F485033

General Info

Members Datasets Scaffolds Average Seq Length
896 714 369 212

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2881147464|2881154583
Length 237
Sequence ARIGEKSVLFVMAAEAEYGPHLKELFTPLMTGVGPVEAAVRLGAELATLKAEGALPDLVVSLGSAGSRTLEQTEIYQAVSVSYRDMDASPLGFEKGATPFLDLPVTVPLPFVIPGIKSATLSTGGAIVTGIAYDAIDADMVDMETFACLRACQLFGVPLVGLRGISDGAADLRHVGDWTEYLHVIDEKLAAAVGLLEQAIGGGLLDADCCPDQAARRCGSPKSMREMRPRTAPVASR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
10 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
13 2512875024 Mesorhizobium loti R88b Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
17 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
20 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
21 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
22 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
23 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
24 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
25 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
26 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
27 2534681786 Brucella suis 92/29 Isolate Unclassified
28 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
29 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
30 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
31 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
32 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
33 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
34 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
35 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
36 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
37 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
38 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
39 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
40 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
41 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
42 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
43 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
44 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
45 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
46 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
47 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
48 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
49 2643221557 Ensifer sp. Root558 Isolate Unclassified
50 2643221558 Rhizobium sp. Root149 Isolate Unclassified
51 2643221582 Rhizobium sp. Root651 Isolate Unclassified
52 2643221591 Devosia sp. Root685 Isolate Unclassified
53 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
54 2643221610 Ensifer sp. Root74 Isolate Unclassified
55 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
56 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
57 2643221668 Ensifer sp. Root423 Isolate Unclassified
58 2643221675 Ensifer sp. Root1298 Isolate Unclassified
59 2643221680 Ensifer sp. Root1312 Isolate Unclassified
60 2643221726 Ensifer sp. Root954 Isolate Unclassified
61 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
62 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
63 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
64 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
65 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
66 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
67 2738543024 Aminobacter sp. AP02 Isolate Unclassified
68 2751185800 Brucella pituitosa AA2 Isolate Unclassified
69 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
70 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
71 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
72 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
73 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
74 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
75 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
76 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
77 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
78 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
79 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
80 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
81 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
82 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
83 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
84 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
85 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
86 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
87 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
88 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
89 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
90 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
91 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
92 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
93 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
94 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
95 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
96 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
97 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
98 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
99 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
100 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
101 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
102 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
103 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
104 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
105 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
106 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
107 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
108 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
109 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
110 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
111 2854911287 Brucella lupini LUP21 Isolate Unclassified
112 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
113 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
114 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
115 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
116 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
117 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
118 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
119 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
120 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
121 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
122 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
123 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
124 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
125 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
126 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
127 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
128 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
129 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
130 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
131 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
132 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
133 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
134 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
135 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
136 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
137 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
138 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
139 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
140 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
141 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
142 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
143 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
144 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
145 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
146 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
147 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
148 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
149 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
150 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
151 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
152 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
153 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
154 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
155 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
156 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
157 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
158 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
159 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
160 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
161 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
162 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
163 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
164 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
165 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
166 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
167 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
168 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
169 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
170 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
171 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
172 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
173 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
174 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
175 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
176 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
177 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
178 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
179 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
180 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
181 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
182 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
183 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
184 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
185 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
186 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
187 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
188 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
189 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
190 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
191 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
192 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
193 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
194 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
195 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
196 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
197 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
198 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
199 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
200 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
201 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
202 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
203 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
204 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
205 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
206 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
207 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
208 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
209 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
210 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
211 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
212 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
213 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
214 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
215 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
216 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
217 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
218 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
219 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
220 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
221 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
222 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
223 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
224 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
225 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
226 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
227 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
228 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
229 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
230 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
231 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
232 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
233 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
234 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
235 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
236 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
237 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
238 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
239 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
240 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
241 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
242 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
243 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
244 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
245 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
246 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
247 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
248 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
249 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
250 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
251 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
252 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
253 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
254 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
255 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
256 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
257 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
258 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
259 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
260 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
261 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
262 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
263 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
264 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
265 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
266 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
267 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
268 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
269 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
270 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
271 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
272 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
273 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
274 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
275 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
276 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
277 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
278 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
279 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
280 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
281 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
282 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
283 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
284 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
285 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
286 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
287 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
288 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
289 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
290 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
291 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
292 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
293 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
294 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
295 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
296 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
297 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
298 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
299 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
300 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
301 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
302 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
303 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
304 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
305 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
306 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
307 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
308 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
309 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
310 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
311 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
312 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
313 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
314 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
315 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
316 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
317 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
318 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
319 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
320 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
321 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
322 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
323 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
324 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
325 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
326 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
327 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
328 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
329 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
330 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
331 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
332 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
333 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
334 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
335 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
336 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
337 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
338 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
339 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
340 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
341 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
342 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
343 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
344 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
345 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
346 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
347 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
348 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
349 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
350 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
351 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
352 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
353 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
354 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
355 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
356 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
357 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
358 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
359 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
360 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
361 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
362 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
363 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
364 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
365 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
366 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
367 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
368 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
369 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
370 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
371 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
372 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
373 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
374 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
375 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
376 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
377 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
378 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
379 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
380 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
381 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
382 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
383 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
384 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
385 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
386 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
387 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
388 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
389 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
390 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
391 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
392 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
393 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
394 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
395 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
396 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
397 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
398 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
399 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
400 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
401 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
402 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
403 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
404 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
405 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
406 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
407 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
408 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
409 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
410 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
411 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
412 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
413 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
414 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
415 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
416 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
417 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
418 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
419 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
420 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
421 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
422 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
423 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
424 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
425 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
426 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
427 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
428 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
429 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
430 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
431 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
432 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
433 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
434 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
435 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
436 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
437 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
438 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
439 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
440 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
441 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
442 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
443 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
444 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
445 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
446 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
447 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
448 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
449 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
450 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
451 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
452 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
453 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
454 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
455 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
456 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
457 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
458 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
459 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
460 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
461 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
462 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
463 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
464 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
465 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
466 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
467 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
468 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
469 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
470 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
471 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
472 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
473 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
474 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
475 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
476 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
477 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
478 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
479 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
480 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
481 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
482 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
483 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
484 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
485 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
486 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
487 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
488 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
489 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
490 3004167301 Mesorhizobium loti 582 Isolate Unclassified
491 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
492 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
493 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
494 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
495 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
496 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
497 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
498 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
499 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
500 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
501 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
502 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
503 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
504 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
505 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
506 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
507 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
508 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
509 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
510 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
511 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
512 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
513 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
514 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
515 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
516 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
517 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
518 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
519 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
520 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
521 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
522 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
523 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
524 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
525 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
526 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
527 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
528 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
529 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
530 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
531 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
532 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
533 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
534 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
535 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
536 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
537 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
538 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
539 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
540 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
541 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
542 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
543 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
544 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
545 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
546 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
547 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
548 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
549 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
550 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
551 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
552 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
553 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
554 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
555 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
556 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
557 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
558 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
559 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
560 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
561 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
562 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
563 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
564 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
565 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
566 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
567 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
568 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
570 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
572 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
573 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
574 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
575 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
576 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
582 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
584 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
585 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
586 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
588 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
589 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
590 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
591 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
592 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
594 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
595 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
596 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
597 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
598 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
599 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
600 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
601 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
602 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
603 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
604 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
605 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
606 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
607 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
608 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
609 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
610 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
611 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
612 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
613 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
614 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
615 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
616 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
617 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
618 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
619 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
620 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
621 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
622 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
623 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
624 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
625 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
626 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
627 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
628 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
629 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
630 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
631 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
632 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
633 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
634 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
635 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
636 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
637 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
638 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
639 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
640 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
641 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
642 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
643 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
644 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
645 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
646 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
647 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
648 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
649 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
650 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
651 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
652 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
653 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
654 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
655 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
656 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
657 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
658 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
659 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
660 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
661 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
662 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
663 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
664 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
665 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
666 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
667 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
668 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
669 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
670 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
671 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
672 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
673 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
674 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
675 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
676 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
677 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
678 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
679 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
680 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
681 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
682 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
683 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
684 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
685 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
686 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
687 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
688 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
689 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
690 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
691 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
692 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
693 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
694 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
695 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
696 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
697 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
698 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
699 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
700 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
701 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
702 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
703 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
704 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
705 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
706 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
707 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
708 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
709 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
710 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
711 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
712 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
713 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
714 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.07
Metatranscriptomes 0.11
Isolates 58.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 8.26
Nodule 50.45
Rhizoplane 1.23
Rhizosphere 27.9
Stem 0
Stem Tuber 0
Unclassified 11.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000604 3300001904 Bacteria 6567
2 JGI24740J21852_10005625 3300001979 Bacteria 5276
3 JGI24739J22299_10009416 3300001989 Bacteria 3640
4 JGI24737J22298_10021752 3300001990 Bacteria 2041
5 JGI24735J21928_10022976 3300002067 Bacteria 1893
6 JGI24738J21930_10000460 3300002075 Bacteria 11559
7 JGI25156J39149_1003677 3300002705 Bacteria 4926
8 JGI25157J39369_1000347 3300002741 Bacteria 32658
9 JGI25151J46595_10013540 3300003187 Bacteria 3666
10 JGI25165J46597_1000020 3300003214 Bacteria 370477
11 Ga0055542_1000516 3300003762 Bacteria 34984
12 Ga0055529_1001859 3300003763 Bacteria 4953
13 Ga0055524_1001144 3300003775 Bacteria 15980
14 Ga0055531_10010137 3300003794 Bacteria 4725
15 Ga0065707_10026222 3300005295 Bacteria 1598
16 Ga0070658_10027680 3300005327 Bacteria 4548
17 Ga0070661_100193526 3300005344 Bacteria 1551
18 Ga0070668_100226896 3300005347 Bacteria 1543
19 Ga0070668_100520382 3300005347 Bacteria 1032
20 Ga0070669_100254130 3300005353 Bacteria 1400
21 Ga0070674_100133706 3300005356 Bacteria 1853
22 Ga0070667_100155124 3300005367 Bacteria 2013
23 Ga0070663_100007173 3300005455 Bacteria 6770
24 Ga0070684_100774430 3300005535 Bacteria 896
25 Ga0068853_100046275 3300005539 Bacteria 3730
26 Ga0070665_100306506 3300005548 Bacteria 1591
27 Ga0070665_100310859 3300005548 Bacteria 1580
28 Ga0068855_100089250 3300005563 Bacteria 3559
29 Ga0068857_100346664 3300005577 Bacteria 1375
30 Ga0068857_100358512 3300005577 Bacteria 1351
31 Ga0068857_101062743 3300005577 Bacteria 781
32 Ga0068854_100171209 3300005578 Bacteria 1690
33 Ga0068856_100111381 3300005614 Bacteria 2734
34 Ga0068856_100186994 3300005614 Bacteria 2085
35 Ga0068852_100376932 3300005616 Bacteria 1391
36 Ga0068852_100617585 3300005616 Bacteria 1089
37 Ga0068851_10069493 3300005834 Bacteria 1819
38 Ga0075365_10001929 3300006038 Bacteria 9790
39 Ga0075365_10040892 3300006038 Bacteria 3025
40 Ga0075365_10043590 3300006038 Bacteria 2937
41 Ga0075365_10055747 3300006038 Bacteria 2625
42 Ga0075368_10044900 3300006042 Bacteria 1745
43 Ga0075364_10035265 3300006051 Bacteria 3233
44 Ga0075364_10039182 3300006051 Bacteria 3071
45 Ga0075362_10045337 3300006177 Bacteria 1952
46 Ga0075362_10305474 3300006177 Bacteria 790
47 Ga0075367_10004358 3300006178 Bacteria 6898
48 Ga0075367_10019011 3300006178 Bacteria 3802
49 Ga0075367_10039830 3300006178 Bacteria 2741
50 Ga0075367_10206281 3300006178 Bacteria 1228
51 Ga0075369_10005979 3300006186 Bacteria 4579
52 Ga0075369_10038049 3300006186 Bacteria 2051
53 Ga0075370_10230305 3300006353 Bacteria 1096
54 Ga0075370_10247450 3300006353 Bacteria 1056
55 Ga0079104_1004473 3300006946 Bacteria 5962
56 Ga0079104_1007226 3300006946 Bacteria 4064
57 Ga0099826_10009775 3300006948 Bacteria 7165
58 Ga0105240_10637479 3300009093 Bacteria 1169
59 Ga0105247_10406684 3300009101 Bacteria 971
60 Ga0105241_10291819 3300009174 Bacteria 1396
61 Ga0105237_10213315 3300009545 Bacteria 1930
62 Ga0105237_10244105 3300009545 Bacteria 1797
63 Ga0105238_10012176 3300009551 Bacteria 8671
64 Ga0105249_10518356 3300009553 Bacteria 1239
65 Ga0105239_10081120 3300010375 Bacteria 3570
66 Ga0105239_10222678 3300010375 Bacteria 2116
67 Ga0105239_10248558 3300010375 Bacteria 1997
68 Ga0105239_10361696 3300010375 Bacteria 1639
69 Ga0105239_11054413 3300010375 Bacteria 935
70 Ga0105246_10862399 3300011119 Bacteria 809
71 Ga0163163_10279239 3300014325 Bacteria 1722
72 Ga0157380_10763163 3300014326 Bacteria 980
73 Ga0182008_10049151 3300014497 Bacteria 2093
74 Ga0214544_1006450 3300021320 Bacteria 21631
75 Ga0214542_1000029 3300021321 Bacteria 174097
76 Ga0214542_1025934 3300021321 Bacteria 2958
77 Ga0214543_1000040 3300021327 Bacteria 174142
78 Ga0214543_1000049 3300021327 Bacteria 149506
79 Ga0228711_1003229 3300022739 Bacteria 25290
80 Ga0228710_1000004 3300022740 Bacteria 250560
81 Ga0209147_101667 3300025229 Bacteria 7306
82 Ga0209026_1000005 3300025250 Bacteria 731387
83 Ga0209148_1000078 3300025254 Bacteria 296101
84 Ga0209148_1024328 3300025254 Bacteria 957
85 Ga0209759_1000239 3300025256 Bacteria 81781
86 Ga0209233_1000047 3300025261 Bacteria 459614
87 Ga0209565_1015883 3300025263 Bacteria 1686
88 Ga0209455_1000194 3300025272 Bacteria 89837
89 Ga0209025_1000105 3300025294 Bacteria 224157
90 Ga0209025_1049819 3300025294 Bacteria 1681
91 Ga0209758_1018328 3300025297 Bacteria 3436
92 Ga0209758_1050254 3300025297 Bacteria 1464
93 Ga0209256_1000027 3300025299 Bacteria 423283
94 Ga0207656_10091644 3300025321 Bacteria 1380
95 Ga0207647_10017158 3300025904 Bacteria 4926
96 Ga0207647_10046213 3300025904 Bacteria 2714
97 Ga0207645_10236719 3300025907 Bacteria 1206
98 Ga0207705_10079956 3300025909 Bacteria 2381
99 Ga0207654_10161822 3300025911 Bacteria 1447
100 Ga0207695_10665938 3300025913 Bacteria 922
101 Ga0207671_10035087 3300025914 Bacteria 3725
102 Ga0207671_10103285 3300025914 Bacteria 2161
103 Ga0207657_10067581 3300025919 Bacteria 3039
104 Ga0207657_10253441 3300025919 Bacteria 1402
105 Ga0207694_10076577 3300025924 Bacteria 2620
106 Ga0207694_10123698 3300025924 Bacteria 2067
107 Ga0207690_10345533 3300025932 Bacteria 1175
108 Ga0207706_10076512 3300025933 Bacteria 2943
109 Ga0207669_10232391 3300025937 Bacteria 1361
110 Ga0207669_10558317 3300025937 Bacteria 925
111 Ga0207661_10371723 3300025944 Bacteria 1293
112 Ga0207639_10019079 3300026041 Bacteria 4883
113 Ga0207639_10028706 3300026041 Bacteria 4064
114 Ga0207639_10040125 3300026041 Bacteria 3492
115 Ga0207678_10128163 3300026067 Bacteria 2164
116 Ga0207702_10010044 3300026078 Bacteria 7936
117 Ga0207648_10153690 3300026089 Bacteria 2031
118 Ga0207674_10127654 3300026116 Bacteria 2508
119 Ga0207674_10174321 3300026116 Bacteria 2103
120 Ga0207683_10192707 3300026121 Bacteria 1851
121 Ga0207698_10148006 3300026142 Bacteria 2034
122 Ga0209281_1000134 3300027111 Bacteria 185406
123 Ga0209281_1000445 3300027111 Bacteria 59209
124 Ga0209371_1000009 3300027312 Bacteria 963030
125 Ga0209371_1001016 3300027312 Bacteria 21360
126 Ga0209282_1000029 3300027666 Bacteria 157883
127 Ga0209282_1025331 3300027666 Bacteria 3710
128 Ga0209813_10071784 3300027866 Bacteria 1127
129 Ga0268266_10039602 3300028379 Bacteria 4015
130 Ga0268266_10258402 3300028379 Bacteria 1613
131 Ga0307515_10000029 3300028794 Bacteria 365410
132 Ga0307515_10000277 3300028794 Bacteria 125765
133 Ga0307515_10005710 3300028794 Bacteria 25131
134 Ga0307515_10136809 3300028794 Bacteria 2657
135 Ga0268256_1000010 3300030500 Bacteria 963034
136 Ga0268256_1005318 3300030500 Bacteria 5090
137 Ga0307513_10003029 3300031456 Bacteria 22905
138 Ga0307408_100135017 3300031548 Bacteria 1929
139 Ga0307408_100425932 3300031548 Bacteria 1145
140 Ga0307410_10012335 3300031852 Bacteria 4938
141 Ga0307406_10043274 3300031901 Bacteria 2815
142 Ga0307406_10126124 3300031901 Bacteria 1789
143 Ga0307412_10090470 3300031911 Bacteria 2139
144 Ga0307412_10198393 3300031911 Bacteria 1522
145 Ga0307412_10350197 3300031911 Bacteria 1185
146 Ga0315914_1000004 3300031967 Bacteria 288534
147 Ga0307409_100247978 3300031995 Bacteria 1626
148 Ga0307416_100318575 3300032002 Bacteria 1556
149 Ga0307416_100413082 3300032002 Bacteria 1391
150 Ga0307416_100686042 3300032002 Bacteria 1112
151 Ga0307414_10230673 3300032004 Bacteria 1526
152 Ga0307414_10712960 3300032004 Bacteria 909
153 Ga0307411_10190578 3300032005 Bacteria 1565
154 Ga0315913_1000370 3300033430 Bacteria 38384
155 Ga0315915_1000003 3300033464 Bacteria 407996
156 Ga0373931_0160631 3300035691 Bacteria 1317
157 Ga0395900_0044321 3300037418 Bacteria 4584
158 Ga0395900_0373102 3300037418 Bacteria 1396
159 Ga0395900_0668407 3300037418 Bacteria 974
160 Ga0395898_0813450 3300037466 Bacteria 874
161 Ga0395905_0044744 3300037471 Bacteria 4153
162 Ga0395905_0047448 3300037471 Bacteria 4025
163 Ga0395905_0082924 3300037471 Bacteria 3004
164 Ga0395905_0172370 3300037471 Bacteria 2032
165 Ga0395905_0309335 3300037471 Bacteria 1468
166 Ga0395905_0746590 3300037471 Bacteria 881
167 Ga0395901_0055397 3300038443 Bacteria 4124
168 Ga0395901_0357364 3300038443 Bacteria 1507
169 Ga0395901_0377891 3300038443 Bacteria 1459
170 Ga0395901_0951536 3300038443 Bacteria 838
171 Ga0439465_0009030 3300041413 Bacteria 3142
172 Ga0439448_0120371 3300042005 Bacteria 901
173 Ga0450900_008873 3300042136 Bacteria 1265
174 Ga0466960_0018792 3300044901 Bacteria 3034
175 Ga0466967_0310148 3300045976 Bacteria 1520
176 Ga0495627_000757 3300046453 Bacteria 24076
177 Ga0495638_0006811 3300046460 Bacteria 8249
178 Ga0495638_0227171 3300046460 Bacteria 1040
179 Ga0495638_0291378 3300046460 Bacteria 883
180 Ga0495631_0123549 3300046518 Bacteria 1113
181 Ga0495668_0117288 3300046616 Bacteria 1456
182 Ga0495625_0025379 3300046660 Bacteria 4496
183 Ga0495625_0031385 3300046660 Bacteria 3953
184 Ga0495625_0078591 3300046660 Bacteria 2303
185 Ga0495588_0000559 3300046674 Bacteria 17899
186 Ga0495671_0013217 3300046692 Bacteria 4481
187 Ga0495681_0002200 3300047470 Bacteria 14067
188 Ga0495686_0213685 3300047472 Bacteria 1101
189 Ga0496102_0064051 3300048905 Bacteria 3367
190 Ga0496102_0410744 3300048905 Bacteria 1272
191 Ga0496109_0241754 3300048912 Bacteria 1699
192 Ga0496110_0213443 3300048913 Bacteria 1755
193 Ga0496111_0072083 3300048914 Bacteria 2514
194 Ga0496115_0212255 3300048918 Bacteria 1599
195 Ga0496116_0000026 3300048919 Bacteria 450803
196 Ga0496116_0016002 3300048919 Bacteria 5896
197 Ga0496118_0062119 3300048921 Bacteria 2761
198 Ga0496118_0134211 3300048921 Bacteria 1582
199 Ga0496119_0000827 3300048922 Bacteria 41250
200 Ga0496119_0049823 3300048922 Bacteria 2586
201 Ga0496120_0001220 3300048923 Bacteria 32486
202 Ga0496120_0041504 3300048923 Bacteria 2694
203 Ga0496121_0024486 3300048924 Bacteria 5769
204 Ga0496121_0451018 3300048924 Bacteria 829
205 Ga0496122_0001094 3300048925 Bacteria 46993
206 Ga0496122_0026504 3300048925 Bacteria 4994
207 Ga0496122_0083749 3300048925 Bacteria 2209
208 Ga0496122_0320707 3300048925 Bacteria 824
209 Ga0496123_0001198 3300048926 Bacteria 38067
210 Ga0496123_0134900 3300048926 Bacteria 1360
211 Ga0496124_0000083 3300048927 Bacteria 207798
212 Ga0496124_0095089 3300048927 Bacteria 2422
213 Ga0496124_0118629 3300048927 Bacteria 2118
214 Ga0496124_0530940 3300048927 Bacteria 781
215 Ga0496125_0000602 3300048928 Bacteria 61264
216 Ga0496125_0062487 3300048928 Bacteria 2977
217 Ga0496125_0079689 3300048928 Bacteria 2511
218 Ga0496125_0092750 3300048928 Bacteria 2256
219 Ga0496125_0183659 3300048928 Bacteria 1390
220 Ga0496125_0266816 3300048928 Bacteria 1069
221 Ga0496126_0000069 3300048929 Bacteria 246935
222 Ga0496126_0480828 3300048929 Bacteria 995
223 Ga0496126_0522218 3300048929 Bacteria 946
224 Ga0496126_0664556 3300048929 Bacteria 814
225 Ga0501031_0000003 3300049568 Bacteria 206821
226 Ga0501031_0110207 3300049568 Bacteria 1797
227 Ga0501031_0170555 3300049568 Bacteria 1422
228 Ga0501031_0205516 3300049568 Bacteria 1284
229 Ga0501031_0225275 3300049568 Bacteria 1220
230 Ga0501031_0227647 3300049568 Bacteria 1214
231 Ga0501031_0312302 3300049568 Bacteria 1018
232 Ga0501032_0000010 3300049569 Bacteria 206795
233 Ga0501032_0000546 3300049569 Bacteria 30501
234 Ga0501032_0038298 3300049569 Bacteria 3267
235 Ga0501032_0106271 3300049569 Bacteria 1859
236 Ga0501032_0433747 3300049569 Bacteria 842
237 Ga0501032_0433748 3300049569 Bacteria 842
238 Ga0501033_0000017 3300049570 Bacteria 206819
239 Ga0501033_0007011 3300049570 Bacteria 8799
240 Ga0501033_0075934 3300049570 Bacteria 2466
241 Ga0501033_0129466 3300049570 Bacteria 1829
242 Ga0501033_0160323 3300049570 Bacteria 1619
243 Ga0501033_0218163 3300049570 Bacteria 1358
244 Ga0501033_0498522 3300049570 Bacteria 842
245 Ga0501033_0498525 3300049570 Bacteria 842
246 Ga0501034_0000053 3300049571 Bacteria 206821
247 Ga0501034_0001507 3300049571 Bacteria 30558
248 Ga0501034_0137573 3300049571 Bacteria 2423
249 Ga0501034_0292788 3300049571 Bacteria 1565
250 Ga0501034_0371301 3300049571 Bacteria 1357
251 Ga0501034_0380632 3300049571 Bacteria 1336
252 Ga0501034_0477428 3300049571 Bacteria 1162
253 Ga0501034_0554374 3300049571 Bacteria 1058
254 Ga0501034_0789890 3300049571 Bacteria 842
255 Ga0501036_0000009 3300049572 Bacteria 206821
256 Ga0501036_0001029 3300049572 Bacteria 21072
257 Ga0501036_0145208 3300049572 Bacteria 2001
258 Ga0501036_0440654 3300049572 Bacteria 1085
259 Ga0501036_0692168 3300049572 Bacteria 842
260 Ga0501037_0000008 3300049573 Bacteria 206812
261 Ga0501037_0000838 3300049573 Bacteria 22953
262 Ga0501037_0029710 3300049573 Bacteria 4037
263 Ga0501037_0133871 3300049573 Bacteria 1776
264 Ga0501037_0278986 3300049573 Bacteria 1164
265 Ga0501038_0000008 3300049574 Bacteria 206821
266 Ga0501038_0002532 3300049574 Bacteria 17039
267 Ga0501038_0052723 3300049574 Bacteria 3506
268 Ga0501038_0588889 3300049574 Bacteria 842
269 Ga0501038_0588893 3300049574 Bacteria 842
270 Ga0501039_0000021 3300049575 Bacteria 162552
271 Ga0501039_0001378 3300049575 Bacteria 17825
272 Ga0501039_0081398 3300049575 Bacteria 2521
273 Ga0501039_0626571 3300049575 Bacteria 842
274 Ga0501040_0007087 3300049576 Bacteria 7265
275 Ga0501040_0240431 3300049576 Bacteria 1290
276 Ga0501043_0000043 3300049579 Bacteria 115410
277 Ga0501043_0000656 3300049579 Bacteria 30519
278 Ga0501043_0029929 3300049579 Bacteria 4277
279 Ga0501043_0044479 3300049579 Bacteria 3491
280 Ga0501043_0077343 3300049579 Bacteria 2614
281 Ga0501046_0074049 3300049580 Bacteria 2642
282 Ga0501046_0133477 3300049580 Bacteria 1881
283 Ga0501047_0004274 3300049581 Bacteria 13448
284 Ga0501047_0049899 3300049581 Bacteria 4040
285 Ga0501047_0111020 3300049581 Bacteria 2624
286 Ga0501047_0250744 3300049581 Bacteria 1619
287 Ga0501047_0693987 3300049581 Bacteria 835
288 Ga0501048_0008441 3300049582 Bacteria 7790
289 Ga0501048_0041326 3300049582 Bacteria 3303
290 Ga0501048_0142045 3300049582 Bacteria 1698
291 Ga0501068_0096943 3300049584 Bacteria 1824
292 Ga0501070_0007145 3300049586 Bacteria 9487
293 Ga0501070_0046063 3300049586 Bacteria 3626
294 Ga0501070_0510277 3300049586 Bacteria 965
295 Ga0501070_0670508 3300049586 Bacteria 822
296 Ga0501071_0071456 3300049587 Bacteria 2530
297 Ga0501071_0757966 3300049587 Unclassified 748
298 Ga0501072_0324716 3300049588 Bacteria 1223
299 Ga0501073_0039790 3300049589 Bacteria 3330
300 Ga0501073_0078669 3300049589 Bacteria 2295
301 Ga0501073_0102417 3300049589 Bacteria 1988
302 Ga0501074_0017395 3300049590 Bacteria 5216
303 Ga0501075_0011120 3300049591 Bacteria 6358
304 Ga0501079_0017789 3300049741 Bacteria 5431
305 Ga0501080_0040744 3300049742 Bacteria 4331
306 Ga0501080_0376960 3300049742 Bacteria 1279
307 Ga0501080_0530444 3300049742 Bacteria 1050
308 Ga0501083_0094228 3300049744 Bacteria 1977
309 Ga0501083_0216982 3300049744 Bacteria 1247
310 Ga0501035_0000023 3300049822 Bacteria 206821
311 Ga0501035_0000958 3300049822 Bacteria 30505
312 Ga0501035_0060685 3300049822 Bacteria 3366
313 Ga0501035_0082530 3300049822 Bacteria 2836
314 Ga0501035_0107342 3300049822 Bacteria 2448
315 Ga0501035_0196300 3300049822 Bacteria 1733
316 Ga0501035_0209854 3300049822 Bacteria 1666
317 Ga0501035_0337229 3300049822 Bacteria 1264
318 Ga0501035_0665820 3300049822 Bacteria 842
319 Ga0501035_0665824 3300049822 Bacteria 842
320 Ga0501044_0000021 3300049823 Bacteria 206821
321 Ga0501044_0018996 3300049823 Bacteria 7360
322 Ga0501044_0096604 3300049823 Bacteria 2976
323 Ga0501044_0224868 3300049823 Bacteria 1826
324 Ga0501044_0771201 3300049823 Bacteria 842
325 Ga0501044_0771202 3300049823 Bacteria 842
326 nmdc:mga03683_3508_c1 3300050489 Bacteria 4207
327 nmdc:mga03n38_222068_c1 3300050490 Bacteria 987
328 nmdc:mga03n38_24210_c1 3300050490 Bacteria 2480
329 nmdc:mga03n38_341903_c1 3300050490 Bacteria 812
330 nmdc:mga00v17_60381_c1 3300050491 Bacteria 2328
331 nmdc:mga0yw44_130983_c1 3300050492 Bacteria 1624
332 nmdc:mga0yw44_18598_c1 3300050492 Bacteria 3810
333 nmdc:mga0yw44_2158_c1 3300050492 Bacteria 8259
334 nmdc:mga0yw44_40990_c1 3300050492 Bacteria 2755
335 nmdc:mga0k408_285784_c1 3300050493 Bacteria 984
336 nmdc:mga06z11_108525_c1 3300050494 Bacteria 1534
337 nmdc:mga06z11_251023_c1 3300050494 Bacteria 1042
338 nmdc:mga06z11_389092_c1 3300050494 Bacteria 838
339 nmdc:mga06z11_482724_c1 3300050494 Bacteria 750
340 nmdc:mga07m45_164586_c1 3300050496 Bacteria 1288
341 nmdc:mga07m45_229652_c1 3300050496 Bacteria 1080
342 nmdc:mga0sz30_35723_c1 3300050516 Bacteria 2075
343 nmdc:mga0sz30_43965_c2 3300050516 Bacteria 1561
344 nmdc:mga0sz30_87632_c1 3300050516 Bacteria 1352
345 Ga0495655_0098972 3300053083 Bacteria 861
346 Ga0500556_0000124 3300053104 Bacteria 67080
347 Ga0500560_002097 3300053107 Bacteria 3715
348 Ga0500572_001261 3300053111 Bacteria 7133
349 Ga0500652_166684 3300053131 Bacteria 908
350 Ga0500568_0001216 3300053139 Bacteria 17178
351 Ga0500568_0139273 3300053139 Bacteria 900
352 Ga0500573_0296573 3300053140 Bacteria 810
353 Ga0500604_0089761 3300053151 Bacteria 1002
354 Ga0500616_0077825 3300053153 Bacteria 1674
355 Ga0500620_079823 3300053155 Bacteria 1132
356 Ga0500624_000477 3300053157 Bacteria 11906
357 Ga0500627_0088440 3300053158 Bacteria 1385
358 Ga0500627_0156522 3300053158 Bacteria 1029
359 Ga0500627_0185732 3300053158 Bacteria 934
360 Ga0500627_0271551 3300053158 Bacteria 746
361 Ga0500634_0013936 3300053161 Bacteria 4230
362 Ga0500634_0086605 3300053161 Bacteria 1600
363 Ga0500636_0000069 3300053177 Bacteria 50916
364 Ga0500636_0001346 3300053177 Bacteria 13338
365 Ga0500611_027556 3300053727 Bacteria 1145
366 Ga0587106_044095 3300059605 Bacteria 768
367 Ga0501082_0355897 3300060353 Bacteria 1277
368 Ga0501082_0453459 3300060353 Bacteria 1121
369 Ga0530510_0034914 3300061734 Bacteria 3623

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2977898635 2977902253 179
2 3300046660 Ga0495625_0078591 Ga0495625_0078591_293_943 183
3 iso_pu_bacteria 2970532167 2970533737 184
4 3300005367 Ga0070667_100155124 Ga0070667_1001551242 186
5 3300026121 Ga0207683_10192707 Ga0207683_101927071 187
6 3300038443 Ga0395901_0377891 Ga0395901_0377891_764_1354 187
7 3300049568 Ga0501031_0312302 Ga0501031_0312302_222_836 187
8 3300049571 Ga0501034_0137573 Ga0501034_0137573_1389_1976 187
9 3300050494 nmdc:mga06z11_389092_c1 nmdc:mga06z11_389092_c1_232_822 187
10 3300050516 nmdc:mga0sz30_87632_c1 nmdc:mga0sz30_87632_c1_17_607 187
11 3300053139 Ga0500568_0139273 Ga0500568_0139273_292_882 187
12 iso_pu_bacteria 2643221591 2643963301 187
13 3300048925 Ga0496122_0320707 Ga0496122_0320707_154_786 188
14 3300048927 Ga0496124_0095089 Ga0496124_0095089_656_1288 188
15 iso_pu_bacteria 2922178524 2922181721 188
16 3300032004 Ga0307414_10230673 Ga0307414_102306733 190
17 iso_pu_bacteria 2961136820 2961144582 190
18 3300031901 Ga0307406_10126124 Ga0307406_101261242 191
19 3300048914 Ga0496111_0072083 Ga0496111_0072083_1679_2287 191
20 3300048927 Ga0496124_0118629 Ga0496124_0118629_369_977 191
21 3300048928 Ga0496125_0000602 Ga0496125_0000602_16851_17459 191
22 3300049573 Ga0501037_0133871 Ga0501037_0133871_931_1524 191
23 3300048928 Ga0496125_0266816 Ga0496125_0266816_262_858 193
24 iso_pu_bacteria 2898795034 2898796929 193
25 iso_pu_bacteria 2713897090 2715498527 195
26 3300002705 JGI25156J39149_1003677 JGI25156J39149_10036772 196
27 3300002741 JGI25157J39369_1000347 JGI25157J39369_100034723 196
28 3300003187 JGI25151J46595_10013540 JGI25151J46595_100135402 196
29 3300003214 JGI25165J46597_1000020 JGI25165J46597_100002086 196
30 3300003762 Ga0055542_1000516 Ga0055542_100051631 196
31 3300003763 Ga0055529_1001859 Ga0055529_10018596 196
32 3300003775 Ga0055524_1001144 Ga0055524_10011448 196
33 3300003794 Ga0055531_10010137 Ga0055531_100101374 196
34 3300005327 Ga0070658_10027680 Ga0070658_100276802 196
35 3300005356 Ga0070674_100133706 Ga0070674_1001337062 196
36 3300005539 Ga0068853_100046275 Ga0068853_1000462751 196
37 3300005548 Ga0070665_100306506 Ga0070665_1003065063 196
38 3300005548 Ga0070665_100310859 Ga0070665_1003108592 196
39 3300005577 Ga0068857_100346664 Ga0068857_1003466642 196
40 3300005577 Ga0068857_101062743 Ga0068857_1010627431 196
41 3300005578 Ga0068854_100171209 Ga0068854_1001712092 196
42 3300005614 Ga0068856_100111381 Ga0068856_1001113812 196
43 3300005616 Ga0068852_100376932 Ga0068852_1003769322 196
44 3300006038 Ga0075365_10001929 Ga0075365_100019296 196
45 3300006038 Ga0075365_10040892 Ga0075365_100408922 196
46 3300006038 Ga0075365_10043590 Ga0075365_100435903 196
47 3300006042 Ga0075368_10044900 Ga0075368_100449003 196
48 3300006051 Ga0075364_10035265 Ga0075364_100352653 196
49 3300006051 Ga0075364_10039182 Ga0075364_100391825 196
50 3300006177 Ga0075362_10045337 Ga0075362_100453372 196
51 3300006177 Ga0075362_10305474 Ga0075362_103054742 196
52 3300006178 Ga0075367_10004358 Ga0075367_100043581 196
53 3300006178 Ga0075367_10019011 Ga0075367_100190114 196
54 3300006178 Ga0075367_10039830 Ga0075367_100398303 196
55 3300006178 Ga0075367_10206281 Ga0075367_102062812 196
56 3300006186 Ga0075369_10005979 Ga0075369_100059793 196
57 3300006186 Ga0075369_10038049 Ga0075369_100380491 196
58 3300006353 Ga0075370_10230305 Ga0075370_102303052 196
59 3300006353 Ga0075370_10247450 Ga0075370_102474502 196
60 3300006946 Ga0079104_1004473 Ga0079104_10044735 196
61 3300006946 Ga0079104_1007226 Ga0079104_10072264 196
62 3300006948 Ga0099826_10009775 Ga0099826_100097757 196
63 3300009093 Ga0105240_10637479 Ga0105240_106374792 196
64 3300009101 Ga0105247_10406684 Ga0105247_104066842 196
65 3300009545 Ga0105237_10213315 Ga0105237_102133151 196
66 3300009551 Ga0105238_10012176 Ga0105238_100121767 196
67 3300009553 Ga0105249_10518356 Ga0105249_105183562 196
68 3300010375 Ga0105239_10081120 Ga0105239_100811202 196
69 3300010375 Ga0105239_10248558 Ga0105239_102485582 196
70 3300010375 Ga0105239_10361696 Ga0105239_103616962 196
71 3300010375 Ga0105239_11054413 Ga0105239_110544132 196
72 3300011119 Ga0105246_10862399 Ga0105246_108623992 196
73 3300014325 Ga0163163_10279239 Ga0163163_102792391 196
74 3300014326 Ga0157380_10763163 Ga0157380_107631632 196
75 3300014497 Ga0182008_10049151 Ga0182008_100491512 196
76 3300021320 Ga0214544_1006450 Ga0214544_100645011 196
77 3300021321 Ga0214542_1000029 Ga0214542_100002912 196
78 3300021321 Ga0214542_1025934 Ga0214542_10259342 196
79 3300021327 Ga0214543_1000040 Ga0214543_100004012 196
80 3300021327 Ga0214543_1000049 Ga0214543_1000049102 196
81 3300022739 Ga0228711_1003229 Ga0228711_10032297 196
82 3300022740 Ga0228710_1000004 Ga0228710_100000429 196
83 3300025250 Ga0209026_1000005 Ga0209026_1000005712 196
84 3300025254 Ga0209148_1000078 Ga0209148_1000078189 196
85 3300025254 Ga0209148_1024328 Ga0209148_10243282 196
86 3300025256 Ga0209759_1000239 Ga0209759_100023955 196
87 3300025261 Ga0209233_1000047 Ga0209233_1000047249 196
88 3300025263 Ga0209565_1015883 Ga0209565_10158832 196
89 3300025272 Ga0209455_1000194 Ga0209455_100019486 196
90 3300025294 Ga0209025_1000105 Ga0209025_100010557 196
91 3300025294 Ga0209025_1049819 Ga0209025_10498192 196
92 3300025297 Ga0209758_1018328 Ga0209758_10183282 196
93 3300025297 Ga0209758_1050254 Ga0209758_10502541 196
94 3300025299 Ga0209256_1000027 Ga0209256_100002759 196
95 3300025904 Ga0207647_10017158 Ga0207647_100171584 196
96 3300025907 Ga0207645_10236719 Ga0207645_102367192 196
97 3300025914 Ga0207671_10035087 Ga0207671_100350872 196
98 3300025914 Ga0207671_10103285 Ga0207671_101032853 196
99 3300025919 Ga0207657_10253441 Ga0207657_102534412 196
100 3300025924 Ga0207694_10076577 Ga0207694_100765772 196
101 3300025937 Ga0207669_10232391 Ga0207669_102323912 196
102 3300025937 Ga0207669_10558317 Ga0207669_105583171 196
103 3300026041 Ga0207639_10028706 Ga0207639_100287062 196
104 3300026041 Ga0207639_10040125 Ga0207639_100401254 196
105 3300026089 Ga0207648_10153690 Ga0207648_101536904 196
106 3300026116 Ga0207674_10127654 Ga0207674_101276543 196
107 3300026142 Ga0207698_10148006 Ga0207698_101480062 196
108 3300027111 Ga0209281_1000134 Ga0209281_100013435 196
109 3300027111 Ga0209281_1000445 Ga0209281_100044551 196
110 3300027312 Ga0209371_1000009 Ga0209371_1000009782 196
111 3300027312 Ga0209371_1001016 Ga0209371_100101618 196
112 3300027666 Ga0209282_1000029 Ga0209282_10000293 196
113 3300027666 Ga0209282_1025331 Ga0209282_10253312 196
114 3300027866 Ga0209813_10071784 Ga0209813_100717841 196
115 3300028379 Ga0268266_10039602 Ga0268266_100396025 196
116 3300028379 Ga0268266_10258402 Ga0268266_102584022 196
117 3300028794 Ga0307515_10000029 Ga0307515_10000029218 196
118 3300028794 Ga0307515_10000277 Ga0307515_1000027749 196
119 3300028794 Ga0307515_10005710 Ga0307515_1000571024 196
120 3300028794 Ga0307515_10136809 Ga0307515_101368092 196
121 3300030500 Ga0268256_1000010 Ga0268256_1000010781 196
122 3300030500 Ga0268256_1005318 Ga0268256_10053186 196
123 3300031456 Ga0307513_10003029 Ga0307513_1000302912 196
124 3300031911 Ga0307412_10198393 Ga0307412_101983933 196
125 3300031967 Ga0315914_1000004 Ga0315914_100000434 196
126 3300031995 Ga0307409_100247978 Ga0307409_1002479782 196
127 3300032002 Ga0307416_100318575 Ga0307416_1003185751 196
128 3300032002 Ga0307416_100413082 Ga0307416_1004130823 196
129 3300032002 Ga0307416_100686042 Ga0307416_1006860422 196
130 3300033430 Ga0315913_1000370 Ga0315913_10003702 196
131 3300033464 Ga0315915_1000003 Ga0315915_1000003141 196
132 3300035691 Ga0373931_0160631 Ga0373931_0160631_546_1184 196
133 3300037418 Ga0395900_0044321 Ga0395900_0044321_2417_3055 196
134 3300037418 Ga0395900_0373102 Ga0395900_0373102_737_1375 196
135 3300037418 Ga0395900_0668407 Ga0395900_0668407_169_807 196
136 3300037466 Ga0395898_0813450 Ga0395898_0813450_49_687 196
137 3300037471 Ga0395905_0044744 Ga0395905_0044744_3276_3914 196
138 3300037471 Ga0395905_0047448 Ga0395905_0047448_565_1212 196
139 3300037471 Ga0395905_0082924 Ga0395905_0082924_164_802 196
140 3300037471 Ga0395905_0172370 Ga0395905_0172370_163_804 196
141 3300037471 Ga0395905_0309335 Ga0395905_0309335_670_1308 196
142 3300037471 Ga0395905_0746590 Ga0395905_0746590_62_697 196
143 3300038443 Ga0395901_0055397 Ga0395901_0055397_2928_3569 196
144 3300038443 Ga0395901_0357364 Ga0395901_0357364_799_1437 196
145 3300038443 Ga0395901_0951536 Ga0395901_0951536_123_761 196
146 3300041413 Ga0439465_0009030 Ga0439465_0009030_1878_2528 196
147 3300042005 Ga0439448_0120371 Ga0439448_0120371_130_765 196
148 3300042136 Ga0450900_008873 Ga0450900_008873_140_778 196
149 3300044901 Ga0466960_0018792 Ga0466960_0018792_1809_2450 196
150 3300045976 Ga0466967_0310148 Ga0466967_0310148_749_1390 196
151 3300046460 Ga0495638_0006811 Ga0495638_0006811_6222_6863 196
152 3300046460 Ga0495638_0227171 Ga0495638_0227171_269_925 196
153 3300046460 Ga0495638_0291378 Ga0495638_0291378_195_827 196
154 3300046616 Ga0495668_0117288 Ga0495668_0117288_790_1425 196
155 3300046660 Ga0495625_0025379 Ga0495625_0025379_2223_2858 196
156 3300046660 Ga0495625_0031385 Ga0495625_0031385_707_1345 196
157 3300046674 Ga0495588_0000559 Ga0495588_0000559_7445_8083 196
158 3300046692 Ga0495671_0013217 Ga0495671_0013217_165_803 196
159 3300047470 Ga0495681_0002200 Ga0495681_0002200_11958_12596 196
160 3300048905 Ga0496102_0064051 Ga0496102_0064051_1923_2558 196
161 3300048905 Ga0496102_0410744 Ga0496102_0410744_271_912 196
162 3300048912 Ga0496109_0241754 Ga0496109_0241754_576_1232 196
163 3300048913 Ga0496110_0213443 Ga0496110_0213443_1078_1743 196
164 3300048918 Ga0496115_0212255 Ga0496115_0212255_475_1140 196
165 3300048919 Ga0496116_0000026 Ga0496116_0000026_43328_43966 196
166 3300048921 Ga0496118_0062119 Ga0496118_0062119_193_831 196
167 3300048921 Ga0496118_0134211 Ga0496118_0134211_258_923 196
168 3300048922 Ga0496119_0000827 Ga0496119_0000827_17738_18406 196
169 3300048922 Ga0496119_0049823 Ga0496119_0049823_727_1365 196
170 3300048923 Ga0496120_0001220 Ga0496120_0001220_3336_3974 196
171 3300048924 Ga0496121_0451018 Ga0496121_0451018_138_773 196
172 3300048925 Ga0496122_0001094 Ga0496122_0001094_28460_29122 196
173 3300048925 Ga0496122_0026504 Ga0496122_0026504_47_685 196
174 3300048926 Ga0496123_0001198 Ga0496123_0001198_17823_18485 196
175 3300048927 Ga0496124_0000083 Ga0496124_0000083_43402_44040 196
176 3300048927 Ga0496124_0530940 Ga0496124_0530940_124_762 196
177 3300048928 Ga0496125_0079689 Ga0496125_0079689_1765_2403 196
178 3300048928 Ga0496125_0183659 Ga0496125_0183659_460_1125 196
179 3300048929 Ga0496126_0000069 Ga0496126_0000069_234534_235172 196
180 3300048929 Ga0496126_0480828 Ga0496126_0480828_32_697 196
181 3300048929 Ga0496126_0522218 Ga0496126_0522218_219_857 196
182 3300048929 Ga0496126_0664556 Ga0496126_0664556_110_748 196
183 3300049568 Ga0501031_0000003 Ga0501031_0000003_153517_154173 196
184 3300049568 Ga0501031_0110207 Ga0501031_0110207_579_1223 196
185 3300049568 Ga0501031_0170555 Ga0501031_0170555_278_916 196
186 3300049568 Ga0501031_0205516 Ga0501031_0205516_579_1244 196
187 3300049568 Ga0501031_0225275 Ga0501031_0225275_256_891 196
188 3300049568 Ga0501031_0227647 Ga0501031_0227647_146_787 196
189 3300049569 Ga0501032_0000010 Ga0501032_0000010_153517_154173 196
190 3300049569 Ga0501032_0000546 Ga0501032_0000546_19724_20389 196
191 3300049569 Ga0501032_0038298 Ga0501032_0038298_2466_3107 196
192 3300049569 Ga0501032_0106271 Ga0501032_0106271_1033_1677 196
193 3300049569 Ga0501032_0433747 Ga0501032_0433747_141_776 196
194 3300049569 Ga0501032_0433748 Ga0501032_0433748_67_702 196
195 3300049570 Ga0501033_0000017 Ga0501033_0000017_153517_154173 196
196 3300049570 Ga0501033_0007011 Ga0501033_0007011_1243_1908 196
197 3300049570 Ga0501033_0075934 Ga0501033_0075934_923_1567 196
198 3300049570 Ga0501033_0129466 Ga0501033_0129466_1059_1700 196
199 3300049570 Ga0501033_0160323 Ga0501033_0160323_775_1413 196
200 3300049570 Ga0501033_0218163 Ga0501033_0218163_625_1260 196
201 3300049570 Ga0501033_0498522 Ga0501033_0498522_67_702 196
202 3300049570 Ga0501033_0498525 Ga0501033_0498525_141_776 196
203 3300049571 Ga0501034_0000053 Ga0501034_0000053_52649_53305 196
204 3300049571 Ga0501034_0001507 Ga0501034_0001507_10141_10806 196
205 3300049571 Ga0501034_0292788 Ga0501034_0292788_67_702 196
206 3300049571 Ga0501034_0371301 Ga0501034_0371301_669_1319 196
207 3300049571 Ga0501034_0380632 Ga0501034_0380632_670_1314 196
208 3300049571 Ga0501034_0477428 Ga0501034_0477428_159_818 196
209 3300049571 Ga0501034_0554374 Ga0501034_0554374_403_1047 196
210 3300049571 Ga0501034_0789890 Ga0501034_0789890_141_776 196
211 3300049572 Ga0501036_0000009 Ga0501036_0000009_153517_154173 196
212 3300049572 Ga0501036_0001029 Ga0501036_0001029_666_1331 196
213 3300049572 Ga0501036_0145208 Ga0501036_0145208_728_1372 196
214 3300049572 Ga0501036_0440654 Ga0501036_0440654_67_702 196
215 3300049572 Ga0501036_0692168 Ga0501036_0692168_67_702 196
216 3300049573 Ga0501037_0000008 Ga0501037_0000008_52640_53296 196
217 3300049573 Ga0501037_0000838 Ga0501037_0000838_2607_3272 196
218 3300049573 Ga0501037_0029710 Ga0501037_0029710_1607_2242 196
219 3300049573 Ga0501037_0278986 Ga0501037_0278986_389_1027 196
220 3300049574 Ga0501038_0000008 Ga0501038_0000008_52649_53305 196
221 3300049574 Ga0501038_0002532 Ga0501038_0002532_7020_7685 196
222 3300049574 Ga0501038_0052723 Ga0501038_0052723_667_1323 196
223 3300049574 Ga0501038_0588889 Ga0501038_0588889_67_702 196
224 3300049574 Ga0501038_0588893 Ga0501038_0588893_67_702 196
225 3300049575 Ga0501039_0000021 Ga0501039_0000021_109248_109904 196
226 3300049575 Ga0501039_0001378 Ga0501039_0001378_10141_10806 196
227 3300049575 Ga0501039_0081398 Ga0501039_0081398_293_949 196
228 3300049575 Ga0501039_0626571 Ga0501039_0626571_67_702 196
229 3300049576 Ga0501040_0007087 Ga0501040_0007087_6515_7171 196
230 3300049576 Ga0501040_0240431 Ga0501040_0240431_616_1272 196
231 3300049579 Ga0501043_0000043 Ga0501043_0000043_105409_106074 196
232 3300049579 Ga0501043_0000656 Ga0501043_0000656_10597_11253 196
233 3300049579 Ga0501043_0029929 Ga0501043_0029929_378_1013 196
234 3300049579 Ga0501043_0044479 Ga0501043_0044479_62_697 196
235 3300049579 Ga0501043_0077343 Ga0501043_0077343_1246_1890 196
236 3300049580 Ga0501046_0074049 Ga0501046_0074049_867_1508 196
237 3300049580 Ga0501046_0133477 Ga0501046_0133477_1194_1859 196
238 3300049581 Ga0501047_0004274 Ga0501047_0004274_10704_11360 196
239 3300049581 Ga0501047_0049899 Ga0501047_0049899_3265_3900 196
240 3300049581 Ga0501047_0111020 Ga0501047_0111020_881_1522 196
241 3300049581 Ga0501047_0250744 Ga0501047_0250744_83_712 196
242 3300049581 Ga0501047_0693987 Ga0501047_0693987_60_695 196
243 3300049582 Ga0501048_0008441 Ga0501048_0008441_3905_4540 196
244 3300049582 Ga0501048_0041326 Ga0501048_0041326_1074_1730 196
245 3300049582 Ga0501048_0142045 Ga0501048_0142045_495_1136 196
246 3300049584 Ga0501068_0096943 Ga0501068_0096943_49_684 196
247 3300049586 Ga0501070_0007145 Ga0501070_0007145_6845_7501 196
248 3300049586 Ga0501070_0046063 Ga0501070_0046063_2980_3615 196
249 3300049586 Ga0501070_0510277 Ga0501070_0510277_145_786 196
250 3300049586 Ga0501070_0670508 Ga0501070_0670508_23_652 196
251 3300049587 Ga0501071_0071456 Ga0501071_0071456_16_648 196
252 3300049587 Ga0501071_0757966 Ga0501071_0757966_12_677 196
253 3300049588 Ga0501072_0324716 Ga0501072_0324716_26_661 196
254 3300049589 Ga0501073_0039790 Ga0501073_0039790_35_694 196
255 3300049589 Ga0501073_0102417 Ga0501073_0102417_1129_1764 196
256 3300049590 Ga0501074_0017395 Ga0501074_0017395_1073_1708 196
257 3300049591 Ga0501075_0011120 Ga0501075_0011120_1955_2611 196
258 3300049741 Ga0501079_0017789 Ga0501079_0017789_4641_5297 196
259 3300049742 Ga0501080_0040744 Ga0501080_0040744_2694_3329 196
260 3300049742 Ga0501080_0376960 Ga0501080_0376960_339_980 196
261 3300049742 Ga0501080_0530444 Ga0501080_0530444_325_984 196
262 3300049744 Ga0501083_0094228 Ga0501083_0094228_533_1168 196
263 3300049744 Ga0501083_0216982 Ga0501083_0216982_16_675 196
264 3300049822 Ga0501035_0000023 Ga0501035_0000023_153517_154173 196
265 3300049822 Ga0501035_0000958 Ga0501035_0000958_19724_20389 196
266 3300049822 Ga0501035_0060685 Ga0501035_0060685_969_1607 196
267 3300049822 Ga0501035_0082530 Ga0501035_0082530_1488_2129 196
268 3300049822 Ga0501035_0107342 Ga0501035_0107342_1133_1771 196
269 3300049822 Ga0501035_0196300 Ga0501035_0196300_980_1624 196
270 3300049822 Ga0501035_0209854 Ga0501035_0209854_93_728 196
271 3300049822 Ga0501035_0337229 Ga0501035_0337229_179_817 196
272 3300049822 Ga0501035_0665820 Ga0501035_0665820_141_776 196
273 3300049822 Ga0501035_0665824 Ga0501035_0665824_67_702 196
274 3300049823 Ga0501044_0000021 Ga0501044_0000021_52649_53305 196
275 3300049823 Ga0501044_0018996 Ga0501044_0018996_2178_2816 196
276 3300049823 Ga0501044_0096604 Ga0501044_0096604_1979_2644 196
277 3300049823 Ga0501044_0224868 Ga0501044_0224868_894_1538 196
278 3300049823 Ga0501044_0771201 Ga0501044_0771201_141_776 196
279 3300049823 Ga0501044_0771202 Ga0501044_0771202_67_702 196
280 3300050489 nmdc:mga03683_3508_c1 nmdc:mga03683_3508_c1_1700_2365 196
281 3300050490 nmdc:mga03n38_222068_c1 nmdc:mga03n38_222068_c1_193_828 196
282 3300050490 nmdc:mga03n38_24210_c1 nmdc:mga03n38_24210_c1_675_1340 196
283 3300050490 nmdc:mga03n38_341903_c1 nmdc:mga03n38_341903_c1_72_707 196
284 3300050491 nmdc:mga00v17_60381_c1 nmdc:mga00v17_60381_c1_437_1102 196
285 3300050492 nmdc:mga0yw44_130983_c1 nmdc:mga0yw44_130983_c1_92_757 196
286 3300050492 nmdc:mga0yw44_18598_c1 nmdc:mga0yw44_18598_c1_1411_2046 196
287 3300050492 nmdc:mga0yw44_2158_c1 nmdc:mga0yw44_2158_c1_271_906 196
288 3300050492 nmdc:mga0yw44_40990_c1 nmdc:mga0yw44_40990_c1_1175_1840 196
289 3300050493 nmdc:mga0k408_285784_c1 nmdc:mga0k408_285784_c1_46_696 196
290 3300050494 nmdc:mga06z11_108525_c1 nmdc:mga06z11_108525_c1_830_1495 196
291 3300050494 nmdc:mga06z11_251023_c1 nmdc:mga06z11_251023_c1_244_882 196
292 3300050494 nmdc:mga06z11_482724_c1 nmdc:mga06z11_482724_c1_24_659 196
293 3300050496 nmdc:mga07m45_164586_c1 nmdc:mga07m45_164586_c1_467_1132 196
294 3300050496 nmdc:mga07m45_229652_c1 nmdc:mga07m45_229652_c1_232_867 196
295 3300050516 nmdc:mga0sz30_35723_c1 nmdc:mga0sz30_35723_c1_132_770 196
296 3300050516 nmdc:mga0sz30_43965_c2 nmdc:mga0sz30_43965_c2_427_1062 196
297 3300053083 Ga0495655_0098972 Ga0495655_0098972_138_803 196
298 3300053104 Ga0500556_0000124 Ga0500556_0000124_34538_35206 196
299 3300053107 Ga0500560_002097 Ga0500560_002097_2842_3480 196
300 3300053111 Ga0500572_001261 Ga0500572_001261_4811_5452 196
301 3300053131 Ga0500652_166684 Ga0500652_166684_71_739 196
302 3300053139 Ga0500568_0001216 Ga0500568_0001216_13923_14552 196
303 3300053140 Ga0500573_0296573 Ga0500573_0296573_161_799 196
304 3300053151 Ga0500604_0089761 Ga0500604_0089761_330_965 196
305 3300053153 Ga0500616_0077825 Ga0500616_0077825_142_786 196
306 3300053155 Ga0500620_079823 Ga0500620_079823_80_715 196
307 3300053157 Ga0500624_000477 Ga0500624_000477_4807_5445 196
308 3300053158 Ga0500627_0088440 Ga0500627_0088440_456_1091 196
309 3300053158 Ga0500627_0156522 Ga0500627_0156522_85_735 196
310 3300053161 Ga0500634_0013936 Ga0500634_0013936_3284_3922 196
311 3300053161 Ga0500634_0086605 Ga0500634_0086605_593_1231 196
312 3300053177 Ga0500636_0000069 Ga0500636_0000069_19873_20511 196
313 3300053177 Ga0500636_0001346 Ga0500636_0001346_8182_8823 196
314 3300053727 Ga0500611_027556 Ga0500611_027556_311_940 196
315 3300059605 Ga0587106_044095 Ga0587106_044095_63_728 196
316 3300060353 Ga0501082_0355897 Ga0501082_0355897_557_1198 196
317 3300060353 Ga0501082_0453459 Ga0501082_0453459_61_720 196
318 3300061734 Ga0530510_0034914 Ga0530510_0034914_93_749 196
319 iso_pu_bacteria 2503198000 2503200758 196
320 iso_pu_bacteria 2508501122 2509111779 196
321 iso_pu_bacteria 2508501123 2509118944 196
322 iso_pu_bacteria 2508501127 2509141193 196
323 iso_pu_bacteria 2508501127 2509146243 196
324 iso_pu_bacteria 2509276018 2509369029 196
325 iso_pu_bacteria 2509276019 2509375407 196
326 iso_pu_bacteria 2509276022 2509395594 196
327 iso_pu_bacteria 2510065057 2510308146 196
328 iso_pu_bacteria 2510065059 2510316155 196
329 iso_pu_bacteria 2511231027 2511390734 196
330 iso_pu_bacteria 2511231052 2511498925 196
331 iso_pu_bacteria 2512875016 2512929098 196
332 iso_pu_bacteria 2512875024 2512963654 196
333 iso_pu_bacteria 2512875026 2512973125 196
334 iso_pu_bacteria 2513237086 2513587193 196
335 iso_pu_bacteria 2513237087 2513594120 196
336 iso_pu_bacteria 2513237090 2513607778 196
337 iso_pu_bacteria 2513237091 2513616217 196
338 iso_pu_bacteria 2513237140 2513882630 196
339 iso_pu_bacteria 2513237143 2513904613 196
340 iso_pu_bacteria 2513237159 2513996398 196
341 iso_pu_bacteria 2513237164 2514039759 196
342 iso_pu_bacteria 2513237305 2514421658 196
343 iso_pu_bacteria 2513237351 2514590814 196
344 iso_pu_bacteria 2516653046 2516895201 196
345 iso_pu_bacteria 2524023207 2524450916 196
346 iso_pu_bacteria 2534681786 2535486331 196
347 iso_pu_bacteria 2537561587 2537873429 196
348 iso_pu_bacteria 2551306084 2551675237 196
349 iso_pu_bacteria 2551306085 2551686984 196
350 iso_pu_bacteria 2551306086 2551696598 196
351 iso_pu_bacteria 2551306087 2551704793 196
352 iso_pu_bacteria 2551306089 2551709664 196
353 iso_pu_bacteria 2551306090 2551716508 196
354 iso_pu_bacteria 2551306091 2551726703 196
355 iso_pu_bacteria 2551306092 2551737502 196
356 iso_pu_bacteria 2551306093 2551743130 196
357 iso_pu_bacteria 2558860100 2558866503 196
358 iso_pu_bacteria 2582581306 2585264848 196
359 iso_pu_bacteria 2582581865 2585386096 196
360 iso_pu_bacteria 2582581866 2585394659 196
361 iso_pu_bacteria 2588253730 2588514637 196
362 iso_pu_bacteria 2599185210 2599604419 196
363 iso_pu_bacteria 2599185301 2599940536 196
364 iso_pu_bacteria 2599185352 2600197564 196
365 iso_pu_bacteria 2643221550 2643772313 196
366 iso_pu_bacteria 2643221551 2643774433 196
367 iso_pu_bacteria 2643221555 2643792878 196
368 iso_pu_bacteria 2643221557 2643805884 196
369 iso_pu_bacteria 2643221558 2643812599 196
370 iso_pu_bacteria 2643221582 2643920697 196
371 iso_pu_bacteria 2643221595 2643988080 196
372 iso_pu_bacteria 2643221610 2644066061 196
373 iso_pu_bacteria 2643221623 2644132550 196
374 iso_pu_bacteria 2643221627 2644155568 196
375 iso_pu_bacteria 2643221668 2644380365 196
376 iso_pu_bacteria 2643221675 2644417392 196
377 iso_pu_bacteria 2643221680 2644450788 196
378 iso_pu_bacteria 2643221726 2644692788 196
379 iso_pu_bacteria 2687453392 2688597889 196
380 iso_pu_bacteria 2690316117 2692317675 196
381 iso_pu_bacteria 2693429783 2694628950 196
382 iso_pu_bacteria 2693429784 2694637135 196
383 iso_pu_bacteria 2721755686 2723578180 196
384 iso_pu_bacteria 2738543024 2739309560 196
385 iso_pu_bacteria 2751185800 2753357752 196
386 iso_pu_bacteria 2751185821 2753459874 196
387 iso_pu_bacteria 2756170246 2756676223 196
388 iso_pu_bacteria 2757320392 2757569315 196
389 iso_pu_bacteria 2758568016 2758640329 196
390 iso_pu_bacteria 2765235802 2765464440 196
391 iso_pu_bacteria 2767802442 2770194803 196
392 iso_pu_bacteria 2775506902 2776272407 196
393 iso_pu_bacteria 2775506904 2776284347 196
394 iso_pu_bacteria 2791355091 2792621043 196
395 iso_pu_bacteria 2791355092 2792625258 196
396 iso_pu_bacteria 2791355123 2792750028 196
397 iso_pu_bacteria 2802428858 2802718694 196
398 iso_pu_bacteria 2802428862 2802742223 196
399 iso_pu_bacteria 2802428863 2802748906 196
400 iso_pu_bacteria 2818991439 2819556766 196
401 iso_pu_bacteria 2838675328 2838677501 196
402 iso_pu_bacteria 2838714209 2838716390 196
403 iso_pu_bacteria 2838719591 2838719810 196
404 iso_pu_bacteria 2838724970 2838727141 196
405 iso_pu_bacteria 2839993093 2839994354 196
406 iso_pu_bacteria 2840764183 2840764905 196
407 iso_pu_bacteria 2841734538 2841735575 196
408 iso_pu_bacteria 2841846520 2841846741 196
409 iso_pu_bacteria 2841859092 2841860730 196
410 iso_pu_bacteria 2842124991 2842127230 196
411 iso_pu_bacteria 2842130223 2842132394 196
412 iso_pu_bacteria 2842152218 2842152437 196
413 iso_pu_bacteria 2842170452 2842172635 196
414 iso_pu_bacteria 2842175837 2842176056 196
415 iso_pu_bacteria 2842187318 2842189497 196
416 iso_pu_bacteria 2842211629 2842213811 196
417 iso_pu_bacteria 2842224351 2842224571 196
418 iso_pu_bacteria 2842515876 2842517515 196
419 iso_pu_bacteria 2842521101 2842521318 196
420 iso_pu_bacteria 2842871566 2842873564 196
421 iso_pu_bacteria 2844002411 2844004859 196
422 iso_pu_bacteria 2844009547 2844009619 196
423 iso_pu_bacteria 2847417321 2847421346 196
424 iso_pu_bacteria 2847670302 2847672557 196
425 iso_pu_bacteria 2847686936 2847691857 196
426 iso_pu_bacteria 2848992105 2848996131 196
427 iso_pu_bacteria 2850079185 2850079527 196
428 iso_pu_bacteria 2854911287 2854914999 196
429 iso_pu_bacteria 2855825444 2855827839 196
430 iso_pu_bacteria 2855839649 2855843207 196
431 iso_pu_bacteria 2855872281 2855877839 196
432 iso_pu_bacteria 2856314179 2856315785 196
433 iso_pu_bacteria 2856328259 2856329984 196
434 iso_pu_bacteria 2856334872 2856337131 196
435 iso_pu_bacteria 2856342000 2856347721 196
436 iso_pu_bacteria 2856349417 2856355384 196
437 iso_pu_bacteria 2856356410 2856358615 196
438 iso_pu_bacteria 2856364286 2856367652 196
439 iso_pu_bacteria 2857349434 2857353595 196
440 iso_pu_bacteria 2857367948 2857374996 196
441 iso_pu_bacteria 2858800743 2858802935 196
442 iso_pu_bacteria 2869162929 2869163876 196
443 iso_pu_bacteria 2869249662 2869254322 196
444 iso_pu_bacteria 2869256925 2869263952 196
445 iso_pu_bacteria 2869264136 2869270656 196
446 iso_pu_bacteria 2869271264 2869277888 196
447 iso_pu_bacteria 2869278585 2869284436 196
448 iso_pu_bacteria 2869285874 2869286860 196
449 iso_pu_bacteria 2871429161 2871434124 196
450 iso_pu_bacteria 2871435913 2871439407 196
451 iso_pu_bacteria 2871444079 2871449262 196
452 iso_pu_bacteria 2871451962 2871452379 196
453 iso_pu_bacteria 2871459585 2871465525 196
454 iso_pu_bacteria 2871466892 2871472552 196
455 iso_pu_bacteria 2871474448 2871479129 196
456 iso_pu_bacteria 2871481445 2871481784 196
457 iso_pu_bacteria 2871488783 2871490020 196
458 iso_pu_bacteria 2871495908 2871501865 196
459 iso_pu_bacteria 2874102143 2874102862 196
460 iso_pu_bacteria 2874109183 2874111666 196
461 iso_pu_bacteria 2874116593 2874121718 196
462 iso_pu_bacteria 2874123672 2874126864 196
463 iso_pu_bacteria 2874139085 2874139102 196
464 iso_pu_bacteria 2874146452 2874147782 196
465 iso_pu_bacteria 2874155637 2874156700 196
466 iso_pu_bacteria 2874162495 2874163967 196
467 iso_pu_bacteria 2874168670 2874169973 196
468 iso_pu_bacteria 2876363079 2876369564 196
469 iso_pu_bacteria 2876377896 2876382121 196
470 iso_pu_bacteria 2876386047 2876392085 196
471 iso_pu_bacteria 2876392853 2876393857 196
472 iso_pu_bacteria 2876399893 2876401625 196
473 iso_pu_bacteria 2876406927 2876412366 196
474 iso_pu_bacteria 2876413966 2876414726 196
475 iso_pu_bacteria 2876420981 2876423356 196
476 iso_pu_bacteria 2878035449 2878042405 196
477 iso_pu_bacteria 2878738818 2878739949 196
478 iso_pu_bacteria 2878745973 2878746834 196
479 iso_pu_bacteria 2878753008 2878756067 196
480 iso_pu_bacteria 2878760144 2878765898 196
481 iso_pu_bacteria 2878767105 2878772572 196
482 iso_pu_bacteria 2878774303 2878775390 196
483 iso_pu_bacteria 2878781027 2878786057 196
484 iso_pu_bacteria 2881147464 2881154583 196
485 iso_pu_bacteria 2881161766 2881163695 196
486 iso_pu_bacteria 2881845957 2881846849 196
487 iso_pu_bacteria 2881853255 2881857409 196
488 iso_pu_bacteria 2881861095 2881866151 196
489 iso_pu_bacteria 2882632389 2882634247 196
490 iso_pu_bacteria 2882912400 2882917396 196
491 iso_pu_bacteria 2885305155 2885308868 196
492 iso_pu_bacteria 2885312484 2885318751 196
493 iso_pu_bacteria 2885342637 2885345195 196
494 iso_pu_bacteria 2885350715 2885356593 196
495 iso_pu_bacteria 2888337043 2888342310 196
496 iso_pu_bacteria 2888343758 2888346360 196
497 iso_pu_bacteria 2888350351 2888351433 196
498 iso_pu_bacteria 2889010040 2889013721 196
499 iso_pu_bacteria 2889016732 2889021571 196
500 iso_pu_bacteria 2899792073 2899794479 196
501 iso_pu_bacteria 2903448605 2903453152 196
502 iso_pu_bacteria 2903492973 2903497939 196
503 iso_pu_bacteria 2903492973 2903500722 196
504 iso_pu_bacteria 2903513507 2903519453 196
505 iso_pu_bacteria 2903521522 2903526834 196
506 iso_pu_bacteria 2903528002 2903530167 196
507 iso_pu_bacteria 2903540706 2903546844 196
508 iso_pu_bacteria 2904578770 2904578969 196
509 iso_pu_bacteria 2904659560 2904660582 196
510 iso_pu_bacteria 2906308376 2906309214 196
511 iso_pu_bacteria 2906321335 2906326821 196
512 iso_pu_bacteria 2906328253 2906331892 196
513 iso_pu_bacteria 2906354277 2906359068 196
514 iso_pu_bacteria 2906363423 2906368256 196
515 iso_pu_bacteria 2906370794 2906373846 196
516 iso_pu_bacteria 2906378014 2906385539 196
517 iso_pu_bacteria 2906386501 2906393236 196
518 iso_pu_bacteria 2906393657 2906400787 196
519 iso_pu_bacteria 2906401398 2906407168 196
520 iso_pu_bacteria 2906408224 2906409654 196
521 iso_pu_bacteria 2906414383 2906415922 196
522 iso_pu_bacteria 2913295892 2913298340 196
523 iso_pu_bacteria 2915986958 2915989798 196
524 iso_pu_bacteria 2915993759 2915998260 196
525 iso_pu_bacteria 2916000859 2916004919 196
526 iso_pu_bacteria 2916007675 2916014215 196
527 iso_pu_bacteria 2916014648 2916016070 196
528 iso_pu_bacteria 2916021584 2916027990 196
529 iso_pu_bacteria 2916028427 2916029642 196
530 iso_pu_bacteria 2916035215 2916040537 196
531 iso_pu_bacteria 2916041962 2916047409 196
532 iso_pu_bacteria 2916048683 2916054854 196
533 iso_pu_bacteria 2916055098 2916058960 196
534 iso_pu_bacteria 2916068649 2916072598 196
535 iso_pu_bacteria 2916076590 2916078757 196
536 iso_pu_bacteria 2919114240 2919116607 196
537 iso_pu_bacteria 2919119836 2919122204 196
538 iso_pu_bacteria 2919166419 2919168240 196
539 iso_pu_bacteria 2921201388 2921207752 196
540 iso_pu_bacteria 2921208531 2921211529 196
541 iso_pu_bacteria 2921237296 2921243380 196
542 iso_pu_bacteria 2921244191 2921249773 196
543 iso_pu_bacteria 2921257292 2921263537 196
544 iso_pu_bacteria 2921263974 2921269454 196
545 iso_pu_bacteria 2921282425 2921285226 196
546 iso_pu_bacteria 2921289301 2921291465 196
547 iso_pu_bacteria 2921296804 2921299146 196
548 iso_pu_bacteria 2922130491 2922136003 196
549 iso_pu_bacteria 2922151315 2922156512 196
550 iso_pu_bacteria 2922158528 2922160561 196
551 iso_pu_bacteria 2922172374 2922175096 196
552 iso_pu_bacteria 2922185730 2922189620 196
553 iso_pu_bacteria 2924144063 2924149144 196
554 iso_pu_bacteria 2924150972 2924153294 196
555 iso_pu_bacteria 2924158325 2924164531 196
556 iso_pu_bacteria 2924165586 2924171647 196
557 iso_pu_bacteria 2924172951 2924177380 196
558 iso_pu_bacteria 2924179722 2924185574 196
559 iso_pu_bacteria 2924186466 2924191144 196
560 iso_pu_bacteria 2924193448 2924198132 196
561 iso_pu_bacteria 2924200457 2924204936 196
562 iso_pu_bacteria 2924207177 2924211749 196
563 iso_pu_bacteria 2924214083 2924216723 196
564 iso_pu_bacteria 2924221636 2924227066 196
565 iso_pu_bacteria 2924228884 2924229561 196
566 iso_pu_bacteria 2924710171 2924713729 196
567 iso_pu_bacteria 2924726620 2924728639 196
568 iso_pu_bacteria 2924733363 2924740648 196
569 iso_pu_bacteria 2924741084 2924746372 196
570 iso_pu_bacteria 2924748358 2924750933 196
571 iso_pu_bacteria 2924762789 2924767855 196
572 iso_pu_bacteria 2924776078 2924777548 196
573 iso_pu_bacteria 2924784321 2924791109 196
574 iso_pu_bacteria 2926754445 2926754615 196
575 iso_pu_bacteria 2928521798 2928521869 196
576 iso_pu_bacteria 2933006813 2933007084 196
577 iso_pu_bacteria 2933011516 2933015326 196
578 iso_pu_bacteria 2937002841 2937008927 196
579 iso_pu_bacteria 2937009748 2937013942 196
580 iso_pu_bacteria 2937016420 2937020832 196
581 iso_pu_bacteria 2937023124 2937025717 196
582 iso_pu_bacteria 2937036028 2937038974 196
583 iso_pu_bacteria 2937042894 2937048962 196
584 iso_pu_bacteria 2937049772 2937054292 196
585 iso_pu_bacteria 2937056579 2937061918 196
586 iso_pu_bacteria 2937063883 2937071050 196
587 iso_pu_bacteria 2937071275 2937073493 196
588 iso_pu_bacteria 2937084907 2937088619 196
589 iso_pu_bacteria 2937091812 2937097647 196
590 iso_pu_bacteria 2937098957 2937100719 196
591 iso_pu_bacteria 2937106411 2937112321 196
592 iso_pu_bacteria 2937113482 2937118534 196
593 iso_pu_bacteria 2937119839 2937121860 196
594 iso_pu_bacteria 2937126314 2937127005 196
595 iso_pu_bacteria 2937813078 2937813926 196
596 iso_pu_bacteria 2937822353 2937824178 196
597 iso_pu_bacteria 2937836603 2937842386 196
598 iso_pu_bacteria 2937848649 2937851497 196
599 iso_pu_bacteria 2937861824 2937862248 196
600 iso_pu_bacteria 2937868953 2937875808 196
601 iso_pu_bacteria 2937891427 2937894960 196
602 iso_pu_bacteria 2937972304 2937976516 196
603 iso_pu_bacteria 2937980651 2937981225 196
604 iso_pu_bacteria 2937994558 2938000703 196
605 iso_pu_bacteria 2938014810 2938019782 196
606 iso_pu_bacteria 2941499720 2941501124 196
607 iso_pu_bacteria 2954011201 2954014774 196
608 iso_pu_bacteria 2957382221 2957386905 196
609 iso_pu_bacteria 2957388812 2957393770 196
610 iso_pu_bacteria 2957395598 2957401793 196
611 iso_pu_bacteria 2957402308 2957405607 196
612 iso_pu_bacteria 2957408893 2957413800 196
613 iso_pu_bacteria 2957415311 2957421905 196
614 iso_pu_bacteria 2957422303 2957425037 196
615 iso_pu_bacteria 2957430029 2957434360 196
616 iso_pu_bacteria 2957437181 2957438713 196
617 iso_pu_bacteria 2957443900 2957449819 196
618 iso_pu_bacteria 2957450854 2957451728 196
619 iso_pu_bacteria 2957457609 2957462217 196
620 iso_pu_bacteria 2957464669 2957469107 196
621 iso_pu_bacteria 2957471148 2957475502 196
622 iso_pu_bacteria 2957478035 2957482463 196
623 iso_pu_bacteria 2957484790 2957486416 196
624 iso_pu_bacteria 2957491536 2957493768 196
625 iso_pu_bacteria 2957498199 2957498916 196
626 iso_pu_bacteria 2957505466 2957510492 196
627 iso_pu_bacteria 2958034702 2958038533 196
628 iso_pu_bacteria 2958041894 2958042164 196
629 iso_pu_bacteria 2958041894 2958056144 196
630 iso_pu_bacteria 2958064165 2958069794 196
631 iso_pu_bacteria 2958071322 2958075430 196
632 iso_pu_bacteria 2958084443 2958091047 196
633 iso_pu_bacteria 2958092219 2958093516 196
634 iso_pu_bacteria 2958100919 2958103863 196
635 iso_pu_bacteria 2958108152 2958111528 196
636 iso_pu_bacteria 2958115193 2958121493 196
637 iso_pu_bacteria 2958122699 2958125305 196
638 iso_pu_bacteria 2958130278 2958131265 196
639 iso_pu_bacteria 2958137437 2958141505 196
640 iso_pu_bacteria 2958158011 2958162065 196
641 iso_pu_bacteria 2958165035 2958171074 196
642 iso_pu_bacteria 2958179912 2958180664 196
643 iso_pu_bacteria 2960584000 2960588398 196
644 iso_pu_bacteria 2960591022 2960593245 196
645 iso_pu_bacteria 2960597568 2960598099 196
646 iso_pu_bacteria 2960603979 2960605297 196
647 iso_pu_bacteria 2960610863 2960615320 196
648 iso_pu_bacteria 2960617483 2960622868 196
649 iso_pu_bacteria 2960624210 2960625830 196
650 iso_pu_bacteria 2960637947 2960638925 196
651 iso_pu_bacteria 2960645483 2960646813 196
652 iso_pu_bacteria 2960652885 2960659348 196
653 iso_pu_bacteria 2960660292 2960666602 196
654 iso_pu_bacteria 2960667422 2960673086 196
655 iso_pu_bacteria 2960674078 2960677934 196
656 iso_pu_bacteria 2960687367 2960688742 196
657 iso_pu_bacteria 2961077736 2961078498 196
658 iso_pu_bacteria 2961114664 2961120903 196
659 iso_pu_bacteria 2961127735 2961132990 196
660 iso_pu_bacteria 2961163497 2961169518 196
661 iso_pu_bacteria 2961170736 2961174068 196
662 iso_pu_bacteria 2961183825 2961185297 196
663 iso_pu_bacteria 2963644680 2963650136 196
664 iso_pu_bacteria 2964607997 2964609214 196
665 iso_pu_bacteria 2964615318 2964621538 196
666 iso_pu_bacteria 2964621998 2964627922 196
667 iso_pu_bacteria 2964636051 2964641889 196
668 iso_pu_bacteria 2964643177 2964648121 196
669 iso_pu_bacteria 2964649959 2964655051 196
670 iso_pu_bacteria 2964656573 2964661876 196
671 iso_pu_bacteria 2964663802 2964668545 196
672 iso_pu_bacteria 2964670856 2964673732 196
673 iso_pu_bacteria 2964678106 2964678869 196
674 iso_pu_bacteria 2964685014 2964686763 196
675 iso_pu_bacteria 2964691889 2964697616 196
676 iso_pu_bacteria 2964698721 2964700312 196
677 iso_pu_bacteria 2964705432 2964708948 196
678 iso_pu_bacteria 2964712639 2964718050 196
679 iso_pu_bacteria 2964719344 2964720338 196
680 iso_pu_bacteria 2965018300 2965023770 196
681 iso_pu_bacteria 2965025482 2965031173 196
682 iso_pu_bacteria 2965032056 2965036349 196
683 iso_pu_bacteria 2965040258 2965045479 196
684 iso_pu_bacteria 2965047637 2965049381 196
685 iso_pu_bacteria 2965062239 2965070207 196
686 iso_pu_bacteria 2965089291 2965091892 196
687 iso_pu_bacteria 2965102966 2965107725 196
688 iso_pu_bacteria 2965110997 2965116620 196
689 iso_pu_bacteria 2965119406 2965126543 196
690 iso_pu_bacteria 2967664464 2967665800 196
691 iso_pu_bacteria 2967671571 2967673057 196
692 iso_pu_bacteria 2967678726 2967680326 196
693 iso_pu_bacteria 2967693043 2967697540 196
694 iso_pu_bacteria 2967699805 2967702424 196
695 iso_pu_bacteria 2967706974 2967713174 196
696 iso_pu_bacteria 2967714385 2967720244 196
697 iso_pu_bacteria 2967721400 2967727655 196
698 iso_pu_bacteria 2967728569 2967732834 196
699 iso_pu_bacteria 2967735183 2967735667 196
700 iso_pu_bacteria 2967742019 2967744930 196
701 iso_pu_bacteria 2967748971 2967749608 196
702 iso_pu_bacteria 2967755722 2967758419 196
703 iso_pu_bacteria 2967762386 2967763655 196
704 iso_pu_bacteria 2967769361 2967774459 196
705 iso_pu_bacteria 2967775926 2967781264 196
706 iso_pu_bacteria 2967996073 2968002757 196
707 iso_pu_bacteria 2968003550 2968005153 196
708 iso_pu_bacteria 2968016561 2968021164 196
709 iso_pu_bacteria 2968083720 2968086518 196
710 iso_pu_bacteria 2968091066 2968095313 196
711 iso_pu_bacteria 2968097103 2968101282 196
712 iso_pu_bacteria 2968110612 2968111640 196
713 iso_pu_bacteria 2968117919 2968120078 196
714 iso_pu_bacteria 2968128360 2968128567 196
715 iso_pu_bacteria 2968138860 2968147012 196
716 iso_pu_bacteria 2968171901 2968177908 196
717 iso_pu_bacteria 2970019648 2970021109 196
718 iso_pu_bacteria 2970026789 2970031884 196
719 iso_pu_bacteria 2970033650 2970039949 196
720 iso_pu_bacteria 2970040964 2970046710 196
721 iso_pu_bacteria 2970047711 2970051829 196
722 iso_pu_bacteria 2970054988 2970060419 196
723 iso_pu_bacteria 2970061556 2970063562 196
724 iso_pu_bacteria 2970068827 2970075731 196
725 iso_pu_bacteria 2970076120 2970082385 196
726 iso_pu_bacteria 2970082768 2970085153 196
727 iso_pu_bacteria 2970088815 2970093801 196
728 iso_pu_bacteria 2970095765 2970101431 196
729 iso_pu_bacteria 2970102677 2970106174 196
730 iso_pu_bacteria 2970109326 2970115378 196
731 iso_pu_bacteria 2970116247 2970116733 196
732 iso_pu_bacteria 2970129317 2970133829 196
733 iso_pu_bacteria 2970136068 2970139720 196
734 iso_pu_bacteria 2970143518 2970145224 196
735 iso_pu_bacteria 2970149975 2970154586 196
736 iso_pu_bacteria 2970156795 2970158951 196
737 iso_pu_bacteria 2970164137 2970169687 196
738 iso_pu_bacteria 2970170962 2970174027 196
739 iso_pu_bacteria 2970177841 2970182468 196
740 iso_pu_bacteria 2970184632 2970186991 196
741 iso_pu_bacteria 2970191845 2970197769 196
742 iso_pu_bacteria 2970469710 2970476269 196
743 iso_pu_bacteria 2970489779 2970491517 196
744 iso_pu_bacteria 2970503327 2970506656 196
745 iso_pu_bacteria 2970510686 2970517277 196
746 iso_pu_bacteria 2970524798 2970527866 196
747 iso_pu_bacteria 2970540015 2970543731 196
748 iso_pu_bacteria 2970547951 2970549479 196
749 iso_pu_bacteria 2970554993 2970560754 196
750 iso_pu_bacteria 2970593180 2970599051 196
751 iso_pu_bacteria 2970619444 2970625391 196
752 iso_pu_bacteria 2970627176 2970628020 196
753 iso_pu_bacteria 2977516862 2977518879 196
754 iso_pu_bacteria 2977523885 2977527090 196
755 iso_pu_bacteria 2977530762 2977530976 196
756 iso_pu_bacteria 2977537788 2977542786 196
757 iso_pu_bacteria 2977551784 2977557660 196
758 iso_pu_bacteria 2977558990 2977564682 196
759 iso_pu_bacteria 2977565890 2977569958 196
760 iso_pu_bacteria 2977572785 2977573481 196
761 iso_pu_bacteria 2977579622 2977584586 196
762 iso_pu_bacteria 2977821940 2977825288 196
763 iso_pu_bacteria 2977843712 2977847010 196
764 iso_pu_bacteria 2977851361 2977854001 196
765 iso_pu_bacteria 2977858184 2977860351 196
766 iso_pu_bacteria 2977864932 2977868282 196
767 iso_pu_bacteria 2977872689 2977874125 196
768 iso_pu_bacteria 2977907340 2977909827 196
769 iso_pu_bacteria 2977915119 2977915326 196
770 iso_pu_bacteria 2977922695 2977923206 196
771 iso_pu_bacteria 2977935797 2977937192 196
772 iso_pu_bacteria 2977942078 2977945803 196
773 iso_pu_bacteria 2977950692 2977955541 196
774 iso_pu_bacteria 2977957713 2977960940 196
775 iso_pu_bacteria 2977971508 2977973506 196
776 iso_pu_bacteria 2977986579 2977992493 196
777 iso_pu_bacteria 2978969890 2978970864 196
778 iso_pu_bacteria 2979100975 2979104918 196
779 iso_pu_bacteria 2979710463 2979711731 196
780 iso_pu_bacteria 2979742915 2979747045 196
781 iso_pu_bacteria 2979764755 2979768795 196
782 iso_pu_bacteria 2979772303 2979775006 196
783 iso_pu_bacteria 2979793036 2979796882 196
784 iso_pu_bacteria 2979808191 2979811356 196
785 iso_pu_bacteria 2984509177 2984513281 196
786 iso_pu_bacteria 2984518228 2984520350 196
787 iso_pu_bacteria 2984537506 2984539648 196
788 iso_pu_bacteria 2984587000 2984587973 196
789 iso_pu_bacteria 2984601300 2984601874 196
790 iso_pu_bacteria 2987636660 2987642992 196
791 iso_pu_bacteria 2987645492 2987649410 196
792 iso_pu_bacteria 2987652177 2987655461 196
793 iso_pu_bacteria 2987659509 2987665504 196
794 iso_pu_bacteria 2987666974 2987672290 196
795 iso_pu_bacteria 2987673487 2987673984 196
796 iso_pu_bacteria 2995392953 2995395892 196
797 iso_pu_bacteria 2996310559 2996312964 196
798 iso_pu_bacteria 2996341866 2996348937 196
799 iso_pu_bacteria 2996348954 2996355026 196
800 iso_pu_bacteria 2996386984 2996389787 196
801 iso_pu_bacteria 3000135777 3000142244 196
802 iso_pu_bacteria 3002141150 3002142778 196
803 iso_pu_bacteria 3003930520 3003931551 196
804 iso_pu_bacteria 3004167301 3004171928 196
805 iso_pu_bacteria 3004188549 3004194706 196
806 iso_pu_bacteria 3004195979 3004198081 196
807 iso_pu_bacteria 3004203850 3004210785 196
808 iso_pu_bacteria 3004211236 3004213504 196
809 iso_pu_bacteria 3004218560 3004221209 196
810 iso_pu_bacteria 3004232784 3004239374 196
811 iso_pu_bacteria 3004239961 3004243727 196
812 iso_pu_bacteria 3004248173 3004251647 196
813 iso_pu_bacteria 3004268573 3004271471 196
814 iso_pu_bacteria 3004275668 3004281560 196
815 iso_pu_bacteria 3004334049 3004338528 196
816 iso_pu_bacteria 637000159 637078818 196
817 iso_pu_bacteria 648276728 648736662 196
818 iso_pu_bacteria 649633066 649872419 196
819 iso_pu_bacteria 8002285264 8002288238 196
820 iso_pu_bacteria 8003570095 8003572320 196
821 iso_pu_bacteria 8003992118 8003995789 196
822 iso_pu_bacteria 8003999396 8004003545 196
823 iso_pu_bacteria 8004300914 8004305870 196
824 iso_pu_bacteria 8004312739 8004320607 196
825 iso_pu_bacteria 8004361976 8004363723 196
826 iso_pu_bacteria 8004374579 8004377655 196
827 iso_pu_bacteria 8004387939 8004388145 196
828 iso_pu_bacteria 8004395343 8004395675 196
829 iso_pu_bacteria 8004445564 8004451572 196
830 iso_pu_bacteria 8004633249 8004636448 196
831 iso_pu_bacteria 8004640170 8004643646 196
832 iso_pu_bacteria 8004703790 8004713226 196
833 iso_pu_bacteria 8004714634 8004715472 196
834 iso_pu_bacteria 8004727605 8004729953 196
835 iso_pu_bacteria 8018150411 8018152839 196
836 iso_pu_bacteria 8054460903 8054461101 196
837 iso_pu_bacteria 8054558443 8054561109 196
838 iso_pu_bacteria 8055617313 8055619158 196
839 3300048923 Ga0496120_0041504 Ga0496120_0041504_833_1483 197
840 3300048925 Ga0496122_0083749 Ga0496122_0083749_1129_1779 197
841 3300048926 Ga0496123_0134900 Ga0496123_0134900_43_693 197
842 3300048928 Ga0496125_0062487 Ga0496125_0062487_872_1522 197
843 3300049589 Ga0501073_0078669 Ga0501073_0078669_67_723 198
844 3300006038 Ga0075365_10055747 Ga0075365_100557473 200
845 3300047472 Ga0495686_0213685 Ga0495686_0213685_273_932 200
846 3300053158 Ga0500627_0185732 Ga0500627_0185732_251_907 200
847 3300053158 Ga0500627_0271551 Ga0500627_0271551_40_699 200
848 3300005295 Ga0065707_10026222 Ga0065707_100262222 204
849 3300005347 Ga0070668_100520382 Ga0070668_1005203822 204
850 3300005353 Ga0070669_100254130 Ga0070669_1002541302 204
851 3300046453 Ga0495627_000757 Ga0495627_000757_20175_20819 204
852 3300046518 Ga0495631_0123549 Ga0495631_0123549_47_691 204
853 3300031911 Ga0307412_10090470 Ga0307412_100904703 207
854 3300032004 Ga0307414_10712960 Ga0307414_107129601 207
855 3300025229 Ga0209147_101667 Ga0209147_1016679 209
856 3300048919 Ga0496116_0016002 Ga0496116_0016002_45_680 209
857 3300048924 Ga0496121_0024486 Ga0496121_0024486_2297_2932 209
858 3300048928 Ga0496125_0092750 Ga0496125_0092750_1530_2165 209
859 3300001904 JGI24736J21556_1000604 JGI24736J21556_10006046 214
860 3300001979 JGI24740J21852_10005625 JGI24740J21852_100056253 214
861 3300001989 JGI24739J22299_10009416 JGI24739J22299_100094164 214
862 3300001990 JGI24737J22298_10021752 JGI24737J22298_100217522 214
863 3300002067 JGI24735J21928_10022976 JGI24735J21928_100229762 214
864 3300002075 JGI24738J21930_10000460 JGI24738J21930_100004604 214
865 3300005344 Ga0070661_100193526 Ga0070661_1001935262 214
866 3300005347 Ga0070668_100226896 Ga0070668_1002268961 214
867 3300005455 Ga0070663_100007173 Ga0070663_1000071732 214
868 3300005535 Ga0070684_100774430 Ga0070684_1007744302 214
869 3300005563 Ga0068855_100089250 Ga0068855_1000892503 214
870 3300005577 Ga0068857_100358512 Ga0068857_1003585122 214
871 3300005614 Ga0068856_100186994 Ga0068856_1001869942 214
872 3300005616 Ga0068852_100617585 Ga0068852_1006175852 214
873 3300005834 Ga0068851_10069493 Ga0068851_100694932 214
874 3300009174 Ga0105241_10291819 Ga0105241_102918191 214
875 3300009545 Ga0105237_10244105 Ga0105237_102441053 214
876 3300010375 Ga0105239_10222678 Ga0105239_102226783 214
877 3300025321 Ga0207656_10091644 Ga0207656_100916442 214
878 3300025904 Ga0207647_10046213 Ga0207647_100462132 214
879 3300025909 Ga0207705_10079956 Ga0207705_100799563 214
880 3300025911 Ga0207654_10161822 Ga0207654_101618222 214
881 3300025913 Ga0207695_10665938 Ga0207695_106659382 214
882 3300025919 Ga0207657_10067581 Ga0207657_100675814 214
883 3300025924 Ga0207694_10123698 Ga0207694_101236982 214
884 3300025932 Ga0207690_10345533 Ga0207690_103455332 214
885 3300025933 Ga0207706_10076512 Ga0207706_100765121 214
886 3300025944 Ga0207661_10371723 Ga0207661_103717232 214
887 3300026041 Ga0207639_10019079 Ga0207639_100190796 214
888 3300026067 Ga0207678_10128163 Ga0207678_101281632 214
889 3300026078 Ga0207702_10010044 Ga0207702_100100447 214
890 3300026116 Ga0207674_10174321 Ga0207674_101743212 214
891 3300031548 Ga0307408_100135017 Ga0307408_1001350172 214
892 3300031548 Ga0307408_100425932 Ga0307408_1004259322 214
893 3300031852 Ga0307410_10012335 Ga0307410_100123353 214
894 3300031901 Ga0307406_10043274 Ga0307406_100432741 214
895 3300031911 Ga0307412_10350197 Ga0307412_103501972 214
896 3300032005 Ga0307411_10190578 Ga0307411_101905783 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

128

200

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pr3-assembly1.cif.gz_B crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase 0.9468 4 205
4pr3-assembly1.cif.gz_B crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase 0.9146 4 205
4pr3-assembly1.cif.gz_A crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase 0.9139 4 210
4pr3-assembly1.cif.gz_A crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase 0.8923 4 210
5dk6-assembly1.cif.gz_A crystal structure of a 5'-methylthioadenosine/s-adenosylhomocysteine (mta/sah) nucleosidase (mtan) from colwellia psychrerythraea 34h (cps_4743, target psi-029300) in complex with adenine at 2.27 a resolution 0.8035 12 203
ID Description Score Start End Superfamily
4pr3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9414 4 205 3.40.50.1580
4pr3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.913 4 205 3.40.50.1580
af_Q69XD3_13_258_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8318 40 66 3.40.50.2000
af_K7UNY3_10_282_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8067 43 66 3.40.50.2000
af_Q4CYT0_175_370_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7745 43 65 3.40.1090.10
ID Description Score Start End GO Terms
AF-A0A440E534-F1-model_v4 deleted 1.002 4 68
AF-A0A3S1SEQ8-F1-model_v4 deleted 0.9968 4 75
AF-A0A4Q3YJT3-F1-model_v4 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (EC 3.2.2.9) 0.9961 4 80 GO:0008782
GO:0009116
AF-A0A258MY70-F1-model_v4 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase 0.9651 4 171 GO:0003824
GO:0009116
AF-A0A832PQ91-F1-model_v4 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (EC 3.2.2.9) 0.9562 4 205 GO:0009116
GO:0016798

Feature Viewer

pLDDT pTM Quality
89.42 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map