig_2627030 2162886006 Bacteria 1862
3 JGI24746J21847_1006848 3300001977 Unclassified 1753
4 JGI25406J46586_10001818 3300003203 Bacteria 10012
5 Ga0065704_10109728 3300005289 Bacteria 1997
6 Ga0065712_10000224 3300005290 Bacteria 41217
7 Ga0065712_10014822 3300005290 Bacteria 1923
8 Ga0065712_10111567 3300005290 Bacteria 1815
9 Ga0065715_10089748 3300005293 Bacteria 8623
10 Ga0065715_10095099 3300005293 Bacteria 4166
11 Ga0065715_10100902 3300005293 Bacteria 3257
12 Ga0065715_10194936 3300005293 Bacteria 1393
13 Ga0065707_10084845 3300005295 Bacteria 6719
14 Ga0065707_10085296 3300005295 Bacteria 6277
15 Ga0065707_10106567 3300005295 Bacteria 2590
16 Ga0070676_10003279 3300005328 Bacteria 8409
17 Ga0070676_10266000 3300005328 Bacteria 1150
18 Ga0070683_100025954 3300005329 Bacteria 5269
19 Ga0070683_100072301 3300005329 Bacteria 3219
20 Ga0070683_100112916 3300005329 Bacteria 2564
21 Ga0070690_100012450 3300005330 Bacteria 5004
22 Ga0070690_100054104 3300005330 Unclassified 2569
23 Ga0070690_100094305 3300005330 Bacteria 1975
24 Ga0070690_100104685 3300005330 Bacteria 1880
25 Ga0070670_100009563 3300005331 Bacteria 8274
26 Ga0070670_100014335 3300005331 Bacteria 6801
27 Ga0070670_100155658 3300005331 Bacteria 1979
28 Ga0070670_100251574 3300005331 Bacteria 1539
29 Ga0070677_10033017 3300005333 Bacteria 1990
30 Ga0070677_10037624 3300005333 Bacteria 1888
31 Ga0068869_100000164 3300005334 Bacteria 33044
32 Ga0068869_100008941 3300005334 Bacteria 6483
33 Ga0068869_100015465 3300005334 Bacteria 5120
34 Ga0068869_100029311 3300005334 Bacteria 3855
35 Ga0070666_10007377 3300005335 Bacteria 6774
36 Ga0070666_10228463 3300005335 Bacteria 1314
37 Ga0070680_100058419 3300005336 Bacteria 3154
38 Ga0070680_100136562 3300005336 Bacteria 2055
39 Ga0070680_100215102 3300005336 Bacteria 1622
40 Ga0068868_100009781 3300005338 Bacteria 6919
41 Ga0070660_100037008 3300005339 Bacteria 3698
42 Ga0070689_100031008 3300005340 Unclassified 4061
43 Ga0070689_100046202 3300005340 Bacteria 3354
44 Ga0070689_100049309 3300005340 Bacteria 3250
45 Ga0070691_10088815 3300005341 Bacteria 1522
46 Ga0070687_100010934 3300005343 Bacteria 3950
47 Ga0070687_100021280 3300005343 Bacteria 3045
48 Ga0070661_100198264 3300005344 Unclassified 1533
49 Ga0070692_10127785 3300005345 Bacteria 1425
50 Ga0070669_100005961 3300005353 Bacteria 8792
51 Ga0070669_100011092 3300005353 Bacteria 6396
52 Ga0070669_100011765 3300005353 Bacteria 6209
53 Ga0070669_100014192 3300005353 Bacteria 5668
54 Ga0070669_100014834 3300005353 Bacteria 5550
55 Ga0070669_100036572 3300005353 Bacteria 3558
56 Ga0070675_100004100 3300005354 Bacteria 11064
57 Ga0070675_100016054 3300005354 Bacteria 5934
58 Ga0070675_100020870 3300005354 Bacteria 5229
59 Ga0070675_100059848 3300005354 Bacteria 3143
60 Ga0070675_100076844 3300005354 Bacteria 2778
61 Ga0070675_100085504 3300005354 Bacteria 2635
62 Ga0070675_100095659 3300005354 Bacteria 2494
63 Ga0070675_100097942 3300005354 Unclassified 2466
64 Ga0070675_100122882 3300005354 Bacteria 2207
65 Ga0070675_100124900 3300005354 Bacteria 2189
66 Ga0070675_100138878 3300005354 Unclassified 2076
67 Ga0070671_100026865 3300005355 Bacteria 4735
68 Ga0070671_100078200 3300005355 Bacteria 2765
69 Ga0070671_100081468 3300005355 Bacteria 2706
70 Ga0070674_100001822 3300005356 Bacteria 11565
71 Ga0070674_100013956 3300005356 Bacteria 4981
72 Ga0070674_100054230 3300005356 Bacteria 2772
73 Ga0070674_100079626 3300005356 Bacteria 2338
74 Ga0070674_100193990 3300005356 Bacteria 1564
75 Ga0070674_100235139 3300005356 Bacteria 1432
76 Ga0070673_100004892 3300005364 Bacteria 8529
77 Ga0070673_100005207 3300005364 Bacteria 8305
78 Ga0070673_100018730 3300005364 Bacteria 4955
79 Ga0070673_100021228 3300005364 Bacteria 4702
80 Ga0070673_100037411 3300005364 Bacteria 3697
81 Ga0070673_100050724 3300005364 Bacteria 3245
82 Ga0070673_100266778 3300005364 Bacteria 1497
83 Ga0070688_100024541 3300005365 Bacteria 3559
84 Ga0070688_100048929 3300005365 Bacteria 2629
85 Ga0070688_100069896 3300005365 Bacteria 2244
86 Ga0070688_100131802 3300005365 Bacteria 1687
87 Ga0070667_100273906 3300005367 Bacteria 1514
88 Ga0070709_10119145 3300005434 Bacteria 1786
89 Ga0070713_100226737 3300005436 Bacteria 1697
90 Ga0070701_10002667 3300005438 Bacteria 6917
91 Ga0070701_10017957 3300005438 Bacteria 3317
92 Ga0070701_10031398 3300005438 Bacteria 2636
93 Ga0070701_10043275 3300005438 Bacteria 2303
94 Ga0070701_10056965 3300005438 Bacteria 2047
95 Ga0070705_100000480 3300005440 Bacteria 23036
96 Ga0070705_100111905 3300005440 Bacteria 1746
97 Ga0070700_100003057 3300005441 Bacteria 8570
98 Ga0070700_100003923 3300005441 Bacteria 7729
99 Ga0070700_100028947 3300005441 Bacteria 3300
100 Ga0070700_100045845 3300005441 Bacteria 2698
101 Ga0070700_100058319 3300005441 Bacteria 2425
102 Ga0070700_100093376 3300005441 Bacteria 1968
103 Ga0070694_100008652 3300005444 Bacteria 6234
104 Ga0070694_100018055 3300005444 Bacteria 4470
105 Ga0070694_100045543 3300005444 Bacteria 2940
106 Ga0070694_100155020 3300005444 Bacteria 1676
107 Ga0070663_100067586 3300005455 Bacteria 2593
108 Ga0070678_100015130 3300005456 Bacteria 4893
109 Ga0070678_100085576 3300005456 Bacteria 2403
110 Ga0070678_100096881 3300005456 Bacteria 2277
111 Ga0070662_100022569 3300005457 Bacteria 4310
112 Ga0070681_10011456 3300005458 Bacteria 8776
113 Ga0070681_10247920 3300005458 Bacteria 1694
114 Ga0068867_100000602 3300005459 Bacteria 23814
115 Ga0068867_100023276 3300005459 Bacteria 4434
116 Ga0068867_100123234 3300005459 Bacteria 2005
117 Ga0068867_100148675 3300005459 Bacteria 1838
118 Ga0068867_100260693 3300005459 Bacteria 1413
119 Ga0070685_10012395 3300005466 Unclassified 4479
120 Ga0070685_10073285 3300005466 Bacteria 2035
121 Ga0070698_100000065 3300005471 Bacteria 77879
122 Ga0070698_100058441 3300005471 Bacteria 3899
123 Ga0070698_100282657 3300005471 Bacteria 1591
124 Ga0070699_100005699 3300005518 Bacteria 10906
125 Ga0070699_100085764 3300005518 Bacteria 2748
126 Ga0070679_100097975 3300005530 Bacteria 2920
127 Ga0070684_100004023 3300005535 Bacteria 11122
128 Ga0070684_100006285 3300005535 Bacteria 9177
129 Ga0070684_100067068 3300005535 Bacteria 3151
130 Ga0070697_100214874 3300005536 Bacteria 1638
131 Ga0070697_100275637 3300005536 Bacteria 1442
132 Ga0070672_100005801 3300005543 Bacteria 8236
133 Ga0070672_100006260 3300005543 Bacteria 7975
134 Ga0070672_100077253 3300005543 Bacteria 2662
135 Ga0070672_100099884 3300005543 Bacteria 2353
136 Ga0070672_100289528 3300005543 Bacteria 1386
137 Ga0070686_100007899 3300005544 Bacteria 5948
138 Ga0070686_100029128 3300005544 Bacteria 3355
139 Ga0070686_100165841 3300005544 Bacteria 1558
140 Ga0070695_100000291 3300005545 Bacteria 25256
141 Ga0070695_100216352 3300005545 Bacteria 1378
142 Ga0070696_100000658 3300005546 Bacteria 22113
143 Ga0070696_100009484 3300005546 Bacteria 6519
144 Ga0070696_100017656 3300005546 Bacteria 4818
145 Ga0070693_100021199 3300005547 Bacteria 3440
146 Ga0070693_100024736 3300005547 Unclassified 3224
147 Ga0070665_100112374 3300005548 Bacteria 2727
148 Ga0070704_100082720 3300005549 Bacteria 2368
149 Ga0070704_100097593 3300005549 Bacteria 2205
150 Ga0070704_100208236 3300005549 Unclassified 1583
151 Ga0070664_100000978 3300005564 Bacteria 22369
152 Ga0070664_100006259 3300005564 Bacteria 9613
153 Ga0070664_100007251 3300005564 Bacteria 8938
154 Ga0070664_100026422 3300005564 Bacteria 4815
155 Ga0070664_100190995 3300005564 Bacteria 1825
156 Ga0068857_100007575 3300005577 Bacteria 9344
157 Ga0068857_100284593 3300005577 Bacteria 1521
158 Ga0068854_100006198 3300005578 Bacteria 7594
159 Ga0068854_100014989 3300005578 Bacteria 5123
160 Ga0068854_100283766 3300005578 Unclassified 1334
161 Ga0068856_100077925 3300005614 Bacteria 3285
162 Ga0070702_100066314 3300005615 Bacteria 2116
163 Ga0068852_100118915 3300005616 Bacteria 2415
164 Ga0068852_100554477 3300005616 Bacteria 1150
165 Ga0068859_100002800 3300005617 Bacteria 17665
166 Ga0068859_100011240 3300005617 Bacteria 9006
167 Ga0068859_100013737 3300005617 Bacteria 8118
168 Ga0068859_100072621 3300005617 Bacteria 3478
169 Ga0068859_100226121 3300005617 Bacteria 1959
170 Ga0068859_100278746 3300005617 Bacteria 1764
171 Ga0068859_100457025 3300005617 Bacteria 1373
172 Ga0068864_100019150 3300005618 Bacteria 5722
173 Ga0068864_100039704 3300005618 Bacteria 4022
174 Ga0068864_100052637 3300005618 Bacteria 3509
175 Ga0068864_100109056 3300005618 Bacteria 2464
176 Ga0068864_100235909 3300005618 Unclassified 1693
177 Ga0068864_100242353 3300005618 Bacteria 1671
178 Ga0068864_100335130 3300005618 Bacteria 1424
179 Ga0068861_100013462 3300005719 Bacteria 5726
180 Ga0068861_100023591 3300005719 Unclassified 4439
181 Ga0068861_100038363 3300005719 Bacteria 3566
182 Ga0068861_100047052 3300005719 Bacteria 3255
183 Ga0068861_100211725 3300005719 Bacteria 1633
184 Ga0068870_10001407 3300005840 Bacteria 9706
185 Ga0068870_10004720 3300005840 Bacteria 5888
186 Ga0068870_10005437 3300005840 Bacteria 5565
187 Ga0068870_10057326 3300005840 Bacteria 2082
188 Ga0068870_10142815 3300005840 Bacteria 1402
189 Ga0068863_100001053 3300005841 Bacteria 27573
190 Ga0068863_100069840 3300005841 Bacteria 3321
191 Ga0068863_100169433 3300005841 Bacteria 2094
192 Ga0068858_100006389 3300005842 Bacteria 11485
193 Ga0068858_100030281 3300005842 Bacteria 5025
194 Ga0068858_100031784 3300005842 Unclassified 4906
195 Ga0068858_100057907 3300005842 Bacteria 3581
196 Ga0068858_100279455 3300005842 Bacteria 1590
197 Ga0068860_100036645 3300005843 Bacteria 4699
198 Ga0068860_100047203 3300005843 Bacteria 4105
199 Ga0068860_100069469 3300005843 Bacteria 3348
200 Ga0068860_100097897 3300005843 Bacteria 2797
201 Ga0068862_100000329 3300005844 Bacteria 51684
202 Ga0068862_100001825 3300005844 Bacteria 19302
203 Ga0068862_100089183 3300005844 Bacteria 2684
204 Ga0068862_100153499 3300005844 Bacteria 2051
205 Ga0081539_10000071 3300005985 Bacteria 233094
206 Ga0081539_10000112 3300005985 Bacteria 190218
207 Ga0081539_10000381 3300005985 Bacteria 96399
208 Ga0081539_10008388 3300005985 Bacteria 9017
209 Ga0075365_10058327 3300006038 Bacteria 2570
210 Ga0075368_10006392 3300006042 Bacteria 4112
211 Ga0075364_10195225 3300006051 Bacteria 1371
212 Ga0075432_10026868 3300006058 Unclassified 1979
213 Ga0075362_10009884 3300006177 Bacteria 3705
214 Ga0075367_10025202 3300006178 Bacteria 3361
215 Ga0075367_10040434 3300006178 Bacteria 2722
216 Ga0075366_10001741 3300006195 Bacteria 10946
217 Ga0075366_10008608 3300006195 Bacteria 5681
218 Ga0075366_10071308 3300006195 Bacteria 2070
219 Ga0097621_100160176 3300006237 Bacteria 1934
220 Ga0097621_100296833 3300006237 Bacteria 1426
221 Ga0075370_10002276 3300006353 Bacteria 8849
222 Ga0068871_100152699 3300006358 Bacteria 1970
223 Ga0068871_100171878 3300006358 Unclassified 1858
224 Ga0068871_100215861 3300006358 Bacteria 1661
225 Ga0068871_100236565 3300006358 Bacteria 1587
226 Ga0068871_100260704 3300006358 Bacteria 1512
227 Ga0075428_100001738 3300006844 Bacteria 23248
228 Ga0075428_100003729 3300006844 Bacteria 16708
229 Ga0075428_100008343 3300006844 Bacteria 11487
230 Ga0075428_100024750 3300006844 Bacteria 6642
231 Ga0075428_100046100 3300006844 Bacteria 4789
232 Ga0075428_100054950 3300006844 Bacteria 4363
233 Ga0075428_100272932 3300006844 Bacteria 1819
234 Ga0075428_100392468 3300006844 Bacteria 1487
235 Ga0075430_100000657 3300006846 Bacteria 26393
236 Ga0075430_100005358 3300006846 Bacteria 10835
237 Ga0075430_100007232 3300006846 Bacteria 9373
238 Ga0075430_100225142 3300006846 Bacteria 1556
239 Ga0075431_100000275 3300006847 Bacteria 39941
240 Ga0075431_100004051 3300006847 Bacteria 14281
241 Ga0075431_100014980 3300006847 Bacteria 7848
242 Ga0075431_100019814 3300006847 Bacteria 6868
243 Ga0075431_100033996 3300006847 Bacteria 5254
244 Ga0075431_100063568 3300006847 Bacteria 3809
245 Ga0075431_100159895 3300006847 Bacteria 2316
246 Ga0075431_100244342 3300006847 Unclassified 1825
247 Ga0075431_100260702 3300006847 Unclassified 1759
248 Ga0075431_100508078 3300006847 Bacteria 1196
249 Ga0075433_10000250 3300006852 Bacteria 31089
250 Ga0075433_10001162 3300006852 Bacteria 19120
251 Ga0075433_10002061 3300006852 Bacteria 15191
252 Ga0075433_10003337 3300006852 Bacteria 12403
253 Ga0075433_10066387 3300006852 Bacteria 3166
254 Ga0075433_10070556 3300006852 Bacteria 3071
255 Ga0075433_10097297 3300006852 Bacteria 2605
256 Ga0075433_10101726 3300006852 Bacteria 2545
257 Ga0075433_10134441 3300006852 Bacteria 2198
258 Ga0075433_10168035 3300006852 Bacteria 1952
259 Ga0075434_100000994 3300006871 Bacteria 22977
260 Ga0075434_100010564 3300006871 Bacteria 8663
261 Ga0075434_100017954 3300006871 Bacteria 6826
262 Ga0075434_100019301 3300006871 Bacteria 6596
263 Ga0075434_100083991 3300006871 Unclassified 3183
264 Ga0075434_100098700 3300006871 Bacteria 2926
265 Ga0075434_100113932 3300006871 Bacteria 2716
266 Ga0075434_100117813 3300006871 Bacteria 2669
267 Ga0075429_100000158 3300006880 Bacteria 42731
268 Ga0075429_100009296 3300006880 Bacteria 8532
269 Ga0075429_100013117 3300006880 Bacteria 7189
270 Ga0075429_100015725 3300006880 Bacteria 6555
271 Ga0075429_100034722 3300006880 Bacteria 4383
272 Ga0075429_100042741 3300006880 Bacteria 3943
273 Ga0075429_100121027 3300006880 Bacteria 2288
274 Ga0075429_100135640 3300006880 Unclassified 2154
275 Ga0075429_100149200 3300006880 Bacteria 2047
276 Ga0068865_100039555 3300006881 Unclassified 3199
277 Ga0097620_100002800 3300006931 Bacteria 17665
278 Ga0097620_100011240 3300006931 Bacteria 9006
279 Ga0097620_100013737 3300006931 Bacteria 8118
280 Ga0097620_100072621 3300006931 Bacteria 3478
281 Ga0097620_100226116 3300006931 Bacteria 1959
282 Ga0097620_100278755 3300006931 Bacteria 1764
283 Ga0097620_100457013 3300006931 Bacteria 1373
284 Ga0075435_100001534 3300007076 Bacteria 14875
285 Ga0075435_100023047 3300007076 Bacteria 4807
286 Ga0111539_10000005 3300009094 Bacteria 467342
287 Ga0111539_10000174 3300009094 Bacteria 74442
288 Ga0111539_10000574 3300009094 Bacteria 47151
289 Ga0111539_10000685 3300009094 Bacteria 43832
290 Ga0111539_10005222 3300009094 Bacteria 16820
291 Ga0111539_10032308 3300009094 Bacteria 6357
292 Ga0111539_10035251 3300009094 Bacteria 6060
293 Ga0111539_10035310 3300009094 Bacteria 6054
294 Ga0111539_10059129 3300009094 Bacteria 4546
295 Ga0111539_10092359 3300009094 Bacteria 3557
296 Ga0111539_10092919 3300009094 Bacteria 3544
297 Ga0111539_10107024 3300009094 Bacteria 3281
298 Ga0111539_10159899 3300009094 Bacteria 2635
299 Ga0111539_10228850 3300009094 Bacteria 2165
300 Ga0111539_10320040 3300009094 Bacteria 1805
301 Ga0111539_10599442 3300009094 Bacteria 1283
302 Ga0111539_10603498 3300009094 Bacteria 1278
303 Ga0111539_10671469 3300009094 Bacteria 1206
304 Ga0105245_10011620 3300009098 Bacteria 7667
305 Ga0114129_10000118 3300009147 Bacteria 79809
306 Ga0114129_10005768 3300009147 Bacteria 17540
307 Ga0114129_10006505 3300009147 Bacteria 16577
308 Ga0114129_10007613 3300009147 Bacteria 15412
309 Ga0114129_10008731 3300009147 Bacteria 14448
310 Ga0114129_10016429 3300009147 Bacteria 10534
311 Ga0114129_10017397 3300009147 Bacteria 10238
312 Ga0114129_10025128 3300009147 Bacteria 8443
313 Ga0114129_10027641 3300009147 Bacteria 8033
314 Ga0114129_10035839 3300009147 Bacteria 7006
315 Ga0114129_10042471 3300009147 Bacteria 6403
316 Ga0114129_10119199 3300009147 Bacteria 3635
317 Ga0114129_10161237 3300009147 Bacteria 3063
318 Ga0114129_10276280 3300009147 Bacteria 2246
319 Ga0114129_10280037 3300009147 Bacteria 2228
320 Ga0114129_10330004 3300009147 Bacteria 2026
321 Ga0114129_10430727 3300009147 Bacteria 1733
322 Ga0105243_10018566 3300009148 Bacteria 5270
323 Ga0105243_10103095 3300009148 Bacteria 2372
324 Ga0105243_10419685 3300009148 Unclassified 1247
325 Ga0105242_10039698 3300009176 Bacteria 3789
326 Ga0105242_10088838 3300009176 Unclassified 2597
327 Ga0105242_10100435 3300009176 Bacteria 2451
328 Ga0105248_10007300 3300009177 Bacteria 12126
329 Ga0105248_10446675 3300009177 Bacteria 1457
330 Ga0105238_10110199 3300009551 Bacteria 2734
331 Ga0105249_10009981 3300009553 Bacteria 8328
332 Ga0105249_10068922 3300009553 Bacteria 3263
333 Ga0105249_10082314 3300009553 Unclassified 2995
334 Ga0105249_10122478 3300009553 Bacteria 2473
335 Ga0105239_10140604 3300010375 Bacteria 2689
336 Ga0105246_10059940 3300011119 Bacteria 2643
337 Ga0105246_10128893 3300011119 Bacteria 1886
338 Ga0157369_10063772 3300013105 Bacteria 3969
339 Ga0157374_10181321 3300013296 Bacteria 2057
340 Ga0157374_10299498 3300013296 Bacteria 1591
341 Ga0157378_10045117 3300013297 Bacteria 3916
342 Ga0163162_10073919 3300013306 Bacteria 3466
343 Ga0157372_10045148 3300013307 Bacteria 4886
344 Ga0157372_10296483 3300013307 Bacteria 1881
345 Ga0157372_10413806 3300013307 Bacteria 1571
346 Ga0157375_10022294 3300013308 Bacteria 5827
347 Ga0157375_10048486 3300013308 Bacteria 4155
348 Ga0157375_10118263 3300013308 Bacteria 2757
349 Ga0157375_10160904 3300013308 Unclassified 2387
350 Ga0157375_10229782 3300013308 Bacteria 2014
351 Ga0163163_10018289 3300014325 Bacteria 6556
352 Ga0163163_10021696 3300014325 Bacteria 6065
353 Ga0163163_10037256 3300014325 Bacteria 4730
354 Ga0163163_10092328 3300014325 Bacteria 3042
355 Ga0163163_10137263 3300014325 Bacteria 2487
356 Ga0157380_10008708 3300014326 Bacteria 7251
357 Ga0157380_10009733 3300014326 Bacteria 6897
358 Ga0157380_10010942 3300014326 Bacteria 6542
359 Ga0157380_10013498 3300014326 Bacteria 5958
360 Ga0157380_10016847 3300014326 Bacteria 5396
361 Ga0157380_10038570 3300014326 Bacteria 3710
362 Ga0157380_10055963 3300014326 Bacteria 3135
363 Ga0157380_10060658 3300014326 Bacteria 3023
364 Ga0157380_10165260 3300014326 Bacteria 1928
365 Ga0157380_10253378 3300014326 Bacteria 1594
366 Ga0157380_10302436 3300014326 Bacteria 1474
367 Ga0157380_10339770 3300014326 Bacteria 1400
368 Ga0157377_10001749 3300014745 Bacteria 9465
369 Ga0157377_10008447 3300014745 Bacteria 5023
370 Ga0157377_10070290 3300014745 Bacteria 2022
371 Ga0157377_10119240 3300014745 Bacteria 1597
372 Ga0157379_10339505 3300014968 Bacteria 1374
373 Ga0157376_10086851 3300014969 Bacteria 2697
374 Ga0157376_10142885 3300014969 Bacteria 2149
375 Ga0157376_10176221 3300014969 Bacteria 1951
376 Ga0157376_10181195 3300014969 Bacteria 1926
377 Ga0163161_10021167 3300017792 Bacteria 4572
378 Ga0163161_10145992 3300017792 Unclassified 1794
379 Ga0206353_10784074 3300020082 Bacteria 3343
380 Ga0206353_11614262 3300020082 Bacteria 1660
381 Ga0207697_10002221 3300025315 Bacteria 10139
382 Ga0207697_10025418 3300025315 Unclassified 2420
383 Ga0207682_10002828 3300025893 Bacteria 7660
384 Ga0207682_10009124 3300025893 Unclassified 3919
385 Ga0207682_10019481 3300025893 Bacteria 2656
386 Ga0207682_10020685 3300025893 Bacteria 2584
387 Ga0207682_10037896 3300025893 Bacteria 1954
388 Ga0207642_10005801 3300025899 Bacteria 4059
389 Ga0207642_10100645 3300025899 Bacteria 1450
390 Ga0207688_10005474 3300025901 Bacteria 6904
391 Ga0207688_10008339 3300025901 Bacteria 5635
392 Ga0207688_10049763 3300025901 Bacteria 2343
393 Ga0207680_10015108 3300025903 Unclassified 4021
394 Ga0207680_10061082 3300025903 Bacteria 2297
395 Ga0207647_10046083 3300025904 Bacteria 2717
396 Ga0207645_10010524 3300025907 Bacteria 6352
397 Ga0207645_10027975 3300025907 Unclassified 3639
398 Ga0207645_10152974 3300025907 Bacteria 1506
399 Ga0207645_10231442 3300025907 Bacteria 1220
400 Ga0207645_10267544 3300025907 Bacteria 1133
401 Ga0207645_10272309 3300025907 Bacteria 1123
402 Ga0207643_10000313 3300025908 Bacteria 33506
403 Ga0207643_10006614 3300025908 Bacteria 6215
404 Ga0207643_10007720 3300025908 Bacteria 5780
405 Ga0207684_10184886 3300025910 Bacteria 1797
406 Ga0207684_10217581 3300025910 Bacteria 1648
407 Ga0207654_10049799 3300025911 Bacteria 2405
408 Ga0207707_10089748 3300025912 Bacteria 2686
409 Ga0207695_10085350 3300025913 Bacteria 3186
410 Ga0207660_10059277 3300025917 Bacteria 2748
411 Ga0207660_10205490 3300025917 Bacteria 1540
412 Ga0207660_10215210 3300025917 Bacteria 1506
413 Ga0207662_10012377 3300025918 Bacteria 4749
414 Ga0207657_10064982 3300025919 Bacteria 3112
415 Ga0207652_10257353 3300025921 Bacteria 1574
416 Ga0207646_10096265 3300025922 Bacteria 2652
417 Ga0207681_10001162 3300025923 Bacteria 16989
418 Ga0207681_10010139 3300025923 Bacteria 5768
419 Ga0207681_10038539 3300025923 Bacteria 3167
420 Ga0207681_10041502 3300025923 Bacteria 3068
421 Ga0207681_10045683 3300025923 Bacteria 2942
422 Ga0207681_10133845 3300025923 Bacteria 1836
423 Ga0207650_10006646 3300025925 Bacteria 7891
424 Ga0207650_10014299 3300025925 Bacteria 5515
425 Ga0207650_10018290 3300025925 Bacteria 4916
426 Ga0207650_10030262 3300025925 Bacteria 3898
427 Ga0207650_10079622 3300025925 Bacteria 2482
428 Ga0207650_10153987 3300025925 Bacteria 1817
429 Ga0207650_10174120 3300025925 Bacteria 1712
430 Ga0207659_10000069 3300025926 Bacteria 65505
431 Ga0207659_10003754 3300025926 Bacteria 9156
432 Ga0207659_10010127 3300025926 Bacteria 5911
433 Ga0207659_10017190 3300025926 Bacteria 4720
434 Ga0207659_10019468 3300025926 Bacteria 4470
435 Ga0207659_10020332 3300025926 Bacteria 4387
436 Ga0207659_10026533 3300025926 Unclassified 3910
437 Ga0207659_10060791 3300025926 Bacteria 2721
438 Ga0207659_10103865 3300025926 Bacteria 2148
439 Ga0207659_10209647 3300025926 Bacteria 1561
440 Ga0207687_10065027 3300025927 Bacteria 2589
441 Ga0207700_10342977 3300025928 Bacteria 1299
442 Ga0207664_10077546 3300025929 Bacteria 2692
443 Ga0207644_10041137 3300025931 Bacteria 3268
444 Ga0207644_10066500 3300025931 Bacteria 2625
445 Ga0207644_10102045 3300025931 Bacteria 2157
446 Ga0207644_10104842 3300025931 Bacteria 2129
447 Ga0207644_10133172 3300025931 Bacteria 1905
448 Ga0207644_10234067 3300025931 Bacteria 1461
449 Ga0207690_10077014 3300025932 Bacteria 2317
450 Ga0207706_10006256 3300025933 Bacteria 11067
451 Ga0207706_10052401 3300025933 Bacteria 3602
452 Ga0207706_10145761 3300025933 Bacteria 2083
453 Ga0207706_10346577 3300025933 Bacteria 1292
454 Ga0207706_10376282 3300025933 Bacteria 1233
455 Ga0207709_10047189 3300025935 Bacteria 2617
456 Ga0207670_10008145 3300025936 Bacteria 5899
457 Ga0207670_10029097 3300025936 Bacteria 3516
458 Ga0207669_10002269 3300025937 Bacteria 8185
459 Ga0207669_10033910 3300025937 Bacteria 2887
460 Ga0207669_10035605 3300025937 Bacteria 2835
461 Ga0207669_10040516 3300025937 Bacteria 2703
462 Ga0207669_10046556 3300025937 Bacteria 2564
463 Ga0207669_10095364 3300025937 Bacteria 1950
464 Ga0207669_10123520 3300025937 Unclassified 1763
465 Ga0207704_10054292 3300025938 Bacteria 2442
466 Ga0207704_10197081 3300025938 Bacteria 1470
467 Ga0207691_10002129 3300025940 Bacteria 19364
468 Ga0207691_10004493 3300025940 Bacteria 13502
469 Ga0207691_10007982 3300025940 Bacteria 10181
470 Ga0207691_10039435 3300025940 Bacteria 4370
471 Ga0207691_10063606 3300025940 Bacteria 3346
472 Ga0207691_10162980 3300025940 Bacteria 1955
473 Ga0207691_10170304 3300025940 Bacteria 1907
474 Ga0207711_10013579 3300025941 Bacteria 6764
475 Ga0207711_10068161 3300025941 Bacteria 3081
476 Ga0207711_10293028 3300025941 Bacteria 1500
477 Ga0207689_10003735 3300025942 Bacteria 13874
478 Ga0207689_10015936 3300025942 Bacteria 6363
479 Ga0207689_10036229 3300025942 Bacteria 4096
480 Ga0207661_10079734 3300025944 Bacteria 2699
481 Ga0207661_10254098 3300025944 Bacteria 1563
482 Ga0207679_10004277 3300025945 Bacteria 8869
483 Ga0207679_10233507 3300025945 Bacteria 1554
484 Ga0207667_10181529 3300025949 Bacteria 2161
485 Ga0207651_10006307 3300025960 Bacteria 6189
486 Ga0207651_10008306 3300025960 Bacteria 5601
487 Ga0207651_10022784 3300025960 Bacteria 3838
488 Ga0207651_10027563 3300025960 Bacteria 3569
489 Ga0207651_10051693 3300025960 Bacteria 2797
490 Ga0207651_10076604 3300025960 Bacteria 2391
491 Ga0207651_10089749 3300025960 Bacteria 2245
492 Ga0207651_10255294 3300025960 Bacteria 1436
493 Ga0207712_10017847 3300025961 Bacteria 4616
494 Ga0207712_10267471 3300025961 Bacteria 1389
495 Ga0207640_10013602 3300025981 Bacteria 4669
496 Ga0207658_10078217 3300025986 Bacteria 2527
497 Ga0207677_10084296 3300026023 Bacteria 2290
498 Ga0207677_10114372 3300026023 Bacteria 2016
499 Ga0207703_10002345 3300026035 Bacteria 16494
500 Ga0207703_10028164 3300026035 Unclassified 4426
501 Ga0207703_10257786 3300026035 Bacteria 1575
502 Ga0207678_10156234 3300026067 Bacteria 1948
503 Ga0207708_10002764 3300026075 Bacteria 12889
504 Ga0207708_10005736 3300026075 Bacteria 9177
505 Ga0207708_10006339 3300026075 Bacteria 8769
506 Ga0207708_10010105 3300026075 Bacteria 7008
507 Ga0207708_10027617 3300026075 Bacteria 4298
508 Ga0207708_10037570 3300026075 Unclassified 3689
509 Ga0207708_10066006 3300026075 Bacteria 2767
510 Ga0207708_10084269 3300026075 Bacteria 2444
511 Ga0207641_10030522 3300026088 Bacteria 4465
512 Ga0207641_10164722 3300026088 Bacteria 2018
513 Ga0207641_10391894 3300026088 Bacteria 1332
514 Ga0207648_10001714 3300026089 Bacteria 23992
515 Ga0207648_10013358 3300026089 Bacteria 7643
516 Ga0207648_10053312 3300026089 Bacteria 3535
517 Ga0207648_10055479 3300026089 Unclassified 3459
518 Ga0207648_10062163 3300026089 Bacteria 3256
519 Ga0207648_10099447 3300026089 Bacteria 2547
520 Ga0207648_10203415 3300026089 Bacteria 1757
521 Ga0207648_10382549 3300026089 Bacteria 1273
522 Ga0207676_10013471 3300026095 Bacteria 5874
523 Ga0207676_10062878 3300026095 Unclassified 2946
524 Ga0207676_10168210 3300026095 Bacteria 1907
525 Ga0207676_10193951 3300026095 Bacteria 1790
526 Ga0207676_10200858 3300026095 Bacteria 1761
527 Ga0207676_10214481 3300026095 Bacteria 1710
528 Ga0207676_10290661 3300026095 Bacteria 1488
529 Ga0207676_10311040 3300026095 Bacteria 1442
530 Ga0207676_10372638 3300026095 Bacteria 1327
531 Ga0207674_10005457 3300026116 Bacteria 15103
532 Ga0207674_10025977 3300026116 Bacteria 6232
533 Ga0207674_10087028 3300026116 Unclassified 3118
534 Ga0207674_10168173 3300026116 Bacteria 2146
535 Ga0207674_10291727 3300026116 Unclassified 1580
536 Ga0207675_100001185 3300026118 Bacteria 25972
537 Ga0207675_100068866 3300026118 Bacteria 3307
538 Ga0207675_100270129 3300026118 Bacteria 1650
539 Ga0207683_10022735 3300026121 Bacteria 5385
540 Ga0207683_10088605 3300026121 Bacteria 2754
541 Ga0207683_10113082 3300026121 Bacteria 2432
542 Ga0207683_10137320 3300026121 Bacteria 2201
543 Ga0207683_10190877 3300026121 Bacteria 1860
544 Ga0207683_10201254 3300026121 Bacteria 1810
545 Ga0207683_10240672 3300026121 Bacteria 1651
546 Ga0207698_10288860 3300026142 Bacteria 1521
547 Ga0209813_10057437 3300027866 Bacteria 1234
548 Ga0207428_10000039 3300027907 Bacteria 213218
549 Ga0207428_10000135 3300027907 Bacteria 99170
550 Ga0207428_10000771 3300027907 Bacteria 36418
551 Ga0207428_10001299 3300027907 Bacteria 26621
552 Ga0207428_10008659 3300027907 Bacteria 9187
553 Ga0207428_10023449 3300027907 Bacteria 5190
554 Ga0207428_10024098 3300027907 Bacteria 5110
555 Ga0207428_10028954 3300027907 Bacteria 4596
556 Ga0207428_10038791 3300027907 Bacteria 3870
557 Ga0207428_10100115 3300027907 Bacteria 2240
558 Ga0268265_10000669 3300028380 Bacteria 33991
559 Ga0268265_10033148 3300028380 Unclassified 3752
560 Ga0268264_10008991 3300028381 Bacteria 8289
561 Ga0268264_10017565 3300028381 Bacteria 5858
562 Ga0268264_10060207 3300028381 Bacteria 3182
563 Ga0307408_100008352 3300031548 Bacteria 6838
564 Ga0307408_100029716 3300031548 Bacteria 3789
565 Ga0307408_100069311 3300031548 Bacteria 2600
566 Ga0307408_100111867 3300031548 Bacteria 2099
567 Ga0307408_100289138 3300031548 Bacteria 1368
568 Ga0307405_10007529 3300031731 Bacteria 5452
569 Ga0307413_10002840 3300031824 Bacteria 7147
570 Ga0307413_10046394 3300031824 Bacteria 2583
571 Ga0307413_10113471 3300031824 Bacteria 1819
572 Ga0307410_10015073 3300031852 Bacteria 4573
573 Ga0307410_10100464 3300031852 Bacteria 2072
574 Ga0307410_10104524 3300031852 Bacteria 2036
575 Ga0307406_10072891 3300031901 Bacteria 2256
576 Ga0307407_10001638 3300031903 Bacteria 8281
577 Ga0307407_10002134 3300031903 Bacteria 7605
578 Ga0307407_10053906 3300031903 Bacteria 2316
579 Ga0307407_10249059 3300031903 Bacteria 1216
580 Ga0307412_10002016 3300031911 Bacteria 11274
581 Ga0307412_10013621 3300031911 Bacteria 4775
582 Ga0307412_10095686 3300031911 Bacteria 2088
583 Ga0307412_10170108 3300031911 Bacteria 1628
584 Ga0307412_10262922 3300031911 Bacteria 1346
585 Ga0307409_100010114 3300031995 Bacteria 5840
586 Ga0307409_100011771 3300031995 Bacteria 5537
587 Ga0307409_100262901 3300031995 Bacteria 1585
588 Ga0307416_100003225 3300032002 Bacteria 9557
589 Ga0307416_100025602 3300032002 Bacteria 4328
590 Ga0307416_100045414 3300032002 Bacteria 3459
591 Ga0307416_100086827 3300032002 Bacteria 2668
592 Ga0307416_100104312 3300032002 Bacteria 2478
593 Ga0307416_100183228 3300032002 Bacteria 1965
594 Ga0307416_100424079 3300032002 Bacteria 1375
595 Ga0307414_10041271 3300032004 Bacteria 3124
596 Ga0307414_10041356 3300032004 Bacteria 3122
597 Ga0307411_10007967 3300032005 Bacteria 5449
598 Ga0307411_10012818 3300032005 Bacteria 4595
599 Ga0307411_10194617 3300032005 Bacteria 1551
600 Ga0307415_100000965 3300032126 Bacteria 13202
601 Ga0307415_100155108 3300032126 Bacteria 1767
602 Ga0316583_10000566 3300032133 Bacteria 11223
603 Ga0373943_0033523 3300035170 Bacteria 2447
604 Ga0373943_0048804 3300035170 Bacteria 2075
605 Ga0373946_0037366 3300035171 Bacteria 1973
606 Ga0373962_0031288 3300035242 Bacteria 1459
607 Ga0373931_0116713 3300035691 Bacteria 1521
608 Ga0373937_0000658 3300036401 Bacteria 30316
609 Ga0373937_0158874 3300036401 Bacteria 2119
610 Ga0373925_0075684 3300037068 Bacteria 2551
611 Ga0373925_0192732 3300037068 Bacteria 1618
612 Ga0395898_0036074 3300037466 Bacteria 4912
613 Ga0395901_0232049 3300038443 Bacteria 1926
614 Ga0439453_0004641 3300041408 Bacteria 2051
615 Ga0439443_003016 3300042003 Bacteria 2080
616 Ga0450920_017124 3300042122 Bacteria 1384
617 Ga0450920_019516 3300042122 Bacteria 1302
618 Ga0439446_0038233 3300042156 Bacteria 1407
619 Ga0439446_0051880 3300042156 Bacteria 1226
620 Ga0439435_0001272 3300042436 Bacteria 4580
621 Ga0439435_0036719 3300042436 Bacteria 1355
622 Ga0439464_0002401 3300042439 Bacteria 4605
623 Ga0439464_0057968 3300042439 Bacteria 1130
624 Ga0439460_0016839 3300042461 Bacteria 1952
625 Ga0451577_0244023 3300042876 Bacteria 1625
626 Ga0466969_0013841 3300044656 Bacteria 4247
627 Ga0466961_0013832 3300044693 Bacteria 5171
628 Ga0466963_0108225 3300044694 Bacteria 1906
629 Ga0466957_0163472 3300044842 Bacteria 1447
630 Ga0466960_0005662 3300044901 Bacteria 4959
631 Ga0466959_0097535 3300045049 Bacteria 2106
632 Ga0451576_0067927 3300045051 Bacteria 3710
633 Ga0451576_0105738 3300045051 Bacteria 2928
634 Ga0451576_0136410 3300045051 Bacteria 2559
635 Ga0451576_0186122 3300045051 Bacteria 2168
636 Ga0451576_0315387 3300045051 Bacteria 1636
637 Ga0466967_0216855 3300045976 Bacteria 1817
638 Ga0495629_0026125 3300046459 Bacteria 4149
639 Ga0495629_0159757 3300046459 Bacteria 1566
640 Ga0495580_0171973 3300046472 Bacteria 1498
641 Ga0495639_0073584 3300046475 Bacteria 1582
642 Ga0495584_0152803 3300046491 Bacteria 1173
643 Ga0495642_0030430 3300046528 Unclassified 2159
644 Ga0495642_0048849 3300046528 Bacteria 1737
645 Ga0495598_0009732 3300046537 Unclassified 2282
646 Ga0495598_0017892 3300046537 Bacteria 1833
647 Ga0495598_0036071 3300046537 Bacteria 1419
648 Ga0495621_0004315 3300046539 Bacteria 3988
649 Ga0495621_0041316 3300046539 Bacteria 1619
650 Ga0495621_0077781 3300046539 Bacteria 1232
651 Ga0495621_0086641 3300046539 Bacteria 1175
652 Ga0495656_0114276 3300046615 Bacteria 1267
653 Ga0495656_0134196 3300046615 Bacteria 1181
654 Ga0495634_0204011 3300046642 Bacteria 1227
655 Ga0495659_0010652 3300046664 Bacteria 2956
656 Ga0495659_0013392 3300046664 Unclassified 2671
657 Ga0495658_0045868 3300046683 Bacteria 2455
658 Ga0495613_0118970 3300046689 Bacteria 1898
659 Ga0495636_0022450 3300047318 Bacteria 2550
660 Ga0495636_0032293 3300047318 Bacteria 2148
661 Ga0495684_0182978 3300047471 Unclassified 1553
662 Ga0496102_0121507 3300048905 Bacteria 2440
663 Ga0496104_0020073 3300048907 Bacteria 6121
664 Ga0496106_0021860 3300048909 Bacteria 4752
665 Ga0496108_0003333 3300048911 Bacteria 12902
666 Ga0496109_0002246 3300048912 Bacteria 16055
667 Ga0496109_0105464 3300048912 Bacteria 2617
668 Ga0496109_0389188 3300048912 Unclassified 1317
669 Ga0496110_0019663 3300048913 Bacteria 5688
670 Ga0496110_0167220 3300048913 Bacteria 1994
671 Ga0496112_0006815 3300048915 Bacteria 10071
672 Ga0501299_002654 3300049522 Bacteria 2497
673 Ga0501031_0016547 3300049568 Bacteria 4791
674 Ga0501031_0098234 3300049568 Bacteria 1911
675 Ga0501032_0000238 3300049569 Bacteria 45642
676 Ga0501032_0013296 3300049569 Bacteria 5859
677 Ga0501032_0073518 3300049569 Unclassified 2277
678 Ga0501032_0113710 3300049569 Bacteria 1790
679 Ga0501033_0000401 3300049570 Bacteria 41669
680 Ga0501033_0011050 3300049570 Bacteria 6911
681 Ga0501033_0033214 3300049570 Unclassified 3874
682 Ga0501034_0017129 3300049571 Bacteria 7434
683 Ga0501034_0032395 3300049571 Bacteria 5307
684 Ga0501034_0042867 3300049571 Bacteria 4580
685 Ga0501034_0153304 3300049571 Bacteria 2279
686 Ga0501036_0000929 3300049572 Bacteria 21971
687 Ga0501036_0005688 3300049572 Bacteria 10114
688 Ga0501036_0009729 3300049572 Bacteria 7916
689 Ga0501036_0026139 3300049572 Bacteria 4927
690 Ga0501036_0037224 3300049572 Bacteria 4116
691 Ga0501036_0159714 3300049572 Bacteria 1901
692 Ga0501036_0174181 3300049572 Bacteria 1812
693 Ga0501037_0000917 3300049573 Bacteria 21894
694 Ga0501037_0003947 3300049573 Bacteria 10758
695 Ga0501037_0033834 3300049573 Bacteria 3774
696 Ga0501037_0045756 3300049573 Unclassified 3211
697 Ga0501038_0014613 3300049574 Bacteria 7153
698 Ga0501038_0016100 3300049574 Bacteria 6788
699 Ga0501038_0016573 3300049574 Bacteria 6680
700 Ga0501038_0096378 3300049574 Bacteria 2470
701 Ga0501039_0005219 3300049575 Bacteria 9836
702 Ga0501039_0013177 3300049575 Bacteria 6319
703 Ga0501039_0026039 3300049575 Bacteria 4496
704 Ga0501039_0047618 3300049575 Bacteria 3314
705 Ga0501041_0223075 3300049577 Bacteria 1183
706 Ga0501042_0002600 3300049578 Bacteria 11099
707 Ga0501042_0014904 3300049578 Bacteria 5313
708 Ga0501042_0036162 3300049578 Bacteria 3504
709 Ga0501042_0056034 3300049578 Bacteria 2813
710 Ga0501042_0082101 3300049578 Bacteria 2311
711 Ga0501043_0006256 3300049579 Bacteria 9556
712 Ga0501043_0006646 3300049579 Bacteria 9251
713 Ga0501043_0013085 3300049579 Bacteria 6484
714 Ga0501043_0023740 3300049579 Bacteria 4810
715 Ga0501043_0145397 3300049579 Bacteria 1857
716 Ga0501046_0006740 3300049580 Bacteria 10142
717 Ga0501046_0058808 3300049580 Bacteria 3012
718 Ga0501047_0020624 3300049581 Bacteria 6328
719 Ga0501047_0021809 3300049581 Bacteria 6150
720 Ga0501047_0058819 3300049581 Unclassified 3712
721 Ga0501047_0167469 3300049581 Bacteria 2067
722 Ga0501047_0221453 3300049581 Bacteria 1748
723 Ga0501047_0252396 3300049581 Unclassified 1612
724 Ga0501048_0012018 3300049582 Bacteria 6451
725 Ga0501048_0020453 3300049582 Bacteria 4850
726 Ga0501048_0047865 3300049582 Unclassified 3050
727 Ga0501067_0001099 3300049583 Bacteria 14590
728 Ga0501067_0013093 3300049583 Bacteria 4591
729 Ga0501067_0035711 3300049583 Bacteria 2760
730 Ga0501067_0041555 3300049583 Bacteria 2553
731 Ga0501067_0060863 3300049583 Bacteria 2090
732 Ga0501068_0019353 3300049584 Unclassified 3952
733 Ga0501069_0001181 3300049585 Bacteria 12683
734 Ga0501069_0020521 3300049585 Bacteria 3580
735 Ga0501070_0003740 3300049586 Bacteria 13137
736 Ga0501070_0017240 3300049586 Bacteria 6064
737 Ga0501070_0030841 3300049586 Bacteria 4490
738 Ga0501070_0104435 3300049586 Bacteria 2343
739 Ga0501070_0376771 3300049586 Bacteria 1150
740 Ga0501071_0002110 3300049587 Bacteria 11931
741 Ga0501071_0037052 3300049587 Bacteria 3481
742 Ga0501071_0041664 3300049587 Bacteria 3288
743 Ga0501071_0164542 3300049587 Unclassified 1659
744 Ga0501071_0221733 3300049587 Unclassified 1423
745 Ga0501072_0036056 3300049588 Bacteria 3877
746 Ga0501072_0037951 3300049588 Bacteria 3780
747 Ga0501072_0148601 3300049588 Bacteria 1868
748 Ga0501072_0193022 3300049588 Bacteria 1624
749 Ga0501072_0309143 3300049588 Bacteria 1256
750 Ga0501073_0000317 3300049589 Bacteria 32076
751 Ga0501073_0001232 3300049589 Bacteria 18681
752 Ga0501073_0023642 3300049589 Bacteria 4410
753 Ga0501073_0057368 3300049589 Unclassified 2722
754 Ga0501074_0000434 3300049590 Bacteria 25006
755 Ga0501074_0014555 3300049590 Bacteria 5723
756 Ga0501074_0107863 3300049590 Bacteria 1993
757 Ga0501075_0002786 3300049591 Bacteria 11705
758 Ga0501075_0125777 3300049591 Bacteria 1952
759 Ga0501075_0138096 3300049591 Bacteria 1857
760 Ga0501075_0149270 3300049591 Bacteria 1782
761 Ga0501075_0348573 3300049591 Bacteria 1128
762 Ga0501076_0013580 3300049592 Bacteria 6109
763 Ga0501076_0054574 3300049592 Bacteria 3167
764 Ga0501076_0067509 3300049592 Bacteria 2856
765 Ga0501076_0079242 3300049592 Bacteria 2636
766 Ga0501076_0111241 3300049592 Bacteria 2214
767 Ga0501076_0126900 3300049592 Bacteria 2068
768 Ga0501076_0184396 3300049592 Bacteria 1702
769 Ga0501076_0367318 3300049592 Bacteria 1182
770 Ga0501077_0079977 3300049593 Bacteria 2071
771 Ga0501208_004452 3300049655 Bacteria 1652
772 Ga0501079_0000383 3300049741 Bacteria 28481
773 Ga0501079_0001580 3300049741 Bacteria 16186
774 Ga0501079_0014701 3300049741 Bacteria 5966
775 Ga0501079_0019689 3300049741 Bacteria 5154
776 Ga0501079_0057248 3300049741 Bacteria 3008
777 Ga0501079_0061547 3300049741 Bacteria 2896
778 Ga0501079_0100488 3300049741 Bacteria 2243
779 Ga0501079_0153968 3300049741 Bacteria 1792
780 Ga0501079_0294032 3300049741 Bacteria 1270
781 Ga0501080_0001278 3300049742 Bacteria 20899
782 Ga0501080_0008621 3300049742 Bacteria 9253
783 Ga0501080_0025447 3300049742 Bacteria 5493
784 Ga0501080_0054760 3300049742 Bacteria 3714
785 Ga0501080_0094475 3300049742 Bacteria 2777
786 Ga0501080_0160082 3300049742 Bacteria 2079
787 Ga0501081_0003674 3300049743 Bacteria 9822
788 Ga0501081_0024754 3300049743 Bacteria 4032
789 Ga0501081_0092419 3300049743 Bacteria 2129
790 Ga0501081_0116228 3300049743 Bacteria 1902
791 Ga0501035_0009381 3300049822 Bacteria 9097
792 Ga0501035_0028662 3300049822 Bacteria 5081
793 Ga0501035_0386933 3300049822 Bacteria 1166
794 Ga0501044_0030678 3300049823 Bacteria 5663
795 Ga0501044_0043300 3300049823 Bacteria 4677
796 Ga0501044_0120418 3300049823 Bacteria 2626
797 Ga0501044_0295446 3300049823 Bacteria 1550
798 Ga0501045_0032745 3300049824 Bacteria 3767
799 Ga0501045_0069627 3300049824 Unclassified 2587
800 Ga0501045_0071718 3300049824 Bacteria 2549
801 Ga0501045_0073611 3300049824 Bacteria 2516
802 nmdc:mga03683_17706_c1 3300050489 Bacteria 2701
803 nmdc:mga00v17_181844_c1 3300050491 Bacteria 1357
804 nmdc:mga00v17_64086_c1 3300050491 Bacteria 2265
805 nmdc:mga0k408_111324_c1 3300050493 Bacteria 1618
806 nmdc:mga0k408_4519_c1 3300050493 Bacteria 7384
807 nmdc:mga06z11_158571_c1 3300050494 Bacteria 1292
808 nmdc:mga07m45_46194_c1 3300050496 Bacteria 2446
809 nmdc:mga05p37_100573_c2 3300050507 Bacteria 1826
810 nmdc:mga05p37_1253_c1 3300050507 Bacteria 29454
811 nmdc:mga05p37_16996_c1 3300050507 Bacteria 8774
812 nmdc:mga05p37_210553_c1 3300050507 Bacteria 2350
813 nmdc:mga05p37_27781_c1 3300050507 Bacteria 6892
814 nmdc:mga05p37_2875_c1 3300050507 Bacteria 19989
815 nmdc:mga05p37_30_c1 3300050507 Bacteria 114300
816 nmdc:mga05p37_339947_c1 3300050507 Bacteria 1770
817 nmdc:mga05p37_397857_c1 3300050507 Bacteria 1609
818 nmdc:mga05p37_43958_c1 3300050507 Bacteria 5496
819 nmdc:mga05p37_450047_c1 3300050507 Bacteria 1491
820 nmdc:mga05p37_5569_c1 3300050507 Bacteria 14808
821 nmdc:mga05p37_68823_c1 3300050507 Bacteria 4353
822 nmdc:mga05p37_69995_c1 3300050507 Bacteria 4316
823 nmdc:mga05p37_90707_c1 3300050507 Bacteria 3766
824 nmdc:mga05p37_97270_c1 3300050507 Bacteria 3626
825 nmdc:mga09592_1343_c2 3300050508 Bacteria 11749
826 nmdc:mga09592_135173_c1 3300050508 Unclassified 2123
827 nmdc:mga09592_166652_c1 3300050508 Bacteria 1904
828 nmdc:mga09592_20644_c1 3300050508 Bacteria 5420
829 nmdc:mga09592_22778_c1 3300050508 Bacteria 5169
830 nmdc:mga09592_23459_c1 3300050508 Bacteria 5097
831 nmdc:mga09592_235084_c1 3300050508 Bacteria 1588
832 nmdc:mga09592_57833_c1 3300050508 Bacteria 3278
833 nmdc:mga0qj67_13049_c1 3300050509 Bacteria 6274
834 nmdc:mga0qj67_14806_c1 3300050509 Bacteria 5898
835 nmdc:mga0qj67_17279_c1 3300050509 Bacteria 5483
836 nmdc:mga0qj67_25363_c1 3300050509 Bacteria 4580
837 nmdc:mga0qj67_353348_c1 3300050509 Bacteria 1188
838 nmdc:mga0qj67_49758_c1 3300050509 Bacteria 3312
839 nmdc:mga0qj67_9467_c1 3300050509 Bacteria 7251
840 nmdc:mga06r32_131911_c1 3300050510 Bacteria 2471
841 nmdc:mga06r32_15344_c1 3300050510 Bacteria 6960
842 nmdc:mga06r32_191618_c1 3300050510 Bacteria 2032
843 nmdc:mga06r32_221012_c1 3300050510 Unclassified 1882
844 nmdc:mga06r32_30067_c1 3300050510 Bacteria 5095
845 nmdc:mga08y16_119710_c1 3300050511 Bacteria 2740
846 nmdc:mga08y16_16298_c1 3300050511 Bacteria 7815
847 nmdc:mga08y16_21168_c1 3300050511 Bacteria 6866
848 nmdc:mga08y16_26967_c1 3300050511 Bacteria 6055
849 nmdc:mga08y16_3256_c1 3300050511 Bacteria 16807
850 nmdc:mga08y16_4131_c1 3300050511 Bacteria 15153
851 nmdc:mga08y16_53199_c1 3300050511 Bacteria 4235
852 nmdc:mga08y16_55176_c1 3300050511 Bacteria 4153
853 nmdc:mga08y16_58750_c1 3300050511 Unclassified 4018
854 nmdc:mga08y16_65182_c1 3300050511 Bacteria 3803
855 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
856 nmdc:mga08y16_7878_c1 3300050511 Bacteria 11145
857 nmdc:mga08y16_80712_c1 3300050511 Bacteria 3391
858 nmdc:mga08y16_8160_c1 3300050511 Bacteria 10957
859 nmdc:mga08y16_9605_c1 3300050511 Bacteria 10158
860 nmdc:mga0n895_10877_c1 3300050512 Bacteria 8079
861 nmdc:mga0n895_115268_c1 3300050512 Bacteria 2705
862 nmdc:mga0n895_257755_c1 3300050512 Bacteria 1770
863 nmdc:mga0n895_33561_c1 3300050512 Bacteria 4934
864 nmdc:mga0n895_5357_c1 3300050512 Bacteria 10698
865 nmdc:mga0n895_71693_c1 3300050512 Bacteria 3436
866 nmdc:mga0n895_8209_c1 3300050512 Bacteria 9026
867 nmdc:mga0n895_97410_c1 3300050512 Bacteria 2947
868 nmdc:mga0rr50_14028_c1 3300050513 Bacteria 5239
869 nmdc:mga0rr50_167547_c1 3300050513 Bacteria 1787
870 nmdc:mga0rr50_331650_c1 3300050513 Bacteria 1277
871 nmdc:mga0rr50_7788_c1 3300050513 Bacteria 6638
872 nmdc:mga0a205_10878_c1 3300050515 Bacteria 8372
873 nmdc:mga0a205_11133_c2 3300050515 Bacteria 5960
874 nmdc:mga0a205_143712_c1 3300050515 Bacteria 2286
875 nmdc:mga0a205_178207_c1 3300050515 Bacteria 2020
876 nmdc:mga0a205_187776_c1 3300050515 Bacteria 1959
877 nmdc:mga0a205_2489_c1 3300050515 Bacteria 16239
878 nmdc:mga0a205_69123_c1 3300050515 Bacteria 2799
879 nmdc:mga0a205_7677_c1 3300050515 Bacteria 9785
880 nmdc:mga0a205_8842_c1 3300050515 Bacteria 9175
881 nmdc:mga0a205_93331_c1 3300050515 Bacteria 2908
882 Ga0495619_0108113 3300053085 Bacteria 1898
883 Ga0495619_0118321 3300053085 Bacteria 1815
884 Ga0495619_0322260 3300053085 Bacteria 1070
885 Ga0500555_009514 3300053103 Bacteria 2780
886 Ga0501084_0007989 3300054114 Bacteria 8711
887 Ga0501084_0063868 3300054114 Bacteria 3083
888 Ga0501084_0111332 3300054114 Bacteria 2301
889 Ga0501084_0251147 3300054114 Bacteria 1493
890 Ga0501084_0338394 3300054114 Bacteria 1271
891 Ga0501084_0391766 3300054114 Bacteria 1174
892 Ga0590075_014875 3300059424 Bacteria 1905
893 Ga0501082_0011211 3300060353 Bacteria 7702
894 Ga0501082_0023603 3300060353 Bacteria 5305
895 Ga0501082_0133598 3300060353 Bacteria 2153
896 Ga0501082_0144249 3300060353 Unclassified 2066
897 Ga0530510_0000588 3300061734 Bacteria 23387
898 Ga0105238_10293079
899 SwRhRL3b_contig_2627030
900 JGI24746J21847_1006848
901 JGI25406J46586_10001818
902 Ga0065704_10109728
903 Ga0065712_10000224
904 Ga0065712_10014822
905 Ga0065712_10111567
906 Ga0065715_10089748
907 Ga0065715_10095099
908 Ga0065715_10100902
909 Ga0065715_10194936
910 Ga0065707_10084845
911 Ga0065707_10085296
912 Ga0065707_10106567
913 Ga0070676_10003279
914 Ga0070676_10266000
915 Ga0070683_100025954
916 Ga0070683_100072301
917 Ga0070683_100112916
918 Ga0070690_100012450
919 Ga0070690_100054104
920 Ga0070690_100094305
921 Ga0070690_100104685
922 Ga0070670_100009563
923 Ga0070670_100014335
924 Ga0070670_100155658
925 Ga0070670_100251574
926 Ga0070677_10033017
927 Ga0070677_10037624
928 Ga0068869_100000164
929 Ga0068869_100008941
930 Ga0068869_100015465
931 Ga0068869_100029311
932 Ga0070666_10007377
933 Ga0070666_10228463
934 Ga0070680_100058419
935 Ga0070680_100136562
936 Ga0070680_100215102
937 Ga0068868_100009781
938 Ga0070660_100037008
939 Ga0070689_100031008
940 Ga0070689_100046202
941 Ga0070689_100049309
942 Ga0070691_10088815
943 Ga0070687_100010934
944 Ga0070687_100021280
945 Ga0070661_100198264
946 Ga0070692_10127785
947 Ga0070669_100005961
948 Ga0070669_100011092
949 Ga0070669_100011765
950 Ga0070669_100014192
951 Ga0070669_100014834
952 Ga0070669_100036572
953 Ga0070675_100004100
954 Ga0070675_100016054
955 Ga0070675_100020870
956 Ga0070675_100059848
957 Ga0070675_100076844
958 Ga0070675_100085504
959 Ga0070675_100095659
960 Ga0070675_100097942
961 Ga0070675_100122882
962 Ga0070675_100124900
963 Ga0070675_100138878
964 Ga0070671_100026865
965 Ga0070671_100078200
966 Ga0070671_100081468
967 Ga0070674_100001822
968 Ga0070674_100013956
969 Ga0070674_100054230
970 Ga0070674_100079626
971 Ga0070674_100193990
972 Ga0070674_100235139
973 Ga0070673_100004892
974 Ga0070673_100005207
975 Ga0070673_100018730
976 Ga0070673_100021228
977 Ga0070673_100037411
978 Ga0070673_100050724
979 Ga0070673_100266778
980 Ga0070688_100024541
981 Ga0070688_100048929
982 Ga0070688_100069896
983 Ga0070688_100131802
984 Ga0070667_100273906
985 Ga0070709_10119145
986 Ga0070713_100226737
987 Ga0070701_10002667
988 Ga0070701_10017957
989 Ga0070701_10031398
990 Ga0070701_10043275
991 Ga0070701_10056965
992 Ga0070705_100000480
993 Ga0070705_100111905
994 Ga0070700_100003057
995 Ga0070700_100003923
996 Ga0070700_100028947
997 Ga0070700_100045845
998 Ga0070700_100058319
999 Ga0070700_100093376
1000 Ga0070694_100008652
1001 Ga0070694_100018055
1002 Ga0070694_100045543
1003 Ga0070694_100155020
1004 Ga0070663_100067586
1005 Ga0070678_100015130
1006 Ga0070678_100085576
1007 Ga0070678_100096881
1008 Ga0070662_100022569
1009 Ga0070681_10011456
1010 Ga0070681_10247920
1011 Ga0068867_100000602
1012 Ga0068867_100023276
1013 Ga0068867_100123234
1014 Ga0068867_100148675
1015 Ga0068867_100260693
1016 Ga0070685_10012395
1017 Ga0070685_10073285
1018 Ga0070698_100000065
1019 Ga0070698_100058441
1020 Ga0070698_100282657
1021 Ga0070699_100005699
1022 Ga0070699_100085764
1023 Ga0070679_100097975
1024 Ga0070684_100004023
1025 Ga0070684_100006285
1026 Ga0070684_100067068
1027 Ga0070697_100214874
1028 Ga0070697_100275637
1029 Ga0070672_100005801
1030 Ga0070672_100006260
1031 Ga0070672_100077253
1032 Ga0070672_100099884
1033 Ga0070672_100289528
1034 Ga0070686_100007899
1035 Ga0070686_100029128
1036 Ga0070686_100165841
1037 Ga0070695_100000291
1038 Ga0070695_100216352
1039 Ga0070696_100000658
1040 Ga0070696_100009484
1041 Ga0070696_100017656
1042 Ga0070693_100021199
1043 Ga0070693_100024736
1044 Ga0070665_100112374
1045 Ga0070704_100082720
1046 Ga0070704_100097593
1047 Ga0070704_100208236
1048 Ga0070664_100000978
1049 Ga0070664_100006259
1050 Ga0070664_100007251
1051 Ga0070664_100026422
1052 Ga0070664_100190995
1053 Ga0068857_100007575
1054 Ga0068857_100284593
1055 Ga0068854_100006198
1056 Ga0068854_100014989
1057 Ga0068854_100283766
1058 Ga0068856_100077925
1059 Ga0070702_100066314
1060 Ga0068852_100118915
1061 Ga0068852_100554477
1062 Ga0068859_100002800
1063 Ga0068859_100011240
1064 Ga0068859_100013737
1065 Ga0068859_100072621
1066 Ga0068859_100226121
1067 Ga0068859_100278746
1068 Ga0068859_100457025
1069 Ga0068864_100019150
1070 Ga0068864_100039704
1071 Ga0068864_100052637
1072 Ga0068864_100109056
1073 Ga0068864_100235909
1074 Ga0068864_100242353
1075 Ga0068864_100335130
1076 Ga0068861_100013462
1077 Ga0068861_100023591
1078 Ga0068861_100038363
1079 Ga0068861_100047052
1080 Ga0068861_100211725
1081 Ga0068870_10001407
1082 Ga0068870_10004720
1083 Ga0068870_10005437
1084 Ga0068870_10057326
1085 Ga0068870_10142815
1086 Ga0068863_100001053
1087 Ga0068863_100069840
1088 Ga0068863_100169433
1089 Ga0068858_100006389
1090 Ga0068858_100030281
1091 Ga0068858_100031784
1092 Ga0068858_100057907
1093 Ga0068858_100279455
1094 Ga0068860_100036645
1095 Ga0068860_100047203
1096 Ga0068860_100069469
1097 Ga0068860_100097897
1098 Ga0068862_100000329
1099 Ga0068862_100001825
1100 Ga0068862_100089183
1101 Ga0068862_100153499
1102 Ga0081539_10000071
1103 Ga0081539_10000112
1104 Ga0081539_10000381
1105 Ga0081539_10008388
1106 Ga0075365_10058327
1107 Ga0075368_10006392
1108 Ga0075364_10195225
1109 Ga0075432_10026868
1110 Ga0075362_10009884
1111 Ga0075367_10025202
1112 Ga0075367_10040434
1113 Ga0075366_10001741
1114 Ga0075366_10008608
1115 Ga0075366_10071308
1116 Ga0097621_100160176
1117 Ga0097621_100296833
1118 Ga0075370_10002276
1119 Ga0068871_100152699
1120 Ga0068871_100171878
1121 Ga0068871_100215861
1122 Ga0068871_100236565
1123 Ga0068871_100260704
1124 Ga0075428_100001738
1125 Ga0075428_100003729
1126 Ga0075428_100008343
1127 Ga0075428_100024750
1128 Ga0075428_100046100
1129 Ga0075428_100054950
1130 Ga0075428_100272932
1131 Ga0075428_100392468
1132 Ga0075430_100000657
1133 Ga0075430_100005358
1134 Ga0075430_100007232
1135 Ga0075430_100225142
1136 Ga0075431_100000275
1137 Ga0075431_100004051
1138 Ga0075431_100014980
1139 Ga0075431_100019814
1140 Ga0075431_100033996
1141 Ga0075431_100063568
1142 Ga0075431_100159895
1143 Ga0075431_100244342
1144 Ga0075431_100260702
1145 Ga0075431_100508078
1146 Ga0075433_10000250
1147 Ga0075433_10001162
1148 Ga0075433_10002061
1149 Ga0075433_10003337
1150 Ga0075433_10066387
1151 Ga0075433_10070556
1152 Ga0075433_10097297
1153 Ga0075433_10101726
1154 Ga0075433_10134441
1155 Ga0075433_10168035
1156 Ga0075434_100000994
1157 Ga0075434_100010564
1158 Ga0075434_100017954
1159 Ga0075434_100019301
1160 Ga0075434_100083991
1161 Ga0075434_100098700
1162 Ga0075434_100113932
1163 Ga0075434_100117813
1164 Ga0075429_100000158
1165 Ga0075429_100009296
1166 Ga0075429_100013117
1167 Ga0075429_100015725
1168 Ga0075429_100034722
1169 Ga0075429_100042741
1170 Ga0075429_100121027
1171 Ga0075429_100135640
1172 Ga0075429_100149200
1173 Ga0068865_100039555
1174 Ga0097620_100002800
1175 Ga0097620_100011240
1176 Ga0097620_100013737
1177 Ga0097620_100072621
1178 Ga0097620_100226116
1179 Ga0097620_100278755
1180 Ga0097620_100457013
1181 Ga0075435_100001534
1182 Ga0075435_100023047
1183 Ga0111539_10000005
1184 Ga0111539_10000174
1185 Ga0111539_10000574
1186 Ga0111539_10000685
1187 Ga0111539_10005222
1188 Ga0111539_10032308
1189 Ga0111539_10035251
1190 Ga0111539_10035310
1191 Ga0111539_10059129
1192 Ga0111539_10092359
1193 Ga0111539_10092919
1194 Ga0111539_10107024
1195 Ga0111539_10159899
1196 Ga0111539_10228850
1197 Ga0111539_10320040
1198 Ga0111539_10599442
1199 Ga0111539_10603498
1200 Ga0111539_10671469
1201 Ga0105245_10011620
1202 Ga0114129_10000118
1203 Ga0114129_10005768
1204 Ga0114129_10006505
1205 Ga0114129_10007613
1206 Ga0114129_10008731
1207 Ga0114129_10016429
1208 Ga0114129_10017397
1209 Ga0114129_10025128
1210 Ga0114129_10027641
1211 Ga0114129_10035839
1212 Ga0114129_10042471
1213 Ga0114129_10119199
1214 Ga0114129_10161237
1215 Ga0114129_10276280
1216 Ga0114129_10280037
1217 Ga0114129_10330004
1218 Ga0114129_10430727
1219 Ga0105243_10018566
1220 Ga0105243_10103095
1221 Ga0105243_10419685
1222 Ga0105242_10039698
1223 Ga0105242_10088838
1224 Ga0105242_10100435
1225 Ga0105248_10007300
1226 Ga0105248_10446675
1227 Ga0105238_10110199
1228 Ga0105249_10009981
1229 Ga0105249_10068922
1230 Ga0105249_10082314
1231 Ga0105249_10122478
1232 Ga0105239_10140604
1233 Ga0105246_10059940
1234 Ga0105246_10128893
1235 Ga0157369_10063772
1236 Ga0157374_10181321
1237 Ga0157374_10299498
1238 Ga0157378_10045117
1239 Ga0163162_10073919
1240 Ga0157372_10045148
1241 Ga0157372_10296483
1242 Ga0157372_10413806
1243 Ga0157375_10022294
1244 Ga0157375_10048486
1245 Ga0157375_10118263
1246 Ga0157375_10160904
1247 Ga0157375_10229782
1248 Ga0163163_10018289
1249 Ga0163163_10021696
1250 Ga0163163_10037256
1251 Ga0163163_10092328
1252 Ga0163163_10137263
1253 Ga0157380_10008708
1254 Ga0157380_10009733
1255 Ga0157380_10010942
1256 Ga0157380_10013498
1257 Ga0157380_10016847
1258 Ga0157380_10038570
1259 Ga0157380_10055963
1260 Ga0157380_10060658
1261 Ga0157380_10165260
1262 Ga0157380_10253378
1263 Ga0157380_10302436
1264 Ga0157380_10339770
1265 Ga0157377_10001749
1266 Ga0157377_10008447
1267 Ga0157377_10070290
1268 Ga0157377_10119240
1269 Ga0157379_10339505
1270 Ga0157376_10086851
1271 Ga0157376_10142885
1272 Ga0157376_10176221
1273 Ga0157376_10181195
1274 Ga0163161_10021167
1275 Ga0163161_10145992
1276 Ga0206353_10784074
1277 Ga0206353_11614262
1278 Ga0207697_10002221
1279 Ga0207697_10025418
1280 Ga0207682_10002828
1281 Ga0207682_10009124
1282 Ga0207682_10019481
1283 Ga0207682_10020685
1284 Ga0207682_10037896
1285 Ga0207642_10005801
1286 Ga0207642_10100645
1287 Ga0207688_10005474
1288 Ga0207688_10008339
1289 Ga0207688_10049763
1290 Ga0207680_10015108
1291 Ga0207680_10061082
1292 Ga0207647_10046083
1293 Ga0207645_10010524
1294 Ga0207645_10027975
1295 Ga0207645_10152974
1296 Ga0207645_10231442
1297 Ga0207645_10267544
1298 Ga0207645_10272309
1299 Ga0207643_10000313
1300 Ga0207643_10006614
1301 Ga0207643_10007720
1302 Ga0207684_10184886
1303 Ga0207684_10217581
1304 Ga0207654_10049799
1305 Ga0207707_10089748
1306 Ga0207695_10085350
1307 Ga0207660_10059277
1308 Ga0207660_10205490
1309 Ga0207660_10215210
1310 Ga0207662_10012377
1311 Ga0207657_10064982
1312 Ga0207652_10257353
1313 Ga0207646_10096265
1314 Ga0207681_10001162
1315 Ga0207681_10010139
1316 Ga0207681_10038539
1317 Ga0207681_10041502
1318 Ga0207681_10045683
1319 Ga0207681_10133845
1320 Ga0207650_10006646
1321 Ga0207650_10014299
1322 Ga0207650_10018290
1323 Ga0207650_10030262
1324 Ga0207650_10079622
1325 Ga0207650_10153987
1326 Ga0207650_10174120
1327 Ga0207659_10000069
1328 Ga0207659_10003754
1329 Ga0207659_10010127
1330 Ga0207659_10017190
1331 Ga0207659_10019468
1332 Ga0207659_10020332
1333 Ga0207659_10026533
1334 Ga0207659_10060791
1335 Ga0207659_10103865
1336 Ga0207659_10209647
1337 Ga0207687_10065027
1338 Ga0207700_10342977
1339 Ga0207664_10077546
1340 Ga0207644_10041137
1341 Ga0207644_10066500
1342 Ga0207644_10102045
1343 Ga0207644_10104842
1344 Ga0207644_10133172
1345 Ga0207644_10234067
1346 Ga0207690_10077014
1347 Ga0207706_10006256
1348 Ga0207706_10052401
1349 Ga0207706_10145761
1350 Ga0207706_10346577
1351 Ga0207706_10376282
1352 Ga0207709_10047189
1353 Ga0207670_10008145
1354 Ga0207670_10029097
1355 Ga0207669_10002269
1356 Ga0207669_10033910
1357 Ga0207669_10035605
1358 Ga0207669_10040516
1359 Ga0207669_10046556
1360 Ga0207669_10095364
1361 Ga0207669_10123520
1362 Ga0207704_10054292
1363 Ga0207704_10197081
1364 Ga0207691_10002129
1365 Ga0207691_10004493
1366 Ga0207691_10007982
1367 Ga0207691_10039435
1368 Ga0207691_10063606
1369 Ga0207691_10162980
1370 Ga0207691_10170304
1371 Ga0207711_10013579
1372 Ga0207711_10068161
1373 Ga0207711_10293028
1374 Ga0207689_10003735
1375 Ga0207689_10015936
1376 Ga0207689_10036229
1377 Ga0207661_10079734
1378 Ga0207661_10254098
1379 Ga0207679_10004277
1380 Ga0207679_10233507
1381 Ga0207667_10181529
1382 Ga0207651_10006307
1383 Ga0207651_10008306
1384 Ga0207651_10022784
1385 Ga0207651_10027563
1386 Ga0207651_10051693
1387 Ga0207651_10076604
1388 Ga0207651_10089749
1389 Ga0207651_10255294
1390 Ga0207712_10017847
1391 Ga0207712_10267471
1392 Ga0207640_10013602
1393 Ga0207658_10078217
1394 Ga0207677_10084296
1395 Ga0207677_10114372
1396 Ga0207703_10002345
1397 Ga0207703_10028164
1398 Ga0207703_10257786
1399 Ga0207678_10156234
1400 Ga0207708_10002764
1401 Ga0207708_10005736
1402 Ga0207708_10006339
1403 Ga0207708_10010105
1404 Ga0207708_10027617
1405 Ga0207708_10037570
1406 Ga0207708_10066006
1407 Ga0207708_10084269
1408 Ga0207641_10030522
1409 Ga0207641_10164722
1410 Ga0207641_10391894
1411 Ga0207648_10001714
1412 Ga0207648_10013358
1413 Ga0207648_10053312
1414 Ga0207648_10055479
1415 Ga0207648_10062163
1416 Ga0207648_10099447
1417 Ga0207648_10203415
1418 Ga0207648_10382549
1419 Ga0207676_10013471
1420 Ga0207676_10062878
1421 Ga0207676_10168210
1422 Ga0207676_10193951
1423 Ga0207676_10200858
1424 Ga0207676_10214481
1425 Ga0207676_10290661
1426 Ga0207676_10311040
1427 Ga0207676_10372638
1428 Ga0207674_10005457
1429 Ga0207674_10025977
1430 Ga0207674_10087028
1431 Ga0207674_10168173
1432 Ga0207674_10291727
1433 Ga0207675_100001185
1434 Ga0207675_100068866
1435 Ga0207675_100270129
1436 Ga0207683_10022735
1437 Ga0207683_10088605
1438 Ga0207683_10113082
1439 Ga0207683_10137320
1440 Ga0207683_10190877
1441 Ga0207683_10201254
1442 Ga0207683_10240672
1443 Ga0207698_10288860
1444 Ga0209813_10057437
1445 Ga0207428_10000039
1446 Ga0207428_10000135
1447 Ga0207428_10000771
1448 Ga0207428_10001299
1449 Ga0207428_10008659
1450 Ga0207428_10023449
1451 Ga0207428_10024098
1452 Ga0207428_10028954
1453 Ga0207428_10038791
1454 Ga0207428_10100115
1455 Ga0268265_10000669
1456 Ga0268265_10033148
1457 Ga0268264_10008991
1458 Ga0268264_10017565
1459 Ga0268264_10060207
1460 Ga0307408_100008352
1461 Ga0307408_100029716
1462 Ga0307408_100069311
1463 Ga0307408_100111867
1464 Ga0307408_100289138
1465 Ga0307405_10007529
1466 Ga0307413_10002840
1467 Ga0307413_10046394
1468 Ga0307413_10113471
1469 Ga0307410_10015073
1470 Ga0307410_10100464
1471 Ga0307410_10104524
1472 Ga0307406_10072891
1473 Ga0307407_10001638
1474 Ga0307407_10002134
1475 Ga0307407_10053906
1476 Ga0307407_10249059
1477 Ga0307412_10002016
1478 Ga0307412_10013621
1479 Ga0307412_10095686
1480 Ga0307412_10170108
1481 Ga0307412_10262922
1482 Ga0307409_100010114
1483 Ga0307409_100011771
1484 Ga0307409_100262901
1485 Ga0307416_100003225
1486 Ga0307416_100025602
1487 Ga0307416_100045414
1488 Ga0307416_100086827
1489 Ga0307416_100104312
1490 Ga0307416_100183228
1491 Ga0307416_100424079
1492 Ga0307414_10041271
1493 Ga0307414_10041356
1494 Ga0307411_10007967
1495 Ga0307411_10012818
1496 Ga0307411_10194617
1497 Ga0307415_100000965
1498 Ga0307415_100155108
1499 Ga0316583_10000566
1500 Ga0373943_0033523
1501 Ga0373943_0048804
1502 Ga0373946_0037366
1503 Ga0373962_0031288
1504 Ga0373931_0116713
1505 Ga0373937_0000658
1506 Ga0373937_0158874
1507 Ga0373925_0075684
1508 Ga0373925_0192732
1509 Ga0395898_0036074
1510 Ga0395901_0232049
1511 Ga0439453_0004641
1512 Ga0439443_003016
1513 Ga0450920_017124
1514 Ga0450920_019516
1515 Ga0439446_0038233
1516 Ga0439446_0051880
1517 Ga0439435_0001272
1518 Ga0439435_0036719
1519 Ga0439464_0002401
1520 Ga0439464_0057968
1521 Ga0439460_0016839
1522 Ga0451577_0244023
1523 Ga0466969_0013841
1524 Ga0466961_0013832
1525 Ga0466963_0108225
1526 Ga0466957_0163472
1527 Ga0466960_0005662
1528 Ga0466959_0097535
1529 Ga0451576_0067927
1530 Ga0451576_0105738
1531 Ga0451576_0136410
1532 Ga0451576_0186122
1533 Ga0451576_0315387
1534 Ga0466967_0216855
1535 Ga0495629_0026125
1536 Ga0495629_0159757
1537 Ga0495580_0171973
1538 Ga0495639_0073584
1539 Ga0495584_0152803
1540 Ga0495642_0030430
1541 Ga0495642_0048849
1542 Ga0495598_0009732
1543 Ga0495598_0017892
1544 Ga0495598_0036071
1545 Ga0495621_0004315
1546 Ga0495621_0041316
1547 Ga0495621_0077781
1548 Ga0495621_0086641
1549 Ga0495656_0114276
1550 Ga0495656_0134196
1551 Ga0495634_0204011
1552 Ga0495659_0010652
1553 Ga0495659_0013392
1554 Ga0495658_0045868
1555 Ga0495613_0118970
1556 Ga0495636_0022450
1557 Ga0495636_0032293
1558 Ga0495684_0182978
1559 Ga0496102_0121507
1560 Ga0496104_0020073
1561 Ga0496106_0021860
1562 Ga0496108_0003333
1563 Ga0496109_0002246
1564 Ga0496109_0105464
1565 Ga0496109_0389188
1566 Ga0496110_0019663
1567 Ga0496110_0167220
1568 Ga0496112_0006815
1569 Ga0501299_002654
1570 Ga0501031_0016547
1571 Ga0501031_0098234
1572 Ga0501032_0000238
1573 Ga0501032_0013296
1574 Ga0501032_0073518
1575 Ga0501032_0113710
1576 Ga0501033_0000401
1577 Ga0501033_0011050
1578 Ga0501033_0033214
1579 Ga0501034_0017129
1580 Ga0501034_0032395
1581 Ga0501034_0042867
1582 Ga0501034_0153304
1583 Ga0501036_0000929
1584 Ga0501036_0005688
1585 Ga0501036_0009729
1586 Ga0501036_0026139
1587 Ga0501036_0037224
1588 Ga0501036_0159714
1589 Ga0501036_0174181
1590 Ga0501037_0000917
1591 Ga0501037_0003947
1592 Ga0501037_0033834
1593 Ga0501037_0045756
1594 Ga0501038_0014613
1595 Ga0501038_0016100
1596 Ga0501038_0016573
1597 Ga0501038_0096378
1598 Ga0501039_0005219
1599 Ga0501039_0013177
1600 Ga0501039_0026039
1601 Ga0501039_0047618
1602 Ga0501041_0223075
1603 Ga0501042_0002600
1604 Ga0501042_0014904
1605 Ga0501042_0036162
1606 Ga0501042_0056034
1607 Ga0501042_0082101
1608 Ga0501043_0006256
1609 Ga0501043_0006646
1610 Ga0501043_0013085
1611 Ga0501043_0023740
1612 Ga0501043_0145397
1613 Ga0501046_0006740
1614 Ga0501046_0058808
1615 Ga0501047_0020624
1616 Ga0501047_0021809
1617 Ga0501047_0058819
1618 Ga0501047_0167469
1619 Ga0501047_0221453
1620 Ga0501047_0252396
1621 Ga0501048_0012018
1622 Ga0501048_0020453
1623 Ga0501048_0047865
1624 Ga0501067_0001099
1625 Ga0501067_0013093
1626 Ga0501067_0035711
1627 Ga0501067_0041555
1628 Ga0501067_0060863
1629 Ga0501068_0019353
1630 Ga0501069_0001181
1631 Ga0501069_0020521
1632 Ga0501070_0003740
1633 Ga0501070_0017240
1634 Ga0501070_0030841
1635 Ga0501070_0104435
1636 Ga0501070_0376771
1637 Ga0501071_0002110
1638 Ga0501071_0037052
1639 Ga0501071_0041664
1640 Ga0501071_0164542
1641 Ga0501071_0221733
1642 Ga0501072_0036056
1643 Ga0501072_0037951
1644 Ga0501072_0148601
1645 Ga0501072_0193022
1646 Ga0501072_0309143
1647 Ga0501073_0000317
1648 Ga0501073_0001232
1649 Ga0501073_0023642
1650 Ga0501073_0057368
1651 Ga0501074_0000434
1652 Ga0501074_0014555
1653 Ga0501074_0107863
1654 Ga0501075_0002786
1655 Ga0501075_0125777
1656 Ga0501075_0138096
1657 Ga0501075_0149270
1658 Ga0501075_0348573
1659 Ga0501076_0013580
1660 Ga0501076_0054574
1661 Ga0501076_0067509
1662 Ga0501076_0079242
1663 Ga0501076_0111241
1664 Ga0501076_0126900
1665 Ga0501076_0184396
1666 Ga0501076_0367318
1667 Ga0501077_0079977
1668 Ga0501208_004452
1669 Ga0501079_0000383
1670 Ga0501079_0001580
1671 Ga0501079_0014701
1672 Ga0501079_0019689
1673 Ga0501079_0057248
1674 Ga0501079_0061547
1675 Ga0501079_0100488
1676 Ga0501079_0153968
1677 Ga0501079_0294032
1678 Ga0501080_0001278
1679 Ga0501080_0008621
1680 Ga0501080_0025447
1681 Ga0501080_0054760
1682 Ga0501080_0094475
1683 Ga0501080_0160082
1684 Ga0501081_0003674
1685 Ga0501081_0024754
1686 Ga0501081_0092419
1687 Ga0501081_0116228
1688 Ga0501035_0009381
1689 Ga0501035_0028662
1690 Ga0501035_0386933
1691 Ga0501044_0030678
1692 Ga0501044_0043300
1693 Ga0501044_0120418
1694 Ga0501044_0295446
1695 Ga0501045_0032745
1696 Ga0501045_0069627
1697 Ga0501045_0071718
1698 Ga0501045_0073611
1699 nmdc:mga03683_17706_c1
1700 nmdc:mga00v17_181844_c1
1701 nmdc:mga00v17_64086_c1
1702 nmdc:mga0k408_111324_c1
1703 nmdc:mga0k408_4519_c1
1704 nmdc:mga06z11_158571_c1
1705 nmdc:mga07m45_46194_c1
1706 nmdc:mga05p37_100573_c2
1707 nmdc:mga05p37_1253_c1
1708 nmdc:mga05p37_16996_c1
1709 nmdc:mga05p37_210553_c1
1710 nmdc:mga05p37_27781_c1
1711 nmdc:mga05p37_2875_c1
1712 nmdc:mga05p37_30_c1
1713 nmdc:mga05p37_339947_c1
1714 nmdc:mga05p37_397857_c1
1715 nmdc:mga05p37_43958_c1
1716 nmdc:mga05p37_450047_c1
1717 nmdc:mga05p37_5569_c1
1718 nmdc:mga05p37_68823_c1
1719 nmdc:mga05p37_69995_c1
1720 nmdc:mga05p37_90707_c1
1721 nmdc:mga05p37_97270_c1
1722 nmdc:mga09592_1343_c2
1723 nmdc:mga09592_135173_c1
1724 nmdc:mga09592_166652_c1
1725 nmdc:mga09592_20644_c1
1726 nmdc:mga09592_22778_c1
1727 nmdc:mga09592_23459_c1
1728 nmdc:mga09592_235084_c1
1729 nmdc:mga09592_57833_c1
1730 nmdc:mga0qj67_13049_c1
1731 nmdc:mga0qj67_14806_c1
1732 nmdc:mga0qj67_17279_c1
1733 nmdc:mga0qj67_25363_c1
1734 nmdc:mga0qj67_353348_c1
1735 nmdc:mga0qj67_49758_c1
1736 nmdc:mga0qj67_9467_c1
1737 nmdc:mga06r32_131911_c1
1738 nmdc:mga06r32_15344_c1
1739 nmdc:mga06r32_191618_c1
1740 nmdc:mga06r32_221012_c1
1741 nmdc:mga06r32_30067_c1
1742 nmdc:mga08y16_119710_c1
1743 nmdc:mga08y16_16298_c1
1744 nmdc:mga08y16_21168_c1
1745 nmdc:mga08y16_26967_c1
1746 nmdc:mga08y16_3256_c1
1747 nmdc:mga08y16_4131_c1
1748 nmdc:mga08y16_53199_c1
1749 nmdc:mga08y16_55176_c1
1750 nmdc:mga08y16_58750_c1
1751 nmdc:mga08y16_65182_c1
1752 nmdc:mga08y16_6_c1
1753 nmdc:mga08y16_7878_c1
1754 nmdc:mga08y16_80712_c1
1755 nmdc:mga08y16_8160_c1
1756 nmdc:mga08y16_9605_c1
1757 nmdc:mga0n895_10877_c1
1758 nmdc:mga0n895_115268_c1
1759 nmdc:mga0n895_257755_c1
1760 nmdc:mga0n895_33561_c1
1761 nmdc:mga0n895_5357_c1
1762 nmdc:mga0n895_71693_c1
1763 nmdc:mga0n895_8209_c1
1764 nmdc:mga0n895_97410_c1
1765 nmdc:mga0rr50_14028_c1
1766 nmdc:mga0rr50_167547_c1
1767 nmdc:mga0rr50_331650_c1
1768 nmdc:mga0rr50_7788_c1
1769 nmdc:mga0a205_10878_c1
1770 nmdc:mga0a205_11133_c2
1771 nmdc:mga0a205_143712_c1
1772 nmdc:mga0a205_178207_c1
1773 nmdc:mga0a205_187776_c1
1774 nmdc:mga0a205_2489_c1
1775 nmdc:mga0a205_69123_c1
1776 nmdc:mga0a205_7677_c1
1777 nmdc:mga0a205_8842_c1
1778 nmdc:mga0a205_93331_c1
1779 Ga0495619_0108113
1780 Ga0495619_0118321
1781 Ga0495619_0322260
1782 Ga0500555_009514
1783 Ga0501084_0007989
1784 Ga0501084_0063868
1785 Ga0501084_0111332
1786 Ga0501084_0251147
1787 Ga0501084_0338394
1788 Ga0501084_0391766
1789 Ga0590075_014875
1790 Ga0501082_0011211
1791 Ga0501082_0023603
1792 Ga0501082_0133598
1793 Ga0501082_0144249
1794 Ga0530510_0000588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

46

165

0.91

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

177

364

0.9

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

173

298

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zh8-assembly1.cif.gz_B crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution 0.8856 5 325
3e9m-assembly2.cif.gz_C-2 crystal structure of an oxidoreductase from enterococcus faecalis 0.8823 5 324
1h6d-assembly3.cif.gz_I oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol 0.8792 6 328
4had-assembly1.cif.gz_D crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.8778 7 327
5a06-assembly1.cif.gz_C crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol 0.8776 7 330
ID Description Score Start End Superfamily
af_Q9VJH7_91_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9652 7 122 3.40.50.720
af_M9PE54_6_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9441 7 123 3.40.50.720
3rbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9428 5 125 3.40.50.720
af_D4A903_1_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9396 7 123 3.40.50.720
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9265 7 125 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2E4W3E9-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.966 6 325 GO:0000166
GO:0016491
AF-A0A3C0VKN9-F1-model_v4 Oxidoreductase 0.945 3 126 GO:0000166
AF-A0A2E4W3E9-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9346 6 325 GO:0000166
GO:0016491
AF-A0A3C0VKN9-F1-model_v4 Oxidoreductase 0.9305 3 126 GO:0000166
AF-A0A4V6KL50-F1-model_v4 1,5-anhydro-D-fructose reductase (EC 1.1.1.292) 0.9285 8 111 GO:0000166
GO:0033712

Map