F485033
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 896 | 714 | 369 | 212 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2881147464|2881154583 |
| Length | 237 |
| Sequence | ARIGEKSVLFVMAAEAEYGPHLKELFTPLMTGVGPVEAAVRLGAELATLKAEGALPDLVVSLGSAGSRTLEQTEIYQAVSVSYRDMDASPLGFEKGATPFLDLPVTVPLPFVIPGIKSATLSTGGAIVTGIAYDAIDADMVDMETFACLRACQLFGVPLVGLRGISDGAADLRHVGDWTEYLHVIDEKLAAAVGLLEQAIGGGLLDADCCPDQAARRCGSPKSMREMRPRTAPVASR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 10 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 11 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 12 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 13 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 14 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 15 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 16 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 17 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 18 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 19 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 20 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 21 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 22 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 23 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 24 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 25 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 26 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 27 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 28 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 29 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 30 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 31 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 32 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 33 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 34 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 35 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 36 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 37 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 38 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 39 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 40 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 41 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 42 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 43 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 44 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 45 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 46 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 47 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 48 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 49 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 50 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 51 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 52 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 53 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 54 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 55 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 56 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 57 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 58 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 59 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 60 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 61 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 62 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 63 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 64 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 65 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 66 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 67 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 68 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 69 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 70 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 71 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 72 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 73 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 74 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 75 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 76 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 77 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 78 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 79 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 80 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 81 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 82 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 83 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 84 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 85 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 86 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 87 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 88 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 89 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 90 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 91 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 92 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 93 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 94 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 95 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 96 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 97 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 98 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 99 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 100 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 101 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 102 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 103 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 104 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 105 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 106 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 107 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 108 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 109 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 110 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 111 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 112 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 113 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 114 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 115 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 116 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 117 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 118 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 119 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 120 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 121 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 122 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 123 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 124 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 125 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 126 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 127 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 128 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 129 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 130 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 131 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 132 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 133 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 134 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 135 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 136 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 137 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 138 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 139 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 140 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 141 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 142 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 143 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 144 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 145 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 146 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 147 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 148 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 149 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 150 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 151 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 152 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 153 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 154 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 155 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 156 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 157 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 158 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 159 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 160 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 161 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 162 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 163 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 164 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 165 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 166 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 167 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 168 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 169 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 170 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 171 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 172 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 173 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 174 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 175 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 176 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 177 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 178 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 179 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 180 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 181 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 182 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 183 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 184 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 185 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 186 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 187 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 188 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 189 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 190 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 191 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 192 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 193 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 194 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 195 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 196 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 197 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 198 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 199 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 200 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 201 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 202 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 203 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 204 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 205 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 206 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 207 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 208 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 209 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 210 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 211 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 212 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 213 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 214 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 215 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 216 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 217 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 218 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 219 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 220 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 221 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 222 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 223 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 224 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 225 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 226 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 227 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 228 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 229 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 230 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 231 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 232 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 233 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 234 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 235 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 236 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 237 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 238 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 239 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 240 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 241 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 242 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 243 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 244 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 245 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 246 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 247 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 248 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 249 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 250 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 251 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 252 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 253 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 254 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 255 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 256 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 257 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 258 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 259 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 260 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 261 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 262 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 263 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 264 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 265 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 266 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 267 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 268 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 269 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 270 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 271 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 272 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 273 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 274 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 275 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 276 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 277 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 278 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 279 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 280 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 281 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 282 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 283 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 284 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 285 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 286 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 287 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 288 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 289 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 290 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 291 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 292 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 293 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 294 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 295 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 296 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 297 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 298 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 299 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 300 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 301 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 302 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 303 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 304 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 305 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 306 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 307 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 308 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 309 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 310 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 311 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 312 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 313 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 314 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 315 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 316 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 317 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 318 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 319 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 320 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 321 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 322 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 323 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 324 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 325 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 326 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 327 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 328 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 329 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 330 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 331 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 332 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 333 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 334 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 335 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 336 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 337 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 338 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 339 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 340 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 341 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 342 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 343 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 344 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 345 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 346 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 347 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 348 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 349 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 350 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 351 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 352 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 353 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 354 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 355 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 356 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 357 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 358 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 359 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 360 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 361 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 362 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 363 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 364 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 365 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 366 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 367 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 368 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 369 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 370 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 371 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 372 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 373 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 374 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 375 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 376 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 377 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 378 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 379 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 380 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 381 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 382 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 383 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 384 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 385 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 386 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 387 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 388 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 389 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 390 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 391 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 392 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 393 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 394 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 395 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 396 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 397 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 398 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 399 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 400 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 401 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 402 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 403 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 404 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 405 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 406 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 407 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 408 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 409 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 410 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 411 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 412 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 413 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 414 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 415 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 416 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 417 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 418 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 419 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 420 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 421 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 422 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 423 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 424 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 425 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 426 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 427 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 428 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 429 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 430 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 431 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 432 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 433 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 434 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 435 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 436 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 437 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 438 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 439 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 440 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 441 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 442 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 443 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 444 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 445 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 446 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 447 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 448 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 449 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 450 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 451 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 452 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 453 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 454 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 455 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 456 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 457 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 458 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 459 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 460 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 461 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 462 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 463 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 464 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 465 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 466 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 467 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 468 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 469 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 470 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 471 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 472 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 473 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 474 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 475 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 476 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 477 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 478 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 479 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 480 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 481 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 482 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 483 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 484 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 485 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 486 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 487 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 488 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 489 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 490 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 491 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 492 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 493 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 494 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 495 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 496 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 497 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 498 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 499 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 500 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 501 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 502 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 503 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 504 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 505 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 506 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 507 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 508 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 509 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 510 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 511 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 512 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 513 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 514 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 515 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 516 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 517 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 518 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 519 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 520 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 521 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 522 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 523 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 524 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 525 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 526 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 527 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 528 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 529 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 530 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 531 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 532 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 533 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 534 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 535 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 536 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 537 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 538 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 539 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 540 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 541 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 542 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 543 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 544 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 545 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 546 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 547 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 548 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 549 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 550 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 551 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 552 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 553 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 554 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 555 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 556 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 557 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 558 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 559 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 560 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 561 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 562 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 563 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 564 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 565 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 566 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 567 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 568 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 569 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 571 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 572 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 573 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 574 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 584 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 589 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 591 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 592 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 594 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 595 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 596 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 597 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 598 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 599 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 600 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 601 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 602 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 603 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 604 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 605 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 606 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 607 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 608 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 609 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 610 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 611 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 612 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 613 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 614 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 615 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 616 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 617 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 627 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 628 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 629 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 630 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 631 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 632 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 633 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 634 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 635 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 636 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 637 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 638 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 639 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 640 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 641 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 642 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 643 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 644 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 645 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 646 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 647 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 648 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 649 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 650 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 651 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 652 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 653 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 654 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 656 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 657 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 658 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 659 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 660 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 661 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 662 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 663 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 664 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 665 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 667 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 668 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 669 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 670 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 671 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 672 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 673 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 674 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 676 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 677 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 678 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 679 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 680 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 681 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 682 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 683 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 684 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 685 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 686 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 687 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 688 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 689 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 690 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 691 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 692 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 693 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 694 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 695 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 696 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 697 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 698 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 699 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 700 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 701 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 702 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 703 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 704 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 705 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 706 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 707 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 708 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 709 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 710 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 711 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 712 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 713 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 714 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 41.07 |
| Metatranscriptomes | 0.11 |
| Isolates | 58.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.56 |
| Bulb | 0 |
| Endosphere | 8.26 |
| Nodule | 50.45 |
| Rhizoplane | 1.23 |
| Rhizosphere | 27.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000604 | 3300001904 | Bacteria | 6567 |
| 2 | JGI24740J21852_10005625 | 3300001979 | Bacteria | 5276 |
| 3 | JGI24739J22299_10009416 | 3300001989 | Bacteria | 3640 |
| 4 | JGI24737J22298_10021752 | 3300001990 | Bacteria | 2041 |
| 5 | JGI24735J21928_10022976 | 3300002067 | Bacteria | 1893 |
| 6 | JGI24738J21930_10000460 | 3300002075 | Bacteria | 11559 |
| 7 | JGI25156J39149_1003677 | 3300002705 | Bacteria | 4926 |
| 8 | JGI25157J39369_1000347 | 3300002741 | Bacteria | 32658 |
| 9 | JGI25151J46595_10013540 | 3300003187 | Bacteria | 3666 |
| 10 | JGI25165J46597_1000020 | 3300003214 | Bacteria | 370477 |
| 11 | Ga0055542_1000516 | 3300003762 | Bacteria | 34984 |
| 12 | Ga0055529_1001859 | 3300003763 | Bacteria | 4953 |
| 13 | Ga0055524_1001144 | 3300003775 | Bacteria | 15980 |
| 14 | Ga0055531_10010137 | 3300003794 | Bacteria | 4725 |
| 15 | Ga0065707_10026222 | 3300005295 | Bacteria | 1598 |
| 16 | Ga0070658_10027680 | 3300005327 | Bacteria | 4548 |
| 17 | Ga0070661_100193526 | 3300005344 | Bacteria | 1551 |
| 18 | Ga0070668_100226896 | 3300005347 | Bacteria | 1543 |
| 19 | Ga0070668_100520382 | 3300005347 | Bacteria | 1032 |
| 20 | Ga0070669_100254130 | 3300005353 | Bacteria | 1400 |
| 21 | Ga0070674_100133706 | 3300005356 | Bacteria | 1853 |
| 22 | Ga0070667_100155124 | 3300005367 | Bacteria | 2013 |
| 23 | Ga0070663_100007173 | 3300005455 | Bacteria | 6770 |
| 24 | Ga0070684_100774430 | 3300005535 | Bacteria | 896 |
| 25 | Ga0068853_100046275 | 3300005539 | Bacteria | 3730 |
| 26 | Ga0070665_100306506 | 3300005548 | Bacteria | 1591 |
| 27 | Ga0070665_100310859 | 3300005548 | Bacteria | 1580 |
| 28 | Ga0068855_100089250 | 3300005563 | Bacteria | 3559 |
| 29 | Ga0068857_100346664 | 3300005577 | Bacteria | 1375 |
| 30 | Ga0068857_100358512 | 3300005577 | Bacteria | 1351 |
| 31 | Ga0068857_101062743 | 3300005577 | Bacteria | 781 |
| 32 | Ga0068854_100171209 | 3300005578 | Bacteria | 1690 |
| 33 | Ga0068856_100111381 | 3300005614 | Bacteria | 2734 |
| 34 | Ga0068856_100186994 | 3300005614 | Bacteria | 2085 |
| 35 | Ga0068852_100376932 | 3300005616 | Bacteria | 1391 |
| 36 | Ga0068852_100617585 | 3300005616 | Bacteria | 1089 |
| 37 | Ga0068851_10069493 | 3300005834 | Bacteria | 1819 |
| 38 | Ga0075365_10001929 | 3300006038 | Bacteria | 9790 |
| 39 | Ga0075365_10040892 | 3300006038 | Bacteria | 3025 |
| 40 | Ga0075365_10043590 | 3300006038 | Bacteria | 2937 |
| 41 | Ga0075365_10055747 | 3300006038 | Bacteria | 2625 |
| 42 | Ga0075368_10044900 | 3300006042 | Bacteria | 1745 |
| 43 | Ga0075364_10035265 | 3300006051 | Bacteria | 3233 |
| 44 | Ga0075364_10039182 | 3300006051 | Bacteria | 3071 |
| 45 | Ga0075362_10045337 | 3300006177 | Bacteria | 1952 |
| 46 | Ga0075362_10305474 | 3300006177 | Bacteria | 790 |
| 47 | Ga0075367_10004358 | 3300006178 | Bacteria | 6898 |
| 48 | Ga0075367_10019011 | 3300006178 | Bacteria | 3802 |
| 49 | Ga0075367_10039830 | 3300006178 | Bacteria | 2741 |
| 50 | Ga0075367_10206281 | 3300006178 | Bacteria | 1228 |
| 51 | Ga0075369_10005979 | 3300006186 | Bacteria | 4579 |
| 52 | Ga0075369_10038049 | 3300006186 | Bacteria | 2051 |
| 53 | Ga0075370_10230305 | 3300006353 | Bacteria | 1096 |
| 54 | Ga0075370_10247450 | 3300006353 | Bacteria | 1056 |
| 55 | Ga0079104_1004473 | 3300006946 | Bacteria | 5962 |
| 56 | Ga0079104_1007226 | 3300006946 | Bacteria | 4064 |
| 57 | Ga0099826_10009775 | 3300006948 | Bacteria | 7165 |
| 58 | Ga0105240_10637479 | 3300009093 | Bacteria | 1169 |
| 59 | Ga0105247_10406684 | 3300009101 | Bacteria | 971 |
| 60 | Ga0105241_10291819 | 3300009174 | Bacteria | 1396 |
| 61 | Ga0105237_10213315 | 3300009545 | Bacteria | 1930 |
| 62 | Ga0105237_10244105 | 3300009545 | Bacteria | 1797 |
| 63 | Ga0105238_10012176 | 3300009551 | Bacteria | 8671 |
| 64 | Ga0105249_10518356 | 3300009553 | Bacteria | 1239 |
| 65 | Ga0105239_10081120 | 3300010375 | Bacteria | 3570 |
| 66 | Ga0105239_10222678 | 3300010375 | Bacteria | 2116 |
| 67 | Ga0105239_10248558 | 3300010375 | Bacteria | 1997 |
| 68 | Ga0105239_10361696 | 3300010375 | Bacteria | 1639 |
| 69 | Ga0105239_11054413 | 3300010375 | Bacteria | 935 |
| 70 | Ga0105246_10862399 | 3300011119 | Bacteria | 809 |
| 71 | Ga0163163_10279239 | 3300014325 | Bacteria | 1722 |
| 72 | Ga0157380_10763163 | 3300014326 | Bacteria | 980 |
| 73 | Ga0182008_10049151 | 3300014497 | Bacteria | 2093 |
| 74 | Ga0214544_1006450 | 3300021320 | Bacteria | 21631 |
| 75 | Ga0214542_1000029 | 3300021321 | Bacteria | 174097 |
| 76 | Ga0214542_1025934 | 3300021321 | Bacteria | 2958 |
| 77 | Ga0214543_1000040 | 3300021327 | Bacteria | 174142 |
| 78 | Ga0214543_1000049 | 3300021327 | Bacteria | 149506 |
| 79 | Ga0228711_1003229 | 3300022739 | Bacteria | 25290 |
| 80 | Ga0228710_1000004 | 3300022740 | Bacteria | 250560 |
| 81 | Ga0209147_101667 | 3300025229 | Bacteria | 7306 |
| 82 | Ga0209026_1000005 | 3300025250 | Bacteria | 731387 |
| 83 | Ga0209148_1000078 | 3300025254 | Bacteria | 296101 |
| 84 | Ga0209148_1024328 | 3300025254 | Bacteria | 957 |
| 85 | Ga0209759_1000239 | 3300025256 | Bacteria | 81781 |
| 86 | Ga0209233_1000047 | 3300025261 | Bacteria | 459614 |
| 87 | Ga0209565_1015883 | 3300025263 | Bacteria | 1686 |
| 88 | Ga0209455_1000194 | 3300025272 | Bacteria | 89837 |
| 89 | Ga0209025_1000105 | 3300025294 | Bacteria | 224157 |
| 90 | Ga0209025_1049819 | 3300025294 | Bacteria | 1681 |
| 91 | Ga0209758_1018328 | 3300025297 | Bacteria | 3436 |
| 92 | Ga0209758_1050254 | 3300025297 | Bacteria | 1464 |
| 93 | Ga0209256_1000027 | 3300025299 | Bacteria | 423283 |
| 94 | Ga0207656_10091644 | 3300025321 | Bacteria | 1380 |
| 95 | Ga0207647_10017158 | 3300025904 | Bacteria | 4926 |
| 96 | Ga0207647_10046213 | 3300025904 | Bacteria | 2714 |
| 97 | Ga0207645_10236719 | 3300025907 | Bacteria | 1206 |
| 98 | Ga0207705_10079956 | 3300025909 | Bacteria | 2381 |
| 99 | Ga0207654_10161822 | 3300025911 | Bacteria | 1447 |
| 100 | Ga0207695_10665938 | 3300025913 | Bacteria | 922 |
| 101 | Ga0207671_10035087 | 3300025914 | Bacteria | 3725 |
| 102 | Ga0207671_10103285 | 3300025914 | Bacteria | 2161 |
| 103 | Ga0207657_10067581 | 3300025919 | Bacteria | 3039 |
| 104 | Ga0207657_10253441 | 3300025919 | Bacteria | 1402 |
| 105 | Ga0207694_10076577 | 3300025924 | Bacteria | 2620 |
| 106 | Ga0207694_10123698 | 3300025924 | Bacteria | 2067 |
| 107 | Ga0207690_10345533 | 3300025932 | Bacteria | 1175 |
| 108 | Ga0207706_10076512 | 3300025933 | Bacteria | 2943 |
| 109 | Ga0207669_10232391 | 3300025937 | Bacteria | 1361 |
| 110 | Ga0207669_10558317 | 3300025937 | Bacteria | 925 |
| 111 | Ga0207661_10371723 | 3300025944 | Bacteria | 1293 |
| 112 | Ga0207639_10019079 | 3300026041 | Bacteria | 4883 |
| 113 | Ga0207639_10028706 | 3300026041 | Bacteria | 4064 |
| 114 | Ga0207639_10040125 | 3300026041 | Bacteria | 3492 |
| 115 | Ga0207678_10128163 | 3300026067 | Bacteria | 2164 |
| 116 | Ga0207702_10010044 | 3300026078 | Bacteria | 7936 |
| 117 | Ga0207648_10153690 | 3300026089 | Bacteria | 2031 |
| 118 | Ga0207674_10127654 | 3300026116 | Bacteria | 2508 |
| 119 | Ga0207674_10174321 | 3300026116 | Bacteria | 2103 |
| 120 | Ga0207683_10192707 | 3300026121 | Bacteria | 1851 |
| 121 | Ga0207698_10148006 | 3300026142 | Bacteria | 2034 |
| 122 | Ga0209281_1000134 | 3300027111 | Bacteria | 185406 |
| 123 | Ga0209281_1000445 | 3300027111 | Bacteria | 59209 |
| 124 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 125 | Ga0209371_1001016 | 3300027312 | Bacteria | 21360 |
| 126 | Ga0209282_1000029 | 3300027666 | Bacteria | 157883 |
| 127 | Ga0209282_1025331 | 3300027666 | Bacteria | 3710 |
| 128 | Ga0209813_10071784 | 3300027866 | Bacteria | 1127 |
| 129 | Ga0268266_10039602 | 3300028379 | Bacteria | 4015 |
| 130 | Ga0268266_10258402 | 3300028379 | Bacteria | 1613 |
| 131 | Ga0307515_10000029 | 3300028794 | Bacteria | 365410 |
| 132 | Ga0307515_10000277 | 3300028794 | Bacteria | 125765 |
| 133 | Ga0307515_10005710 | 3300028794 | Bacteria | 25131 |
| 134 | Ga0307515_10136809 | 3300028794 | Bacteria | 2657 |
| 135 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 136 | Ga0268256_1005318 | 3300030500 | Bacteria | 5090 |
| 137 | Ga0307513_10003029 | 3300031456 | Bacteria | 22905 |
| 138 | Ga0307408_100135017 | 3300031548 | Bacteria | 1929 |
| 139 | Ga0307408_100425932 | 3300031548 | Bacteria | 1145 |
| 140 | Ga0307410_10012335 | 3300031852 | Bacteria | 4938 |
| 141 | Ga0307406_10043274 | 3300031901 | Bacteria | 2815 |
| 142 | Ga0307406_10126124 | 3300031901 | Bacteria | 1789 |
| 143 | Ga0307412_10090470 | 3300031911 | Bacteria | 2139 |
| 144 | Ga0307412_10198393 | 3300031911 | Bacteria | 1522 |
| 145 | Ga0307412_10350197 | 3300031911 | Bacteria | 1185 |
| 146 | Ga0315914_1000004 | 3300031967 | Bacteria | 288534 |
| 147 | Ga0307409_100247978 | 3300031995 | Bacteria | 1626 |
| 148 | Ga0307416_100318575 | 3300032002 | Bacteria | 1556 |
| 149 | Ga0307416_100413082 | 3300032002 | Bacteria | 1391 |
| 150 | Ga0307416_100686042 | 3300032002 | Bacteria | 1112 |
| 151 | Ga0307414_10230673 | 3300032004 | Bacteria | 1526 |
| 152 | Ga0307414_10712960 | 3300032004 | Bacteria | 909 |
| 153 | Ga0307411_10190578 | 3300032005 | Bacteria | 1565 |
| 154 | Ga0315913_1000370 | 3300033430 | Bacteria | 38384 |
| 155 | Ga0315915_1000003 | 3300033464 | Bacteria | 407996 |
| 156 | Ga0373931_0160631 | 3300035691 | Bacteria | 1317 |
| 157 | Ga0395900_0044321 | 3300037418 | Bacteria | 4584 |
| 158 | Ga0395900_0373102 | 3300037418 | Bacteria | 1396 |
| 159 | Ga0395900_0668407 | 3300037418 | Bacteria | 974 |
| 160 | Ga0395898_0813450 | 3300037466 | Bacteria | 874 |
| 161 | Ga0395905_0044744 | 3300037471 | Bacteria | 4153 |
| 162 | Ga0395905_0047448 | 3300037471 | Bacteria | 4025 |
| 163 | Ga0395905_0082924 | 3300037471 | Bacteria | 3004 |
| 164 | Ga0395905_0172370 | 3300037471 | Bacteria | 2032 |
| 165 | Ga0395905_0309335 | 3300037471 | Bacteria | 1468 |
| 166 | Ga0395905_0746590 | 3300037471 | Bacteria | 881 |
| 167 | Ga0395901_0055397 | 3300038443 | Bacteria | 4124 |
| 168 | Ga0395901_0357364 | 3300038443 | Bacteria | 1507 |
| 169 | Ga0395901_0377891 | 3300038443 | Bacteria | 1459 |
| 170 | Ga0395901_0951536 | 3300038443 | Bacteria | 838 |
| 171 | Ga0439465_0009030 | 3300041413 | Bacteria | 3142 |
| 172 | Ga0439448_0120371 | 3300042005 | Bacteria | 901 |
| 173 | Ga0450900_008873 | 3300042136 | Bacteria | 1265 |
| 174 | Ga0466960_0018792 | 3300044901 | Bacteria | 3034 |
| 175 | Ga0466967_0310148 | 3300045976 | Bacteria | 1520 |
| 176 | Ga0495627_000757 | 3300046453 | Bacteria | 24076 |
| 177 | Ga0495638_0006811 | 3300046460 | Bacteria | 8249 |
| 178 | Ga0495638_0227171 | 3300046460 | Bacteria | 1040 |
| 179 | Ga0495638_0291378 | 3300046460 | Bacteria | 883 |
| 180 | Ga0495631_0123549 | 3300046518 | Bacteria | 1113 |
| 181 | Ga0495668_0117288 | 3300046616 | Bacteria | 1456 |
| 182 | Ga0495625_0025379 | 3300046660 | Bacteria | 4496 |
| 183 | Ga0495625_0031385 | 3300046660 | Bacteria | 3953 |
| 184 | Ga0495625_0078591 | 3300046660 | Bacteria | 2303 |
| 185 | Ga0495588_0000559 | 3300046674 | Bacteria | 17899 |
| 186 | Ga0495671_0013217 | 3300046692 | Bacteria | 4481 |
| 187 | Ga0495681_0002200 | 3300047470 | Bacteria | 14067 |
| 188 | Ga0495686_0213685 | 3300047472 | Bacteria | 1101 |
| 189 | Ga0496102_0064051 | 3300048905 | Bacteria | 3367 |
| 190 | Ga0496102_0410744 | 3300048905 | Bacteria | 1272 |
| 191 | Ga0496109_0241754 | 3300048912 | Bacteria | 1699 |
| 192 | Ga0496110_0213443 | 3300048913 | Bacteria | 1755 |
| 193 | Ga0496111_0072083 | 3300048914 | Bacteria | 2514 |
| 194 | Ga0496115_0212255 | 3300048918 | Bacteria | 1599 |
| 195 | Ga0496116_0000026 | 3300048919 | Bacteria | 450803 |
| 196 | Ga0496116_0016002 | 3300048919 | Bacteria | 5896 |
| 197 | Ga0496118_0062119 | 3300048921 | Bacteria | 2761 |
| 198 | Ga0496118_0134211 | 3300048921 | Bacteria | 1582 |
| 199 | Ga0496119_0000827 | 3300048922 | Bacteria | 41250 |
| 200 | Ga0496119_0049823 | 3300048922 | Bacteria | 2586 |
| 201 | Ga0496120_0001220 | 3300048923 | Bacteria | 32486 |
| 202 | Ga0496120_0041504 | 3300048923 | Bacteria | 2694 |
| 203 | Ga0496121_0024486 | 3300048924 | Bacteria | 5769 |
| 204 | Ga0496121_0451018 | 3300048924 | Bacteria | 829 |
| 205 | Ga0496122_0001094 | 3300048925 | Bacteria | 46993 |
| 206 | Ga0496122_0026504 | 3300048925 | Bacteria | 4994 |
| 207 | Ga0496122_0083749 | 3300048925 | Bacteria | 2209 |
| 208 | Ga0496122_0320707 | 3300048925 | Bacteria | 824 |
| 209 | Ga0496123_0001198 | 3300048926 | Bacteria | 38067 |
| 210 | Ga0496123_0134900 | 3300048926 | Bacteria | 1360 |
| 211 | Ga0496124_0000083 | 3300048927 | Bacteria | 207798 |
| 212 | Ga0496124_0095089 | 3300048927 | Bacteria | 2422 |
| 213 | Ga0496124_0118629 | 3300048927 | Bacteria | 2118 |
| 214 | Ga0496124_0530940 | 3300048927 | Bacteria | 781 |
| 215 | Ga0496125_0000602 | 3300048928 | Bacteria | 61264 |
| 216 | Ga0496125_0062487 | 3300048928 | Bacteria | 2977 |
| 217 | Ga0496125_0079689 | 3300048928 | Bacteria | 2511 |
| 218 | Ga0496125_0092750 | 3300048928 | Bacteria | 2256 |
| 219 | Ga0496125_0183659 | 3300048928 | Bacteria | 1390 |
| 220 | Ga0496125_0266816 | 3300048928 | Bacteria | 1069 |
| 221 | Ga0496126_0000069 | 3300048929 | Bacteria | 246935 |
| 222 | Ga0496126_0480828 | 3300048929 | Bacteria | 995 |
| 223 | Ga0496126_0522218 | 3300048929 | Bacteria | 946 |
| 224 | Ga0496126_0664556 | 3300048929 | Bacteria | 814 |
| 225 | Ga0501031_0000003 | 3300049568 | Bacteria | 206821 |
| 226 | Ga0501031_0110207 | 3300049568 | Bacteria | 1797 |
| 227 | Ga0501031_0170555 | 3300049568 | Bacteria | 1422 |
| 228 | Ga0501031_0205516 | 3300049568 | Bacteria | 1284 |
| 229 | Ga0501031_0225275 | 3300049568 | Bacteria | 1220 |
| 230 | Ga0501031_0227647 | 3300049568 | Bacteria | 1214 |
| 231 | Ga0501031_0312302 | 3300049568 | Bacteria | 1018 |
| 232 | Ga0501032_0000010 | 3300049569 | Bacteria | 206795 |
| 233 | Ga0501032_0000546 | 3300049569 | Bacteria | 30501 |
| 234 | Ga0501032_0038298 | 3300049569 | Bacteria | 3267 |
| 235 | Ga0501032_0106271 | 3300049569 | Bacteria | 1859 |
| 236 | Ga0501032_0433747 | 3300049569 | Bacteria | 842 |
| 237 | Ga0501032_0433748 | 3300049569 | Bacteria | 842 |
| 238 | Ga0501033_0000017 | 3300049570 | Bacteria | 206819 |
| 239 | Ga0501033_0007011 | 3300049570 | Bacteria | 8799 |
| 240 | Ga0501033_0075934 | 3300049570 | Bacteria | 2466 |
| 241 | Ga0501033_0129466 | 3300049570 | Bacteria | 1829 |
| 242 | Ga0501033_0160323 | 3300049570 | Bacteria | 1619 |
| 243 | Ga0501033_0218163 | 3300049570 | Bacteria | 1358 |
| 244 | Ga0501033_0498522 | 3300049570 | Bacteria | 842 |
| 245 | Ga0501033_0498525 | 3300049570 | Bacteria | 842 |
| 246 | Ga0501034_0000053 | 3300049571 | Bacteria | 206821 |
| 247 | Ga0501034_0001507 | 3300049571 | Bacteria | 30558 |
| 248 | Ga0501034_0137573 | 3300049571 | Bacteria | 2423 |
| 249 | Ga0501034_0292788 | 3300049571 | Bacteria | 1565 |
| 250 | Ga0501034_0371301 | 3300049571 | Bacteria | 1357 |
| 251 | Ga0501034_0380632 | 3300049571 | Bacteria | 1336 |
| 252 | Ga0501034_0477428 | 3300049571 | Bacteria | 1162 |
| 253 | Ga0501034_0554374 | 3300049571 | Bacteria | 1058 |
| 254 | Ga0501034_0789890 | 3300049571 | Bacteria | 842 |
| 255 | Ga0501036_0000009 | 3300049572 | Bacteria | 206821 |
| 256 | Ga0501036_0001029 | 3300049572 | Bacteria | 21072 |
| 257 | Ga0501036_0145208 | 3300049572 | Bacteria | 2001 |
| 258 | Ga0501036_0440654 | 3300049572 | Bacteria | 1085 |
| 259 | Ga0501036_0692168 | 3300049572 | Bacteria | 842 |
| 260 | Ga0501037_0000008 | 3300049573 | Bacteria | 206812 |
| 261 | Ga0501037_0000838 | 3300049573 | Bacteria | 22953 |
| 262 | Ga0501037_0029710 | 3300049573 | Bacteria | 4037 |
| 263 | Ga0501037_0133871 | 3300049573 | Bacteria | 1776 |
| 264 | Ga0501037_0278986 | 3300049573 | Bacteria | 1164 |
| 265 | Ga0501038_0000008 | 3300049574 | Bacteria | 206821 |
| 266 | Ga0501038_0002532 | 3300049574 | Bacteria | 17039 |
| 267 | Ga0501038_0052723 | 3300049574 | Bacteria | 3506 |
| 268 | Ga0501038_0588889 | 3300049574 | Bacteria | 842 |
| 269 | Ga0501038_0588893 | 3300049574 | Bacteria | 842 |
| 270 | Ga0501039_0000021 | 3300049575 | Bacteria | 162552 |
| 271 | Ga0501039_0001378 | 3300049575 | Bacteria | 17825 |
| 272 | Ga0501039_0081398 | 3300049575 | Bacteria | 2521 |
| 273 | Ga0501039_0626571 | 3300049575 | Bacteria | 842 |
| 274 | Ga0501040_0007087 | 3300049576 | Bacteria | 7265 |
| 275 | Ga0501040_0240431 | 3300049576 | Bacteria | 1290 |
| 276 | Ga0501043_0000043 | 3300049579 | Bacteria | 115410 |
| 277 | Ga0501043_0000656 | 3300049579 | Bacteria | 30519 |
| 278 | Ga0501043_0029929 | 3300049579 | Bacteria | 4277 |
| 279 | Ga0501043_0044479 | 3300049579 | Bacteria | 3491 |
| 280 | Ga0501043_0077343 | 3300049579 | Bacteria | 2614 |
| 281 | Ga0501046_0074049 | 3300049580 | Bacteria | 2642 |
| 282 | Ga0501046_0133477 | 3300049580 | Bacteria | 1881 |
| 283 | Ga0501047_0004274 | 3300049581 | Bacteria | 13448 |
| 284 | Ga0501047_0049899 | 3300049581 | Bacteria | 4040 |
| 285 | Ga0501047_0111020 | 3300049581 | Bacteria | 2624 |
| 286 | Ga0501047_0250744 | 3300049581 | Bacteria | 1619 |
| 287 | Ga0501047_0693987 | 3300049581 | Bacteria | 835 |
| 288 | Ga0501048_0008441 | 3300049582 | Bacteria | 7790 |
| 289 | Ga0501048_0041326 | 3300049582 | Bacteria | 3303 |
| 290 | Ga0501048_0142045 | 3300049582 | Bacteria | 1698 |
| 291 | Ga0501068_0096943 | 3300049584 | Bacteria | 1824 |
| 292 | Ga0501070_0007145 | 3300049586 | Bacteria | 9487 |
| 293 | Ga0501070_0046063 | 3300049586 | Bacteria | 3626 |
| 294 | Ga0501070_0510277 | 3300049586 | Bacteria | 965 |
| 295 | Ga0501070_0670508 | 3300049586 | Bacteria | 822 |
| 296 | Ga0501071_0071456 | 3300049587 | Bacteria | 2530 |
| 297 | Ga0501071_0757966 | 3300049587 | Unclassified | 748 |
| 298 | Ga0501072_0324716 | 3300049588 | Bacteria | 1223 |
| 299 | Ga0501073_0039790 | 3300049589 | Bacteria | 3330 |
| 300 | Ga0501073_0078669 | 3300049589 | Bacteria | 2295 |
| 301 | Ga0501073_0102417 | 3300049589 | Bacteria | 1988 |
| 302 | Ga0501074_0017395 | 3300049590 | Bacteria | 5216 |
| 303 | Ga0501075_0011120 | 3300049591 | Bacteria | 6358 |
| 304 | Ga0501079_0017789 | 3300049741 | Bacteria | 5431 |
| 305 | Ga0501080_0040744 | 3300049742 | Bacteria | 4331 |
| 306 | Ga0501080_0376960 | 3300049742 | Bacteria | 1279 |
| 307 | Ga0501080_0530444 | 3300049742 | Bacteria | 1050 |
| 308 | Ga0501083_0094228 | 3300049744 | Bacteria | 1977 |
| 309 | Ga0501083_0216982 | 3300049744 | Bacteria | 1247 |
| 310 | Ga0501035_0000023 | 3300049822 | Bacteria | 206821 |
| 311 | Ga0501035_0000958 | 3300049822 | Bacteria | 30505 |
| 312 | Ga0501035_0060685 | 3300049822 | Bacteria | 3366 |
| 313 | Ga0501035_0082530 | 3300049822 | Bacteria | 2836 |
| 314 | Ga0501035_0107342 | 3300049822 | Bacteria | 2448 |
| 315 | Ga0501035_0196300 | 3300049822 | Bacteria | 1733 |
| 316 | Ga0501035_0209854 | 3300049822 | Bacteria | 1666 |
| 317 | Ga0501035_0337229 | 3300049822 | Bacteria | 1264 |
| 318 | Ga0501035_0665820 | 3300049822 | Bacteria | 842 |
| 319 | Ga0501035_0665824 | 3300049822 | Bacteria | 842 |
| 320 | Ga0501044_0000021 | 3300049823 | Bacteria | 206821 |
| 321 | Ga0501044_0018996 | 3300049823 | Bacteria | 7360 |
| 322 | Ga0501044_0096604 | 3300049823 | Bacteria | 2976 |
| 323 | Ga0501044_0224868 | 3300049823 | Bacteria | 1826 |
| 324 | Ga0501044_0771201 | 3300049823 | Bacteria | 842 |
| 325 | Ga0501044_0771202 | 3300049823 | Bacteria | 842 |
| 326 | nmdc:mga03683_3508_c1 | 3300050489 | Bacteria | 4207 |
| 327 | nmdc:mga03n38_222068_c1 | 3300050490 | Bacteria | 987 |
| 328 | nmdc:mga03n38_24210_c1 | 3300050490 | Bacteria | 2480 |
| 329 | nmdc:mga03n38_341903_c1 | 3300050490 | Bacteria | 812 |
| 330 | nmdc:mga00v17_60381_c1 | 3300050491 | Bacteria | 2328 |
| 331 | nmdc:mga0yw44_130983_c1 | 3300050492 | Bacteria | 1624 |
| 332 | nmdc:mga0yw44_18598_c1 | 3300050492 | Bacteria | 3810 |
| 333 | nmdc:mga0yw44_2158_c1 | 3300050492 | Bacteria | 8259 |
| 334 | nmdc:mga0yw44_40990_c1 | 3300050492 | Bacteria | 2755 |
| 335 | nmdc:mga0k408_285784_c1 | 3300050493 | Bacteria | 984 |
| 336 | nmdc:mga06z11_108525_c1 | 3300050494 | Bacteria | 1534 |
| 337 | nmdc:mga06z11_251023_c1 | 3300050494 | Bacteria | 1042 |
| 338 | nmdc:mga06z11_389092_c1 | 3300050494 | Bacteria | 838 |
| 339 | nmdc:mga06z11_482724_c1 | 3300050494 | Bacteria | 750 |
| 340 | nmdc:mga07m45_164586_c1 | 3300050496 | Bacteria | 1288 |
| 341 | nmdc:mga07m45_229652_c1 | 3300050496 | Bacteria | 1080 |
| 342 | nmdc:mga0sz30_35723_c1 | 3300050516 | Bacteria | 2075 |
| 343 | nmdc:mga0sz30_43965_c2 | 3300050516 | Bacteria | 1561 |
| 344 | nmdc:mga0sz30_87632_c1 | 3300050516 | Bacteria | 1352 |
| 345 | Ga0495655_0098972 | 3300053083 | Bacteria | 861 |
| 346 | Ga0500556_0000124 | 3300053104 | Bacteria | 67080 |
| 347 | Ga0500560_002097 | 3300053107 | Bacteria | 3715 |
| 348 | Ga0500572_001261 | 3300053111 | Bacteria | 7133 |
| 349 | Ga0500652_166684 | 3300053131 | Bacteria | 908 |
| 350 | Ga0500568_0001216 | 3300053139 | Bacteria | 17178 |
| 351 | Ga0500568_0139273 | 3300053139 | Bacteria | 900 |
| 352 | Ga0500573_0296573 | 3300053140 | Bacteria | 810 |
| 353 | Ga0500604_0089761 | 3300053151 | Bacteria | 1002 |
| 354 | Ga0500616_0077825 | 3300053153 | Bacteria | 1674 |
| 355 | Ga0500620_079823 | 3300053155 | Bacteria | 1132 |
| 356 | Ga0500624_000477 | 3300053157 | Bacteria | 11906 |
| 357 | Ga0500627_0088440 | 3300053158 | Bacteria | 1385 |
| 358 | Ga0500627_0156522 | 3300053158 | Bacteria | 1029 |
| 359 | Ga0500627_0185732 | 3300053158 | Bacteria | 934 |
| 360 | Ga0500627_0271551 | 3300053158 | Bacteria | 746 |
| 361 | Ga0500634_0013936 | 3300053161 | Bacteria | 4230 |
| 362 | Ga0500634_0086605 | 3300053161 | Bacteria | 1600 |
| 363 | Ga0500636_0000069 | 3300053177 | Bacteria | 50916 |
| 364 | Ga0500636_0001346 | 3300053177 | Bacteria | 13338 |
| 365 | Ga0500611_027556 | 3300053727 | Bacteria | 1145 |
| 366 | Ga0587106_044095 | 3300059605 | Bacteria | 768 |
| 367 | Ga0501082_0355897 | 3300060353 | Bacteria | 1277 |
| 368 | Ga0501082_0453459 | 3300060353 | Bacteria | 1121 |
| 369 | Ga0530510_0034914 | 3300061734 | Bacteria | 3623 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2977898635 | 2977902253 | 179 |
| 2 | 3300046660 | Ga0495625_0078591 | Ga0495625_0078591_293_943 | 183 |
| 3 | iso_pu_bacteria | 2970532167 | 2970533737 | 184 |
| 4 | 3300005367 | Ga0070667_100155124 | Ga0070667_1001551242 | 186 |
| 5 | 3300026121 | Ga0207683_10192707 | Ga0207683_101927071 | 187 |
| 6 | 3300038443 | Ga0395901_0377891 | Ga0395901_0377891_764_1354 | 187 |
| 7 | 3300049568 | Ga0501031_0312302 | Ga0501031_0312302_222_836 | 187 |
| 8 | 3300049571 | Ga0501034_0137573 | Ga0501034_0137573_1389_1976 | 187 |
| 9 | 3300050494 | nmdc:mga06z11_389092_c1 | nmdc:mga06z11_389092_c1_232_822 | 187 |
| 10 | 3300050516 | nmdc:mga0sz30_87632_c1 | nmdc:mga0sz30_87632_c1_17_607 | 187 |
| 11 | 3300053139 | Ga0500568_0139273 | Ga0500568_0139273_292_882 | 187 |
| 12 | iso_pu_bacteria | 2643221591 | 2643963301 | 187 |
| 13 | 3300048925 | Ga0496122_0320707 | Ga0496122_0320707_154_786 | 188 |
| 14 | 3300048927 | Ga0496124_0095089 | Ga0496124_0095089_656_1288 | 188 |
| 15 | iso_pu_bacteria | 2922178524 | 2922181721 | 188 |
| 16 | 3300032004 | Ga0307414_10230673 | Ga0307414_102306733 | 190 |
| 17 | iso_pu_bacteria | 2961136820 | 2961144582 | 190 |
| 18 | 3300031901 | Ga0307406_10126124 | Ga0307406_101261242 | 191 |
| 19 | 3300048914 | Ga0496111_0072083 | Ga0496111_0072083_1679_2287 | 191 |
| 20 | 3300048927 | Ga0496124_0118629 | Ga0496124_0118629_369_977 | 191 |
| 21 | 3300048928 | Ga0496125_0000602 | Ga0496125_0000602_16851_17459 | 191 |
| 22 | 3300049573 | Ga0501037_0133871 | Ga0501037_0133871_931_1524 | 191 |
| 23 | 3300048928 | Ga0496125_0266816 | Ga0496125_0266816_262_858 | 193 |
| 24 | iso_pu_bacteria | 2898795034 | 2898796929 | 193 |
| 25 | iso_pu_bacteria | 2713897090 | 2715498527 | 195 |
| 26 | 3300002705 | JGI25156J39149_1003677 | JGI25156J39149_10036772 | 196 |
| 27 | 3300002741 | JGI25157J39369_1000347 | JGI25157J39369_100034723 | 196 |
| 28 | 3300003187 | JGI25151J46595_10013540 | JGI25151J46595_100135402 | 196 |
| 29 | 3300003214 | JGI25165J46597_1000020 | JGI25165J46597_100002086 | 196 |
| 30 | 3300003762 | Ga0055542_1000516 | Ga0055542_100051631 | 196 |
| 31 | 3300003763 | Ga0055529_1001859 | Ga0055529_10018596 | 196 |
| 32 | 3300003775 | Ga0055524_1001144 | Ga0055524_10011448 | 196 |
| 33 | 3300003794 | Ga0055531_10010137 | Ga0055531_100101374 | 196 |
| 34 | 3300005327 | Ga0070658_10027680 | Ga0070658_100276802 | 196 |
| 35 | 3300005356 | Ga0070674_100133706 | Ga0070674_1001337062 | 196 |
| 36 | 3300005539 | Ga0068853_100046275 | Ga0068853_1000462751 | 196 |
| 37 | 3300005548 | Ga0070665_100306506 | Ga0070665_1003065063 | 196 |
| 38 | 3300005548 | Ga0070665_100310859 | Ga0070665_1003108592 | 196 |
| 39 | 3300005577 | Ga0068857_100346664 | Ga0068857_1003466642 | 196 |
| 40 | 3300005577 | Ga0068857_101062743 | Ga0068857_1010627431 | 196 |
| 41 | 3300005578 | Ga0068854_100171209 | Ga0068854_1001712092 | 196 |
| 42 | 3300005614 | Ga0068856_100111381 | Ga0068856_1001113812 | 196 |
| 43 | 3300005616 | Ga0068852_100376932 | Ga0068852_1003769322 | 196 |
| 44 | 3300006038 | Ga0075365_10001929 | Ga0075365_100019296 | 196 |
| 45 | 3300006038 | Ga0075365_10040892 | Ga0075365_100408922 | 196 |
| 46 | 3300006038 | Ga0075365_10043590 | Ga0075365_100435903 | 196 |
| 47 | 3300006042 | Ga0075368_10044900 | Ga0075368_100449003 | 196 |
| 48 | 3300006051 | Ga0075364_10035265 | Ga0075364_100352653 | 196 |
| 49 | 3300006051 | Ga0075364_10039182 | Ga0075364_100391825 | 196 |
| 50 | 3300006177 | Ga0075362_10045337 | Ga0075362_100453372 | 196 |
| 51 | 3300006177 | Ga0075362_10305474 | Ga0075362_103054742 | 196 |
| 52 | 3300006178 | Ga0075367_10004358 | Ga0075367_100043581 | 196 |
| 53 | 3300006178 | Ga0075367_10019011 | Ga0075367_100190114 | 196 |
| 54 | 3300006178 | Ga0075367_10039830 | Ga0075367_100398303 | 196 |
| 55 | 3300006178 | Ga0075367_10206281 | Ga0075367_102062812 | 196 |
| 56 | 3300006186 | Ga0075369_10005979 | Ga0075369_100059793 | 196 |
| 57 | 3300006186 | Ga0075369_10038049 | Ga0075369_100380491 | 196 |
| 58 | 3300006353 | Ga0075370_10230305 | Ga0075370_102303052 | 196 |
| 59 | 3300006353 | Ga0075370_10247450 | Ga0075370_102474502 | 196 |
| 60 | 3300006946 | Ga0079104_1004473 | Ga0079104_10044735 | 196 |
| 61 | 3300006946 | Ga0079104_1007226 | Ga0079104_10072264 | 196 |
| 62 | 3300006948 | Ga0099826_10009775 | Ga0099826_100097757 | 196 |
| 63 | 3300009093 | Ga0105240_10637479 | Ga0105240_106374792 | 196 |
| 64 | 3300009101 | Ga0105247_10406684 | Ga0105247_104066842 | 196 |
| 65 | 3300009545 | Ga0105237_10213315 | Ga0105237_102133151 | 196 |
| 66 | 3300009551 | Ga0105238_10012176 | Ga0105238_100121767 | 196 |
| 67 | 3300009553 | Ga0105249_10518356 | Ga0105249_105183562 | 196 |
| 68 | 3300010375 | Ga0105239_10081120 | Ga0105239_100811202 | 196 |
| 69 | 3300010375 | Ga0105239_10248558 | Ga0105239_102485582 | 196 |
| 70 | 3300010375 | Ga0105239_10361696 | Ga0105239_103616962 | 196 |
| 71 | 3300010375 | Ga0105239_11054413 | Ga0105239_110544132 | 196 |
| 72 | 3300011119 | Ga0105246_10862399 | Ga0105246_108623992 | 196 |
| 73 | 3300014325 | Ga0163163_10279239 | Ga0163163_102792391 | 196 |
| 74 | 3300014326 | Ga0157380_10763163 | Ga0157380_107631632 | 196 |
| 75 | 3300014497 | Ga0182008_10049151 | Ga0182008_100491512 | 196 |
| 76 | 3300021320 | Ga0214544_1006450 | Ga0214544_100645011 | 196 |
| 77 | 3300021321 | Ga0214542_1000029 | Ga0214542_100002912 | 196 |
| 78 | 3300021321 | Ga0214542_1025934 | Ga0214542_10259342 | 196 |
| 79 | 3300021327 | Ga0214543_1000040 | Ga0214543_100004012 | 196 |
| 80 | 3300021327 | Ga0214543_1000049 | Ga0214543_1000049102 | 196 |
| 81 | 3300022739 | Ga0228711_1003229 | Ga0228711_10032297 | 196 |
| 82 | 3300022740 | Ga0228710_1000004 | Ga0228710_100000429 | 196 |
| 83 | 3300025250 | Ga0209026_1000005 | Ga0209026_1000005712 | 196 |
| 84 | 3300025254 | Ga0209148_1000078 | Ga0209148_1000078189 | 196 |
| 85 | 3300025254 | Ga0209148_1024328 | Ga0209148_10243282 | 196 |
| 86 | 3300025256 | Ga0209759_1000239 | Ga0209759_100023955 | 196 |
| 87 | 3300025261 | Ga0209233_1000047 | Ga0209233_1000047249 | 196 |
| 88 | 3300025263 | Ga0209565_1015883 | Ga0209565_10158832 | 196 |
| 89 | 3300025272 | Ga0209455_1000194 | Ga0209455_100019486 | 196 |
| 90 | 3300025294 | Ga0209025_1000105 | Ga0209025_100010557 | 196 |
| 91 | 3300025294 | Ga0209025_1049819 | Ga0209025_10498192 | 196 |
| 92 | 3300025297 | Ga0209758_1018328 | Ga0209758_10183282 | 196 |
| 93 | 3300025297 | Ga0209758_1050254 | Ga0209758_10502541 | 196 |
| 94 | 3300025299 | Ga0209256_1000027 | Ga0209256_100002759 | 196 |
| 95 | 3300025904 | Ga0207647_10017158 | Ga0207647_100171584 | 196 |
| 96 | 3300025907 | Ga0207645_10236719 | Ga0207645_102367192 | 196 |
| 97 | 3300025914 | Ga0207671_10035087 | Ga0207671_100350872 | 196 |
| 98 | 3300025914 | Ga0207671_10103285 | Ga0207671_101032853 | 196 |
| 99 | 3300025919 | Ga0207657_10253441 | Ga0207657_102534412 | 196 |
| 100 | 3300025924 | Ga0207694_10076577 | Ga0207694_100765772 | 196 |
| 101 | 3300025937 | Ga0207669_10232391 | Ga0207669_102323912 | 196 |
| 102 | 3300025937 | Ga0207669_10558317 | Ga0207669_105583171 | 196 |
| 103 | 3300026041 | Ga0207639_10028706 | Ga0207639_100287062 | 196 |
| 104 | 3300026041 | Ga0207639_10040125 | Ga0207639_100401254 | 196 |
| 105 | 3300026089 | Ga0207648_10153690 | Ga0207648_101536904 | 196 |
| 106 | 3300026116 | Ga0207674_10127654 | Ga0207674_101276543 | 196 |
| 107 | 3300026142 | Ga0207698_10148006 | Ga0207698_101480062 | 196 |
| 108 | 3300027111 | Ga0209281_1000134 | Ga0209281_100013435 | 196 |
| 109 | 3300027111 | Ga0209281_1000445 | Ga0209281_100044551 | 196 |
| 110 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009782 | 196 |
| 111 | 3300027312 | Ga0209371_1001016 | Ga0209371_100101618 | 196 |
| 112 | 3300027666 | Ga0209282_1000029 | Ga0209282_10000293 | 196 |
| 113 | 3300027666 | Ga0209282_1025331 | Ga0209282_10253312 | 196 |
| 114 | 3300027866 | Ga0209813_10071784 | Ga0209813_100717841 | 196 |
| 115 | 3300028379 | Ga0268266_10039602 | Ga0268266_100396025 | 196 |
| 116 | 3300028379 | Ga0268266_10258402 | Ga0268266_102584022 | 196 |
| 117 | 3300028794 | Ga0307515_10000029 | Ga0307515_10000029218 | 196 |
| 118 | 3300028794 | Ga0307515_10000277 | Ga0307515_1000027749 | 196 |
| 119 | 3300028794 | Ga0307515_10005710 | Ga0307515_1000571024 | 196 |
| 120 | 3300028794 | Ga0307515_10136809 | Ga0307515_101368092 | 196 |
| 121 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010781 | 196 |
| 122 | 3300030500 | Ga0268256_1005318 | Ga0268256_10053186 | 196 |
| 123 | 3300031456 | Ga0307513_10003029 | Ga0307513_1000302912 | 196 |
| 124 | 3300031911 | Ga0307412_10198393 | Ga0307412_101983933 | 196 |
| 125 | 3300031967 | Ga0315914_1000004 | Ga0315914_100000434 | 196 |
| 126 | 3300031995 | Ga0307409_100247978 | Ga0307409_1002479782 | 196 |
| 127 | 3300032002 | Ga0307416_100318575 | Ga0307416_1003185751 | 196 |
| 128 | 3300032002 | Ga0307416_100413082 | Ga0307416_1004130823 | 196 |
| 129 | 3300032002 | Ga0307416_100686042 | Ga0307416_1006860422 | 196 |
| 130 | 3300033430 | Ga0315913_1000370 | Ga0315913_10003702 | 196 |
| 131 | 3300033464 | Ga0315915_1000003 | Ga0315915_1000003141 | 196 |
| 132 | 3300035691 | Ga0373931_0160631 | Ga0373931_0160631_546_1184 | 196 |
| 133 | 3300037418 | Ga0395900_0044321 | Ga0395900_0044321_2417_3055 | 196 |
| 134 | 3300037418 | Ga0395900_0373102 | Ga0395900_0373102_737_1375 | 196 |
| 135 | 3300037418 | Ga0395900_0668407 | Ga0395900_0668407_169_807 | 196 |
| 136 | 3300037466 | Ga0395898_0813450 | Ga0395898_0813450_49_687 | 196 |
| 137 | 3300037471 | Ga0395905_0044744 | Ga0395905_0044744_3276_3914 | 196 |
| 138 | 3300037471 | Ga0395905_0047448 | Ga0395905_0047448_565_1212 | 196 |
| 139 | 3300037471 | Ga0395905_0082924 | Ga0395905_0082924_164_802 | 196 |
| 140 | 3300037471 | Ga0395905_0172370 | Ga0395905_0172370_163_804 | 196 |
| 141 | 3300037471 | Ga0395905_0309335 | Ga0395905_0309335_670_1308 | 196 |
| 142 | 3300037471 | Ga0395905_0746590 | Ga0395905_0746590_62_697 | 196 |
| 143 | 3300038443 | Ga0395901_0055397 | Ga0395901_0055397_2928_3569 | 196 |
| 144 | 3300038443 | Ga0395901_0357364 | Ga0395901_0357364_799_1437 | 196 |
| 145 | 3300038443 | Ga0395901_0951536 | Ga0395901_0951536_123_761 | 196 |
| 146 | 3300041413 | Ga0439465_0009030 | Ga0439465_0009030_1878_2528 | 196 |
| 147 | 3300042005 | Ga0439448_0120371 | Ga0439448_0120371_130_765 | 196 |
| 148 | 3300042136 | Ga0450900_008873 | Ga0450900_008873_140_778 | 196 |
| 149 | 3300044901 | Ga0466960_0018792 | Ga0466960_0018792_1809_2450 | 196 |
| 150 | 3300045976 | Ga0466967_0310148 | Ga0466967_0310148_749_1390 | 196 |
| 151 | 3300046460 | Ga0495638_0006811 | Ga0495638_0006811_6222_6863 | 196 |
| 152 | 3300046460 | Ga0495638_0227171 | Ga0495638_0227171_269_925 | 196 |
| 153 | 3300046460 | Ga0495638_0291378 | Ga0495638_0291378_195_827 | 196 |
| 154 | 3300046616 | Ga0495668_0117288 | Ga0495668_0117288_790_1425 | 196 |
| 155 | 3300046660 | Ga0495625_0025379 | Ga0495625_0025379_2223_2858 | 196 |
| 156 | 3300046660 | Ga0495625_0031385 | Ga0495625_0031385_707_1345 | 196 |
| 157 | 3300046674 | Ga0495588_0000559 | Ga0495588_0000559_7445_8083 | 196 |
| 158 | 3300046692 | Ga0495671_0013217 | Ga0495671_0013217_165_803 | 196 |
| 159 | 3300047470 | Ga0495681_0002200 | Ga0495681_0002200_11958_12596 | 196 |
| 160 | 3300048905 | Ga0496102_0064051 | Ga0496102_0064051_1923_2558 | 196 |
| 161 | 3300048905 | Ga0496102_0410744 | Ga0496102_0410744_271_912 | 196 |
| 162 | 3300048912 | Ga0496109_0241754 | Ga0496109_0241754_576_1232 | 196 |
| 163 | 3300048913 | Ga0496110_0213443 | Ga0496110_0213443_1078_1743 | 196 |
| 164 | 3300048918 | Ga0496115_0212255 | Ga0496115_0212255_475_1140 | 196 |
| 165 | 3300048919 | Ga0496116_0000026 | Ga0496116_0000026_43328_43966 | 196 |
| 166 | 3300048921 | Ga0496118_0062119 | Ga0496118_0062119_193_831 | 196 |
| 167 | 3300048921 | Ga0496118_0134211 | Ga0496118_0134211_258_923 | 196 |
| 168 | 3300048922 | Ga0496119_0000827 | Ga0496119_0000827_17738_18406 | 196 |
| 169 | 3300048922 | Ga0496119_0049823 | Ga0496119_0049823_727_1365 | 196 |
| 170 | 3300048923 | Ga0496120_0001220 | Ga0496120_0001220_3336_3974 | 196 |
| 171 | 3300048924 | Ga0496121_0451018 | Ga0496121_0451018_138_773 | 196 |
| 172 | 3300048925 | Ga0496122_0001094 | Ga0496122_0001094_28460_29122 | 196 |
| 173 | 3300048925 | Ga0496122_0026504 | Ga0496122_0026504_47_685 | 196 |
| 174 | 3300048926 | Ga0496123_0001198 | Ga0496123_0001198_17823_18485 | 196 |
| 175 | 3300048927 | Ga0496124_0000083 | Ga0496124_0000083_43402_44040 | 196 |
| 176 | 3300048927 | Ga0496124_0530940 | Ga0496124_0530940_124_762 | 196 |
| 177 | 3300048928 | Ga0496125_0079689 | Ga0496125_0079689_1765_2403 | 196 |
| 178 | 3300048928 | Ga0496125_0183659 | Ga0496125_0183659_460_1125 | 196 |
| 179 | 3300048929 | Ga0496126_0000069 | Ga0496126_0000069_234534_235172 | 196 |
| 180 | 3300048929 | Ga0496126_0480828 | Ga0496126_0480828_32_697 | 196 |
| 181 | 3300048929 | Ga0496126_0522218 | Ga0496126_0522218_219_857 | 196 |
| 182 | 3300048929 | Ga0496126_0664556 | Ga0496126_0664556_110_748 | 196 |
| 183 | 3300049568 | Ga0501031_0000003 | Ga0501031_0000003_153517_154173 | 196 |
| 184 | 3300049568 | Ga0501031_0110207 | Ga0501031_0110207_579_1223 | 196 |
| 185 | 3300049568 | Ga0501031_0170555 | Ga0501031_0170555_278_916 | 196 |
| 186 | 3300049568 | Ga0501031_0205516 | Ga0501031_0205516_579_1244 | 196 |
| 187 | 3300049568 | Ga0501031_0225275 | Ga0501031_0225275_256_891 | 196 |
| 188 | 3300049568 | Ga0501031_0227647 | Ga0501031_0227647_146_787 | 196 |
| 189 | 3300049569 | Ga0501032_0000010 | Ga0501032_0000010_153517_154173 | 196 |
| 190 | 3300049569 | Ga0501032_0000546 | Ga0501032_0000546_19724_20389 | 196 |
| 191 | 3300049569 | Ga0501032_0038298 | Ga0501032_0038298_2466_3107 | 196 |
| 192 | 3300049569 | Ga0501032_0106271 | Ga0501032_0106271_1033_1677 | 196 |
| 193 | 3300049569 | Ga0501032_0433747 | Ga0501032_0433747_141_776 | 196 |
| 194 | 3300049569 | Ga0501032_0433748 | Ga0501032_0433748_67_702 | 196 |
| 195 | 3300049570 | Ga0501033_0000017 | Ga0501033_0000017_153517_154173 | 196 |
| 196 | 3300049570 | Ga0501033_0007011 | Ga0501033_0007011_1243_1908 | 196 |
| 197 | 3300049570 | Ga0501033_0075934 | Ga0501033_0075934_923_1567 | 196 |
| 198 | 3300049570 | Ga0501033_0129466 | Ga0501033_0129466_1059_1700 | 196 |
| 199 | 3300049570 | Ga0501033_0160323 | Ga0501033_0160323_775_1413 | 196 |
| 200 | 3300049570 | Ga0501033_0218163 | Ga0501033_0218163_625_1260 | 196 |
| 201 | 3300049570 | Ga0501033_0498522 | Ga0501033_0498522_67_702 | 196 |
| 202 | 3300049570 | Ga0501033_0498525 | Ga0501033_0498525_141_776 | 196 |
| 203 | 3300049571 | Ga0501034_0000053 | Ga0501034_0000053_52649_53305 | 196 |
| 204 | 3300049571 | Ga0501034_0001507 | Ga0501034_0001507_10141_10806 | 196 |
| 205 | 3300049571 | Ga0501034_0292788 | Ga0501034_0292788_67_702 | 196 |
| 206 | 3300049571 | Ga0501034_0371301 | Ga0501034_0371301_669_1319 | 196 |
| 207 | 3300049571 | Ga0501034_0380632 | Ga0501034_0380632_670_1314 | 196 |
| 208 | 3300049571 | Ga0501034_0477428 | Ga0501034_0477428_159_818 | 196 |
| 209 | 3300049571 | Ga0501034_0554374 | Ga0501034_0554374_403_1047 | 196 |
| 210 | 3300049571 | Ga0501034_0789890 | Ga0501034_0789890_141_776 | 196 |
| 211 | 3300049572 | Ga0501036_0000009 | Ga0501036_0000009_153517_154173 | 196 |
| 212 | 3300049572 | Ga0501036_0001029 | Ga0501036_0001029_666_1331 | 196 |
| 213 | 3300049572 | Ga0501036_0145208 | Ga0501036_0145208_728_1372 | 196 |
| 214 | 3300049572 | Ga0501036_0440654 | Ga0501036_0440654_67_702 | 196 |
| 215 | 3300049572 | Ga0501036_0692168 | Ga0501036_0692168_67_702 | 196 |
| 216 | 3300049573 | Ga0501037_0000008 | Ga0501037_0000008_52640_53296 | 196 |
| 217 | 3300049573 | Ga0501037_0000838 | Ga0501037_0000838_2607_3272 | 196 |
| 218 | 3300049573 | Ga0501037_0029710 | Ga0501037_0029710_1607_2242 | 196 |
| 219 | 3300049573 | Ga0501037_0278986 | Ga0501037_0278986_389_1027 | 196 |
| 220 | 3300049574 | Ga0501038_0000008 | Ga0501038_0000008_52649_53305 | 196 |
| 221 | 3300049574 | Ga0501038_0002532 | Ga0501038_0002532_7020_7685 | 196 |
| 222 | 3300049574 | Ga0501038_0052723 | Ga0501038_0052723_667_1323 | 196 |
| 223 | 3300049574 | Ga0501038_0588889 | Ga0501038_0588889_67_702 | 196 |
| 224 | 3300049574 | Ga0501038_0588893 | Ga0501038_0588893_67_702 | 196 |
| 225 | 3300049575 | Ga0501039_0000021 | Ga0501039_0000021_109248_109904 | 196 |
| 226 | 3300049575 | Ga0501039_0001378 | Ga0501039_0001378_10141_10806 | 196 |
| 227 | 3300049575 | Ga0501039_0081398 | Ga0501039_0081398_293_949 | 196 |
| 228 | 3300049575 | Ga0501039_0626571 | Ga0501039_0626571_67_702 | 196 |
| 229 | 3300049576 | Ga0501040_0007087 | Ga0501040_0007087_6515_7171 | 196 |
| 230 | 3300049576 | Ga0501040_0240431 | Ga0501040_0240431_616_1272 | 196 |
| 231 | 3300049579 | Ga0501043_0000043 | Ga0501043_0000043_105409_106074 | 196 |
| 232 | 3300049579 | Ga0501043_0000656 | Ga0501043_0000656_10597_11253 | 196 |
| 233 | 3300049579 | Ga0501043_0029929 | Ga0501043_0029929_378_1013 | 196 |
| 234 | 3300049579 | Ga0501043_0044479 | Ga0501043_0044479_62_697 | 196 |
| 235 | 3300049579 | Ga0501043_0077343 | Ga0501043_0077343_1246_1890 | 196 |
| 236 | 3300049580 | Ga0501046_0074049 | Ga0501046_0074049_867_1508 | 196 |
| 237 | 3300049580 | Ga0501046_0133477 | Ga0501046_0133477_1194_1859 | 196 |
| 238 | 3300049581 | Ga0501047_0004274 | Ga0501047_0004274_10704_11360 | 196 |
| 239 | 3300049581 | Ga0501047_0049899 | Ga0501047_0049899_3265_3900 | 196 |
| 240 | 3300049581 | Ga0501047_0111020 | Ga0501047_0111020_881_1522 | 196 |
| 241 | 3300049581 | Ga0501047_0250744 | Ga0501047_0250744_83_712 | 196 |
| 242 | 3300049581 | Ga0501047_0693987 | Ga0501047_0693987_60_695 | 196 |
| 243 | 3300049582 | Ga0501048_0008441 | Ga0501048_0008441_3905_4540 | 196 |
| 244 | 3300049582 | Ga0501048_0041326 | Ga0501048_0041326_1074_1730 | 196 |
| 245 | 3300049582 | Ga0501048_0142045 | Ga0501048_0142045_495_1136 | 196 |
| 246 | 3300049584 | Ga0501068_0096943 | Ga0501068_0096943_49_684 | 196 |
| 247 | 3300049586 | Ga0501070_0007145 | Ga0501070_0007145_6845_7501 | 196 |
| 248 | 3300049586 | Ga0501070_0046063 | Ga0501070_0046063_2980_3615 | 196 |
| 249 | 3300049586 | Ga0501070_0510277 | Ga0501070_0510277_145_786 | 196 |
| 250 | 3300049586 | Ga0501070_0670508 | Ga0501070_0670508_23_652 | 196 |
| 251 | 3300049587 | Ga0501071_0071456 | Ga0501071_0071456_16_648 | 196 |
| 252 | 3300049587 | Ga0501071_0757966 | Ga0501071_0757966_12_677 | 196 |
| 253 | 3300049588 | Ga0501072_0324716 | Ga0501072_0324716_26_661 | 196 |
| 254 | 3300049589 | Ga0501073_0039790 | Ga0501073_0039790_35_694 | 196 |
| 255 | 3300049589 | Ga0501073_0102417 | Ga0501073_0102417_1129_1764 | 196 |
| 256 | 3300049590 | Ga0501074_0017395 | Ga0501074_0017395_1073_1708 | 196 |
| 257 | 3300049591 | Ga0501075_0011120 | Ga0501075_0011120_1955_2611 | 196 |
| 258 | 3300049741 | Ga0501079_0017789 | Ga0501079_0017789_4641_5297 | 196 |
| 259 | 3300049742 | Ga0501080_0040744 | Ga0501080_0040744_2694_3329 | 196 |
| 260 | 3300049742 | Ga0501080_0376960 | Ga0501080_0376960_339_980 | 196 |
| 261 | 3300049742 | Ga0501080_0530444 | Ga0501080_0530444_325_984 | 196 |
| 262 | 3300049744 | Ga0501083_0094228 | Ga0501083_0094228_533_1168 | 196 |
| 263 | 3300049744 | Ga0501083_0216982 | Ga0501083_0216982_16_675 | 196 |
| 264 | 3300049822 | Ga0501035_0000023 | Ga0501035_0000023_153517_154173 | 196 |
| 265 | 3300049822 | Ga0501035_0000958 | Ga0501035_0000958_19724_20389 | 196 |
| 266 | 3300049822 | Ga0501035_0060685 | Ga0501035_0060685_969_1607 | 196 |
| 267 | 3300049822 | Ga0501035_0082530 | Ga0501035_0082530_1488_2129 | 196 |
| 268 | 3300049822 | Ga0501035_0107342 | Ga0501035_0107342_1133_1771 | 196 |
| 269 | 3300049822 | Ga0501035_0196300 | Ga0501035_0196300_980_1624 | 196 |
| 270 | 3300049822 | Ga0501035_0209854 | Ga0501035_0209854_93_728 | 196 |
| 271 | 3300049822 | Ga0501035_0337229 | Ga0501035_0337229_179_817 | 196 |
| 272 | 3300049822 | Ga0501035_0665820 | Ga0501035_0665820_141_776 | 196 |
| 273 | 3300049822 | Ga0501035_0665824 | Ga0501035_0665824_67_702 | 196 |
| 274 | 3300049823 | Ga0501044_0000021 | Ga0501044_0000021_52649_53305 | 196 |
| 275 | 3300049823 | Ga0501044_0018996 | Ga0501044_0018996_2178_2816 | 196 |
| 276 | 3300049823 | Ga0501044_0096604 | Ga0501044_0096604_1979_2644 | 196 |
| 277 | 3300049823 | Ga0501044_0224868 | Ga0501044_0224868_894_1538 | 196 |
| 278 | 3300049823 | Ga0501044_0771201 | Ga0501044_0771201_141_776 | 196 |
| 279 | 3300049823 | Ga0501044_0771202 | Ga0501044_0771202_67_702 | 196 |
| 280 | 3300050489 | nmdc:mga03683_3508_c1 | nmdc:mga03683_3508_c1_1700_2365 | 196 |
| 281 | 3300050490 | nmdc:mga03n38_222068_c1 | nmdc:mga03n38_222068_c1_193_828 | 196 |
| 282 | 3300050490 | nmdc:mga03n38_24210_c1 | nmdc:mga03n38_24210_c1_675_1340 | 196 |
| 283 | 3300050490 | nmdc:mga03n38_341903_c1 | nmdc:mga03n38_341903_c1_72_707 | 196 |
| 284 | 3300050491 | nmdc:mga00v17_60381_c1 | nmdc:mga00v17_60381_c1_437_1102 | 196 |
| 285 | 3300050492 | nmdc:mga0yw44_130983_c1 | nmdc:mga0yw44_130983_c1_92_757 | 196 |
| 286 | 3300050492 | nmdc:mga0yw44_18598_c1 | nmdc:mga0yw44_18598_c1_1411_2046 | 196 |
| 287 | 3300050492 | nmdc:mga0yw44_2158_c1 | nmdc:mga0yw44_2158_c1_271_906 | 196 |
| 288 | 3300050492 | nmdc:mga0yw44_40990_c1 | nmdc:mga0yw44_40990_c1_1175_1840 | 196 |
| 289 | 3300050493 | nmdc:mga0k408_285784_c1 | nmdc:mga0k408_285784_c1_46_696 | 196 |
| 290 | 3300050494 | nmdc:mga06z11_108525_c1 | nmdc:mga06z11_108525_c1_830_1495 | 196 |
| 291 | 3300050494 | nmdc:mga06z11_251023_c1 | nmdc:mga06z11_251023_c1_244_882 | 196 |
| 292 | 3300050494 | nmdc:mga06z11_482724_c1 | nmdc:mga06z11_482724_c1_24_659 | 196 |
| 293 | 3300050496 | nmdc:mga07m45_164586_c1 | nmdc:mga07m45_164586_c1_467_1132 | 196 |
| 294 | 3300050496 | nmdc:mga07m45_229652_c1 | nmdc:mga07m45_229652_c1_232_867 | 196 |
| 295 | 3300050516 | nmdc:mga0sz30_35723_c1 | nmdc:mga0sz30_35723_c1_132_770 | 196 |
| 296 | 3300050516 | nmdc:mga0sz30_43965_c2 | nmdc:mga0sz30_43965_c2_427_1062 | 196 |
| 297 | 3300053083 | Ga0495655_0098972 | Ga0495655_0098972_138_803 | 196 |
| 298 | 3300053104 | Ga0500556_0000124 | Ga0500556_0000124_34538_35206 | 196 |
| 299 | 3300053107 | Ga0500560_002097 | Ga0500560_002097_2842_3480 | 196 |
| 300 | 3300053111 | Ga0500572_001261 | Ga0500572_001261_4811_5452 | 196 |
| 301 | 3300053131 | Ga0500652_166684 | Ga0500652_166684_71_739 | 196 |
| 302 | 3300053139 | Ga0500568_0001216 | Ga0500568_0001216_13923_14552 | 196 |
| 303 | 3300053140 | Ga0500573_0296573 | Ga0500573_0296573_161_799 | 196 |
| 304 | 3300053151 | Ga0500604_0089761 | Ga0500604_0089761_330_965 | 196 |
| 305 | 3300053153 | Ga0500616_0077825 | Ga0500616_0077825_142_786 | 196 |
| 306 | 3300053155 | Ga0500620_079823 | Ga0500620_079823_80_715 | 196 |
| 307 | 3300053157 | Ga0500624_000477 | Ga0500624_000477_4807_5445 | 196 |
| 308 | 3300053158 | Ga0500627_0088440 | Ga0500627_0088440_456_1091 | 196 |
| 309 | 3300053158 | Ga0500627_0156522 | Ga0500627_0156522_85_735 | 196 |
| 310 | 3300053161 | Ga0500634_0013936 | Ga0500634_0013936_3284_3922 | 196 |
| 311 | 3300053161 | Ga0500634_0086605 | Ga0500634_0086605_593_1231 | 196 |
| 312 | 3300053177 | Ga0500636_0000069 | Ga0500636_0000069_19873_20511 | 196 |
| 313 | 3300053177 | Ga0500636_0001346 | Ga0500636_0001346_8182_8823 | 196 |
| 314 | 3300053727 | Ga0500611_027556 | Ga0500611_027556_311_940 | 196 |
| 315 | 3300059605 | Ga0587106_044095 | Ga0587106_044095_63_728 | 196 |
| 316 | 3300060353 | Ga0501082_0355897 | Ga0501082_0355897_557_1198 | 196 |
| 317 | 3300060353 | Ga0501082_0453459 | Ga0501082_0453459_61_720 | 196 |
| 318 | 3300061734 | Ga0530510_0034914 | Ga0530510_0034914_93_749 | 196 |
| 319 | iso_pu_bacteria | 2503198000 | 2503200758 | 196 |
| 320 | iso_pu_bacteria | 2508501122 | 2509111779 | 196 |
| 321 | iso_pu_bacteria | 2508501123 | 2509118944 | 196 |
| 322 | iso_pu_bacteria | 2508501127 | 2509141193 | 196 |
| 323 | iso_pu_bacteria | 2508501127 | 2509146243 | 196 |
| 324 | iso_pu_bacteria | 2509276018 | 2509369029 | 196 |
| 325 | iso_pu_bacteria | 2509276019 | 2509375407 | 196 |
| 326 | iso_pu_bacteria | 2509276022 | 2509395594 | 196 |
| 327 | iso_pu_bacteria | 2510065057 | 2510308146 | 196 |
| 328 | iso_pu_bacteria | 2510065059 | 2510316155 | 196 |
| 329 | iso_pu_bacteria | 2511231027 | 2511390734 | 196 |
| 330 | iso_pu_bacteria | 2511231052 | 2511498925 | 196 |
| 331 | iso_pu_bacteria | 2512875016 | 2512929098 | 196 |
| 332 | iso_pu_bacteria | 2512875024 | 2512963654 | 196 |
| 333 | iso_pu_bacteria | 2512875026 | 2512973125 | 196 |
| 334 | iso_pu_bacteria | 2513237086 | 2513587193 | 196 |
| 335 | iso_pu_bacteria | 2513237087 | 2513594120 | 196 |
| 336 | iso_pu_bacteria | 2513237090 | 2513607778 | 196 |
| 337 | iso_pu_bacteria | 2513237091 | 2513616217 | 196 |
| 338 | iso_pu_bacteria | 2513237140 | 2513882630 | 196 |
| 339 | iso_pu_bacteria | 2513237143 | 2513904613 | 196 |
| 340 | iso_pu_bacteria | 2513237159 | 2513996398 | 196 |
| 341 | iso_pu_bacteria | 2513237164 | 2514039759 | 196 |
| 342 | iso_pu_bacteria | 2513237305 | 2514421658 | 196 |
| 343 | iso_pu_bacteria | 2513237351 | 2514590814 | 196 |
| 344 | iso_pu_bacteria | 2516653046 | 2516895201 | 196 |
| 345 | iso_pu_bacteria | 2524023207 | 2524450916 | 196 |
| 346 | iso_pu_bacteria | 2534681786 | 2535486331 | 196 |
| 347 | iso_pu_bacteria | 2537561587 | 2537873429 | 196 |
| 348 | iso_pu_bacteria | 2551306084 | 2551675237 | 196 |
| 349 | iso_pu_bacteria | 2551306085 | 2551686984 | 196 |
| 350 | iso_pu_bacteria | 2551306086 | 2551696598 | 196 |
| 351 | iso_pu_bacteria | 2551306087 | 2551704793 | 196 |
| 352 | iso_pu_bacteria | 2551306089 | 2551709664 | 196 |
| 353 | iso_pu_bacteria | 2551306090 | 2551716508 | 196 |
| 354 | iso_pu_bacteria | 2551306091 | 2551726703 | 196 |
| 355 | iso_pu_bacteria | 2551306092 | 2551737502 | 196 |
| 356 | iso_pu_bacteria | 2551306093 | 2551743130 | 196 |
| 357 | iso_pu_bacteria | 2558860100 | 2558866503 | 196 |
| 358 | iso_pu_bacteria | 2582581306 | 2585264848 | 196 |
| 359 | iso_pu_bacteria | 2582581865 | 2585386096 | 196 |
| 360 | iso_pu_bacteria | 2582581866 | 2585394659 | 196 |
| 361 | iso_pu_bacteria | 2588253730 | 2588514637 | 196 |
| 362 | iso_pu_bacteria | 2599185210 | 2599604419 | 196 |
| 363 | iso_pu_bacteria | 2599185301 | 2599940536 | 196 |
| 364 | iso_pu_bacteria | 2599185352 | 2600197564 | 196 |
| 365 | iso_pu_bacteria | 2643221550 | 2643772313 | 196 |
| 366 | iso_pu_bacteria | 2643221551 | 2643774433 | 196 |
| 367 | iso_pu_bacteria | 2643221555 | 2643792878 | 196 |
| 368 | iso_pu_bacteria | 2643221557 | 2643805884 | 196 |
| 369 | iso_pu_bacteria | 2643221558 | 2643812599 | 196 |
| 370 | iso_pu_bacteria | 2643221582 | 2643920697 | 196 |
| 371 | iso_pu_bacteria | 2643221595 | 2643988080 | 196 |
| 372 | iso_pu_bacteria | 2643221610 | 2644066061 | 196 |
| 373 | iso_pu_bacteria | 2643221623 | 2644132550 | 196 |
| 374 | iso_pu_bacteria | 2643221627 | 2644155568 | 196 |
| 375 | iso_pu_bacteria | 2643221668 | 2644380365 | 196 |
| 376 | iso_pu_bacteria | 2643221675 | 2644417392 | 196 |
| 377 | iso_pu_bacteria | 2643221680 | 2644450788 | 196 |
| 378 | iso_pu_bacteria | 2643221726 | 2644692788 | 196 |
| 379 | iso_pu_bacteria | 2687453392 | 2688597889 | 196 |
| 380 | iso_pu_bacteria | 2690316117 | 2692317675 | 196 |
| 381 | iso_pu_bacteria | 2693429783 | 2694628950 | 196 |
| 382 | iso_pu_bacteria | 2693429784 | 2694637135 | 196 |
| 383 | iso_pu_bacteria | 2721755686 | 2723578180 | 196 |
| 384 | iso_pu_bacteria | 2738543024 | 2739309560 | 196 |
| 385 | iso_pu_bacteria | 2751185800 | 2753357752 | 196 |
| 386 | iso_pu_bacteria | 2751185821 | 2753459874 | 196 |
| 387 | iso_pu_bacteria | 2756170246 | 2756676223 | 196 |
| 388 | iso_pu_bacteria | 2757320392 | 2757569315 | 196 |
| 389 | iso_pu_bacteria | 2758568016 | 2758640329 | 196 |
| 390 | iso_pu_bacteria | 2765235802 | 2765464440 | 196 |
| 391 | iso_pu_bacteria | 2767802442 | 2770194803 | 196 |
| 392 | iso_pu_bacteria | 2775506902 | 2776272407 | 196 |
| 393 | iso_pu_bacteria | 2775506904 | 2776284347 | 196 |
| 394 | iso_pu_bacteria | 2791355091 | 2792621043 | 196 |
| 395 | iso_pu_bacteria | 2791355092 | 2792625258 | 196 |
| 396 | iso_pu_bacteria | 2791355123 | 2792750028 | 196 |
| 397 | iso_pu_bacteria | 2802428858 | 2802718694 | 196 |
| 398 | iso_pu_bacteria | 2802428862 | 2802742223 | 196 |
| 399 | iso_pu_bacteria | 2802428863 | 2802748906 | 196 |
| 400 | iso_pu_bacteria | 2818991439 | 2819556766 | 196 |
| 401 | iso_pu_bacteria | 2838675328 | 2838677501 | 196 |
| 402 | iso_pu_bacteria | 2838714209 | 2838716390 | 196 |
| 403 | iso_pu_bacteria | 2838719591 | 2838719810 | 196 |
| 404 | iso_pu_bacteria | 2838724970 | 2838727141 | 196 |
| 405 | iso_pu_bacteria | 2839993093 | 2839994354 | 196 |
| 406 | iso_pu_bacteria | 2840764183 | 2840764905 | 196 |
| 407 | iso_pu_bacteria | 2841734538 | 2841735575 | 196 |
| 408 | iso_pu_bacteria | 2841846520 | 2841846741 | 196 |
| 409 | iso_pu_bacteria | 2841859092 | 2841860730 | 196 |
| 410 | iso_pu_bacteria | 2842124991 | 2842127230 | 196 |
| 411 | iso_pu_bacteria | 2842130223 | 2842132394 | 196 |
| 412 | iso_pu_bacteria | 2842152218 | 2842152437 | 196 |
| 413 | iso_pu_bacteria | 2842170452 | 2842172635 | 196 |
| 414 | iso_pu_bacteria | 2842175837 | 2842176056 | 196 |
| 415 | iso_pu_bacteria | 2842187318 | 2842189497 | 196 |
| 416 | iso_pu_bacteria | 2842211629 | 2842213811 | 196 |
| 417 | iso_pu_bacteria | 2842224351 | 2842224571 | 196 |
| 418 | iso_pu_bacteria | 2842515876 | 2842517515 | 196 |
| 419 | iso_pu_bacteria | 2842521101 | 2842521318 | 196 |
| 420 | iso_pu_bacteria | 2842871566 | 2842873564 | 196 |
| 421 | iso_pu_bacteria | 2844002411 | 2844004859 | 196 |
| 422 | iso_pu_bacteria | 2844009547 | 2844009619 | 196 |
| 423 | iso_pu_bacteria | 2847417321 | 2847421346 | 196 |
| 424 | iso_pu_bacteria | 2847670302 | 2847672557 | 196 |
| 425 | iso_pu_bacteria | 2847686936 | 2847691857 | 196 |
| 426 | iso_pu_bacteria | 2848992105 | 2848996131 | 196 |
| 427 | iso_pu_bacteria | 2850079185 | 2850079527 | 196 |
| 428 | iso_pu_bacteria | 2854911287 | 2854914999 | 196 |
| 429 | iso_pu_bacteria | 2855825444 | 2855827839 | 196 |
| 430 | iso_pu_bacteria | 2855839649 | 2855843207 | 196 |
| 431 | iso_pu_bacteria | 2855872281 | 2855877839 | 196 |
| 432 | iso_pu_bacteria | 2856314179 | 2856315785 | 196 |
| 433 | iso_pu_bacteria | 2856328259 | 2856329984 | 196 |
| 434 | iso_pu_bacteria | 2856334872 | 2856337131 | 196 |
| 435 | iso_pu_bacteria | 2856342000 | 2856347721 | 196 |
| 436 | iso_pu_bacteria | 2856349417 | 2856355384 | 196 |
| 437 | iso_pu_bacteria | 2856356410 | 2856358615 | 196 |
| 438 | iso_pu_bacteria | 2856364286 | 2856367652 | 196 |
| 439 | iso_pu_bacteria | 2857349434 | 2857353595 | 196 |
| 440 | iso_pu_bacteria | 2857367948 | 2857374996 | 196 |
| 441 | iso_pu_bacteria | 2858800743 | 2858802935 | 196 |
| 442 | iso_pu_bacteria | 2869162929 | 2869163876 | 196 |
| 443 | iso_pu_bacteria | 2869249662 | 2869254322 | 196 |
| 444 | iso_pu_bacteria | 2869256925 | 2869263952 | 196 |
| 445 | iso_pu_bacteria | 2869264136 | 2869270656 | 196 |
| 446 | iso_pu_bacteria | 2869271264 | 2869277888 | 196 |
| 447 | iso_pu_bacteria | 2869278585 | 2869284436 | 196 |
| 448 | iso_pu_bacteria | 2869285874 | 2869286860 | 196 |
| 449 | iso_pu_bacteria | 2871429161 | 2871434124 | 196 |
| 450 | iso_pu_bacteria | 2871435913 | 2871439407 | 196 |
| 451 | iso_pu_bacteria | 2871444079 | 2871449262 | 196 |
| 452 | iso_pu_bacteria | 2871451962 | 2871452379 | 196 |
| 453 | iso_pu_bacteria | 2871459585 | 2871465525 | 196 |
| 454 | iso_pu_bacteria | 2871466892 | 2871472552 | 196 |
| 455 | iso_pu_bacteria | 2871474448 | 2871479129 | 196 |
| 456 | iso_pu_bacteria | 2871481445 | 2871481784 | 196 |
| 457 | iso_pu_bacteria | 2871488783 | 2871490020 | 196 |
| 458 | iso_pu_bacteria | 2871495908 | 2871501865 | 196 |
| 459 | iso_pu_bacteria | 2874102143 | 2874102862 | 196 |
| 460 | iso_pu_bacteria | 2874109183 | 2874111666 | 196 |
| 461 | iso_pu_bacteria | 2874116593 | 2874121718 | 196 |
| 462 | iso_pu_bacteria | 2874123672 | 2874126864 | 196 |
| 463 | iso_pu_bacteria | 2874139085 | 2874139102 | 196 |
| 464 | iso_pu_bacteria | 2874146452 | 2874147782 | 196 |
| 465 | iso_pu_bacteria | 2874155637 | 2874156700 | 196 |
| 466 | iso_pu_bacteria | 2874162495 | 2874163967 | 196 |
| 467 | iso_pu_bacteria | 2874168670 | 2874169973 | 196 |
| 468 | iso_pu_bacteria | 2876363079 | 2876369564 | 196 |
| 469 | iso_pu_bacteria | 2876377896 | 2876382121 | 196 |
| 470 | iso_pu_bacteria | 2876386047 | 2876392085 | 196 |
| 471 | iso_pu_bacteria | 2876392853 | 2876393857 | 196 |
| 472 | iso_pu_bacteria | 2876399893 | 2876401625 | 196 |
| 473 | iso_pu_bacteria | 2876406927 | 2876412366 | 196 |
| 474 | iso_pu_bacteria | 2876413966 | 2876414726 | 196 |
| 475 | iso_pu_bacteria | 2876420981 | 2876423356 | 196 |
| 476 | iso_pu_bacteria | 2878035449 | 2878042405 | 196 |
| 477 | iso_pu_bacteria | 2878738818 | 2878739949 | 196 |
| 478 | iso_pu_bacteria | 2878745973 | 2878746834 | 196 |
| 479 | iso_pu_bacteria | 2878753008 | 2878756067 | 196 |
| 480 | iso_pu_bacteria | 2878760144 | 2878765898 | 196 |
| 481 | iso_pu_bacteria | 2878767105 | 2878772572 | 196 |
| 482 | iso_pu_bacteria | 2878774303 | 2878775390 | 196 |
| 483 | iso_pu_bacteria | 2878781027 | 2878786057 | 196 |
| 484 | iso_pu_bacteria | 2881147464 | 2881154583 | 196 |
| 485 | iso_pu_bacteria | 2881161766 | 2881163695 | 196 |
| 486 | iso_pu_bacteria | 2881845957 | 2881846849 | 196 |
| 487 | iso_pu_bacteria | 2881853255 | 2881857409 | 196 |
| 488 | iso_pu_bacteria | 2881861095 | 2881866151 | 196 |
| 489 | iso_pu_bacteria | 2882632389 | 2882634247 | 196 |
| 490 | iso_pu_bacteria | 2882912400 | 2882917396 | 196 |
| 491 | iso_pu_bacteria | 2885305155 | 2885308868 | 196 |
| 492 | iso_pu_bacteria | 2885312484 | 2885318751 | 196 |
| 493 | iso_pu_bacteria | 2885342637 | 2885345195 | 196 |
| 494 | iso_pu_bacteria | 2885350715 | 2885356593 | 196 |
| 495 | iso_pu_bacteria | 2888337043 | 2888342310 | 196 |
| 496 | iso_pu_bacteria | 2888343758 | 2888346360 | 196 |
| 497 | iso_pu_bacteria | 2888350351 | 2888351433 | 196 |
| 498 | iso_pu_bacteria | 2889010040 | 2889013721 | 196 |
| 499 | iso_pu_bacteria | 2889016732 | 2889021571 | 196 |
| 500 | iso_pu_bacteria | 2899792073 | 2899794479 | 196 |
| 501 | iso_pu_bacteria | 2903448605 | 2903453152 | 196 |
| 502 | iso_pu_bacteria | 2903492973 | 2903497939 | 196 |
| 503 | iso_pu_bacteria | 2903492973 | 2903500722 | 196 |
| 504 | iso_pu_bacteria | 2903513507 | 2903519453 | 196 |
| 505 | iso_pu_bacteria | 2903521522 | 2903526834 | 196 |
| 506 | iso_pu_bacteria | 2903528002 | 2903530167 | 196 |
| 507 | iso_pu_bacteria | 2903540706 | 2903546844 | 196 |
| 508 | iso_pu_bacteria | 2904578770 | 2904578969 | 196 |
| 509 | iso_pu_bacteria | 2904659560 | 2904660582 | 196 |
| 510 | iso_pu_bacteria | 2906308376 | 2906309214 | 196 |
| 511 | iso_pu_bacteria | 2906321335 | 2906326821 | 196 |
| 512 | iso_pu_bacteria | 2906328253 | 2906331892 | 196 |
| 513 | iso_pu_bacteria | 2906354277 | 2906359068 | 196 |
| 514 | iso_pu_bacteria | 2906363423 | 2906368256 | 196 |
| 515 | iso_pu_bacteria | 2906370794 | 2906373846 | 196 |
| 516 | iso_pu_bacteria | 2906378014 | 2906385539 | 196 |
| 517 | iso_pu_bacteria | 2906386501 | 2906393236 | 196 |
| 518 | iso_pu_bacteria | 2906393657 | 2906400787 | 196 |
| 519 | iso_pu_bacteria | 2906401398 | 2906407168 | 196 |
| 520 | iso_pu_bacteria | 2906408224 | 2906409654 | 196 |
| 521 | iso_pu_bacteria | 2906414383 | 2906415922 | 196 |
| 522 | iso_pu_bacteria | 2913295892 | 2913298340 | 196 |
| 523 | iso_pu_bacteria | 2915986958 | 2915989798 | 196 |
| 524 | iso_pu_bacteria | 2915993759 | 2915998260 | 196 |
| 525 | iso_pu_bacteria | 2916000859 | 2916004919 | 196 |
| 526 | iso_pu_bacteria | 2916007675 | 2916014215 | 196 |
| 527 | iso_pu_bacteria | 2916014648 | 2916016070 | 196 |
| 528 | iso_pu_bacteria | 2916021584 | 2916027990 | 196 |
| 529 | iso_pu_bacteria | 2916028427 | 2916029642 | 196 |
| 530 | iso_pu_bacteria | 2916035215 | 2916040537 | 196 |
| 531 | iso_pu_bacteria | 2916041962 | 2916047409 | 196 |
| 532 | iso_pu_bacteria | 2916048683 | 2916054854 | 196 |
| 533 | iso_pu_bacteria | 2916055098 | 2916058960 | 196 |
| 534 | iso_pu_bacteria | 2916068649 | 2916072598 | 196 |
| 535 | iso_pu_bacteria | 2916076590 | 2916078757 | 196 |
| 536 | iso_pu_bacteria | 2919114240 | 2919116607 | 196 |
| 537 | iso_pu_bacteria | 2919119836 | 2919122204 | 196 |
| 538 | iso_pu_bacteria | 2919166419 | 2919168240 | 196 |
| 539 | iso_pu_bacteria | 2921201388 | 2921207752 | 196 |
| 540 | iso_pu_bacteria | 2921208531 | 2921211529 | 196 |
| 541 | iso_pu_bacteria | 2921237296 | 2921243380 | 196 |
| 542 | iso_pu_bacteria | 2921244191 | 2921249773 | 196 |
| 543 | iso_pu_bacteria | 2921257292 | 2921263537 | 196 |
| 544 | iso_pu_bacteria | 2921263974 | 2921269454 | 196 |
| 545 | iso_pu_bacteria | 2921282425 | 2921285226 | 196 |
| 546 | iso_pu_bacteria | 2921289301 | 2921291465 | 196 |
| 547 | iso_pu_bacteria | 2921296804 | 2921299146 | 196 |
| 548 | iso_pu_bacteria | 2922130491 | 2922136003 | 196 |
| 549 | iso_pu_bacteria | 2922151315 | 2922156512 | 196 |
| 550 | iso_pu_bacteria | 2922158528 | 2922160561 | 196 |
| 551 | iso_pu_bacteria | 2922172374 | 2922175096 | 196 |
| 552 | iso_pu_bacteria | 2922185730 | 2922189620 | 196 |
| 553 | iso_pu_bacteria | 2924144063 | 2924149144 | 196 |
| 554 | iso_pu_bacteria | 2924150972 | 2924153294 | 196 |
| 555 | iso_pu_bacteria | 2924158325 | 2924164531 | 196 |
| 556 | iso_pu_bacteria | 2924165586 | 2924171647 | 196 |
| 557 | iso_pu_bacteria | 2924172951 | 2924177380 | 196 |
| 558 | iso_pu_bacteria | 2924179722 | 2924185574 | 196 |
| 559 | iso_pu_bacteria | 2924186466 | 2924191144 | 196 |
| 560 | iso_pu_bacteria | 2924193448 | 2924198132 | 196 |
| 561 | iso_pu_bacteria | 2924200457 | 2924204936 | 196 |
| 562 | iso_pu_bacteria | 2924207177 | 2924211749 | 196 |
| 563 | iso_pu_bacteria | 2924214083 | 2924216723 | 196 |
| 564 | iso_pu_bacteria | 2924221636 | 2924227066 | 196 |
| 565 | iso_pu_bacteria | 2924228884 | 2924229561 | 196 |
| 566 | iso_pu_bacteria | 2924710171 | 2924713729 | 196 |
| 567 | iso_pu_bacteria | 2924726620 | 2924728639 | 196 |
| 568 | iso_pu_bacteria | 2924733363 | 2924740648 | 196 |
| 569 | iso_pu_bacteria | 2924741084 | 2924746372 | 196 |
| 570 | iso_pu_bacteria | 2924748358 | 2924750933 | 196 |
| 571 | iso_pu_bacteria | 2924762789 | 2924767855 | 196 |
| 572 | iso_pu_bacteria | 2924776078 | 2924777548 | 196 |
| 573 | iso_pu_bacteria | 2924784321 | 2924791109 | 196 |
| 574 | iso_pu_bacteria | 2926754445 | 2926754615 | 196 |
| 575 | iso_pu_bacteria | 2928521798 | 2928521869 | 196 |
| 576 | iso_pu_bacteria | 2933006813 | 2933007084 | 196 |
| 577 | iso_pu_bacteria | 2933011516 | 2933015326 | 196 |
| 578 | iso_pu_bacteria | 2937002841 | 2937008927 | 196 |
| 579 | iso_pu_bacteria | 2937009748 | 2937013942 | 196 |
| 580 | iso_pu_bacteria | 2937016420 | 2937020832 | 196 |
| 581 | iso_pu_bacteria | 2937023124 | 2937025717 | 196 |
| 582 | iso_pu_bacteria | 2937036028 | 2937038974 | 196 |
| 583 | iso_pu_bacteria | 2937042894 | 2937048962 | 196 |
| 584 | iso_pu_bacteria | 2937049772 | 2937054292 | 196 |
| 585 | iso_pu_bacteria | 2937056579 | 2937061918 | 196 |
| 586 | iso_pu_bacteria | 2937063883 | 2937071050 | 196 |
| 587 | iso_pu_bacteria | 2937071275 | 2937073493 | 196 |
| 588 | iso_pu_bacteria | 2937084907 | 2937088619 | 196 |
| 589 | iso_pu_bacteria | 2937091812 | 2937097647 | 196 |
| 590 | iso_pu_bacteria | 2937098957 | 2937100719 | 196 |
| 591 | iso_pu_bacteria | 2937106411 | 2937112321 | 196 |
| 592 | iso_pu_bacteria | 2937113482 | 2937118534 | 196 |
| 593 | iso_pu_bacteria | 2937119839 | 2937121860 | 196 |
| 594 | iso_pu_bacteria | 2937126314 | 2937127005 | 196 |
| 595 | iso_pu_bacteria | 2937813078 | 2937813926 | 196 |
| 596 | iso_pu_bacteria | 2937822353 | 2937824178 | 196 |
| 597 | iso_pu_bacteria | 2937836603 | 2937842386 | 196 |
| 598 | iso_pu_bacteria | 2937848649 | 2937851497 | 196 |
| 599 | iso_pu_bacteria | 2937861824 | 2937862248 | 196 |
| 600 | iso_pu_bacteria | 2937868953 | 2937875808 | 196 |
| 601 | iso_pu_bacteria | 2937891427 | 2937894960 | 196 |
| 602 | iso_pu_bacteria | 2937972304 | 2937976516 | 196 |
| 603 | iso_pu_bacteria | 2937980651 | 2937981225 | 196 |
| 604 | iso_pu_bacteria | 2937994558 | 2938000703 | 196 |
| 605 | iso_pu_bacteria | 2938014810 | 2938019782 | 196 |
| 606 | iso_pu_bacteria | 2941499720 | 2941501124 | 196 |
| 607 | iso_pu_bacteria | 2954011201 | 2954014774 | 196 |
| 608 | iso_pu_bacteria | 2957382221 | 2957386905 | 196 |
| 609 | iso_pu_bacteria | 2957388812 | 2957393770 | 196 |
| 610 | iso_pu_bacteria | 2957395598 | 2957401793 | 196 |
| 611 | iso_pu_bacteria | 2957402308 | 2957405607 | 196 |
| 612 | iso_pu_bacteria | 2957408893 | 2957413800 | 196 |
| 613 | iso_pu_bacteria | 2957415311 | 2957421905 | 196 |
| 614 | iso_pu_bacteria | 2957422303 | 2957425037 | 196 |
| 615 | iso_pu_bacteria | 2957430029 | 2957434360 | 196 |
| 616 | iso_pu_bacteria | 2957437181 | 2957438713 | 196 |
| 617 | iso_pu_bacteria | 2957443900 | 2957449819 | 196 |
| 618 | iso_pu_bacteria | 2957450854 | 2957451728 | 196 |
| 619 | iso_pu_bacteria | 2957457609 | 2957462217 | 196 |
| 620 | iso_pu_bacteria | 2957464669 | 2957469107 | 196 |
| 621 | iso_pu_bacteria | 2957471148 | 2957475502 | 196 |
| 622 | iso_pu_bacteria | 2957478035 | 2957482463 | 196 |
| 623 | iso_pu_bacteria | 2957484790 | 2957486416 | 196 |
| 624 | iso_pu_bacteria | 2957491536 | 2957493768 | 196 |
| 625 | iso_pu_bacteria | 2957498199 | 2957498916 | 196 |
| 626 | iso_pu_bacteria | 2957505466 | 2957510492 | 196 |
| 627 | iso_pu_bacteria | 2958034702 | 2958038533 | 196 |
| 628 | iso_pu_bacteria | 2958041894 | 2958042164 | 196 |
| 629 | iso_pu_bacteria | 2958041894 | 2958056144 | 196 |
| 630 | iso_pu_bacteria | 2958064165 | 2958069794 | 196 |
| 631 | iso_pu_bacteria | 2958071322 | 2958075430 | 196 |
| 632 | iso_pu_bacteria | 2958084443 | 2958091047 | 196 |
| 633 | iso_pu_bacteria | 2958092219 | 2958093516 | 196 |
| 634 | iso_pu_bacteria | 2958100919 | 2958103863 | 196 |
| 635 | iso_pu_bacteria | 2958108152 | 2958111528 | 196 |
| 636 | iso_pu_bacteria | 2958115193 | 2958121493 | 196 |
| 637 | iso_pu_bacteria | 2958122699 | 2958125305 | 196 |
| 638 | iso_pu_bacteria | 2958130278 | 2958131265 | 196 |
| 639 | iso_pu_bacteria | 2958137437 | 2958141505 | 196 |
| 640 | iso_pu_bacteria | 2958158011 | 2958162065 | 196 |
| 641 | iso_pu_bacteria | 2958165035 | 2958171074 | 196 |
| 642 | iso_pu_bacteria | 2958179912 | 2958180664 | 196 |
| 643 | iso_pu_bacteria | 2960584000 | 2960588398 | 196 |
| 644 | iso_pu_bacteria | 2960591022 | 2960593245 | 196 |
| 645 | iso_pu_bacteria | 2960597568 | 2960598099 | 196 |
| 646 | iso_pu_bacteria | 2960603979 | 2960605297 | 196 |
| 647 | iso_pu_bacteria | 2960610863 | 2960615320 | 196 |
| 648 | iso_pu_bacteria | 2960617483 | 2960622868 | 196 |
| 649 | iso_pu_bacteria | 2960624210 | 2960625830 | 196 |
| 650 | iso_pu_bacteria | 2960637947 | 2960638925 | 196 |
| 651 | iso_pu_bacteria | 2960645483 | 2960646813 | 196 |
| 652 | iso_pu_bacteria | 2960652885 | 2960659348 | 196 |
| 653 | iso_pu_bacteria | 2960660292 | 2960666602 | 196 |
| 654 | iso_pu_bacteria | 2960667422 | 2960673086 | 196 |
| 655 | iso_pu_bacteria | 2960674078 | 2960677934 | 196 |
| 656 | iso_pu_bacteria | 2960687367 | 2960688742 | 196 |
| 657 | iso_pu_bacteria | 2961077736 | 2961078498 | 196 |
| 658 | iso_pu_bacteria | 2961114664 | 2961120903 | 196 |
| 659 | iso_pu_bacteria | 2961127735 | 2961132990 | 196 |
| 660 | iso_pu_bacteria | 2961163497 | 2961169518 | 196 |
| 661 | iso_pu_bacteria | 2961170736 | 2961174068 | 196 |
| 662 | iso_pu_bacteria | 2961183825 | 2961185297 | 196 |
| 663 | iso_pu_bacteria | 2963644680 | 2963650136 | 196 |
| 664 | iso_pu_bacteria | 2964607997 | 2964609214 | 196 |
| 665 | iso_pu_bacteria | 2964615318 | 2964621538 | 196 |
| 666 | iso_pu_bacteria | 2964621998 | 2964627922 | 196 |
| 667 | iso_pu_bacteria | 2964636051 | 2964641889 | 196 |
| 668 | iso_pu_bacteria | 2964643177 | 2964648121 | 196 |
| 669 | iso_pu_bacteria | 2964649959 | 2964655051 | 196 |
| 670 | iso_pu_bacteria | 2964656573 | 2964661876 | 196 |
| 671 | iso_pu_bacteria | 2964663802 | 2964668545 | 196 |
| 672 | iso_pu_bacteria | 2964670856 | 2964673732 | 196 |
| 673 | iso_pu_bacteria | 2964678106 | 2964678869 | 196 |
| 674 | iso_pu_bacteria | 2964685014 | 2964686763 | 196 |
| 675 | iso_pu_bacteria | 2964691889 | 2964697616 | 196 |
| 676 | iso_pu_bacteria | 2964698721 | 2964700312 | 196 |
| 677 | iso_pu_bacteria | 2964705432 | 2964708948 | 196 |
| 678 | iso_pu_bacteria | 2964712639 | 2964718050 | 196 |
| 679 | iso_pu_bacteria | 2964719344 | 2964720338 | 196 |
| 680 | iso_pu_bacteria | 2965018300 | 2965023770 | 196 |
| 681 | iso_pu_bacteria | 2965025482 | 2965031173 | 196 |
| 682 | iso_pu_bacteria | 2965032056 | 2965036349 | 196 |
| 683 | iso_pu_bacteria | 2965040258 | 2965045479 | 196 |
| 684 | iso_pu_bacteria | 2965047637 | 2965049381 | 196 |
| 685 | iso_pu_bacteria | 2965062239 | 2965070207 | 196 |
| 686 | iso_pu_bacteria | 2965089291 | 2965091892 | 196 |
| 687 | iso_pu_bacteria | 2965102966 | 2965107725 | 196 |
| 688 | iso_pu_bacteria | 2965110997 | 2965116620 | 196 |
| 689 | iso_pu_bacteria | 2965119406 | 2965126543 | 196 |
| 690 | iso_pu_bacteria | 2967664464 | 2967665800 | 196 |
| 691 | iso_pu_bacteria | 2967671571 | 2967673057 | 196 |
| 692 | iso_pu_bacteria | 2967678726 | 2967680326 | 196 |
| 693 | iso_pu_bacteria | 2967693043 | 2967697540 | 196 |
| 694 | iso_pu_bacteria | 2967699805 | 2967702424 | 196 |
| 695 | iso_pu_bacteria | 2967706974 | 2967713174 | 196 |
| 696 | iso_pu_bacteria | 2967714385 | 2967720244 | 196 |
| 697 | iso_pu_bacteria | 2967721400 | 2967727655 | 196 |
| 698 | iso_pu_bacteria | 2967728569 | 2967732834 | 196 |
| 699 | iso_pu_bacteria | 2967735183 | 2967735667 | 196 |
| 700 | iso_pu_bacteria | 2967742019 | 2967744930 | 196 |
| 701 | iso_pu_bacteria | 2967748971 | 2967749608 | 196 |
| 702 | iso_pu_bacteria | 2967755722 | 2967758419 | 196 |
| 703 | iso_pu_bacteria | 2967762386 | 2967763655 | 196 |
| 704 | iso_pu_bacteria | 2967769361 | 2967774459 | 196 |
| 705 | iso_pu_bacteria | 2967775926 | 2967781264 | 196 |
| 706 | iso_pu_bacteria | 2967996073 | 2968002757 | 196 |
| 707 | iso_pu_bacteria | 2968003550 | 2968005153 | 196 |
| 708 | iso_pu_bacteria | 2968016561 | 2968021164 | 196 |
| 709 | iso_pu_bacteria | 2968083720 | 2968086518 | 196 |
| 710 | iso_pu_bacteria | 2968091066 | 2968095313 | 196 |
| 711 | iso_pu_bacteria | 2968097103 | 2968101282 | 196 |
| 712 | iso_pu_bacteria | 2968110612 | 2968111640 | 196 |
| 713 | iso_pu_bacteria | 2968117919 | 2968120078 | 196 |
| 714 | iso_pu_bacteria | 2968128360 | 2968128567 | 196 |
| 715 | iso_pu_bacteria | 2968138860 | 2968147012 | 196 |
| 716 | iso_pu_bacteria | 2968171901 | 2968177908 | 196 |
| 717 | iso_pu_bacteria | 2970019648 | 2970021109 | 196 |
| 718 | iso_pu_bacteria | 2970026789 | 2970031884 | 196 |
| 719 | iso_pu_bacteria | 2970033650 | 2970039949 | 196 |
| 720 | iso_pu_bacteria | 2970040964 | 2970046710 | 196 |
| 721 | iso_pu_bacteria | 2970047711 | 2970051829 | 196 |
| 722 | iso_pu_bacteria | 2970054988 | 2970060419 | 196 |
| 723 | iso_pu_bacteria | 2970061556 | 2970063562 | 196 |
| 724 | iso_pu_bacteria | 2970068827 | 2970075731 | 196 |
| 725 | iso_pu_bacteria | 2970076120 | 2970082385 | 196 |
| 726 | iso_pu_bacteria | 2970082768 | 2970085153 | 196 |
| 727 | iso_pu_bacteria | 2970088815 | 2970093801 | 196 |
| 728 | iso_pu_bacteria | 2970095765 | 2970101431 | 196 |
| 729 | iso_pu_bacteria | 2970102677 | 2970106174 | 196 |
| 730 | iso_pu_bacteria | 2970109326 | 2970115378 | 196 |
| 731 | iso_pu_bacteria | 2970116247 | 2970116733 | 196 |
| 732 | iso_pu_bacteria | 2970129317 | 2970133829 | 196 |
| 733 | iso_pu_bacteria | 2970136068 | 2970139720 | 196 |
| 734 | iso_pu_bacteria | 2970143518 | 2970145224 | 196 |
| 735 | iso_pu_bacteria | 2970149975 | 2970154586 | 196 |
| 736 | iso_pu_bacteria | 2970156795 | 2970158951 | 196 |
| 737 | iso_pu_bacteria | 2970164137 | 2970169687 | 196 |
| 738 | iso_pu_bacteria | 2970170962 | 2970174027 | 196 |
| 739 | iso_pu_bacteria | 2970177841 | 2970182468 | 196 |
| 740 | iso_pu_bacteria | 2970184632 | 2970186991 | 196 |
| 741 | iso_pu_bacteria | 2970191845 | 2970197769 | 196 |
| 742 | iso_pu_bacteria | 2970469710 | 2970476269 | 196 |
| 743 | iso_pu_bacteria | 2970489779 | 2970491517 | 196 |
| 744 | iso_pu_bacteria | 2970503327 | 2970506656 | 196 |
| 745 | iso_pu_bacteria | 2970510686 | 2970517277 | 196 |
| 746 | iso_pu_bacteria | 2970524798 | 2970527866 | 196 |
| 747 | iso_pu_bacteria | 2970540015 | 2970543731 | 196 |
| 748 | iso_pu_bacteria | 2970547951 | 2970549479 | 196 |
| 749 | iso_pu_bacteria | 2970554993 | 2970560754 | 196 |
| 750 | iso_pu_bacteria | 2970593180 | 2970599051 | 196 |
| 751 | iso_pu_bacteria | 2970619444 | 2970625391 | 196 |
| 752 | iso_pu_bacteria | 2970627176 | 2970628020 | 196 |
| 753 | iso_pu_bacteria | 2977516862 | 2977518879 | 196 |
| 754 | iso_pu_bacteria | 2977523885 | 2977527090 | 196 |
| 755 | iso_pu_bacteria | 2977530762 | 2977530976 | 196 |
| 756 | iso_pu_bacteria | 2977537788 | 2977542786 | 196 |
| 757 | iso_pu_bacteria | 2977551784 | 2977557660 | 196 |
| 758 | iso_pu_bacteria | 2977558990 | 2977564682 | 196 |
| 759 | iso_pu_bacteria | 2977565890 | 2977569958 | 196 |
| 760 | iso_pu_bacteria | 2977572785 | 2977573481 | 196 |
| 761 | iso_pu_bacteria | 2977579622 | 2977584586 | 196 |
| 762 | iso_pu_bacteria | 2977821940 | 2977825288 | 196 |
| 763 | iso_pu_bacteria | 2977843712 | 2977847010 | 196 |
| 764 | iso_pu_bacteria | 2977851361 | 2977854001 | 196 |
| 765 | iso_pu_bacteria | 2977858184 | 2977860351 | 196 |
| 766 | iso_pu_bacteria | 2977864932 | 2977868282 | 196 |
| 767 | iso_pu_bacteria | 2977872689 | 2977874125 | 196 |
| 768 | iso_pu_bacteria | 2977907340 | 2977909827 | 196 |
| 769 | iso_pu_bacteria | 2977915119 | 2977915326 | 196 |
| 770 | iso_pu_bacteria | 2977922695 | 2977923206 | 196 |
| 771 | iso_pu_bacteria | 2977935797 | 2977937192 | 196 |
| 772 | iso_pu_bacteria | 2977942078 | 2977945803 | 196 |
| 773 | iso_pu_bacteria | 2977950692 | 2977955541 | 196 |
| 774 | iso_pu_bacteria | 2977957713 | 2977960940 | 196 |
| 775 | iso_pu_bacteria | 2977971508 | 2977973506 | 196 |
| 776 | iso_pu_bacteria | 2977986579 | 2977992493 | 196 |
| 777 | iso_pu_bacteria | 2978969890 | 2978970864 | 196 |
| 778 | iso_pu_bacteria | 2979100975 | 2979104918 | 196 |
| 779 | iso_pu_bacteria | 2979710463 | 2979711731 | 196 |
| 780 | iso_pu_bacteria | 2979742915 | 2979747045 | 196 |
| 781 | iso_pu_bacteria | 2979764755 | 2979768795 | 196 |
| 782 | iso_pu_bacteria | 2979772303 | 2979775006 | 196 |
| 783 | iso_pu_bacteria | 2979793036 | 2979796882 | 196 |
| 784 | iso_pu_bacteria | 2979808191 | 2979811356 | 196 |
| 785 | iso_pu_bacteria | 2984509177 | 2984513281 | 196 |
| 786 | iso_pu_bacteria | 2984518228 | 2984520350 | 196 |
| 787 | iso_pu_bacteria | 2984537506 | 2984539648 | 196 |
| 788 | iso_pu_bacteria | 2984587000 | 2984587973 | 196 |
| 789 | iso_pu_bacteria | 2984601300 | 2984601874 | 196 |
| 790 | iso_pu_bacteria | 2987636660 | 2987642992 | 196 |
| 791 | iso_pu_bacteria | 2987645492 | 2987649410 | 196 |
| 792 | iso_pu_bacteria | 2987652177 | 2987655461 | 196 |
| 793 | iso_pu_bacteria | 2987659509 | 2987665504 | 196 |
| 794 | iso_pu_bacteria | 2987666974 | 2987672290 | 196 |
| 795 | iso_pu_bacteria | 2987673487 | 2987673984 | 196 |
| 796 | iso_pu_bacteria | 2995392953 | 2995395892 | 196 |
| 797 | iso_pu_bacteria | 2996310559 | 2996312964 | 196 |
| 798 | iso_pu_bacteria | 2996341866 | 2996348937 | 196 |
| 799 | iso_pu_bacteria | 2996348954 | 2996355026 | 196 |
| 800 | iso_pu_bacteria | 2996386984 | 2996389787 | 196 |
| 801 | iso_pu_bacteria | 3000135777 | 3000142244 | 196 |
| 802 | iso_pu_bacteria | 3002141150 | 3002142778 | 196 |
| 803 | iso_pu_bacteria | 3003930520 | 3003931551 | 196 |
| 804 | iso_pu_bacteria | 3004167301 | 3004171928 | 196 |
| 805 | iso_pu_bacteria | 3004188549 | 3004194706 | 196 |
| 806 | iso_pu_bacteria | 3004195979 | 3004198081 | 196 |
| 807 | iso_pu_bacteria | 3004203850 | 3004210785 | 196 |
| 808 | iso_pu_bacteria | 3004211236 | 3004213504 | 196 |
| 809 | iso_pu_bacteria | 3004218560 | 3004221209 | 196 |
| 810 | iso_pu_bacteria | 3004232784 | 3004239374 | 196 |
| 811 | iso_pu_bacteria | 3004239961 | 3004243727 | 196 |
| 812 | iso_pu_bacteria | 3004248173 | 3004251647 | 196 |
| 813 | iso_pu_bacteria | 3004268573 | 3004271471 | 196 |
| 814 | iso_pu_bacteria | 3004275668 | 3004281560 | 196 |
| 815 | iso_pu_bacteria | 3004334049 | 3004338528 | 196 |
| 816 | iso_pu_bacteria | 637000159 | 637078818 | 196 |
| 817 | iso_pu_bacteria | 648276728 | 648736662 | 196 |
| 818 | iso_pu_bacteria | 649633066 | 649872419 | 196 |
| 819 | iso_pu_bacteria | 8002285264 | 8002288238 | 196 |
| 820 | iso_pu_bacteria | 8003570095 | 8003572320 | 196 |
| 821 | iso_pu_bacteria | 8003992118 | 8003995789 | 196 |
| 822 | iso_pu_bacteria | 8003999396 | 8004003545 | 196 |
| 823 | iso_pu_bacteria | 8004300914 | 8004305870 | 196 |
| 824 | iso_pu_bacteria | 8004312739 | 8004320607 | 196 |
| 825 | iso_pu_bacteria | 8004361976 | 8004363723 | 196 |
| 826 | iso_pu_bacteria | 8004374579 | 8004377655 | 196 |
| 827 | iso_pu_bacteria | 8004387939 | 8004388145 | 196 |
| 828 | iso_pu_bacteria | 8004395343 | 8004395675 | 196 |
| 829 | iso_pu_bacteria | 8004445564 | 8004451572 | 196 |
| 830 | iso_pu_bacteria | 8004633249 | 8004636448 | 196 |
| 831 | iso_pu_bacteria | 8004640170 | 8004643646 | 196 |
| 832 | iso_pu_bacteria | 8004703790 | 8004713226 | 196 |
| 833 | iso_pu_bacteria | 8004714634 | 8004715472 | 196 |
| 834 | iso_pu_bacteria | 8004727605 | 8004729953 | 196 |
| 835 | iso_pu_bacteria | 8018150411 | 8018152839 | 196 |
| 836 | iso_pu_bacteria | 8054460903 | 8054461101 | 196 |
| 837 | iso_pu_bacteria | 8054558443 | 8054561109 | 196 |
| 838 | iso_pu_bacteria | 8055617313 | 8055619158 | 196 |
| 839 | 3300048923 | Ga0496120_0041504 | Ga0496120_0041504_833_1483 | 197 |
| 840 | 3300048925 | Ga0496122_0083749 | Ga0496122_0083749_1129_1779 | 197 |
| 841 | 3300048926 | Ga0496123_0134900 | Ga0496123_0134900_43_693 | 197 |
| 842 | 3300048928 | Ga0496125_0062487 | Ga0496125_0062487_872_1522 | 197 |
| 843 | 3300049589 | Ga0501073_0078669 | Ga0501073_0078669_67_723 | 198 |
| 844 | 3300006038 | Ga0075365_10055747 | Ga0075365_100557473 | 200 |
| 845 | 3300047472 | Ga0495686_0213685 | Ga0495686_0213685_273_932 | 200 |
| 846 | 3300053158 | Ga0500627_0185732 | Ga0500627_0185732_251_907 | 200 |
| 847 | 3300053158 | Ga0500627_0271551 | Ga0500627_0271551_40_699 | 200 |
| 848 | 3300005295 | Ga0065707_10026222 | Ga0065707_100262222 | 204 |
| 849 | 3300005347 | Ga0070668_100520382 | Ga0070668_1005203822 | 204 |
| 850 | 3300005353 | Ga0070669_100254130 | Ga0070669_1002541302 | 204 |
| 851 | 3300046453 | Ga0495627_000757 | Ga0495627_000757_20175_20819 | 204 |
| 852 | 3300046518 | Ga0495631_0123549 | Ga0495631_0123549_47_691 | 204 |
| 853 | 3300031911 | Ga0307412_10090470 | Ga0307412_100904703 | 207 |
| 854 | 3300032004 | Ga0307414_10712960 | Ga0307414_107129601 | 207 |
| 855 | 3300025229 | Ga0209147_101667 | Ga0209147_1016679 | 209 |
| 856 | 3300048919 | Ga0496116_0016002 | Ga0496116_0016002_45_680 | 209 |
| 857 | 3300048924 | Ga0496121_0024486 | Ga0496121_0024486_2297_2932 | 209 |
| 858 | 3300048928 | Ga0496125_0092750 | Ga0496125_0092750_1530_2165 | 209 |
| 859 | 3300001904 | JGI24736J21556_1000604 | JGI24736J21556_10006046 | 214 |
| 860 | 3300001979 | JGI24740J21852_10005625 | JGI24740J21852_100056253 | 214 |
| 861 | 3300001989 | JGI24739J22299_10009416 | JGI24739J22299_100094164 | 214 |
| 862 | 3300001990 | JGI24737J22298_10021752 | JGI24737J22298_100217522 | 214 |
| 863 | 3300002067 | JGI24735J21928_10022976 | JGI24735J21928_100229762 | 214 |
| 864 | 3300002075 | JGI24738J21930_10000460 | JGI24738J21930_100004604 | 214 |
| 865 | 3300005344 | Ga0070661_100193526 | Ga0070661_1001935262 | 214 |
| 866 | 3300005347 | Ga0070668_100226896 | Ga0070668_1002268961 | 214 |
| 867 | 3300005455 | Ga0070663_100007173 | Ga0070663_1000071732 | 214 |
| 868 | 3300005535 | Ga0070684_100774430 | Ga0070684_1007744302 | 214 |
| 869 | 3300005563 | Ga0068855_100089250 | Ga0068855_1000892503 | 214 |
| 870 | 3300005577 | Ga0068857_100358512 | Ga0068857_1003585122 | 214 |
| 871 | 3300005614 | Ga0068856_100186994 | Ga0068856_1001869942 | 214 |
| 872 | 3300005616 | Ga0068852_100617585 | Ga0068852_1006175852 | 214 |
| 873 | 3300005834 | Ga0068851_10069493 | Ga0068851_100694932 | 214 |
| 874 | 3300009174 | Ga0105241_10291819 | Ga0105241_102918191 | 214 |
| 875 | 3300009545 | Ga0105237_10244105 | Ga0105237_102441053 | 214 |
| 876 | 3300010375 | Ga0105239_10222678 | Ga0105239_102226783 | 214 |
| 877 | 3300025321 | Ga0207656_10091644 | Ga0207656_100916442 | 214 |
| 878 | 3300025904 | Ga0207647_10046213 | Ga0207647_100462132 | 214 |
| 879 | 3300025909 | Ga0207705_10079956 | Ga0207705_100799563 | 214 |
| 880 | 3300025911 | Ga0207654_10161822 | Ga0207654_101618222 | 214 |
| 881 | 3300025913 | Ga0207695_10665938 | Ga0207695_106659382 | 214 |
| 882 | 3300025919 | Ga0207657_10067581 | Ga0207657_100675814 | 214 |
| 883 | 3300025924 | Ga0207694_10123698 | Ga0207694_101236982 | 214 |
| 884 | 3300025932 | Ga0207690_10345533 | Ga0207690_103455332 | 214 |
| 885 | 3300025933 | Ga0207706_10076512 | Ga0207706_100765121 | 214 |
| 886 | 3300025944 | Ga0207661_10371723 | Ga0207661_103717232 | 214 |
| 887 | 3300026041 | Ga0207639_10019079 | Ga0207639_100190796 | 214 |
| 888 | 3300026067 | Ga0207678_10128163 | Ga0207678_101281632 | 214 |
| 889 | 3300026078 | Ga0207702_10010044 | Ga0207702_100100447 | 214 |
| 890 | 3300026116 | Ga0207674_10174321 | Ga0207674_101743212 | 214 |
| 891 | 3300031548 | Ga0307408_100135017 | Ga0307408_1001350172 | 214 |
| 892 | 3300031548 | Ga0307408_100425932 | Ga0307408_1004259322 | 214 |
| 893 | 3300031852 | Ga0307410_10012335 | Ga0307410_100123353 | 214 |
| 894 | 3300031901 | Ga0307406_10043274 | Ga0307406_100432741 | 214 |
| 895 | 3300031911 | Ga0307412_10350197 | Ga0307412_103501972 | 214 |
| 896 | 3300032005 | Ga0307411_10190578 | Ga0307411_101905783 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pr3-assembly1.cif.gz_B | crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase | 0.9468 | 4 | 205 |
| 4pr3-assembly1.cif.gz_B | crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase | 0.9146 | 4 | 205 |
| 4pr3-assembly1.cif.gz_A | crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase | 0.9139 | 4 | 210 |
| 4pr3-assembly1.cif.gz_A | crystal structure of brucella melitensis 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase | 0.8923 | 4 | 210 |
| 5dk6-assembly1.cif.gz_A | crystal structure of a 5'-methylthioadenosine/s-adenosylhomocysteine (mta/sah) nucleosidase (mtan) from colwellia psychrerythraea 34h (cps_4743, target psi-029300) in complex with adenine at 2.27 a resolution | 0.8035 | 12 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pr3B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.9414 | 4 | 205 | 3.40.50.1580 |
| 4pr3B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.913 | 4 | 205 | 3.40.50.1580 |
| af_Q69XD3_13_258_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8318 | 40 | 66 | 3.40.50.2000 |
| af_K7UNY3_10_282_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8067 | 43 | 66 | 3.40.50.2000 |
| af_Q4CYT0_175_370_3.40.1090.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain | 0.7745 | 43 | 65 | 3.40.1090.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A440E534-F1-model_v4 | deleted | 1.002 | 4 | 68 |
|
| AF-A0A3S1SEQ8-F1-model_v4 | deleted | 0.9968 | 4 | 75 |
|
| AF-A0A4Q3YJT3-F1-model_v4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (EC 3.2.2.9) | 0.9961 | 4 | 80 |
GO:0008782
GO:0009116 |
| AF-A0A258MY70-F1-model_v4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | 0.9651 | 4 | 171 |
GO:0003824
GO:0009116 |
| AF-A0A832PQ91-F1-model_v4 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (EC 3.2.2.9) | 0.9562 | 4 | 205 |
GO:0009116
GO:0016798 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar