F484978
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 895 | 517 | 767 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300025294|Ga0209025_1001200|Ga0209025_100120035 |
| Length | 344 |
| Sequence | MMRNHNQEGTENTMKRSDFIKGMLVAGVAAASLTLAAPAALAQAKWNLPTAYPSDNPHTENLVLFAKDVEAATGGKLSVTVHANAALFKAPEIKRAVQTGQAQMGEVLMSLHENEDPVFGIDVVPFLATSFDQSKKLYAASKAAIEKKLDSQGVKLLFMVPWAPQGVYVKKDLNTVDDMKGLKWRSYNVGTARLGEMLGMQAVTIQAAELPQALATGVVNSFMSSGGTGYDSKVWESLTHFYDVQAWIPKDATFVNKAAFNGLDKATQDAILKAAAAAEERGWKMWQEKAGWYLDQLKAKGMKVQAPSTELAAGFKKAGDTLTADWLKKAGADGQAIVDAYKKM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 10 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 11 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 12 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 13 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 14 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 15 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 16 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 17 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 18 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 19 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 20 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 21 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 22 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 23 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 24 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 25 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 26 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 27 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 28 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 29 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 30 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 31 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 32 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 33 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 34 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 35 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 36 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 37 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 38 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 39 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 40 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 41 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 42 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 43 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 44 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 45 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 46 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 47 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 48 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 49 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 50 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 51 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 52 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 53 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 54 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 55 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 56 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 57 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 58 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 59 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 60 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 61 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 62 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 63 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 64 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 65 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 66 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 67 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 68 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 69 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 70 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 71 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 72 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 73 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 74 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 75 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 76 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 77 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 78 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 79 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 80 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 81 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 82 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 83 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 84 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 85 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 86 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 87 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 88 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 89 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 90 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 91 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 92 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 93 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 94 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 95 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 96 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 97 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 98 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 99 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 100 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 101 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 102 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 103 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 104 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 105 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 106 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 107 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 108 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 109 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 110 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 111 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 112 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 113 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 114 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 115 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 116 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 117 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 118 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 119 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 120 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 121 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 122 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 123 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 127 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 130 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 132 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 134 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 136 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 138 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 140 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 147 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 150 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 151 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 153 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 154 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 155 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 159 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 164 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 165 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 166 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 168 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 169 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 170 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 172 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 173 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 177 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 178 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 180 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 181 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 182 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 184 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 185 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 186 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 187 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 188 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 189 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 190 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 191 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 192 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 193 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 194 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 195 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 196 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 198 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 199 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 200 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 201 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 202 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 203 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 204 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 205 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 206 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 207 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 209 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 210 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 211 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 212 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 213 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 214 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 215 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 216 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 217 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 218 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 220 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 221 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 241 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 253 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 254 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 255 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 256 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 257 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 264 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 267 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 270 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 340 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 342 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 346 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 347 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 348 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 349 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 350 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 351 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 352 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 353 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 354 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 355 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 356 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 357 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 358 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 359 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 360 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 361 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 362 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 363 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 364 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 365 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 366 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 367 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 368 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 369 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 370 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 371 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 372 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 373 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 374 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 375 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 376 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 377 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 378 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 379 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 380 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 381 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 382 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 383 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 384 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 385 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 386 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 387 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 388 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 389 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 390 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 391 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 392 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 393 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 394 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 424 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 425 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 426 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 427 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 428 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 429 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 432 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 433 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 434 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 435 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 436 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 437 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 438 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 439 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 440 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 441 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 442 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 443 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 451 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 452 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 453 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 454 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 455 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 456 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 457 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 468 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 472 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 473 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 474 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 475 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 476 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 477 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 478 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 479 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 480 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 481 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 482 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 483 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 485 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 486 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 488 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 490 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 493 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 494 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 495 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 496 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 497 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 498 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 499 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 500 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 501 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 502 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 503 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 504 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 505 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 506 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 507 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 508 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 509 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 510 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 511 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 512 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 513 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 514 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 515 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 516 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 517 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.7 |
| Metatranscriptomes | 0.22 |
| Isolates | 14.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.19 |
| Nodule | 10.5 |
| Rhizoplane | 5.47 |
| Rhizosphere | 65.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1000524 | 3300001978 | Bacteria | 2426 |
| 2 | JGI24739J22299_10001664 | 3300001989 | Bacteria | 8445 |
| 3 | JGI24737J22298_10001572 | 3300001990 | Bacteria | 8129 |
| 4 | JGI24750J21931_1000070 | 3300002070 | Bacteria | 14940 |
| 5 | JGI24748J21848_1001020 | 3300002074 | Bacteria | 3045 |
| 6 | JGI24744J21845_10000323 | 3300002077 | Bacteria | 8024 |
| 7 | JGI24034J26672_10001367 | 3300002239 | Bacteria | 3229 |
| 8 | JGI24742J22300_10000129 | 3300002244 | Bacteria | 10987 |
| 9 | JGI25159J45721_1014891 | 3300002987 | Bacteria | 1729 |
| 10 | JGI25151J46595_10000191 | 3300003187 | Bacteria | 75432 |
| 11 | JGI25153J46596_10004863 | 3300003215 | Bacteria | 7152 |
| 12 | JGI25153J46596_10032175 | 3300003215 | Bacteria | 1753 |
| 13 | JGI25160J50197_1000506 | 3300003354 | Bacteria | 23179 |
| 14 | Ga0055526_1003350 | 3300003771 | Bacteria | 10230 |
| 15 | Ga0055524_1000068 | 3300003775 | Bacteria | 130413 |
| 16 | Ga0055524_1015087 | 3300003775 | Bacteria | 2832 |
| 17 | Ga0055536_1009214 | 3300003781 | Bacteria | 4119 |
| 18 | Ga0055534_1004459 | 3300003784 | Bacteria | 4049 |
| 19 | Ga0055531_10019731 | 3300003794 | Bacteria | 2708 |
| 20 | Ga0065165_1000468 | 3300005262 | Bacteria | 63190 |
| 21 | Ga0065714_10069389 | 3300005288 | Bacteria | 4247 |
| 22 | Ga0065712_10073264 | 3300005290 | Bacteria | 4447 |
| 23 | Ga0065712_10101414 | 3300005290 | Bacteria | 2035 |
| 24 | Ga0065715_10093218 | 3300005293 | Bacteria | 4762 |
| 25 | Ga0065707_10014353 | 3300005295 | Bacteria | 1715 |
| 26 | Ga0070658_10012478 | 3300005327 | Bacteria | 6817 |
| 27 | Ga0070658_10017262 | 3300005327 | Bacteria | 5777 |
| 28 | Ga0070658_10219941 | 3300005327 | Bacteria | 1606 |
| 29 | Ga0070676_10001835 | 3300005328 | Bacteria | 10815 |
| 30 | Ga0070676_10053376 | 3300005328 | Bacteria | 2381 |
| 31 | Ga0070683_100000265 | 3300005329 | Bacteria | 36059 |
| 32 | Ga0070690_100000611 | 3300005330 | Bacteria | 18074 |
| 33 | Ga0070690_100061906 | 3300005330 | Bacteria | 2412 |
| 34 | Ga0070690_100098347 | 3300005330 | Bacteria | 1937 |
| 35 | Ga0070690_100277197 | 3300005330 | Bacteria | 1195 |
| 36 | Ga0070670_100006574 | 3300005331 | Bacteria | 9852 |
| 37 | Ga0070670_100416024 | 3300005331 | Bacteria | 1188 |
| 38 | Ga0070677_10000255 | 3300005333 | Bacteria | 18384 |
| 39 | Ga0070677_10016348 | 3300005333 | Bacteria | 2640 |
| 40 | Ga0070677_10129211 | 3300005333 | Bacteria | 1151 |
| 41 | Ga0068869_100000414 | 3300005334 | Bacteria | 23258 |
| 42 | Ga0068869_100069768 | 3300005334 | Bacteria | 2599 |
| 43 | Ga0068869_100111076 | 3300005334 | Bacteria | 2086 |
| 44 | Ga0068869_100140414 | 3300005334 | Bacteria | 1865 |
| 45 | Ga0070666_10009163 | 3300005335 | Bacteria | 6170 |
| 46 | Ga0070666_10011703 | 3300005335 | Bacteria | 5516 |
| 47 | Ga0070680_100006661 | 3300005336 | Bacteria | 8789 |
| 48 | Ga0070680_100009689 | 3300005336 | Bacteria | 7410 |
| 49 | Ga0070680_100022435 | 3300005336 | Bacteria | 5028 |
| 50 | Ga0070682_100000132 | 3300005337 | Bacteria | 62330 |
| 51 | Ga0068868_100000463 | 3300005338 | Bacteria | 27045 |
| 52 | Ga0068868_100020174 | 3300005338 | Bacteria | 5003 |
| 53 | Ga0068868_100361260 | 3300005338 | Bacteria | 1246 |
| 54 | Ga0070660_100002285 | 3300005339 | Bacteria | 13165 |
| 55 | Ga0070660_100046768 | 3300005339 | Bacteria | 3318 |
| 56 | Ga0070660_100070697 | 3300005339 | Bacteria | 2724 |
| 57 | Ga0070689_100002422 | 3300005340 | Bacteria | 12185 |
| 58 | Ga0070689_100053624 | 3300005340 | Bacteria | 3121 |
| 59 | Ga0070689_100161824 | 3300005340 | Bacteria | 1810 |
| 60 | Ga0070691_10000350 | 3300005341 | Bacteria | 16480 |
| 61 | Ga0070687_100000102 | 3300005343 | Bacteria | 28539 |
| 62 | Ga0070687_100034593 | 3300005343 | Bacteria | 2502 |
| 63 | Ga0070661_100000425 | 3300005344 | Bacteria | 32302 |
| 64 | Ga0070661_100112131 | 3300005344 | Bacteria | 2037 |
| 65 | Ga0070692_10000122 | 3300005345 | Bacteria | 18179 |
| 66 | Ga0070668_100002374 | 3300005347 | Bacteria | 13828 |
| 67 | Ga0070669_100000276 | 3300005353 | Bacteria | 41366 |
| 68 | Ga0070669_100037911 | 3300005353 | Bacteria | 3497 |
| 69 | Ga0070675_100001654 | 3300005354 | Bacteria | 16480 |
| 70 | Ga0070675_100039436 | 3300005354 | Bacteria | 3854 |
| 71 | Ga0070671_100006158 | 3300005355 | Bacteria | 9556 |
| 72 | Ga0070671_100180006 | 3300005355 | Bacteria | 1789 |
| 73 | Ga0070671_100533016 | 3300005355 | Bacteria | 1012 |
| 74 | Ga0070674_100002480 | 3300005356 | Bacteria | 10218 |
| 75 | Ga0070674_100012069 | 3300005356 | Bacteria | 5293 |
| 76 | Ga0070674_100134705 | 3300005356 | Bacteria | 1846 |
| 77 | Ga0070673_100009302 | 3300005364 | Bacteria | 6592 |
| 78 | Ga0070688_100001146 | 3300005365 | Bacteria | 13249 |
| 79 | Ga0070688_100021513 | 3300005365 | Bacteria | 3768 |
| 80 | Ga0070688_100051335 | 3300005365 | Bacteria | 2572 |
| 81 | Ga0070688_100144597 | 3300005365 | Bacteria | 1619 |
| 82 | Ga0070688_100146487 | 3300005365 | Bacteria | 1609 |
| 83 | Ga0070659_100000499 | 3300005366 | Bacteria | 28912 |
| 84 | Ga0070659_100054181 | 3300005366 | Bacteria | 3159 |
| 85 | Ga0070659_100092081 | 3300005366 | Bacteria | 2431 |
| 86 | Ga0070659_100127213 | 3300005366 | Bacteria | 2068 |
| 87 | Ga0070667_100002343 | 3300005367 | Bacteria | 16593 |
| 88 | Ga0070703_10017615 | 3300005406 | Bacteria | 2058 |
| 89 | Ga0070709_10001529 | 3300005434 | Bacteria | 12480 |
| 90 | Ga0070714_100031601 | 3300005435 | Bacteria | 4419 |
| 91 | Ga0070714_100050156 | 3300005435 | Bacteria | 3554 |
| 92 | Ga0070714_100079129 | 3300005435 | Bacteria | 2858 |
| 93 | Ga0070714_100172179 | 3300005435 | Bacteria | 1965 |
| 94 | Ga0070713_100012811 | 3300005436 | Bacteria | 6166 |
| 95 | Ga0070713_100022422 | 3300005436 | Bacteria | 4880 |
| 96 | Ga0070713_100267510 | 3300005436 | Bacteria | 1564 |
| 97 | Ga0070710_10014507 | 3300005437 | Bacteria | 3968 |
| 98 | Ga0070710_10015884 | 3300005437 | Bacteria | 3819 |
| 99 | Ga0070701_10001928 | 3300005438 | Bacteria | 7863 |
| 100 | Ga0070701_10044498 | 3300005438 | Bacteria | 2275 |
| 101 | Ga0070711_100030579 | 3300005439 | Bacteria | 3566 |
| 102 | Ga0070711_100075556 | 3300005439 | Bacteria | 2386 |
| 103 | Ga0070705_100000882 | 3300005440 | Bacteria | 16758 |
| 104 | Ga0070700_100000703 | 3300005441 | Bacteria | 16480 |
| 105 | Ga0070694_100000564 | 3300005444 | Bacteria | 20486 |
| 106 | Ga0070708_100015600 | 3300005445 | Bacteria | 6278 |
| 107 | Ga0070663_100000585 | 3300005455 | Bacteria | 19466 |
| 108 | Ga0070663_100022776 | 3300005455 | Bacteria | 4191 |
| 109 | Ga0070663_100029962 | 3300005455 | Bacteria | 3724 |
| 110 | Ga0070678_100000016 | 3300005456 | Bacteria | 53269 |
| 111 | Ga0070678_100031269 | 3300005456 | Bacteria | 3669 |
| 112 | Ga0070678_100079179 | 3300005456 | Bacteria | 2485 |
| 113 | Ga0070662_100004979 | 3300005457 | Bacteria | 8442 |
| 114 | Ga0070681_10007759 | 3300005458 | Bacteria | 10492 |
| 115 | Ga0070681_10020369 | 3300005458 | Bacteria | 6647 |
| 116 | Ga0070681_10129222 | 3300005458 | Bacteria | 2458 |
| 117 | Ga0068867_100005864 | 3300005459 | Bacteria | 8714 |
| 118 | Ga0070685_10000344 | 3300005466 | Bacteria | 28550 |
| 119 | Ga0070685_10265910 | 3300005466 | Bacteria | 1142 |
| 120 | Ga0070699_100176037 | 3300005518 | Bacteria | 1897 |
| 121 | Ga0070679_100007467 | 3300005530 | Bacteria | 10218 |
| 122 | Ga0070679_100033019 | 3300005530 | Bacteria | 5122 |
| 123 | Ga0070679_100053321 | 3300005530 | Bacteria | 4026 |
| 124 | Ga0070684_100000022 | 3300005535 | Bacteria | 128353 |
| 125 | Ga0068853_100003353 | 3300005539 | Bacteria | 12260 |
| 126 | Ga0068853_100082074 | 3300005539 | Bacteria | 2823 |
| 127 | Ga0070672_100001103 | 3300005543 | Bacteria | 16480 |
| 128 | Ga0070672_100135827 | 3300005543 | Bacteria | 2025 |
| 129 | Ga0070686_100001787 | 3300005544 | Bacteria | 11993 |
| 130 | Ga0070686_100009787 | 3300005544 | Bacteria | 5387 |
| 131 | Ga0070686_100020881 | 3300005544 | Bacteria | 3882 |
| 132 | Ga0070695_100004150 | 3300005545 | Bacteria | 8466 |
| 133 | Ga0070695_100135866 | 3300005545 | Bacteria | 1700 |
| 134 | Ga0070696_100003993 | 3300005546 | Bacteria | 9834 |
| 135 | Ga0070693_100002004 | 3300005547 | Bacteria | 9319 |
| 136 | Ga0070665_100028373 | 3300005548 | Bacteria | 5638 |
| 137 | Ga0070665_100081386 | 3300005548 | Bacteria | 3244 |
| 138 | Ga0070665_100133379 | 3300005548 | Bacteria | 2485 |
| 139 | Ga0070665_100166298 | 3300005548 | Bacteria | 2208 |
| 140 | Ga0070704_100000115 | 3300005549 | Bacteria | 28539 |
| 141 | Ga0068855_100040602 | 3300005563 | Bacteria | 5522 |
| 142 | Ga0068855_100050495 | 3300005563 | Bacteria | 4901 |
| 143 | Ga0068855_100067612 | 3300005563 | Bacteria | 4161 |
| 144 | Ga0068855_100080218 | 3300005563 | Bacteria | 3784 |
| 145 | Ga0070664_100001943 | 3300005564 | Bacteria | 16604 |
| 146 | Ga0070664_100150661 | 3300005564 | Bacteria | 2053 |
| 147 | Ga0068857_100000142 | 3300005577 | Bacteria | 44146 |
| 148 | Ga0068854_100000440 | 3300005578 | Bacteria | 25747 |
| 149 | Ga0068854_100070089 | 3300005578 | Bacteria | 2562 |
| 150 | Ga0068856_100000520 | 3300005614 | Bacteria | 42483 |
| 151 | Ga0068856_100243491 | 3300005614 | Bacteria | 1813 |
| 152 | Ga0068856_100386625 | 3300005614 | Bacteria | 1419 |
| 153 | Ga0070702_100000122 | 3300005615 | Bacteria | 23858 |
| 154 | Ga0070702_100014372 | 3300005615 | Bacteria | 4016 |
| 155 | Ga0068852_100000793 | 3300005616 | Bacteria | 20798 |
| 156 | Ga0068852_100054482 | 3300005616 | Bacteria | 3447 |
| 157 | Ga0068852_100190332 | 3300005616 | Bacteria | 1936 |
| 158 | Ga0068859_100007603 | 3300005617 | Bacteria | 11013 |
| 159 | Ga0068859_100054858 | 3300005617 | Bacteria | 4009 |
| 160 | Ga0068859_100085302 | 3300005617 | Bacteria | 3203 |
| 161 | Ga0068864_100000333 | 3300005618 | Bacteria | 41669 |
| 162 | Ga0068864_100125985 | 3300005618 | Bacteria | 2295 |
| 163 | Ga0068866_10000216 | 3300005718 | Bacteria | 27293 |
| 164 | Ga0068861_100004268 | 3300005719 | Bacteria | 9580 |
| 165 | Ga0068861_100504144 | 3300005719 | Bacteria | 1095 |
| 166 | Ga0068870_10000230 | 3300005840 | Bacteria | 20614 |
| 167 | Ga0068863_100032465 | 3300005841 | Bacteria | 4977 |
| 168 | Ga0068863_100108239 | 3300005841 | Bacteria | 2645 |
| 169 | Ga0068863_100285158 | 3300005841 | Bacteria | 1601 |
| 170 | Ga0068858_100000975 | 3300005842 | Bacteria | 29622 |
| 171 | Ga0068858_100124581 | 3300005842 | Bacteria | 2412 |
| 172 | Ga0068858_100223410 | 3300005842 | Bacteria | 1784 |
| 173 | Ga0068858_100453710 | 3300005842 | Bacteria | 1236 |
| 174 | Ga0068860_100001178 | 3300005843 | Bacteria | 28629 |
| 175 | Ga0068862_100003651 | 3300005844 | Bacteria | 13165 |
| 176 | Ga0081455_10000110 | 3300005937 | Bacteria | 92459 |
| 177 | Ga0081540_1108585 | 3300005983 | Bacteria | 1179 |
| 178 | Ga0081539_10020902 | 3300005985 | Bacteria | 4397 |
| 179 | Ga0070717_10001161 | 3300006028 | Bacteria | 17795 |
| 180 | Ga0070717_10392275 | 3300006028 | Bacteria | 1246 |
| 181 | Ga0075368_10056710 | 3300006042 | Bacteria | 1563 |
| 182 | Ga0075363_100003955 | 3300006048 | Bacteria | 6401 |
| 183 | Ga0075363_100019269 | 3300006048 | Bacteria | 3410 |
| 184 | Ga0075363_100026436 | 3300006048 | Bacteria | 2969 |
| 185 | Ga0075363_100041343 | 3300006048 | Bacteria | 2431 |
| 186 | Ga0075363_100045820 | 3300006048 | Bacteria | 2319 |
| 187 | Ga0075364_10031942 | 3300006051 | Bacteria | 3382 |
| 188 | Ga0075364_10076217 | 3300006051 | Bacteria | 2213 |
| 189 | Ga0070715_10118038 | 3300006163 | Bacteria | 1261 |
| 190 | Ga0070716_100010681 | 3300006173 | Bacteria | 4612 |
| 191 | Ga0070712_100185898 | 3300006175 | Bacteria | 1622 |
| 192 | Ga0070712_100274451 | 3300006175 | Bacteria | 1356 |
| 193 | Ga0075362_10000754 | 3300006177 | Bacteria | 9617 |
| 194 | Ga0075362_10008803 | 3300006177 | Bacteria | 3877 |
| 195 | Ga0075362_10033734 | 3300006177 | Bacteria | 2227 |
| 196 | Ga0075362_10056313 | 3300006177 | Bacteria | 1769 |
| 197 | Ga0075367_10051323 | 3300006178 | Bacteria | 2438 |
| 198 | Ga0075367_10071166 | 3300006178 | Bacteria | 2092 |
| 199 | Ga0075369_10007731 | 3300006186 | Bacteria | 4108 |
| 200 | Ga0075369_10030479 | 3300006186 | Bacteria | 2272 |
| 201 | Ga0075369_10033564 | 3300006186 | Bacteria | 2175 |
| 202 | Ga0075366_10001941 | 3300006195 | Bacteria | 10457 |
| 203 | Ga0075366_10031966 | 3300006195 | Bacteria | 3098 |
| 204 | Ga0075366_10050914 | 3300006195 | Bacteria | 2460 |
| 205 | Ga0075366_10053198 | 3300006195 | Bacteria | 2405 |
| 206 | Ga0075366_10075264 | 3300006195 | Bacteria | 2014 |
| 207 | Ga0075366_10120327 | 3300006195 | Bacteria | 1582 |
| 208 | Ga0097621_100000203 | 3300006237 | Bacteria | 38745 |
| 209 | Ga0075370_10011031 | 3300006353 | Bacteria | 4738 |
| 210 | Ga0075370_10013078 | 3300006353 | Bacteria | 4403 |
| 211 | Ga0075370_10032666 | 3300006353 | Bacteria | 2911 |
| 212 | Ga0075370_10098256 | 3300006353 | Bacteria | 1693 |
| 213 | Ga0068871_100000575 | 3300006358 | Bacteria | 25171 |
| 214 | Ga0068871_100014899 | 3300006358 | Bacteria | 5810 |
| 215 | Ga0075428_100094126 | 3300006844 | Bacteria | 3266 |
| 216 | Ga0075428_100339575 | 3300006844 | Bacteria | 1613 |
| 217 | Ga0075430_100091710 | 3300006846 | Bacteria | 2540 |
| 218 | Ga0075431_100076541 | 3300006847 | Bacteria | 3453 |
| 219 | Ga0075433_10014335 | 3300006852 | Bacteria | 6474 |
| 220 | Ga0075434_100145857 | 3300006871 | Bacteria | 2387 |
| 221 | Ga0075429_100081581 | 3300006880 | Bacteria | 2820 |
| 222 | Ga0068865_100003983 | 3300006881 | Bacteria | 8860 |
| 223 | Ga0068865_100360277 | 3300006881 | Bacteria | 1181 |
| 224 | Ga0068865_100387466 | 3300006881 | Bacteria | 1141 |
| 225 | Ga0075436_100014253 | 3300006914 | Bacteria | 5444 |
| 226 | Ga0075436_100219741 | 3300006914 | Bacteria | 1348 |
| 227 | Ga0097620_100007604 | 3300006931 | Bacteria | 11013 |
| 228 | Ga0097620_100054856 | 3300006931 | Bacteria | 4009 |
| 229 | Ga0097620_100085303 | 3300006931 | Bacteria | 3203 |
| 230 | Ga0075435_100053548 | 3300007076 | Bacteria | 3254 |
| 231 | Ga0075435_100086765 | 3300007076 | Bacteria | 2578 |
| 232 | Ga0099795_10075424 | 3300007788 | Bacteria | 1280 |
| 233 | Ga0105251_10080813 | 3300009011 | Bacteria | 1503 |
| 234 | Ga0105240_10085673 | 3300009093 | Bacteria | 3860 |
| 235 | Ga0105240_10106187 | 3300009093 | Bacteria | 3407 |
| 236 | Ga0111539_10000265 | 3300009094 | Bacteria | 62336 |
| 237 | Ga0111539_10220485 | 3300009094 | Bacteria | 2209 |
| 238 | Ga0111539_10497463 | 3300009094 | Bacteria | 1420 |
| 239 | Ga0105245_10000230 | 3300009098 | Bacteria | 53225 |
| 240 | Ga0105245_10031406 | 3300009098 | Bacteria | 4700 |
| 241 | Ga0105245_10081957 | 3300009098 | Bacteria | 2950 |
| 242 | Ga0105245_10221085 | 3300009098 | Bacteria | 1827 |
| 243 | Ga0105245_10323240 | 3300009098 | Bacteria | 1521 |
| 244 | Ga0105247_10020069 | 3300009101 | Bacteria | 4017 |
| 245 | Ga0105247_10038737 | 3300009101 | Bacteria | 2911 |
| 246 | Ga0114129_10039615 | 3300009147 | Bacteria | 6644 |
| 247 | Ga0105243_10000776 | 3300009148 | Bacteria | 30593 |
| 248 | Ga0105243_10009246 | 3300009148 | Bacteria | 7525 |
| 249 | Ga0105243_10224325 | 3300009148 | Bacteria | 1663 |
| 250 | Ga0105241_10017650 | 3300009174 | Bacteria | 5247 |
| 251 | Ga0105241_10066165 | 3300009174 | Bacteria | 2794 |
| 252 | Ga0105242_10001060 | 3300009176 | Bacteria | 21616 |
| 253 | Ga0105242_10074919 | 3300009176 | Bacteria | 2817 |
| 254 | Ga0105242_10086835 | 3300009176 | Bacteria | 2626 |
| 255 | Ga0105242_10093553 | 3300009176 | Bacteria | 2534 |
| 256 | Ga0105242_10348783 | 3300009176 | Bacteria | 1366 |
| 257 | Ga0105248_10001593 | 3300009177 | Bacteria | 25250 |
| 258 | Ga0105248_10054939 | 3300009177 | Bacteria | 4466 |
| 259 | Ga0105248_10077222 | 3300009177 | Bacteria | 3744 |
| 260 | Ga0105248_10110582 | 3300009177 | Bacteria | 3098 |
| 261 | Ga0105237_10010759 | 3300009545 | Bacteria | 9709 |
| 262 | Ga0105237_10053475 | 3300009545 | Bacteria | 4050 |
| 263 | Ga0105238_10037330 | 3300009551 | Bacteria | 4939 |
| 264 | Ga0105238_10163899 | 3300009551 | Bacteria | 2198 |
| 265 | Ga0105238_10186281 | 3300009551 | Bacteria | 2052 |
| 266 | Ga0105238_10236153 | 3300009551 | Bacteria | 1805 |
| 267 | Ga0105249_10009054 | 3300009553 | Bacteria | 8702 |
| 268 | Ga0105249_10263329 | 3300009553 | Bacteria | 1714 |
| 269 | Ga0105239_10000895 | 3300010375 | Bacteria | 42335 |
| 270 | Ga0105239_10017368 | 3300010375 | Bacteria | 7959 |
| 271 | Ga0105239_10082630 | 3300010375 | Bacteria | 3537 |
| 272 | Ga0105239_10255948 | 3300010375 | Bacteria | 1967 |
| 273 | Ga0105246_10003698 | 3300011119 | Bacteria | 9258 |
| 274 | Ga0105246_10243188 | 3300011119 | Bacteria | 1424 |
| 275 | Ga0157373_10008456 | 3300013100 | Bacteria | 7642 |
| 276 | Ga0157371_10068281 | 3300013102 | Bacteria | 2516 |
| 277 | Ga0157371_10122727 | 3300013102 | Bacteria | 1847 |
| 278 | Ga0157371_10144180 | 3300013102 | Bacteria | 1697 |
| 279 | Ga0157370_10064414 | 3300013104 | Bacteria | 3470 |
| 280 | Ga0157369_10098231 | 3300013105 | Bacteria | 3123 |
| 281 | Ga0157369_10547915 | 3300013105 | Bacteria | 1196 |
| 282 | Ga0171462_1006 | 3300013250 | Bacteria | 432986 |
| 283 | Ga0157374_10002125 | 3300013296 | Bacteria | 16679 |
| 284 | Ga0157374_10315118 | 3300013296 | Bacteria | 1549 |
| 285 | Ga0157378_10000864 | 3300013297 | Bacteria | 28028 |
| 286 | Ga0157378_10341099 | 3300013297 | Bacteria | 1461 |
| 287 | Ga0163162_10000420 | 3300013306 | Bacteria | 39042 |
| 288 | Ga0163162_10122200 | 3300013306 | Bacteria | 2709 |
| 289 | Ga0163162_10137012 | 3300013306 | Bacteria | 2559 |
| 290 | Ga0163162_10144932 | 3300013306 | Bacteria | 2490 |
| 291 | Ga0163162_10409569 | 3300013306 | Bacteria | 1488 |
| 292 | Ga0157372_10081999 | 3300013307 | Bacteria | 3651 |
| 293 | Ga0157372_10393530 | 3300013307 | Bacteria | 1615 |
| 294 | Ga0157372_10439730 | 3300013307 | Bacteria | 1520 |
| 295 | Ga0157375_10001160 | 3300013308 | Bacteria | 22770 |
| 296 | Ga0157375_10073104 | 3300013308 | Bacteria | 3447 |
| 297 | Ga0157375_10670838 | 3300013308 | Bacteria | 1192 |
| 298 | Ga0163163_10014455 | 3300014325 | Bacteria | 7254 |
| 299 | Ga0163163_10018179 | 3300014325 | Bacteria | 6574 |
| 300 | Ga0163163_10234677 | 3300014325 | Bacteria | 1884 |
| 301 | Ga0157380_10000205 | 3300014326 | Bacteria | 34945 |
| 302 | Ga0157380_10195843 | 3300014326 | Bacteria | 1788 |
| 303 | Ga0157377_10000053 | 3300014745 | Bacteria | 89091 |
| 304 | Ga0157379_10000617 | 3300014968 | Bacteria | 28764 |
| 305 | Ga0157379_10092951 | 3300014968 | Bacteria | 2706 |
| 306 | Ga0157379_10114162 | 3300014968 | Bacteria | 2428 |
| 307 | Ga0157376_10001214 | 3300014969 | Bacteria | 16996 |
| 308 | Ga0157376_10168417 | 3300014969 | Bacteria | 1992 |
| 309 | Ga0163161_10000555 | 3300017792 | Bacteria | 30093 |
| 310 | Ga0163161_10070460 | 3300017792 | Bacteria | 2556 |
| 311 | Ga0163161_10172237 | 3300017792 | Bacteria | 1656 |
| 312 | Ga0163161_10412826 | 3300017792 | Bacteria | 1085 |
| 313 | Ga0206356_10637864 | 3300020070 | Bacteria | 2198 |
| 314 | Ga0206353_11123090 | 3300020082 | Bacteria | 2034 |
| 315 | Ga0214542_1000153 | 3300021321 | Bacteria | 101854 |
| 316 | Ga0214545_1000018 | 3300021324 | Bacteria | 172019 |
| 317 | Ga0214543_1005445 | 3300021327 | Bacteria | 23409 |
| 318 | Ga0209563_102420 | 3300025230 | Bacteria | 4232 |
| 319 | Ga0209677_104313 | 3300025253 | Bacteria | 4159 |
| 320 | Ga0209233_1003077 | 3300025261 | Bacteria | 5940 |
| 321 | Ga0207666_1000014 | 3300025271 | Bacteria | 41355 |
| 322 | Ga0209130_1000610 | 3300025284 | Bacteria | 34247 |
| 323 | Ga0209130_1003029 | 3300025284 | Bacteria | 7589 |
| 324 | Ga0207673_1000857 | 3300025290 | Bacteria | 3257 |
| 325 | Ga0209675_1000988 | 3300025291 | Bacteria | 17980 |
| 326 | Ga0209676_1005743 | 3300025292 | Bacteria | 6362 |
| 327 | Ga0209676_1015450 | 3300025292 | Bacteria | 2809 |
| 328 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 329 | Ga0209025_1001200 | 3300025294 | Bacteria | 36473 |
| 330 | Ga0209025_1036811 | 3300025294 | Bacteria | 2184 |
| 331 | Ga0209564_1000041 | 3300025295 | Bacteria | 405199 |
| 332 | Ga0209564_1000065 | 3300025295 | Bacteria | 315205 |
| 333 | Ga0209758_1000211 | 3300025297 | Bacteria | 127721 |
| 334 | Ga0209758_1001163 | 3300025297 | Bacteria | 33436 |
| 335 | Ga0209758_1001908 | 3300025297 | Bacteria | 22695 |
| 336 | Ga0209758_1002374 | 3300025297 | Bacteria | 19373 |
| 337 | Ga0209758_1017713 | 3300025297 | Bacteria | 3528 |
| 338 | Ga0209758_1053315 | 3300025297 | Bacteria | 1390 |
| 339 | Ga0209050_1003788 | 3300025298 | Bacteria | 10810 |
| 340 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 341 | Ga0209256_1000266 | 3300025299 | Bacteria | 92357 |
| 342 | Ga0209256_1022522 | 3300025299 | Bacteria | 1905 |
| 343 | Ga0207426_1000143 | 3300025302 | Bacteria | 192948 |
| 344 | Ga0207426_1010356 | 3300025302 | Bacteria | 3622 |
| 345 | Ga0209051_1000778 | 3300025303 | Bacteria | 33824 |
| 346 | Ga0209257_1003322 | 3300025304 | Bacteria | 13923 |
| 347 | Ga0207697_10002418 | 3300025315 | Bacteria | 9704 |
| 348 | Ga0207653_10025976 | 3300025885 | Bacteria | 1876 |
| 349 | Ga0207682_10000154 | 3300025893 | Bacteria | 31265 |
| 350 | Ga0207682_10050735 | 3300025893 | Bacteria | 1716 |
| 351 | Ga0207692_10009560 | 3300025898 | Bacteria | 4056 |
| 352 | Ga0207692_10022758 | 3300025898 | Bacteria | 2888 |
| 353 | Ga0207642_10000582 | 3300025899 | Bacteria | 11255 |
| 354 | Ga0207710_10004647 | 3300025900 | Bacteria | 5959 |
| 355 | Ga0207710_10090272 | 3300025900 | Bacteria | 1433 |
| 356 | Ga0207688_10000140 | 3300025901 | Bacteria | 30639 |
| 357 | Ga0207688_10113117 | 3300025901 | Bacteria | 1577 |
| 358 | Ga0207688_10128920 | 3300025901 | Bacteria | 1481 |
| 359 | Ga0207680_10009990 | 3300025903 | Bacteria | 4730 |
| 360 | Ga0207680_10023329 | 3300025903 | Bacteria | 3377 |
| 361 | Ga0207685_10002988 | 3300025905 | Bacteria | 4014 |
| 362 | Ga0207685_10005749 | 3300025905 | Bacteria | 3308 |
| 363 | Ga0207685_10041077 | 3300025905 | Bacteria | 1728 |
| 364 | Ga0207699_10004747 | 3300025906 | Bacteria | 6492 |
| 365 | Ga0207645_10000182 | 3300025907 | Bacteria | 50129 |
| 366 | Ga0207645_10016432 | 3300025907 | Bacteria | 4899 |
| 367 | Ga0207645_10058250 | 3300025907 | Bacteria | 2466 |
| 368 | Ga0207645_10067549 | 3300025907 | Bacteria | 2285 |
| 369 | Ga0207643_10066015 | 3300025908 | Bacteria | 2074 |
| 370 | Ga0207705_10016850 | 3300025909 | Bacteria | 5233 |
| 371 | Ga0207705_10116329 | 3300025909 | Bacteria | 1980 |
| 372 | Ga0207705_10257732 | 3300025909 | Bacteria | 1331 |
| 373 | Ga0207705_10269559 | 3300025909 | Bacteria | 1302 |
| 374 | Ga0207654_10020714 | 3300025911 | Bacteria | 3491 |
| 375 | Ga0207654_10036971 | 3300025911 | Bacteria | 2731 |
| 376 | Ga0207707_10001647 | 3300025912 | Bacteria | 20601 |
| 377 | Ga0207707_10012925 | 3300025912 | Bacteria | 7266 |
| 378 | Ga0207707_10158440 | 3300025912 | Bacteria | 1979 |
| 379 | Ga0207695_10094135 | 3300025913 | Bacteria | 3004 |
| 380 | Ga0207671_10019625 | 3300025914 | Bacteria | 5165 |
| 381 | Ga0207693_10009838 | 3300025915 | Bacteria | 7778 |
| 382 | Ga0207693_10021820 | 3300025915 | Bacteria | 5091 |
| 383 | Ga0207693_10190106 | 3300025915 | Bacteria | 1616 |
| 384 | Ga0207660_10000007 | 3300025917 | Bacteria | 102878 |
| 385 | Ga0207660_10036762 | 3300025917 | Bacteria | 3406 |
| 386 | Ga0207660_10098654 | 3300025917 | Bacteria | 2179 |
| 387 | Ga0207662_10002310 | 3300025918 | Bacteria | 9549 |
| 388 | Ga0207662_10040341 | 3300025918 | Bacteria | 2744 |
| 389 | Ga0207657_10009907 | 3300025919 | Bacteria | 9539 |
| 390 | Ga0207657_10034884 | 3300025919 | Bacteria | 4517 |
| 391 | Ga0207649_10000143 | 3300025920 | Bacteria | 59962 |
| 392 | Ga0207652_10000459 | 3300025921 | Bacteria | 42058 |
| 393 | Ga0207652_10010295 | 3300025921 | Bacteria | 7527 |
| 394 | Ga0207652_10018025 | 3300025921 | Bacteria | 5786 |
| 395 | Ga0207652_10124855 | 3300025921 | Bacteria | 2292 |
| 396 | Ga0207652_10179800 | 3300025921 | Bacteria | 1900 |
| 397 | Ga0207652_10352966 | 3300025921 | Bacteria | 1327 |
| 398 | Ga0207681_10000506 | 3300025923 | Bacteria | 27118 |
| 399 | Ga0207681_10246116 | 3300025923 | Bacteria | 1394 |
| 400 | Ga0207694_10029693 | 3300025924 | Bacteria | 4173 |
| 401 | Ga0207694_10150897 | 3300025924 | Bacteria | 1872 |
| 402 | Ga0207694_10161762 | 3300025924 | Bacteria | 1808 |
| 403 | Ga0207650_10001959 | 3300025925 | Bacteria | 14473 |
| 404 | Ga0207650_10122609 | 3300025925 | Bacteria | 2025 |
| 405 | Ga0207659_10000015 | 3300025926 | Bacteria | 168475 |
| 406 | Ga0207659_10067829 | 3300025926 | Bacteria | 2592 |
| 407 | Ga0207687_10000357 | 3300025927 | Bacteria | 30477 |
| 408 | Ga0207687_10006416 | 3300025927 | Bacteria | 7769 |
| 409 | Ga0207687_10020981 | 3300025927 | Bacteria | 4337 |
| 410 | Ga0207687_10120178 | 3300025927 | Bacteria | 1964 |
| 411 | Ga0207687_10181998 | 3300025927 | Bacteria | 1629 |
| 412 | Ga0207700_10013332 | 3300025928 | Bacteria | 5343 |
| 413 | Ga0207700_10330155 | 3300025928 | Bacteria | 1324 |
| 414 | Ga0207664_10045273 | 3300025929 | Bacteria | 3450 |
| 415 | Ga0207664_10081399 | 3300025929 | Bacteria | 2635 |
| 416 | Ga0207644_10000369 | 3300025931 | Bacteria | 29423 |
| 417 | Ga0207644_10011324 | 3300025931 | Bacteria | 5899 |
| 418 | Ga0207644_10213319 | 3300025931 | Bacteria | 1527 |
| 419 | Ga0207690_10000183 | 3300025932 | Bacteria | 48283 |
| 420 | Ga0207690_10220540 | 3300025932 | Bacteria | 1451 |
| 421 | Ga0207706_10008183 | 3300025933 | Bacteria | 9645 |
| 422 | Ga0207706_10182035 | 3300025933 | Bacteria | 1845 |
| 423 | Ga0207686_10000234 | 3300025934 | Bacteria | 42207 |
| 424 | Ga0207686_10006030 | 3300025934 | Bacteria | 6507 |
| 425 | Ga0207686_10196530 | 3300025934 | Bacteria | 1441 |
| 426 | Ga0207709_10000081 | 3300025935 | Bacteria | 164427 |
| 427 | Ga0207670_10003127 | 3300025936 | Bacteria | 8760 |
| 428 | Ga0207670_10037539 | 3300025936 | Bacteria | 3158 |
| 429 | Ga0207670_10069004 | 3300025936 | Bacteria | 2437 |
| 430 | Ga0207669_10000008 | 3300025937 | Bacteria | 168213 |
| 431 | Ga0207669_10004576 | 3300025937 | Bacteria | 6100 |
| 432 | Ga0207669_10426110 | 3300025937 | Bacteria | 1045 |
| 433 | Ga0207704_10000244 | 3300025938 | Bacteria | 26922 |
| 434 | Ga0207704_10023473 | 3300025938 | Bacteria | 3325 |
| 435 | Ga0207704_10431304 | 3300025938 | Bacteria | 1047 |
| 436 | Ga0207665_10001391 | 3300025939 | Bacteria | 16282 |
| 437 | Ga0207665_10011994 | 3300025939 | Bacteria | 5692 |
| 438 | Ga0207665_10119311 | 3300025939 | Bacteria | 1862 |
| 439 | Ga0207691_10004725 | 3300025940 | Bacteria | 13167 |
| 440 | Ga0207691_10008666 | 3300025940 | Bacteria | 9758 |
| 441 | Ga0207691_10190128 | 3300025940 | Bacteria | 1791 |
| 442 | Ga0207711_10001662 | 3300025941 | Bacteria | 20503 |
| 443 | Ga0207711_10029338 | 3300025941 | Bacteria | 4639 |
| 444 | Ga0207711_10034451 | 3300025941 | Bacteria | 4288 |
| 445 | Ga0207711_10488376 | 3300025941 | Bacteria | 1147 |
| 446 | Ga0207689_10007527 | 3300025942 | Bacteria | 9549 |
| 447 | Ga0207689_10028470 | 3300025942 | Bacteria | 4675 |
| 448 | Ga0207689_10174400 | 3300025942 | Bacteria | 1773 |
| 449 | Ga0207661_10000626 | 3300025944 | Bacteria | 22719 |
| 450 | Ga0207661_10306552 | 3300025944 | Bacteria | 1425 |
| 451 | Ga0207679_10000046 | 3300025945 | Bacteria | 119975 |
| 452 | Ga0207667_10008711 | 3300025949 | Bacteria | 12024 |
| 453 | Ga0207667_10030154 | 3300025949 | Bacteria | 5869 |
| 454 | Ga0207667_10111735 | 3300025949 | Bacteria | 2818 |
| 455 | Ga0207667_10500462 | 3300025949 | Bacteria | 1233 |
| 456 | Ga0207651_10000850 | 3300025960 | Bacteria | 13309 |
| 457 | Ga0207712_10000555 | 3300025961 | Bacteria | 30178 |
| 458 | Ga0207668_10000133 | 3300025972 | Bacteria | 52202 |
| 459 | Ga0207640_10000956 | 3300025981 | Bacteria | 16050 |
| 460 | Ga0207640_10056272 | 3300025981 | Bacteria | 2581 |
| 461 | Ga0207658_10000535 | 3300025986 | Bacteria | 34617 |
| 462 | Ga0207677_10000898 | 3300026023 | Bacteria | 16712 |
| 463 | Ga0207677_10059235 | 3300026023 | Bacteria | 2640 |
| 464 | Ga0207703_10002811 | 3300026035 | Bacteria | 14856 |
| 465 | Ga0207703_10092987 | 3300026035 | Bacteria | 2539 |
| 466 | Ga0207703_10263706 | 3300026035 | Bacteria | 1558 |
| 467 | Ga0207639_10001004 | 3300026041 | Bacteria | 19189 |
| 468 | Ga0207639_10062824 | 3300026041 | Bacteria | 2873 |
| 469 | Ga0207639_10079315 | 3300026041 | Bacteria | 2594 |
| 470 | Ga0207678_10001462 | 3300026067 | Bacteria | 21675 |
| 471 | Ga0207678_10009251 | 3300026067 | Bacteria | 8672 |
| 472 | Ga0207678_10023444 | 3300026067 | Bacteria | 5398 |
| 473 | Ga0207678_10048390 | 3300026067 | Bacteria | 3675 |
| 474 | Ga0207678_10196899 | 3300026067 | Bacteria | 1722 |
| 475 | Ga0207678_10202800 | 3300026067 | Bacteria | 1696 |
| 476 | Ga0207708_10005241 | 3300026075 | Bacteria | 9549 |
| 477 | Ga0207708_10093790 | 3300026075 | Bacteria | 2317 |
| 478 | Ga0207702_10034556 | 3300026078 | Bacteria | 4227 |
| 479 | Ga0207702_10130770 | 3300026078 | Bacteria | 2259 |
| 480 | Ga0207702_10293745 | 3300026078 | Bacteria | 1540 |
| 481 | Ga0207702_10450418 | 3300026078 | Bacteria | 1249 |
| 482 | Ga0207641_10000593 | 3300026088 | Bacteria | 39825 |
| 483 | Ga0207641_10030576 | 3300026088 | Bacteria | 4461 |
| 484 | Ga0207641_10329064 | 3300026088 | Bacteria | 1451 |
| 485 | Ga0207648_10027455 | 3300026089 | Bacteria | 5052 |
| 486 | Ga0207676_10001432 | 3300026095 | Bacteria | 17727 |
| 487 | Ga0207676_10037847 | 3300026095 | Bacteria | 3679 |
| 488 | Ga0207676_10106836 | 3300026095 | Bacteria | 2333 |
| 489 | Ga0207674_10012323 | 3300026116 | Bacteria | 9559 |
| 490 | Ga0207674_10026154 | 3300026116 | Bacteria | 6208 |
| 491 | Ga0207674_10044332 | 3300026116 | Bacteria | 4581 |
| 492 | Ga0207675_100008687 | 3300026118 | Bacteria | 9549 |
| 493 | Ga0207675_100358304 | 3300026118 | Bacteria | 1431 |
| 494 | Ga0207683_10000002 | 3300026121 | Bacteria | 258441 |
| 495 | Ga0207683_10020673 | 3300026121 | Bacteria | 5631 |
| 496 | Ga0207683_10034149 | 3300026121 | Bacteria | 4420 |
| 497 | Ga0207683_10108287 | 3300026121 | Bacteria | 2487 |
| 498 | Ga0207683_10155672 | 3300026121 | Bacteria | 2064 |
| 499 | Ga0207698_10003217 | 3300026142 | Bacteria | 9811 |
| 500 | Ga0207698_10080210 | 3300026142 | Bacteria | 2628 |
| 501 | Ga0207698_10390680 | 3300026142 | Bacteria | 1326 |
| 502 | Ga0210002_1000206 | 3300027617 | Bacteria | 8455 |
| 503 | Ga0209971_1003881 | 3300027682 | Bacteria | 3535 |
| 504 | Ga0209998_10001772 | 3300027717 | Bacteria | 5109 |
| 505 | Ga0209813_10005839 | 3300027866 | Bacteria | 3013 |
| 506 | Ga0209813_10043129 | 3300027866 | Bacteria | 1381 |
| 507 | Ga0209813_10049834 | 3300027866 | Bacteria | 1305 |
| 508 | Ga0209974_10002651 | 3300027876 | Bacteria | 6482 |
| 509 | Ga0207428_10000011 | 3300027907 | Bacteria | 354388 |
| 510 | Ga0207428_10000046 | 3300027907 | Bacteria | 191032 |
| 511 | Ga0207428_10000058 | 3300027907 | Bacteria | 158579 |
| 512 | Ga0268266_10012179 | 3300028379 | Bacteria | 7443 |
| 513 | Ga0268266_10024675 | 3300028379 | Bacteria | 5116 |
| 514 | Ga0268266_10053089 | 3300028379 | Bacteria | 3481 |
| 515 | Ga0268265_10000117 | 3300028380 | Bacteria | 99955 |
| 516 | Ga0268265_10273760 | 3300028380 | Bacteria | 1507 |
| 517 | Ga0268264_10002676 | 3300028381 | Bacteria | 15555 |
| 518 | Ga0268264_10179896 | 3300028381 | Bacteria | 1919 |
| 519 | Ga0265338_10273627 | 3300028800 | Bacteria | 1237 |
| 520 | Ga0265330_10020716 | 3300031235 | Bacteria | 3005 |
| 521 | Ga0265325_10000780 | 3300031241 | Bacteria | 23067 |
| 522 | Ga0265325_10002090 | 3300031241 | Bacteria | 13645 |
| 523 | Ga0265340_10039465 | 3300031247 | Bacteria | 2330 |
| 524 | Ga0265340_10039612 | 3300031247 | Bacteria | 2324 |
| 525 | Ga0265331_10020429 | 3300031250 | Bacteria | 3400 |
| 526 | Ga0307408_100026651 | 3300031548 | Bacteria | 3973 |
| 527 | Ga0265313_10000340 | 3300031595 | Bacteria | 50703 |
| 528 | Ga0265313_10011551 | 3300031595 | Bacteria | 5478 |
| 529 | Ga0265314_10003026 | 3300031711 | Bacteria | 16605 |
| 530 | Ga0265342_10001270 | 3300031712 | Bacteria | 23770 |
| 531 | Ga0307516_10077093 | 3300031730 | Bacteria | 3183 |
| 532 | Ga0373930_0003564 | 3300034816 | Bacteria | 2477 |
| 533 | Ga0373930_0010397 | 3300034816 | Bacteria | 1663 |
| 534 | Ga0373958_0001846 | 3300034819 | Bacteria | 2901 |
| 535 | Ga0373958_0003589 | 3300034819 | Bacteria | 2247 |
| 536 | Ga0373959_0008010 | 3300034820 | Bacteria | 1787 |
| 537 | Ga0373938_0003021 | 3300034957 | Bacteria | 2731 |
| 538 | Ga0373926_0026781 | 3300035083 | Bacteria | 2018 |
| 539 | Ga0373929_0001396 | 3300035085 | Bacteria | 4629 |
| 540 | Ga0373929_0001838 | 3300035085 | Bacteria | 3978 |
| 541 | Ga0373940_0019504 | 3300035088 | Bacteria | 1714 |
| 542 | Ga0373940_0025820 | 3300035088 | Bacteria | 1533 |
| 543 | Ga0373944_0033067 | 3300035089 | Bacteria | 1565 |
| 544 | Ga0373944_0066431 | 3300035089 | Bacteria | 1166 |
| 545 | Ga0373949_0002656 | 3300035090 | Bacteria | 4497 |
| 546 | Ga0373949_0004019 | 3300035090 | Bacteria | 3410 |
| 547 | Ga0373951_0001331 | 3300035091 | Bacteria | 6502 |
| 548 | Ga0373952_0000618 | 3300035092 | Bacteria | 6324 |
| 549 | Ga0373932_0003969 | 3300035112 | Bacteria | 3523 |
| 550 | Ga0373932_0004893 | 3300035112 | Bacteria | 3156 |
| 551 | Ga0373936_0046784 | 3300035113 | Bacteria | 1744 |
| 552 | Ga0373939_0000414 | 3300035114 | Bacteria | 10738 |
| 553 | Ga0373941_0027427 | 3300035115 | Bacteria | 1662 |
| 554 | Ga0373945_0017957 | 3300035116 | Bacteria | 2402 |
| 555 | Ga0373960_0007461 | 3300035121 | Bacteria | 2592 |
| 556 | Ga0373943_0139808 | 3300035170 | Bacteria | 1303 |
| 557 | Ga0373946_0017722 | 3300035171 | Bacteria | 2727 |
| 558 | Ga0373955_0056201 | 3300035172 | Bacteria | 2159 |
| 559 | Ga0373961_0003176 | 3300035241 | Bacteria | 4098 |
| 560 | Ga0373961_0003980 | 3300035241 | Bacteria | 3605 |
| 561 | Ga0373962_0002230 | 3300035242 | Bacteria | 4629 |
| 562 | Ga0373962_0034085 | 3300035242 | Bacteria | 1408 |
| 563 | Ga0373931_0001595 | 3300035691 | Bacteria | 9798 |
| 564 | Ga0373931_0004138 | 3300035691 | Bacteria | 6584 |
| 565 | Ga0373931_0065631 | 3300035691 | Bacteria | 1967 |
| 566 | Ga0373931_0084732 | 3300035691 | Bacteria | 1755 |
| 567 | Ga0373935_0005678 | 3300035692 | Bacteria | 7364 |
| 568 | Ga0373935_0045366 | 3300035692 | Bacteria | 2773 |
| 569 | Ga0373935_0157647 | 3300035692 | Bacteria | 1545 |
| 570 | Ga0373927_0011098 | 3300035695 | Bacteria | 6000 |
| 571 | Ga0373927_0042625 | 3300035695 | Bacteria | 2940 |
| 572 | Ga0373927_0101961 | 3300035695 | Bacteria | 1867 |
| 573 | Ga0373947_0020787 | 3300035725 | Bacteria | 3793 |
| 574 | Ga0373937_0016895 | 3300036401 | Bacteria | 6488 |
| 575 | Ga0395900_0001080 | 3300037418 | Bacteria | 34679 |
| 576 | Ga0395898_0008858 | 3300037466 | Bacteria | 10605 |
| 577 | Ga0395905_0028226 | 3300037471 | Bacteria | 5290 |
| 578 | Ga0395901_0201556 | 3300038443 | Bacteria | 2086 |
| 579 | Ga0439465_0094574 | 3300041413 | Bacteria | 1026 |
| 580 | Ga0451849_0786269 | 3300041505 | Bacteria | 1449 |
| 581 | Ga0450906_002738 | 3300042145 | Bacteria | 3836 |
| 582 | Ga0439434_0006798 | 3300042435 | Bacteria | 3341 |
| 583 | Ga0450918_000683 | 3300042531 | Bacteria | 7205 |
| 584 | Ga0450893_0010783 | 3300042532 | Bacteria | 1505 |
| 585 | Ga0466972_0000188 | 3300044658 | Bacteria | 47766 |
| 586 | Ga0466965_0012342 | 3300044683 | Bacteria | 4017 |
| 587 | Ga0495603_0026652 | 3300046455 | Bacteria | 3491 |
| 588 | Ga0495603_0121270 | 3300046455 | Bacteria | 1523 |
| 589 | Ga0495629_0000579 | 3300046459 | Bacteria | 29719 |
| 590 | Ga0495629_0027679 | 3300046459 | Bacteria | 4024 |
| 591 | Ga0495638_0003168 | 3300046460 | Bacteria | 13002 |
| 592 | Ga0495641_0012369 | 3300046461 | Bacteria | 4779 |
| 593 | Ga0495582_0009581 | 3300046473 | Bacteria | 5333 |
| 594 | Ga0495605_0124658 | 3300046474 | Bacteria | 1166 |
| 595 | Ga0495639_0060067 | 3300046475 | Bacteria | 1741 |
| 596 | Ga0495664_0017279 | 3300046477 | Bacteria | 4122 |
| 597 | Ga0495594_0034165 | 3300046499 | Bacteria | 2766 |
| 598 | Ga0495618_0068883 | 3300046514 | Bacteria | 2250 |
| 599 | Ga0495643_0015250 | 3300046522 | Bacteria | 4547 |
| 600 | Ga0495665_0015372 | 3300046531 | Bacteria | 4122 |
| 601 | Ga0495640_0036342 | 3300046533 | Bacteria | 3480 |
| 602 | Ga0495621_0002724 | 3300046539 | Bacteria | 4791 |
| 603 | Ga0495635_0024823 | 3300046663 | Bacteria | 4177 |
| 604 | Ga0495588_0064367 | 3300046674 | Bacteria | 1902 |
| 605 | Ga0495658_0000402 | 3300046683 | Bacteria | 24205 |
| 606 | Ga0495669_0032760 | 3300046684 | Bacteria | 2285 |
| 607 | Ga0495613_0083984 | 3300046689 | Bacteria | 2312 |
| 608 | Ga0495624_0061770 | 3300046690 | Bacteria | 2346 |
| 609 | Ga0495636_0093044 | 3300047318 | Bacteria | 1311 |
| 610 | Ga0495674_0037708 | 3300047319 | Bacteria | 4342 |
| 611 | Ga0495680_0031560 | 3300047322 | Bacteria | 4309 |
| 612 | Ga0495680_0038112 | 3300047322 | Bacteria | 3845 |
| 613 | Ga0495675_0089005 | 3300047444 | Bacteria | 1939 |
| 614 | Ga0495684_0033427 | 3300047471 | Bacteria | 3944 |
| 615 | Ga0495593_0057483 | 3300047673 | Bacteria | 2042 |
| 616 | Ga0495615_0003265 | 3300048090 | Bacteria | 2697 |
| 617 | Ga0496100_0000171 | 3300048903 | Bacteria | 35989 |
| 618 | Ga0496100_0117421 | 3300048903 | Bacteria | 1857 |
| 619 | Ga0496101_0002061 | 3300048904 | Bacteria | 12234 |
| 620 | Ga0496101_0009114 | 3300048904 | Bacteria | 6511 |
| 621 | Ga0496101_0020023 | 3300048904 | Bacteria | 4575 |
| 622 | Ga0496102_0021505 | 3300048905 | Bacteria | 5705 |
| 623 | Ga0496102_0075211 | 3300048905 | Bacteria | 3104 |
| 624 | Ga0496102_0261844 | 3300048905 | Bacteria | 1630 |
| 625 | Ga0496103_0000753 | 3300048906 | Bacteria | 23863 |
| 626 | Ga0496103_0005740 | 3300048906 | Bacteria | 7414 |
| 627 | Ga0496104_0014019 | 3300048907 | Bacteria | 7233 |
| 628 | Ga0496104_0016915 | 3300048907 | Bacteria | 6634 |
| 629 | Ga0496104_0050319 | 3300048907 | Bacteria | 3931 |
| 630 | Ga0496105_0011899 | 3300048908 | Bacteria | 6889 |
| 631 | Ga0496105_0100655 | 3300048908 | Bacteria | 2386 |
| 632 | Ga0496106_0000183 | 3300048909 | Bacteria | 45053 |
| 633 | Ga0496106_0037189 | 3300048909 | Bacteria | 3641 |
| 634 | Ga0496106_0037819 | 3300048909 | Bacteria | 3610 |
| 635 | Ga0496107_0002635 | 3300048910 | Bacteria | 11734 |
| 636 | Ga0496107_0098874 | 3300048910 | Bacteria | 2137 |
| 637 | Ga0496107_0252800 | 3300048910 | Bacteria | 1311 |
| 638 | Ga0496108_0001163 | 3300048911 | Bacteria | 20535 |
| 639 | Ga0496108_0013444 | 3300048911 | Bacteria | 6678 |
| 640 | Ga0496108_0121981 | 3300048911 | Bacteria | 2236 |
| 641 | Ga0496108_0193483 | 3300048911 | Bacteria | 1763 |
| 642 | Ga0496109_0000502 | 3300048912 | Bacteria | 33491 |
| 643 | Ga0496109_0002647 | 3300048912 | Bacteria | 15014 |
| 644 | Ga0496110_0010454 | 3300048913 | Bacteria | 7547 |
| 645 | Ga0496110_0010742 | 3300048913 | Bacteria | 7460 |
| 646 | Ga0496110_0067646 | 3300048913 | Bacteria | 3161 |
| 647 | Ga0496110_0528308 | 3300048913 | Bacteria | 1073 |
| 648 | Ga0496111_0018611 | 3300048914 | Bacteria | 4814 |
| 649 | Ga0496111_0043791 | 3300048914 | Bacteria | 3218 |
| 650 | Ga0496111_0087776 | 3300048914 | Bacteria | 2276 |
| 651 | Ga0496112_0035778 | 3300048915 | Bacteria | 4839 |
| 652 | Ga0496112_0087140 | 3300048915 | Bacteria | 3089 |
| 653 | Ga0496113_0009640 | 3300048916 | Bacteria | 6340 |
| 654 | Ga0496113_0010353 | 3300048916 | Bacteria | 6161 |
| 655 | Ga0496113_0021121 | 3300048916 | Bacteria | 4589 |
| 656 | Ga0496113_0185650 | 3300048916 | Bacteria | 1649 |
| 657 | Ga0496114_0009978 | 3300048917 | Bacteria | 7549 |
| 658 | Ga0496114_0011160 | 3300048917 | Bacteria | 7173 |
| 659 | Ga0496114_0139984 | 3300048917 | Bacteria | 2094 |
| 660 | Ga0496114_0174335 | 3300048917 | Bacteria | 1876 |
| 661 | Ga0496115_0001833 | 3300048918 | Bacteria | 15214 |
| 662 | Ga0496115_0040610 | 3300048918 | Bacteria | 3699 |
| 663 | Ga0496115_0046715 | 3300048918 | Bacteria | 3461 |
| 664 | Ga0496115_0048002 | 3300048918 | Bacteria | 3415 |
| 665 | Ga0496115_0090384 | 3300048918 | Bacteria | 2501 |
| 666 | Ga0496117_0019738 | 3300048920 | Bacteria | 5523 |
| 667 | Ga0496118_0159131 | 3300048921 | Bacteria | 1400 |
| 668 | Ga0496122_0039326 | 3300048925 | Bacteria | 3772 |
| 669 | Ga0496123_0027237 | 3300048926 | Bacteria | 4262 |
| 670 | Ga0496124_0103034 | 3300048927 | Bacteria | 2309 |
| 671 | Ga0496125_0030822 | 3300048928 | Bacteria | 4790 |
| 672 | Ga0501034_0022571 | 3300049571 | Bacteria | 6412 |
| 673 | Ga0501034_0046540 | 3300049571 | Bacteria | 4383 |
| 674 | Ga0501037_0167383 | 3300049573 | Bacteria | 1564 |
| 675 | Ga0501047_0077632 | 3300049581 | Bacteria | 3194 |
| 676 | Ga0501047_0254441 | 3300049581 | Bacteria | 1605 |
| 677 | Ga0501071_0469400 | 3300049587 | Bacteria | 964 |
| 678 | Ga0501072_0000961 | 3300049588 | Bacteria | 21245 |
| 679 | Ga0501073_0029164 | 3300049589 | Bacteria | 3943 |
| 680 | Ga0501083_0170805 | 3300049744 | Bacteria | 1421 |
| 681 | nmdc:mga03683_18101_c1 | 3300050489 | Bacteria | 2675 |
| 682 | nmdc:mga03683_68184_c1 | 3300050489 | Bacteria | 1516 |
| 683 | nmdc:mga03n38_120463_c1 | 3300050490 | Bacteria | 1289 |
| 684 | nmdc:mga03n38_32740_c1 | 3300050490 | Bacteria | 2205 |
| 685 | nmdc:mga03n38_34588_c1 | 3300050490 | Bacteria | 2159 |
| 686 | nmdc:mga03n38_52490_c1 | 3300050490 | Bacteria | 1825 |
| 687 | nmdc:mga00v17_14280_c1 | 3300050491 | Bacteria | 4430 |
| 688 | nmdc:mga00v17_26326_c1 | 3300050491 | Bacteria | 3388 |
| 689 | nmdc:mga00v17_9218_c1 | 3300050491 | Bacteria | 5332 |
| 690 | nmdc:mga0yw44_111452_c1 | 3300050492 | Bacteria | 1754 |
| 691 | nmdc:mga0yw44_64176_c1 | 3300050492 | Bacteria | 2260 |
| 692 | nmdc:mga0yw44_88797_c1 | 3300050492 | Bacteria | 1949 |
| 693 | nmdc:mga0k408_14470_c1 | 3300050493 | Bacteria | 4349 |
| 694 | nmdc:mga0k408_19015_c1 | 3300050493 | Bacteria | 3835 |
| 695 | nmdc:mga0k408_22792_c1 | 3300050493 | Bacteria | 3528 |
| 696 | nmdc:mga0k408_3930_c1 | 3300050493 | Bacteria | 7885 |
| 697 | nmdc:mga0k408_84909_c1 | 3300050493 | Bacteria | 1858 |
| 698 | nmdc:mga0k408_93898_c1 | 3300050493 | Bacteria | 1764 |
| 699 | nmdc:mga06z11_244356_c1 | 3300050494 | Bacteria | 1055 |
| 700 | nmdc:mga06z11_27952_c1 | 3300050494 | Bacteria | 2701 |
| 701 | nmdc:mga06z11_28433_c1 | 3300050494 | Bacteria | 2683 |
| 702 | nmdc:mga06z11_47933_c1 | 3300050494 | Bacteria | 2172 |
| 703 | nmdc:mga04h51_4970_c1 | 3300050495 | Bacteria | 3353 |
| 704 | nmdc:mga04h51_64656_c1 | 3300050495 | Bacteria | 1262 |
| 705 | nmdc:mga07m45_24972_c1 | 3300050496 | Bacteria | 3276 |
| 706 | nmdc:mga07m45_30143_c2 | 3300050496 | Bacteria | 1844 |
| 707 | nmdc:mga07m45_39049_c1 | 3300050496 | Bacteria | 2651 |
| 708 | nmdc:mga07m45_47963_c1 | 3300050496 | Bacteria | 2402 |
| 709 | nmdc:mga07m45_65353_c1 | 3300050496 | Bacteria | 2065 |
| 710 | nmdc:mga07m45_675_c1 | 3300050496 | Bacteria | 14518 |
| 711 | nmdc:mga05p37_161839_c1 | 3300050507 | Bacteria | 2733 |
| 712 | nmdc:mga05p37_35_c1 | 3300050507 | Bacteria | 110751 |
| 713 | nmdc:mga09592_163_c1 | 3300050508 | Bacteria | 46620 |
| 714 | nmdc:mga0qj67_143_c1 | 3300050509 | Bacteria | 48269 |
| 715 | nmdc:mga0qj67_94193_c1 | 3300050509 | Bacteria | 2409 |
| 716 | nmdc:mga06r32_253908_c1 | 3300050510 | Bacteria | 1746 |
| 717 | nmdc:mga06r32_514117_c1 | 3300050510 | Bacteria | 1174 |
| 718 | nmdc:mga06r32_936_c1 | 3300050510 | Bacteria | 25964 |
| 719 | nmdc:mga08y16_162903_c1 | 3300050511 | Bacteria | 2317 |
| 720 | nmdc:mga08y16_20491_c1 | 3300050511 | Bacteria | 6981 |
| 721 | nmdc:mga08y16_2671_c1 | 3300050511 | Bacteria | 18327 |
| 722 | nmdc:mga08y16_366379_c1 | 3300050511 | Bacteria | 1479 |
| 723 | nmdc:mga0n895_189673_c1 | 3300050512 | Bacteria | 2087 |
| 724 | nmdc:mga0n895_2984_c1 | 3300050512 | Bacteria | 13428 |
| 725 | nmdc:mga0n895_96051_c1 | 3300050512 | Bacteria | 2969 |
| 726 | nmdc:mga0rr50_12072_c1 | 3300050513 | Bacteria | 5564 |
| 727 | nmdc:mga0rr50_126828_c1 | 3300050513 | Bacteria | 2039 |
| 728 | nmdc:mga0rr50_42198_c1 | 3300050513 | Bacteria | 3330 |
| 729 | nmdc:mga08x19_44766_c1 | 3300050514 | Bacteria | 2826 |
| 730 | nmdc:mga0a205_687_c1 | 3300050515 | Bacteria | 27032 |
| 731 | nmdc:mga0a205_7989_c1 | 3300050515 | Bacteria | 9611 |
| 732 | nmdc:mga0sz30_19198_c1 | 3300050516 | Bacteria | 2745 |
| 733 | nmdc:mga0sz30_51184_c1 | 3300050516 | Bacteria | 1751 |
| 734 | nmdc:mga0sz30_61512_c1 | 3300050516 | Bacteria | 1604 |
| 735 | Ga0495601_0002696 | 3300053077 | Bacteria | 10073 |
| 736 | Ga0495612_0006661 | 3300053078 | Bacteria | 4738 |
| 737 | Ga0495619_0000361 | 3300053085 | Bacteria | 31625 |
| 738 | Ga0495619_0011450 | 3300053085 | Bacteria | 5588 |
| 739 | Ga0500643_000085 | 3300053087 | Bacteria | 98026 |
| 740 | Ga0500651_0087024 | 3300053093 | Bacteria | 1929 |
| 741 | Ga0500566_0000407 | 3300053094 | Bacteria | 23864 |
| 742 | Ga0500566_0196297 | 3300053094 | Bacteria | 1023 |
| 743 | Ga0500640_045033 | 3300053095 | Bacteria | 1936 |
| 744 | Ga0500641_0013036 | 3300053096 | Bacteria | 3050 |
| 745 | Ga0500641_0035624 | 3300053096 | Bacteria | 1987 |
| 746 | Ga0500641_0106403 | 3300053096 | Bacteria | 1206 |
| 747 | Ga0500650_0117629 | 3300053098 | Bacteria | 1240 |
| 748 | Ga0500555_003024 | 3300053103 | Bacteria | 4804 |
| 749 | Ga0500569_004579 | 3300053109 | Bacteria | 2915 |
| 750 | Ga0500595_000024 | 3300053119 | Bacteria | 144160 |
| 751 | Ga0500607_012354 | 3300053121 | Bacteria | 5011 |
| 752 | Ga0500642_0077483 | 3300053130 | Bacteria | 1522 |
| 753 | Ga0500652_000011 | 3300053131 | Bacteria | 160704 |
| 754 | Ga0500658_0120328 | 3300053134 | Bacteria | 1163 |
| 755 | Ga0500559_0026477 | 3300053136 | Bacteria | 2470 |
| 756 | Ga0500604_0038841 | 3300053151 | Bacteria | 1429 |
| 757 | Ga0500616_0000802 | 3300053153 | Bacteria | 35871 |
| 758 | Ga0500616_0017200 | 3300053153 | Bacteria | 4105 |
| 759 | Ga0500616_0047724 | 3300053153 | Bacteria | 2273 |
| 760 | Ga0500616_0064347 | 3300053153 | Bacteria | 1889 |
| 761 | Ga0500638_024357 | 3300053162 | Bacteria | 2884 |
| 762 | Ga0500636_0000103 | 3300053177 | Bacteria | 43319 |
| 763 | Ga0500609_011002 | 3300053731 | Bacteria | 1222 |
| 764 | Ga0501084_0077818 | 3300054114 | Bacteria | 2780 |
| 765 | Ga0501082_0000156 | 3300060353 | Bacteria | 57873 |
| 766 | Ga0501082_0239869 | 3300060353 | Bacteria | 1578 |
| 767 | Ga0501082_0342294 | 3300060353 | Bacteria | 1303 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025923 | Ga0207681_10246116 | Ga0207681_102461161 | 281 |
| 2 | 3300035695 | Ga0373927_0101961 | Ga0373927_0101961_463_1440 | 286 |
| 3 | 3300031235 | Ga0265330_10020716 | Ga0265330_100207164 | 294 |
| 4 | 3300031250 | Ga0265331_10020429 | Ga0265331_100204291 | 294 |
| 5 | 3300053109 | Ga0500569_004579 | Ga0500569_004579_1834_2769 | 298 |
| 6 | iso_pu_bacteria | 2824746037 | 2824749470 | 299 |
| 7 | iso_pu_bacteria | 8019538911 | 8019544477 | 299 |
| 8 | 3300005333 | Ga0070677_10129211 | Ga0070677_101292111 | 301 |
| 9 | 3300005340 | Ga0070689_100053624 | Ga0070689_1000536242 | 301 |
| 10 | 3300005353 | Ga0070669_100037911 | Ga0070669_1000379113 | 301 |
| 11 | 3300005365 | Ga0070688_100021513 | Ga0070688_1000215134 | 301 |
| 12 | 3300005456 | Ga0070678_100031269 | Ga0070678_1000312694 | 301 |
| 13 | 3300005617 | Ga0068859_100054858 | Ga0068859_1000548584 | 301 |
| 14 | 3300006931 | Ga0097620_100054856 | Ga0097620_1000548564 | 301 |
| 15 | 3300009176 | Ga0105242_10086835 | Ga0105242_100868352 | 301 |
| 16 | 3300013306 | Ga0163162_10409569 | Ga0163162_104095692 | 301 |
| 17 | 3300014325 | Ga0163163_10234677 | Ga0163163_102346772 | 301 |
| 18 | 3300025907 | Ga0207645_10058250 | Ga0207645_100582502 | 301 |
| 19 | 3300025926 | Ga0207659_10067829 | Ga0207659_100678292 | 301 |
| 20 | 3300025934 | Ga0207686_10196530 | Ga0207686_101965302 | 301 |
| 21 | 3300025936 | Ga0207670_10037539 | Ga0207670_100375394 | 301 |
| 22 | 3300026095 | Ga0207676_10106836 | Ga0207676_101068362 | 301 |
| 23 | 3300026121 | Ga0207683_10155672 | Ga0207683_101556722 | 301 |
| 24 | 3300005327 | Ga0070658_10017262 | Ga0070658_100172622 | 302 |
| 25 | 3300005530 | Ga0070679_100053321 | Ga0070679_1000533213 | 302 |
| 26 | 3300005563 | Ga0068855_100080218 | Ga0068855_1000802182 | 302 |
| 27 | 3300005578 | Ga0068854_100070089 | Ga0068854_1000700892 | 302 |
| 28 | 3300005614 | Ga0068856_100386625 | Ga0068856_1003866252 | 302 |
| 29 | 3300005841 | Ga0068863_100285158 | Ga0068863_1002851581 | 302 |
| 30 | 3300009093 | Ga0105240_10085673 | Ga0105240_100856732 | 302 |
| 31 | 3300013102 | Ga0157371_10144180 | Ga0157371_101441802 | 302 |
| 32 | 3300013104 | Ga0157370_10064414 | Ga0157370_100644142 | 302 |
| 33 | 3300013297 | Ga0157378_10341099 | Ga0157378_103410991 | 302 |
| 34 | 3300020070 | Ga0206356_10637864 | Ga0206356_106378642 | 302 |
| 35 | 3300020082 | Ga0206353_11123090 | Ga0206353_111230901 | 302 |
| 36 | 3300025909 | Ga0207705_10016850 | Ga0207705_100168502 | 302 |
| 37 | 3300025912 | Ga0207707_10012925 | Ga0207707_100129256 | 302 |
| 38 | 3300025913 | Ga0207695_10094135 | Ga0207695_100941352 | 302 |
| 39 | 3300025917 | Ga0207660_10036762 | Ga0207660_100367622 | 302 |
| 40 | 3300025921 | Ga0207652_10010295 | Ga0207652_100102956 | 302 |
| 41 | 3300025931 | Ga0207644_10213319 | Ga0207644_102133192 | 302 |
| 42 | 3300025949 | Ga0207667_10111735 | Ga0207667_101117352 | 302 |
| 43 | 3300025981 | Ga0207640_10056272 | Ga0207640_100562722 | 302 |
| 44 | 3300026078 | Ga0207702_10293745 | Ga0207702_102937452 | 302 |
| 45 | 3300028800 | Ga0265338_10273627 | Ga0265338_102736271 | 302 |
| 46 | 3300031711 | Ga0265314_10003026 | Ga0265314_100030269 | 302 |
| 47 | 3300035088 | Ga0373940_0019504 | Ga0373940_0019504_481_1458 | 302 |
| 48 | 3300035242 | Ga0373962_0034085 | Ga0373962_0034085_23_1000 | 302 |
| 49 | 3300035691 | Ga0373931_0065631 | Ga0373931_0065631_498_1475 | 302 |
| 50 | 3300048916 | Ga0496113_0185650 | Ga0496113_0185650_630_1607 | 302 |
| 51 | 3300053119 | Ga0500595_000024 | Ga0500595_000024_136239_137234 | 302 |
| 52 | 3300006175 | Ga0070712_100274451 | Ga0070712_1002744512 | 303 |
| 53 | 3300006914 | Ga0075436_100219741 | Ga0075436_1002197412 | 303 |
| 54 | 3300025915 | Ga0207693_10190106 | Ga0207693_101901062 | 303 |
| 55 | 3300031247 | Ga0265340_10039465 | Ga0265340_100394653 | 303 |
| 56 | 3300036401 | Ga0373937_0016895 | Ga0373937_0016895_4755_5735 | 303 |
| 57 | 3300041413 | Ga0439465_0094574 | Ga0439465_0094574_102_1016 | 303 |
| 58 | 3300047444 | Ga0495675_0089005 | Ga0495675_0089005_107_1087 | 303 |
| 59 | 3300005328 | Ga0070676_10053376 | Ga0070676_100533762 | 304 |
| 60 | 3300005335 | Ga0070666_10009163 | Ga0070666_100091632 | 304 |
| 61 | 3300005338 | Ga0068868_100020174 | Ga0068868_1000201742 | 304 |
| 62 | 3300005339 | Ga0070660_100070697 | Ga0070660_1000706972 | 304 |
| 63 | 3300005343 | Ga0070687_100034593 | Ga0070687_1000345932 | 304 |
| 64 | 3300005355 | Ga0070671_100180006 | Ga0070671_1001800061 | 304 |
| 65 | 3300005365 | Ga0070688_100051335 | Ga0070688_1000513352 | 304 |
| 66 | 3300005366 | Ga0070659_100127213 | Ga0070659_1001272132 | 304 |
| 67 | 3300005434 | Ga0070709_10001529 | Ga0070709_100015298 | 304 |
| 68 | 3300005435 | Ga0070714_100031601 | Ga0070714_1000316012 | 304 |
| 69 | 3300005436 | Ga0070713_100022422 | Ga0070713_1000224222 | 304 |
| 70 | 3300005437 | Ga0070710_10014507 | Ga0070710_100145072 | 304 |
| 71 | 3300005438 | Ga0070701_10044498 | Ga0070701_100444982 | 304 |
| 72 | 3300005439 | Ga0070711_100030579 | Ga0070711_1000305794 | 304 |
| 73 | 3300005456 | Ga0070678_100079179 | Ga0070678_1000791792 | 304 |
| 74 | 3300005544 | Ga0070686_100009787 | Ga0070686_1000097872 | 304 |
| 75 | 3300005548 | Ga0070665_100081386 | Ga0070665_1000813864 | 304 |
| 76 | 3300005564 | Ga0070664_100150661 | Ga0070664_1001506612 | 304 |
| 77 | 3300005615 | Ga0070702_100014372 | Ga0070702_1000143724 | 304 |
| 78 | 3300005618 | Ga0068864_100125985 | Ga0068864_1001259852 | 304 |
| 79 | 3300005841 | Ga0068863_100108239 | Ga0068863_1001082393 | 304 |
| 80 | 3300005842 | Ga0068858_100223410 | Ga0068858_1002234101 | 304 |
| 81 | 3300006028 | Ga0070717_10001161 | Ga0070717_1000116112 | 304 |
| 82 | 3300006173 | Ga0070716_100010681 | Ga0070716_1000106815 | 304 |
| 83 | 3300006358 | Ga0068871_100014899 | Ga0068871_1000148995 | 304 |
| 84 | 3300006881 | Ga0068865_100387466 | Ga0068865_1003874661 | 304 |
| 85 | 3300006914 | Ga0075436_100014253 | Ga0075436_1000142534 | 304 |
| 86 | 3300007076 | Ga0075435_100053548 | Ga0075435_1000535482 | 304 |
| 87 | 3300007788 | Ga0099795_10075424 | Ga0099795_100754241 | 304 |
| 88 | 3300009098 | Ga0105245_10323240 | Ga0105245_103232402 | 304 |
| 89 | 3300009101 | Ga0105247_10020069 | Ga0105247_100200691 | 304 |
| 90 | 3300009148 | Ga0105243_10009246 | Ga0105243_100092465 | 304 |
| 91 | 3300009174 | Ga0105241_10066165 | Ga0105241_100661653 | 304 |
| 92 | 3300009176 | Ga0105242_10093553 | Ga0105242_100935532 | 304 |
| 93 | 3300009177 | Ga0105248_10054939 | Ga0105248_100549394 | 304 |
| 94 | 3300009551 | Ga0105238_10037330 | Ga0105238_100373305 | 304 |
| 95 | 3300010375 | Ga0105239_10255948 | Ga0105239_102559482 | 304 |
| 96 | 3300013296 | Ga0157374_10315118 | Ga0157374_103151182 | 304 |
| 97 | 3300013306 | Ga0163162_10137012 | Ga0163162_101370122 | 304 |
| 98 | 3300013308 | Ga0157375_10073104 | Ga0157375_100731043 | 304 |
| 99 | 3300014326 | Ga0157380_10195843 | Ga0157380_101958432 | 304 |
| 100 | 3300025898 | Ga0207692_10009560 | Ga0207692_100095603 | 304 |
| 101 | 3300025900 | Ga0207710_10004647 | Ga0207710_100046472 | 304 |
| 102 | 3300025903 | Ga0207680_10009990 | Ga0207680_100099902 | 304 |
| 103 | 3300025905 | Ga0207685_10002988 | Ga0207685_100029881 | 304 |
| 104 | 3300025906 | Ga0207699_10004747 | Ga0207699_100047475 | 304 |
| 105 | 3300025907 | Ga0207645_10016432 | Ga0207645_100164325 | 304 |
| 106 | 3300025918 | Ga0207662_10040341 | Ga0207662_100403412 | 304 |
| 107 | 3300025919 | Ga0207657_10034884 | Ga0207657_100348842 | 304 |
| 108 | 3300025924 | Ga0207694_10029693 | Ga0207694_100296932 | 304 |
| 109 | 3300025925 | Ga0207650_10122609 | Ga0207650_101226092 | 304 |
| 110 | 3300025927 | Ga0207687_10006416 | Ga0207687_100064165 | 304 |
| 111 | 3300025928 | Ga0207700_10013332 | Ga0207700_100133322 | 304 |
| 112 | 3300025929 | Ga0207664_10081399 | Ga0207664_100813992 | 304 |
| 113 | 3300025931 | Ga0207644_10011324 | Ga0207644_100113245 | 304 |
| 114 | 3300025934 | Ga0207686_10006030 | Ga0207686_100060304 | 304 |
| 115 | 3300025936 | Ga0207670_10069004 | Ga0207670_100690042 | 304 |
| 116 | 3300025938 | Ga0207704_10023473 | Ga0207704_100234733 | 304 |
| 117 | 3300025939 | Ga0207665_10001391 | Ga0207665_100013914 | 304 |
| 118 | 3300025941 | Ga0207711_10029338 | Ga0207711_100293382 | 304 |
| 119 | 3300025942 | Ga0207689_10028470 | Ga0207689_100284702 | 304 |
| 120 | 3300026067 | Ga0207678_10009251 | Ga0207678_100092514 | 304 |
| 121 | 3300026088 | Ga0207641_10030576 | Ga0207641_100305762 | 304 |
| 122 | 3300026095 | Ga0207676_10037847 | Ga0207676_100378474 | 304 |
| 123 | 3300026121 | Ga0207683_10020673 | Ga0207683_100206736 | 304 |
| 124 | 3300027907 | Ga0207428_10000058 | Ga0207428_1000005859 | 304 |
| 125 | 3300028379 | Ga0268266_10012179 | Ga0268266_100121795 | 304 |
| 126 | 3300034816 | Ga0373930_0010397 | Ga0373930_0010397_606_1583 | 304 |
| 127 | 3300034957 | Ga0373938_0003021 | Ga0373938_0003021_1572_2549 | 304 |
| 128 | 3300035085 | Ga0373929_0001838 | Ga0373929_0001838_1994_2971 | 304 |
| 129 | 3300035088 | Ga0373940_0025820 | Ga0373940_0025820_245_1222 | 304 |
| 130 | 3300035089 | Ga0373944_0033067 | Ga0373944_0033067_263_1240 | 304 |
| 131 | 3300035090 | Ga0373949_0002656 | Ga0373949_0002656_2915_3892 | 304 |
| 132 | 3300035112 | Ga0373932_0004893 | Ga0373932_0004893_622_1599 | 304 |
| 133 | 3300035115 | Ga0373941_0027427 | Ga0373941_0027427_521_1498 | 304 |
| 134 | 3300035121 | Ga0373960_0007461 | Ga0373960_0007461_576_1553 | 304 |
| 135 | 3300035170 | Ga0373943_0139808 | Ga0373943_0139808_167_1144 | 304 |
| 136 | 3300035242 | Ga0373962_0002230 | Ga0373962_0002230_2143_3120 | 304 |
| 137 | 3300035691 | Ga0373931_0084732 | Ga0373931_0084732_172_1149 | 304 |
| 138 | 3300035692 | Ga0373935_0005678 | Ga0373935_0005678_4312_5289 | 304 |
| 139 | 3300035695 | Ga0373927_0011098 | Ga0373927_0011098_4267_5244 | 304 |
| 140 | 3300035725 | Ga0373947_0020787 | Ga0373947_0020787_882_1859 | 304 |
| 141 | 3300046455 | Ga0495603_0026652 | Ga0495603_0026652_1677_2654 | 304 |
| 142 | 3300046459 | Ga0495629_0000579 | Ga0495629_0000579_11656_12633 | 304 |
| 143 | 3300046461 | Ga0495641_0012369 | Ga0495641_0012369_3595_4572 | 304 |
| 144 | 3300046473 | Ga0495582_0009581 | Ga0495582_0009581_3213_4190 | 304 |
| 145 | 3300046475 | Ga0495639_0060067 | Ga0495639_0060067_539_1516 | 304 |
| 146 | 3300046499 | Ga0495594_0034165 | Ga0495594_0034165_1579_2556 | 304 |
| 147 | 3300046683 | Ga0495658_0000402 | Ga0495658_0000402_6525_7502 | 304 |
| 148 | 3300046689 | Ga0495613_0083984 | Ga0495613_0083984_521_1498 | 304 |
| 149 | 3300047322 | Ga0495680_0031560 | Ga0495680_0031560_417_1394 | 304 |
| 150 | 3300048904 | Ga0496101_0009114 | Ga0496101_0009114_4188_5165 | 304 |
| 151 | 3300048905 | Ga0496102_0075211 | Ga0496102_0075211_2067_3044 | 304 |
| 152 | 3300048906 | Ga0496103_0005740 | Ga0496103_0005740_4656_5633 | 304 |
| 153 | 3300048908 | Ga0496105_0011899 | Ga0496105_0011899_5358_6335 | 304 |
| 154 | 3300048909 | Ga0496106_0037819 | Ga0496106_0037819_2255_3232 | 304 |
| 155 | 3300048910 | Ga0496107_0098874 | Ga0496107_0098874_151_1128 | 304 |
| 156 | 3300048913 | Ga0496110_0010454 | Ga0496110_0010454_5360_6337 | 304 |
| 157 | 3300048914 | Ga0496111_0087776 | Ga0496111_0087776_1138_2115 | 304 |
| 158 | 3300048915 | Ga0496112_0035778 | Ga0496112_0035778_765_1742 | 304 |
| 159 | 3300048916 | Ga0496113_0009640 | Ga0496113_0009640_1347_2324 | 304 |
| 160 | 3300048917 | Ga0496114_0009978 | Ga0496114_0009978_5959_6936 | 304 |
| 161 | 3300048918 | Ga0496115_0046715 | Ga0496115_0046715_1138_2115 | 304 |
| 162 | 3300048918 | Ga0496115_0090384 | Ga0496115_0090384_1404_2381 | 304 |
| 163 | 3300049571 | Ga0501034_0046540 | Ga0501034_0046540_2518_3498 | 304 |
| 164 | 3300049581 | Ga0501047_0077632 | Ga0501047_0077632_121_1101 | 304 |
| 165 | 3300049744 | Ga0501083_0170805 | Ga0501083_0170805_139_1119 | 304 |
| 166 | 3300050507 | nmdc:mga05p37_35_c1 | nmdc:mga05p37_35_c1_58987_59964 | 304 |
| 167 | 3300050508 | nmdc:mga09592_163_c1 | nmdc:mga09592_163_c1_6676_7653 | 304 |
| 168 | 3300050509 | nmdc:mga0qj67_143_c1 | nmdc:mga0qj67_143_c1_6675_7652 | 304 |
| 169 | 3300050510 | nmdc:mga06r32_936_c1 | nmdc:mga06r32_936_c1_4963_5940 | 304 |
| 170 | 3300050511 | nmdc:mga08y16_2671_c1 | nmdc:mga08y16_2671_c1_5788_6765 | 304 |
| 171 | 3300050512 | nmdc:mga0n895_2984_c1 | nmdc:mga0n895_2984_c1_6759_7736 | 304 |
| 172 | 3300050512 | nmdc:mga0n895_96051_c1 | nmdc:mga0n895_96051_c1_961_1938 | 304 |
| 173 | 3300050513 | nmdc:mga0rr50_12072_c1 | nmdc:mga0rr50_12072_c1_548_1525 | 304 |
| 174 | 3300050513 | nmdc:mga0rr50_42198_c1 | nmdc:mga0rr50_42198_c1_1146_2123 | 304 |
| 175 | 3300050514 | nmdc:mga08x19_44766_c1 | nmdc:mga08x19_44766_c1_113_1090 | 304 |
| 176 | 3300050515 | nmdc:mga0a205_687_c1 | nmdc:mga0a205_687_c1_2356_3333 | 304 |
| 177 | 3300053085 | Ga0495619_0000361 | Ga0495619_0000361_7014_7991 | 304 |
| 178 | 3300060353 | Ga0501082_0342294 | Ga0501082_0342294_145_1125 | 304 |
| 179 | 3300005290 | Ga0065712_10073264 | Ga0065712_100732643 | 305 |
| 180 | 3300005365 | Ga0070688_100144597 | Ga0070688_1001445972 | 305 |
| 181 | 3300005617 | Ga0068859_100085302 | Ga0068859_1000853022 | 305 |
| 182 | 3300006931 | Ga0097620_100085303 | Ga0097620_1000853034 | 305 |
| 183 | 3300009011 | Ga0105251_10080813 | Ga0105251_100808132 | 305 |
| 184 | 3300014325 | Ga0163163_10018179 | Ga0163163_100181795 | 305 |
| 185 | 3300048911 | Ga0496108_0013444 | Ga0496108_0013444_3499_4476 | 305 |
| 186 | 3300048912 | Ga0496109_0000502 | Ga0496109_0000502_787_1764 | 305 |
| 187 | 3300048914 | Ga0496111_0018611 | Ga0496111_0018611_1631_2608 | 305 |
| 188 | 3300048915 | Ga0496112_0087140 | Ga0496112_0087140_1170_2147 | 305 |
| 189 | 3300048916 | Ga0496113_0021121 | Ga0496113_0021121_2307_3284 | 305 |
| 190 | 3300050496 | nmdc:mga07m45_39049_c1 | nmdc:mga07m45_39049_c1_616_1593 | 305 |
| 191 | 3300009147 | Ga0114129_10039615 | Ga0114129_100396154 | 308 |
| 192 | 3300050507 | nmdc:mga05p37_161839_c1 | nmdc:mga05p37_161839_c1_1506_2486 | 308 |
| 193 | 3300050509 | nmdc:mga0qj67_94193_c1 | nmdc:mga0qj67_94193_c1_1180_2160 | 308 |
| 194 | 3300050510 | nmdc:mga06r32_514117_c1 | nmdc:mga06r32_514117_c1_135_1115 | 308 |
| 195 | 3300005842 | Ga0068858_100124581 | Ga0068858_1001245812 | 309 |
| 196 | 3300006846 | Ga0075430_100091710 | Ga0075430_1000917102 | 309 |
| 197 | 3300006847 | Ga0075431_100076541 | Ga0075431_1000765412 | 309 |
| 198 | 3300006880 | Ga0075429_100081581 | Ga0075429_1000815812 | 309 |
| 199 | 3300009177 | Ga0105248_10077222 | Ga0105248_100772223 | 309 |
| 200 | 3300014968 | Ga0157379_10092951 | Ga0157379_100929511 | 309 |
| 201 | 3300025941 | Ga0207711_10034451 | Ga0207711_100344513 | 309 |
| 202 | 3300026035 | Ga0207703_10092987 | Ga0207703_100929872 | 309 |
| 203 | 3300049587 | Ga0501071_0469400 | Ga0501071_0469400_18_953 | 309 |
| 204 | 3300053094 | Ga0500566_0196297 | Ga0500566_0196297_56_991 | 309 |
| 205 | 3300053731 | Ga0500609_011002 | Ga0500609_011002_265_1200 | 309 |
| 206 | 3300003215 | JGI25153J46596_10032175 | JGI25153J46596_100321752 | 310 |
| 207 | 3300005327 | Ga0070658_10219941 | Ga0070658_102199412 | 310 |
| 208 | 3300005563 | Ga0068855_100050495 | Ga0068855_1000504953 | 310 |
| 209 | 3300005616 | Ga0068852_100190332 | Ga0068852_1001903322 | 310 |
| 210 | 3300010375 | Ga0105239_10017368 | Ga0105239_100173683 | 310 |
| 211 | 3300025297 | Ga0209758_1002374 | Ga0209758_10023747 | 310 |
| 212 | 3300025909 | Ga0207705_10116329 | Ga0207705_101163292 | 310 |
| 213 | 3300025921 | Ga0207652_10124855 | Ga0207652_101248552 | 310 |
| 214 | 3300025949 | Ga0207667_10008711 | Ga0207667_1000871110 | 310 |
| 215 | 3300026041 | Ga0207639_10079315 | Ga0207639_100793152 | 310 |
| 216 | 3300026078 | Ga0207702_10450418 | Ga0207702_104504181 | 310 |
| 217 | 3300026116 | Ga0207674_10044332 | Ga0207674_100443322 | 310 |
| 218 | 3300026142 | Ga0207698_10080210 | Ga0207698_100802102 | 310 |
| 219 | 3300048907 | Ga0496104_0016915 | Ga0496104_0016915_1286_2263 | 310 |
| 220 | 3300053094 | Ga0500566_0000407 | Ga0500566_0000407_20831_21808 | 310 |
| 221 | 3300003784 | Ga0055534_1004459 | Ga0055534_10044593 | 311 |
| 222 | 3300025284 | Ga0209130_1003029 | Ga0209130_10030293 | 311 |
| 223 | 3300025292 | Ga0209676_1015450 | Ga0209676_10154503 | 311 |
| 224 | 3300031241 | Ga0265325_10002090 | Ga0265325_1000209011 | 311 |
| 225 | 3300025230 | Ga0209563_102420 | Ga0209563_1024202 | 312 |
| 226 | 3300025253 | Ga0209677_104313 | Ga0209677_1043133 | 312 |
| 227 | 3300025299 | Ga0209256_1022522 | Ga0209256_10225222 | 312 |
| 228 | 3300031595 | Ga0265313_10000340 | Ga0265313_100003406 | 312 |
| 229 | 3300041505 | Ga0451849_0786269 | Ga0451849_0786269_21_995 | 312 |
| 230 | 3300048090 | Ga0495615_0003265 | Ga0495615_0003265_867_1847 | 312 |
| 231 | 3300053087 | Ga0500643_000085 | Ga0500643_000085_26250_27227 | 312 |
| 232 | 3300053093 | Ga0500651_0087024 | Ga0500651_0087024_631_1608 | 312 |
| 233 | 3300053096 | Ga0500641_0035624 | Ga0500641_0035624_379_1356 | 312 |
| 234 | 3300053098 | Ga0500650_0117629 | Ga0500650_0117629_208_1185 | 312 |
| 235 | 3300053103 | Ga0500555_003024 | Ga0500555_003024_2508_3485 | 312 |
| 236 | 3300053134 | Ga0500658_0120328 | Ga0500658_0120328_121_1098 | 312 |
| 237 | 3300053151 | Ga0500604_0038841 | Ga0500604_0038841_100_1077 | 312 |
| 238 | 3300053153 | Ga0500616_0017200 | Ga0500616_0017200_1375_2358 | 312 |
| 239 | 3300013250 | Ga0171462_1006 | Ga0171462_1006224 | 313 |
| 240 | 3300053131 | Ga0500652_000011 | Ga0500652_000011_24000_24980 | 313 |
| 241 | 3300035692 | Ga0373935_0157647 | Ga0373935_0157647_545_1516 | 315 |
| 242 | 3300009148 | Ga0105243_10224325 | Ga0105243_102243252 | 316 |
| 243 | 3300050507 | nmdc:mga05p37_161839_c1 | nmdc:mga05p37_161839_c1_385_1368 | 316 |
| 244 | 3300005295 | Ga0065707_10014353 | Ga0065707_100143531 | 317 |
| 245 | 3300005334 | Ga0068869_100069768 | Ga0068869_1000697683 | 317 |
| 246 | 3300005344 | Ga0070661_100112131 | Ga0070661_1001121312 | 317 |
| 247 | 3300005455 | Ga0070663_100029962 | Ga0070663_1000299623 | 317 |
| 248 | 3300005539 | Ga0068853_100082074 | Ga0068853_1000820742 | 317 |
| 249 | 3300005563 | Ga0068855_100067612 | Ga0068855_1000676121 | 317 |
| 250 | 3300009094 | Ga0111539_10220485 | Ga0111539_102204852 | 317 |
| 251 | 3300009553 | Ga0105249_10263329 | Ga0105249_102633292 | 317 |
| 252 | 3300025297 | Ga0209758_1017713 | Ga0209758_10177132 | 317 |
| 253 | 3300025909 | Ga0207705_10269559 | Ga0207705_102695592 | 317 |
| 254 | 3300026041 | Ga0207639_10062824 | Ga0207639_100628242 | 317 |
| 255 | 3300026067 | Ga0207678_10048390 | Ga0207678_100483903 | 317 |
| 256 | 3300026142 | Ga0207698_10390680 | Ga0207698_103906802 | 317 |
| 257 | 3300028380 | Ga0268265_10273760 | Ga0268265_102737602 | 317 |
| 258 | 3300003215 | JGI25153J46596_10004863 | JGI25153J46596_100048636 | 318 |
| 259 | 3300005330 | Ga0070690_100098347 | Ga0070690_1000983472 | 318 |
| 260 | 3300005336 | Ga0070680_100009689 | Ga0070680_1000096894 | 318 |
| 261 | 3300005366 | Ga0070659_100054181 | Ga0070659_1000541812 | 318 |
| 262 | 3300005435 | Ga0070714_100172179 | Ga0070714_1001721793 | 318 |
| 263 | 3300005436 | Ga0070713_100267510 | Ga0070713_1002675102 | 318 |
| 264 | 3300005437 | Ga0070710_10015884 | Ga0070710_100158842 | 318 |
| 265 | 3300005439 | Ga0070711_100075556 | Ga0070711_1000755562 | 318 |
| 266 | 3300005455 | Ga0070663_100022776 | Ga0070663_1000227762 | 318 |
| 267 | 3300005458 | Ga0070681_10020369 | Ga0070681_100203695 | 318 |
| 268 | 3300005530 | Ga0070679_100033019 | Ga0070679_1000330196 | 318 |
| 269 | 3300005545 | Ga0070695_100135866 | Ga0070695_1001358662 | 318 |
| 270 | 3300005614 | Ga0068856_100243491 | Ga0068856_1002434913 | 318 |
| 271 | 3300006175 | Ga0070712_100185898 | Ga0070712_1001858982 | 318 |
| 272 | 3300006177 | Ga0075362_10033734 | Ga0075362_100337342 | 318 |
| 273 | 3300006881 | Ga0068865_100360277 | Ga0068865_1003602771 | 318 |
| 274 | 3300009098 | Ga0105245_10081957 | Ga0105245_100819572 | 318 |
| 275 | 3300009176 | Ga0105242_10074919 | Ga0105242_100749192 | 318 |
| 276 | 3300013102 | Ga0157371_10122727 | Ga0157371_101227272 | 318 |
| 277 | 3300013105 | Ga0157369_10098231 | Ga0157369_100982313 | 318 |
| 278 | 3300013306 | Ga0163162_10122200 | Ga0163162_101222003 | 318 |
| 279 | 3300013307 | Ga0157372_10439730 | Ga0157372_104397301 | 318 |
| 280 | 3300014968 | Ga0157379_10114162 | Ga0157379_101141622 | 318 |
| 281 | 3300014969 | Ga0157376_10168417 | Ga0157376_101684172 | 318 |
| 282 | 3300025297 | Ga0209758_1000211 | Ga0209758_100021157 | 318 |
| 283 | 3300025898 | Ga0207692_10022758 | Ga0207692_100227582 | 318 |
| 284 | 3300025905 | Ga0207685_10005749 | Ga0207685_100057492 | 318 |
| 285 | 3300025911 | Ga0207654_10036971 | Ga0207654_100369713 | 318 |
| 286 | 3300025915 | Ga0207693_10009838 | Ga0207693_100098383 | 318 |
| 287 | 3300025915 | Ga0207693_10021820 | Ga0207693_100218202 | 318 |
| 288 | 3300025917 | Ga0207660_10098654 | Ga0207660_100986542 | 318 |
| 289 | 3300025921 | Ga0207652_10179800 | Ga0207652_101798002 | 318 |
| 290 | 3300025921 | Ga0207652_10352966 | Ga0207652_103529662 | 318 |
| 291 | 3300025927 | Ga0207687_10120178 | Ga0207687_101201781 | 318 |
| 292 | 3300025932 | Ga0207690_10220540 | Ga0207690_102205402 | 318 |
| 293 | 3300025939 | Ga0207665_10011994 | Ga0207665_100119945 | 318 |
| 294 | 3300026067 | Ga0207678_10023444 | Ga0207678_100234443 | 318 |
| 295 | 3300026118 | Ga0207675_100358304 | Ga0207675_1003583042 | 318 |
| 296 | 3300026121 | Ga0207683_10034149 | Ga0207683_100341492 | 318 |
| 297 | 3300028381 | Ga0268264_10179896 | Ga0268264_101798962 | 318 |
| 298 | 3300035083 | Ga0373926_0026781 | Ga0373926_0026781_954_1973 | 318 |
| 299 | 3300035089 | Ga0373944_0066431 | Ga0373944_0066431_131_1150 | 318 |
| 300 | 3300035113 | Ga0373936_0046784 | Ga0373936_0046784_593_1612 | 318 |
| 301 | 3300035171 | Ga0373946_0017722 | Ga0373946_0017722_738_1757 | 318 |
| 302 | 3300035172 | Ga0373955_0056201 | Ga0373955_0056201_1055_2035 | 318 |
| 303 | 3300035692 | Ga0373935_0045366 | Ga0373935_0045366_1441_2424 | 318 |
| 304 | 3300035695 | Ga0373927_0042625 | Ga0373927_0042625_607_1590 | 318 |
| 305 | 3300037471 | Ga0395905_0028226 | Ga0395905_0028226_936_1913 | 318 |
| 306 | 3300038443 | Ga0395901_0201556 | Ga0395901_0201556_1070_2047 | 318 |
| 307 | 3300044658 | Ga0466972_0000188 | Ga0466972_0000188_18053_19030 | 318 |
| 308 | 3300046459 | Ga0495629_0027679 | Ga0495629_0027679_2263_3246 | 318 |
| 309 | 3300046477 | Ga0495664_0017279 | Ga0495664_0017279_2099_3082 | 318 |
| 310 | 3300046514 | Ga0495618_0068883 | Ga0495618_0068883_1001_1984 | 318 |
| 311 | 3300046531 | Ga0495665_0015372 | Ga0495665_0015372_2993_3976 | 318 |
| 312 | 3300046533 | Ga0495640_0036342 | Ga0495640_0036342_2075_3097 | 318 |
| 313 | 3300046663 | Ga0495635_0024823 | Ga0495635_0024823_2656_3678 | 318 |
| 314 | 3300046674 | Ga0495588_0064367 | Ga0495588_0064367_104_1123 | 318 |
| 315 | 3300046690 | Ga0495624_0061770 | Ga0495624_0061770_571_1554 | 318 |
| 316 | 3300047319 | Ga0495674_0037708 | Ga0495674_0037708_1130_2152 | 318 |
| 317 | 3300047322 | Ga0495680_0038112 | Ga0495680_0038112_2165_3187 | 318 |
| 318 | 3300047471 | Ga0495684_0033427 | Ga0495684_0033427_2173_3195 | 318 |
| 319 | 3300047673 | Ga0495593_0057483 | Ga0495593_0057483_943_1926 | 318 |
| 320 | 3300048907 | Ga0496104_0014019 | Ga0496104_0014019_2625_3647 | 318 |
| 321 | 3300048909 | Ga0496106_0037189 | Ga0496106_0037189_501_1520 | 318 |
| 322 | 3300048910 | Ga0496107_0252800 | Ga0496107_0252800_20_1000 | 318 |
| 323 | 3300048911 | Ga0496108_0121981 | Ga0496108_0121981_21_1043 | 318 |
| 324 | 3300048917 | Ga0496114_0139984 | Ga0496114_0139984_917_1939 | 318 |
| 325 | 3300048918 | Ga0496115_0040610 | Ga0496115_0040610_567_1589 | 318 |
| 326 | 3300048918 | Ga0496115_0048002 | Ga0496115_0048002_2038_3018 | 318 |
| 327 | 3300050492 | nmdc:mga0yw44_88797_c1 | nmdc:mga0yw44_88797_c1_375_1352 | 318 |
| 328 | 3300053077 | Ga0495601_0002696 | Ga0495601_0002696_2234_3217 | 318 |
| 329 | 3300053078 | Ga0495612_0006661 | Ga0495612_0006661_2261_3244 | 318 |
| 330 | 3300053085 | Ga0495619_0011450 | Ga0495619_0011450_2173_3156 | 318 |
| 331 | iso_pu_bacteria | 2824617872 | 2824623313 | 318 |
| 332 | iso_pu_bacteria | 2824626560 | 2824631297 | 318 |
| 333 | iso_pu_bacteria | 2824635225 | 2824638912 | 318 |
| 334 | iso_pu_bacteria | 2824644064 | 2824647453 | 318 |
| 335 | iso_pu_bacteria | 2824714736 | 2824718743 | 318 |
| 336 | iso_pu_bacteria | 2824723954 | 2824729113 | 318 |
| 337 | iso_pu_bacteria | 2885366525 | 2885372167 | 318 |
| 338 | 3300006048 | Ga0075363_100026436 | Ga0075363_1000264364 | 319 |
| 339 | 3300006048 | Ga0075363_100045820 | Ga0075363_1000458202 | 319 |
| 340 | 3300006178 | Ga0075367_10071166 | Ga0075367_100711662 | 319 |
| 341 | 3300009147 | Ga0114129_10039615 | Ga0114129_100396153 | 319 |
| 342 | 3300025295 | Ga0209564_1000065 | Ga0209564_1000065287 | 319 |
| 343 | 3300027866 | Ga0209813_10043129 | Ga0209813_100431292 | 319 |
| 344 | 3300046455 | Ga0495603_0121270 | Ga0495603_0121270_326_1303 | 319 |
| 345 | 3300050490 | nmdc:mga03n38_34588_c1 | nmdc:mga03n38_34588_c1_54_1031 | 319 |
| 346 | 3300050490 | nmdc:mga03n38_52490_c1 | nmdc:mga03n38_52490_c1_795_1772 | 319 |
| 347 | 3300050493 | nmdc:mga0k408_19015_c1 | nmdc:mga0k408_19015_c1_937_1908 | 319 |
| 348 | 3300050493 | nmdc:mga0k408_84909_c1 | nmdc:mga0k408_84909_c1_621_1592 | 319 |
| 349 | 3300050494 | nmdc:mga06z11_244356_c1 | nmdc:mga06z11_244356_c1_48_1019 | 319 |
| 350 | 3300050494 | nmdc:mga06z11_47933_c1 | nmdc:mga06z11_47933_c1_252_1229 | 319 |
| 351 | 3300050496 | nmdc:mga07m45_30143_c2 | nmdc:mga07m45_30143_c2_183_1160 | 319 |
| 352 | 3300053153 | Ga0500616_0064347 | Ga0500616_0064347_183_1178 | 319 |
| 353 | iso_pu_bacteria | 2507262055 | 2507508999 | 319 |
| 354 | iso_pu_bacteria | 2508501009 | 2508543062 | 319 |
| 355 | iso_pu_bacteria | 2508501042 | 2508691207 | 319 |
| 356 | iso_pu_bacteria | 2511231028 | 2511394706 | 319 |
| 357 | iso_pu_bacteria | 2513237087 | 2513590390 | 319 |
| 358 | iso_pu_bacteria | 2513237092 | 2513624362 | 319 |
| 359 | iso_pu_bacteria | 2513237094 | 2513642004 | 319 |
| 360 | iso_pu_bacteria | 2513237102 | 2513703277 | 319 |
| 361 | iso_pu_bacteria | 2513237161 | 2514015988 | 319 |
| 362 | iso_pu_bacteria | 2515154112 | 2515626418 | 319 |
| 363 | iso_pu_bacteria | 2617270735 | 2617348681 | 319 |
| 364 | iso_pu_bacteria | 2617270741 | 2617376126 | 319 |
| 365 | iso_pu_bacteria | 2791355196 | 2793065874 | 319 |
| 366 | iso_pu_bacteria | 2824671348 | 2824676342 | 319 |
| 367 | iso_pu_bacteria | 2824687955 | 2824692741 | 319 |
| 368 | iso_pu_bacteria | 2824732956 | 2824737002 | 319 |
| 369 | iso_pu_bacteria | 2824773399 | 2824776462 | 319 |
| 370 | iso_pu_bacteria | 2838122688 | 2838124100 | 319 |
| 371 | iso_pu_bacteria | 2841941048 | 2841943772 | 319 |
| 372 | iso_pu_bacteria | 2841949485 | 2841950200 | 319 |
| 373 | iso_pu_bacteria | 2841957949 | 2841958345 | 319 |
| 374 | iso_pu_bacteria | 2841966195 | 2841966593 | 319 |
| 375 | iso_pu_bacteria | 2841974524 | 2841975333 | 319 |
| 376 | iso_pu_bacteria | 2841983080 | 2841983102 | 319 |
| 377 | iso_pu_bacteria | 2842038055 | 2842039399 | 319 |
| 378 | iso_pu_bacteria | 2842045827 | 2842047655 | 319 |
| 379 | iso_pu_bacteria | 2849076700 | 2849079631 | 319 |
| 380 | iso_pu_bacteria | 2874590934 | 2874592673 | 319 |
| 381 | iso_pu_bacteria | 2874612657 | 2874616144 | 319 |
| 382 | iso_pu_bacteria | 2874620515 | 2874627450 | 319 |
| 383 | iso_pu_bacteria | 2874645413 | 2874648290 | 319 |
| 384 | iso_pu_bacteria | 2876771140 | 2876772886 | 319 |
| 385 | iso_pu_bacteria | 2876818435 | 2876820214 | 319 |
| 386 | iso_pu_bacteria | 2879074833 | 2879076717 | 319 |
| 387 | iso_pu_bacteria | 2879127579 | 2879131672 | 319 |
| 388 | iso_pu_bacteria | 2879142872 | 2879148035 | 319 |
| 389 | iso_pu_bacteria | 2881364244 | 2881371776 | 319 |
| 390 | iso_pu_bacteria | 2888388044 | 2888394242 | 319 |
| 391 | iso_pu_bacteria | 2904666416 | 2904671032 | 319 |
| 392 | iso_pu_bacteria | 2906626472 | 2906630032 | 319 |
| 393 | iso_pu_bacteria | 2906643746 | 2906648725 | 319 |
| 394 | iso_pu_bacteria | 2908775508 | 2908779788 | 319 |
| 395 | iso_pu_bacteria | 2919171160 | 2919172659 | 319 |
| 396 | iso_pu_bacteria | 2932794094 | 2932798552 | 319 |
| 397 | iso_pu_bacteria | 2932801729 | 2932803140 | 319 |
| 398 | iso_pu_bacteria | 2935608549 | 2935612154 | 319 |
| 399 | iso_pu_bacteria | 2935648319 | 2935649724 | 319 |
| 400 | iso_pu_bacteria | 2935656913 | 2935658761 | 319 |
| 401 | iso_pu_bacteria | 2935769743 | 2935774991 | 319 |
| 402 | iso_pu_bacteria | 2935777560 | 2935782650 | 319 |
| 403 | iso_pu_bacteria | 2935785616 | 2935791764 | 319 |
| 404 | iso_pu_bacteria | 2935793552 | 2935800004 | 319 |
| 405 | iso_pu_bacteria | 2935819856 | 2935821624 | 319 |
| 406 | iso_pu_bacteria | 2935847175 | 2935847225 | 319 |
| 407 | iso_pu_bacteria | 2935883170 | 2935885478 | 319 |
| 408 | iso_pu_bacteria | 2935908558 | 2935914671 | 319 |
| 409 | iso_pu_bacteria | 2935916978 | 2935924862 | 319 |
| 410 | iso_pu_bacteria | 2935926038 | 2935932251 | 319 |
| 411 | iso_pu_bacteria | 2935934488 | 2935940849 | 319 |
| 412 | iso_pu_bacteria | 2935942939 | 2935948922 | 319 |
| 413 | iso_pu_bacteria | 2935951376 | 2935957480 | 319 |
| 414 | iso_pu_bacteria | 2935959822 | 2935960044 | 319 |
| 415 | iso_pu_bacteria | 2935967501 | 2935973927 | 319 |
| 416 | iso_pu_bacteria | 2935975950 | 2935977325 | 319 |
| 417 | iso_pu_bacteria | 2935984226 | 2935988518 | 319 |
| 418 | iso_pu_bacteria | 2936011229 | 2936012794 | 319 |
| 419 | iso_pu_bacteria | 2936019824 | 2936021358 | 319 |
| 420 | iso_pu_bacteria | 2936028420 | 2936030087 | 319 |
| 421 | iso_pu_bacteria | 2936046547 | 2936047552 | 319 |
| 422 | iso_pu_bacteria | 2936055302 | 2936057290 | 319 |
| 423 | iso_pu_bacteria | 3005483717 | 3005486937 | 319 |
| 424 | iso_pu_bacteria | 3005506211 | 3005510114 | 319 |
| 425 | iso_pu_bacteria | 3005587118 | 3005592472 | 319 |
| 426 | iso_pu_bacteria | 3005594810 | 3005598917 | 319 |
| 427 | iso_pu_bacteria | 3005710791 | 3005714509 | 319 |
| 428 | iso_pu_bacteria | 3005718088 | 3005722017 | 319 |
| 429 | iso_pu_bacteria | 8016522445 | 8016530002 | 319 |
| 430 | iso_pu_bacteria | 8016530956 | 8016535238 | 319 |
| 431 | iso_pu_bacteria | 8016539877 | 8016548446 | 319 |
| 432 | iso_pu_bacteria | 8016548790 | 8016553681 | 319 |
| 433 | iso_pu_bacteria | 8016557553 | 8016562063 | 319 |
| 434 | iso_pu_bacteria | 8016566248 | 8016573577 | 319 |
| 435 | iso_pu_bacteria | 8016575299 | 8016577704 | 319 |
| 436 | iso_pu_bacteria | 8016583857 | 8016592263 | 319 |
| 437 | iso_pu_bacteria | 8016595262 | 8016599885 | 319 |
| 438 | iso_pu_bacteria | 8016603502 | 8016610928 | 319 |
| 439 | iso_pu_bacteria | 8016613128 | 8016614036 | 319 |
| 440 | iso_pu_bacteria | 8016622563 | 8016627018 | 319 |
| 441 | iso_pu_bacteria | 8016630954 | 8016640719 | 319 |
| 442 | iso_pu_bacteria | 8019530166 | 8019534989 | 319 |
| 443 | iso_pu_bacteria | 8019547302 | 8019554114 | 319 |
| 444 | iso_pu_bacteria | 8019619141 | 8019627702 | 319 |
| 445 | iso_pu_bacteria | 8019629233 | 8019634804 | 319 |
| 446 | iso_pu_bacteria | 8019638758 | 8019644895 | 319 |
| 447 | iso_pu_bacteria | 8019648815 | 8019657934 | 319 |
| 448 | iso_pu_bacteria | 8019659431 | 8019662704 | 319 |
| 449 | iso_pu_bacteria | 8019668869 | 8019672315 | 319 |
| 450 | iso_pu_bacteria | 8019678201 | 8019683894 | 319 |
| 451 | iso_pu_bacteria | 8019687851 | 8019689635 | 319 |
| 452 | 3300005983 | Ga0081540_1108585 | Ga0081540_11085851 | 320 |
| 453 | 3300025940 | Ga0207691_10190128 | Ga0207691_101901283 | 320 |
| 454 | iso_pu_bacteria | 2738543013 | 2739249976 | 320 |
| 455 | iso_pu_bacteria | 2828305725 | 2828307792 | 320 |
| 456 | iso_pu_bacteria | 2840764183 | 2840766607 | 320 |
| 457 | 3300005288 | Ga0065714_10069389 | Ga0065714_100693892 | 321 |
| 458 | 3300005334 | Ga0068869_100111076 | Ga0068869_1001110762 | 321 |
| 459 | 3300005548 | Ga0070665_100166298 | Ga0070665_1001662983 | 321 |
| 460 | 3300006048 | Ga0075363_100003955 | Ga0075363_1000039555 | 321 |
| 461 | 3300006051 | Ga0075364_10031942 | Ga0075364_100319421 | 321 |
| 462 | 3300006177 | Ga0075362_10008803 | Ga0075362_100088035 | 321 |
| 463 | 3300006178 | Ga0075367_10051323 | Ga0075367_100513232 | 321 |
| 464 | 3300006195 | Ga0075366_10050914 | Ga0075366_100509142 | 321 |
| 465 | 3300006195 | Ga0075366_10053198 | Ga0075366_100531982 | 321 |
| 466 | 3300006353 | Ga0075370_10013078 | Ga0075370_100130784 | 321 |
| 467 | 3300006353 | Ga0075370_10032666 | Ga0075370_100326661 | 321 |
| 468 | 3300009094 | Ga0111539_10497463 | Ga0111539_104974631 | 321 |
| 469 | 3300009177 | Ga0105248_10110582 | Ga0105248_101105822 | 321 |
| 470 | 3300011119 | Ga0105246_10243188 | Ga0105246_102431882 | 321 |
| 471 | 3300013306 | Ga0163162_10144932 | Ga0163162_101449322 | 321 |
| 472 | 3300017792 | Ga0163161_10070460 | Ga0163161_100704602 | 321 |
| 473 | 3300017792 | Ga0163161_10172237 | Ga0163161_101722371 | 321 |
| 474 | 3300017792 | Ga0163161_10412826 | Ga0163161_104128261 | 321 |
| 475 | 3300025905 | Ga0207685_10041077 | Ga0207685_100410772 | 321 |
| 476 | 3300025942 | Ga0207689_10174400 | Ga0207689_101744003 | 321 |
| 477 | 3300026075 | Ga0207708_10093790 | Ga0207708_100937902 | 321 |
| 478 | 3300031548 | Ga0307408_100026651 | Ga0307408_1000266514 | 321 |
| 479 | 3300035241 | Ga0373961_0003980 | Ga0373961_0003980_260_1234 | 321 |
| 480 | 3300042145 | Ga0450906_002738 | Ga0450906_002738_1071_2039 | 321 |
| 481 | 3300042435 | Ga0439434_0006798 | Ga0439434_0006798_778_1746 | 321 |
| 482 | 3300042531 | Ga0450918_000683 | Ga0450918_000683_3302_4270 | 321 |
| 483 | 3300042532 | Ga0450893_0010783 | Ga0450893_0010783_356_1324 | 321 |
| 484 | 3300044683 | Ga0466965_0012342 | Ga0466965_0012342_1172_2140 | 321 |
| 485 | 3300046522 | Ga0495643_0015250 | Ga0495643_0015250_940_1908 | 321 |
| 486 | 3300046539 | Ga0495621_0002724 | Ga0495621_0002724_934_1902 | 321 |
| 487 | 3300048904 | Ga0496101_0020023 | Ga0496101_0020023_2944_3918 | 321 |
| 488 | 3300048913 | Ga0496110_0528308 | Ga0496110_0528308_79_1053 | 321 |
| 489 | 3300048917 | Ga0496114_0174335 | Ga0496114_0174335_733_1701 | 321 |
| 490 | 3300050489 | nmdc:mga03683_68184_c1 | nmdc:mga03683_68184_c1_108_1076 | 321 |
| 491 | 3300050490 | nmdc:mga03n38_120463_c1 | nmdc:mga03n38_120463_c1_144_1109 | 321 |
| 492 | 3300050492 | nmdc:mga0yw44_64176_c1 | nmdc:mga0yw44_64176_c1_790_1758 | 321 |
| 493 | 3300050493 | nmdc:mga0k408_22792_c1 | nmdc:mga0k408_22792_c1_967_1932 | 321 |
| 494 | 3300050496 | nmdc:mga07m45_24972_c1 | nmdc:mga07m45_24972_c1_1623_2588 | 321 |
| 495 | 3300050496 | nmdc:mga07m45_675_c1 | nmdc:mga07m45_675_c1_11629_12597 | 321 |
| 496 | 3300050511 | nmdc:mga08y16_366379_c1 | nmdc:mga08y16_366379_c1_163_1137 | 321 |
| 497 | 3300002987 | JGI25159J45721_1014891 | JGI25159J45721_10148912 | 322 |
| 498 | 3300005262 | Ga0065165_1000468 | Ga0065165_100046863 | 322 |
| 499 | 3300005331 | Ga0070670_100416024 | Ga0070670_1004160241 | 322 |
| 500 | 3300005340 | Ga0070689_100161824 | Ga0070689_1001618242 | 322 |
| 501 | 3300005354 | Ga0070675_100039436 | Ga0070675_1000394365 | 322 |
| 502 | 3300005356 | Ga0070674_100012069 | Ga0070674_1000120694 | 322 |
| 503 | 3300005719 | Ga0068861_100504144 | Ga0068861_1005041441 | 322 |
| 504 | 3300006048 | Ga0075363_100041343 | Ga0075363_1000413431 | 322 |
| 505 | 3300006163 | Ga0070715_10118038 | Ga0070715_101180382 | 322 |
| 506 | 3300006353 | Ga0075370_10011031 | Ga0075370_100110311 | 322 |
| 507 | 3300006844 | Ga0075428_100339575 | Ga0075428_1003395752 | 322 |
| 508 | 3300025284 | Ga0209130_1000610 | Ga0209130_100061022 | 322 |
| 509 | 3300025302 | Ga0207426_1010356 | Ga0207426_10103562 | 322 |
| 510 | 3300025901 | Ga0207688_10128920 | Ga0207688_101289201 | 322 |
| 511 | 3300025933 | Ga0207706_10182035 | Ga0207706_101820353 | 322 |
| 512 | 3300025937 | Ga0207669_10426110 | Ga0207669_104261101 | 322 |
| 513 | 3300025939 | Ga0207665_10119311 | Ga0207665_101193111 | 322 |
| 514 | 3300026121 | Ga0207683_10108287 | Ga0207683_101082871 | 322 |
| 515 | 3300027866 | Ga0209813_10005839 | Ga0209813_100058394 | 322 |
| 516 | 3300027866 | Ga0209813_10049834 | Ga0209813_100498342 | 322 |
| 517 | 3300031730 | Ga0307516_10077093 | Ga0307516_100770932 | 322 |
| 518 | 3300034816 | Ga0373930_0003564 | Ga0373930_0003564_1249_2226 | 322 |
| 519 | 3300034819 | Ga0373958_0003589 | Ga0373958_0003589_626_1603 | 322 |
| 520 | 3300034820 | Ga0373959_0008010 | Ga0373959_0008010_26_1003 | 322 |
| 521 | 3300035116 | Ga0373945_0017957 | Ga0373945_0017957_1365_2342 | 322 |
| 522 | 3300035691 | Ga0373931_0001595 | Ga0373931_0001595_2556_3533 | 322 |
| 523 | 3300048903 | Ga0496100_0117421 | Ga0496100_0117421_609_1586 | 322 |
| 524 | 3300048905 | Ga0496102_0261844 | Ga0496102_0261844_192_1169 | 322 |
| 525 | 3300048907 | Ga0496104_0050319 | Ga0496104_0050319_2021_2998 | 322 |
| 526 | 3300048908 | Ga0496105_0100655 | Ga0496105_0100655_11_988 | 322 |
| 527 | 3300048911 | Ga0496108_0193483 | Ga0496108_0193483_113_1090 | 322 |
| 528 | 3300048913 | Ga0496110_0067646 | Ga0496110_0067646_131_1108 | 322 |
| 529 | 3300048914 | Ga0496111_0043791 | Ga0496111_0043791_1939_2916 | 322 |
| 530 | 3300049581 | Ga0501047_0254441 | Ga0501047_0254441_211_1188 | 322 |
| 531 | 3300049589 | Ga0501073_0029164 | Ga0501073_0029164_907_1884 | 322 |
| 532 | 3300050491 | nmdc:mga00v17_26326_c1 | nmdc:mga00v17_26326_c1_1539_2516 | 322 |
| 533 | 3300050493 | nmdc:mga0k408_93898_c1 | nmdc:mga0k408_93898_c1_50_1027 | 322 |
| 534 | 3300050494 | nmdc:mga06z11_27952_c1 | nmdc:mga06z11_27952_c1_301_1278 | 322 |
| 535 | 3300050494 | nmdc:mga06z11_28433_c1 | nmdc:mga06z11_28433_c1_278_1270 | 322 |
| 536 | 3300050495 | nmdc:mga04h51_4970_c1 | nmdc:mga04h51_4970_c1_1360_2337 | 322 |
| 537 | 3300050516 | nmdc:mga0sz30_51184_c1 | nmdc:mga0sz30_51184_c1_173_1150 | 322 |
| 538 | 3300053096 | Ga0500641_0106403 | Ga0500641_0106403_112_1107 | 322 |
| 539 | 3300053130 | Ga0500642_0077483 | Ga0500642_0077483_257_1237 | 322 |
| 540 | 3300053153 | Ga0500616_0047724 | Ga0500616_0047724_1204_2199 | 322 |
| 541 | 3300060353 | Ga0501082_0239869 | Ga0501082_0239869_304_1281 | 322 |
| 542 | iso_pu_bacteria | 2585427634 | 2586002834 | 322 |
| 543 | iso_pu_bacteria | 2643221547 | 2643755146 | 322 |
| 544 | iso_pu_bacteria | 2643221736 | 2644742099 | 322 |
| 545 | iso_pu_bacteria | 8056875544 | 8056876443 | 322 |
| 546 | 3300003354 | JGI25160J50197_1000506 | JGI25160J50197_100050614 | 323 |
| 547 | 3300003771 | Ga0055526_1003350 | Ga0055526_10033504 | 323 |
| 548 | 3300003775 | Ga0055524_1000068 | Ga0055524_100006874 | 323 |
| 549 | 3300003775 | Ga0055524_1015087 | Ga0055524_10150873 | 323 |
| 550 | 3300003781 | Ga0055536_1009214 | Ga0055536_10092144 | 323 |
| 551 | 3300005330 | Ga0070690_100277197 | Ga0070690_1002771971 | 323 |
| 552 | 3300005355 | Ga0070671_100533016 | Ga0070671_1005330161 | 323 |
| 553 | 3300005435 | Ga0070714_100079129 | Ga0070714_1000791293 | 323 |
| 554 | 3300005436 | Ga0070713_100012811 | Ga0070713_1000128111 | 323 |
| 555 | 3300005548 | Ga0070665_100133379 | Ga0070665_1001333792 | 323 |
| 556 | 3300005985 | Ga0081539_10020902 | Ga0081539_100209023 | 323 |
| 557 | 3300006028 | Ga0070717_10392275 | Ga0070717_103922751 | 323 |
| 558 | 3300006042 | Ga0075368_10056710 | Ga0075368_100567102 | 323 |
| 559 | 3300006048 | Ga0075363_100019269 | Ga0075363_1000192693 | 323 |
| 560 | 3300006051 | Ga0075364_10076217 | Ga0075364_100762172 | 323 |
| 561 | 3300006177 | Ga0075362_10000754 | Ga0075362_100007547 | 323 |
| 562 | 3300006177 | Ga0075362_10056313 | Ga0075362_100563132 | 323 |
| 563 | 3300006186 | Ga0075369_10007731 | Ga0075369_100077312 | 323 |
| 564 | 3300006186 | Ga0075369_10030479 | Ga0075369_100304792 | 323 |
| 565 | 3300006186 | Ga0075369_10033564 | Ga0075369_100335642 | 323 |
| 566 | 3300006195 | Ga0075366_10001941 | Ga0075366_100019414 | 323 |
| 567 | 3300006195 | Ga0075366_10031966 | Ga0075366_100319664 | 323 |
| 568 | 3300006195 | Ga0075366_10120327 | Ga0075366_101203272 | 323 |
| 569 | 3300006353 | Ga0075370_10098256 | Ga0075370_100982562 | 323 |
| 570 | 3300006844 | Ga0075428_100094126 | Ga0075428_1000941262 | 323 |
| 571 | 3300009545 | Ga0105237_10053475 | Ga0105237_100534752 | 323 |
| 572 | 3300010375 | Ga0105239_10082630 | Ga0105239_100826304 | 323 |
| 573 | 3300021321 | Ga0214542_1000153 | Ga0214542_100015322 | 323 |
| 574 | 3300021324 | Ga0214545_1000018 | Ga0214545_1000018120 | 323 |
| 575 | 3300021327 | Ga0214543_1005445 | Ga0214543_100544522 | 323 |
| 576 | 3300025291 | Ga0209675_1000988 | Ga0209675_10009885 | 323 |
| 577 | 3300025295 | Ga0209564_1000041 | Ga0209564_1000041214 | 323 |
| 578 | 3300025297 | Ga0209758_1001908 | Ga0209758_100190816 | 323 |
| 579 | 3300025297 | Ga0209758_1053315 | Ga0209758_10533152 | 323 |
| 580 | 3300025299 | Ga0209256_1000014 | Ga0209256_100001474 | 323 |
| 581 | 3300025299 | Ga0209256_1000266 | Ga0209256_100026648 | 323 |
| 582 | 3300025302 | Ga0207426_1000143 | Ga0207426_1000143155 | 323 |
| 583 | 3300025907 | Ga0207645_10067549 | Ga0207645_100675493 | 323 |
| 584 | 3300025928 | Ga0207700_10330155 | Ga0207700_103301551 | 323 |
| 585 | 3300025929 | Ga0207664_10045273 | Ga0207664_100452731 | 323 |
| 586 | 3300025944 | Ga0207661_10306552 | Ga0207661_103065522 | 323 |
| 587 | 3300026067 | Ga0207678_10196899 | Ga0207678_101968991 | 323 |
| 588 | 3300028379 | Ga0268266_10053089 | Ga0268266_100530893 | 323 |
| 589 | 3300031241 | Ga0265325_10000780 | Ga0265325_1000078022 | 323 |
| 590 | 3300031247 | Ga0265340_10039612 | Ga0265340_100396122 | 323 |
| 591 | 3300037418 | Ga0395900_0001080 | Ga0395900_0001080_19627_20604 | 323 |
| 592 | 3300037466 | Ga0395898_0008858 | Ga0395898_0008858_7725_8702 | 323 |
| 593 | 3300046460 | Ga0495638_0003168 | Ga0495638_0003168_10231_11208 | 323 |
| 594 | 3300048920 | Ga0496117_0019738 | Ga0496117_0019738_3018_4007 | 323 |
| 595 | 3300048921 | Ga0496118_0159131 | Ga0496118_0159131_267_1256 | 323 |
| 596 | 3300048925 | Ga0496122_0039326 | Ga0496122_0039326_2459_3448 | 323 |
| 597 | 3300048928 | Ga0496125_0030822 | Ga0496125_0030822_256_1233 | 323 |
| 598 | 3300049571 | Ga0501034_0022571 | Ga0501034_0022571_1947_2939 | 323 |
| 599 | 3300049573 | Ga0501037_0167383 | Ga0501037_0167383_46_1035 | 323 |
| 600 | 3300049588 | Ga0501072_0000961 | Ga0501072_0000961_9289_10266 | 323 |
| 601 | 3300050489 | nmdc:mga03683_18101_c1 | nmdc:mga03683_18101_c1_404_1384 | 323 |
| 602 | 3300050490 | nmdc:mga03n38_32740_c1 | nmdc:mga03n38_32740_c1_246_1226 | 323 |
| 603 | 3300050491 | nmdc:mga00v17_14280_c1 | nmdc:mga00v17_14280_c1_767_1750 | 323 |
| 604 | 3300050491 | nmdc:mga00v17_9218_c1 | nmdc:mga00v17_9218_c1_2837_3817 | 323 |
| 605 | 3300050492 | nmdc:mga0yw44_111452_c1 | nmdc:mga0yw44_111452_c1_288_1271 | 323 |
| 606 | 3300050493 | nmdc:mga0k408_14470_c1 | nmdc:mga0k408_14470_c1_2306_3289 | 323 |
| 607 | 3300050493 | nmdc:mga0k408_3930_c1 | nmdc:mga0k408_3930_c1_6506_7486 | 323 |
| 608 | 3300050495 | nmdc:mga04h51_64656_c1 | nmdc:mga04h51_64656_c1_11_994 | 323 |
| 609 | 3300050496 | nmdc:mga07m45_47963_c1 | nmdc:mga07m45_47963_c1_576_1559 | 323 |
| 610 | 3300050496 | nmdc:mga07m45_65353_c1 | nmdc:mga07m45_65353_c1_505_1488 | 323 |
| 611 | 3300050511 | nmdc:mga08y16_162903_c1 | nmdc:mga08y16_162903_c1_284_1264 | 323 |
| 612 | 3300050516 | nmdc:mga0sz30_19198_c1 | nmdc:mga0sz30_19198_c1_735_1712 | 323 |
| 613 | 3300050516 | nmdc:mga0sz30_61512_c1 | nmdc:mga0sz30_61512_c1_309_1289 | 323 |
| 614 | 3300053095 | Ga0500640_045033 | Ga0500640_045033_568_1545 | 323 |
| 615 | 3300053096 | Ga0500641_0013036 | Ga0500641_0013036_1254_2237 | 323 |
| 616 | 3300053121 | Ga0500607_012354 | Ga0500607_012354_682_1659 | 323 |
| 617 | 3300053136 | Ga0500559_0026477 | Ga0500559_0026477_1011_1988 | 323 |
| 618 | 3300053153 | Ga0500616_0000802 | Ga0500616_0000802_23303_24283 | 323 |
| 619 | 3300053162 | Ga0500638_024357 | Ga0500638_024357_531_1508 | 323 |
| 620 | 3300053177 | Ga0500636_0000103 | Ga0500636_0000103_503_1480 | 323 |
| 621 | 3300054114 | Ga0501084_0077818 | Ga0501084_0077818_693_1670 | 323 |
| 622 | 3300060353 | Ga0501082_0000156 | Ga0501082_0000156_16307_17290 | 323 |
| 623 | iso_pu_bacteria | 2818991467 | 2819719322 | 323 |
| 624 | 3300005330 | Ga0070690_100061906 | Ga0070690_1000619062 | 324 |
| 625 | 3300005333 | Ga0070677_10016348 | Ga0070677_100163482 | 324 |
| 626 | 3300005334 | Ga0068869_100140414 | Ga0068869_1001404141 | 324 |
| 627 | 3300005338 | Ga0068868_100361260 | Ga0068868_1003612602 | 324 |
| 628 | 3300005356 | Ga0070674_100134705 | Ga0070674_1001347052 | 324 |
| 629 | 3300005365 | Ga0070688_100146487 | Ga0070688_1001464872 | 324 |
| 630 | 3300005466 | Ga0070685_10265910 | Ga0070685_102659101 | 324 |
| 631 | 3300005543 | Ga0070672_100135827 | Ga0070672_1001358272 | 324 |
| 632 | 3300005544 | Ga0070686_100020881 | Ga0070686_1000208812 | 324 |
| 633 | 3300005842 | Ga0068858_100453710 | Ga0068858_1004537101 | 324 |
| 634 | 3300006195 | Ga0075366_10075264 | Ga0075366_100752642 | 324 |
| 635 | 3300009098 | Ga0105245_10031406 | Ga0105245_100314062 | 324 |
| 636 | 3300009098 | Ga0105245_10221085 | Ga0105245_102210852 | 324 |
| 637 | 3300009101 | Ga0105247_10038737 | Ga0105247_100387372 | 324 |
| 638 | 3300009176 | Ga0105242_10348783 | Ga0105242_103487831 | 324 |
| 639 | 3300009551 | Ga0105238_10186281 | Ga0105238_101862811 | 324 |
| 640 | 3300009551 | Ga0105238_10236153 | Ga0105238_102361532 | 324 |
| 641 | 3300013308 | Ga0157375_10670838 | Ga0157375_106708382 | 324 |
| 642 | 3300025261 | Ga0209233_1003077 | Ga0209233_10030773 | 324 |
| 643 | 3300025893 | Ga0207682_10050735 | Ga0207682_100507352 | 324 |
| 644 | 3300025900 | Ga0207710_10090272 | Ga0207710_100902722 | 324 |
| 645 | 3300025901 | Ga0207688_10113117 | Ga0207688_101131172 | 324 |
| 646 | 3300025908 | Ga0207643_10066015 | Ga0207643_100660152 | 324 |
| 647 | 3300025924 | Ga0207694_10150897 | Ga0207694_101508972 | 324 |
| 648 | 3300025927 | Ga0207687_10020981 | Ga0207687_100209811 | 324 |
| 649 | 3300025927 | Ga0207687_10181998 | Ga0207687_101819982 | 324 |
| 650 | 3300025937 | Ga0207669_10004576 | Ga0207669_100045763 | 324 |
| 651 | 3300025938 | Ga0207704_10431304 | Ga0207704_104313041 | 324 |
| 652 | 3300025940 | Ga0207691_10004725 | Ga0207691_100047252 | 324 |
| 653 | 3300025941 | Ga0207711_10488376 | Ga0207711_104883762 | 324 |
| 654 | 3300026023 | Ga0207677_10059235 | Ga0207677_100592352 | 324 |
| 655 | 3300026035 | Ga0207703_10263706 | Ga0207703_102637061 | 324 |
| 656 | 3300026067 | Ga0207678_10202800 | Ga0207678_102028001 | 324 |
| 657 | 3300026088 | Ga0207641_10329064 | Ga0207641_103290641 | 324 |
| 658 | 3300026116 | Ga0207674_10026154 | Ga0207674_100261541 | 324 |
| 659 | 3300046474 | Ga0495605_0124658 | Ga0495605_0124658_15_998 | 324 |
| 660 | 3300047318 | Ga0495636_0093044 | Ga0495636_0093044_317_1300 | 324 |
| 661 | 3300050510 | nmdc:mga06r32_253908_c1 | nmdc:mga06r32_253908_c1_733_1719 | 324 |
| 662 | iso_pu_bacteria | 2643221733 | 2644731692 | 324 |
| 663 | iso_pu_bacteria | 2643221734 | 2644736644 | 324 |
| 664 | iso_pu_bacteria | 2841760612 | 2841763507 | 324 |
| 665 | iso_pu_bacteria | 2841911363 | 2841915773 | 324 |
| 666 | iso_pu_bacteria | 2841917233 | 2841921846 | 324 |
| 667 | iso_pu_bacteria | 2844104063 | 2844109589 | 324 |
| 668 | iso_pu_bacteria | 2851182111 | 2851182733 | 324 |
| 669 | iso_pu_bacteria | 2851246043 | 2851251696 | 324 |
| 670 | iso_pu_bacteria | 2917699015 | 2917704534 | 324 |
| 671 | iso_pu_bacteria | 8057529695 | 8057534560 | 324 |
| 672 | 3300001978 | JGI24747J21853_1000524 | JGI24747J21853_10005242 | 325 |
| 673 | 3300001989 | JGI24739J22299_10001664 | JGI24739J22299_100016641 | 325 |
| 674 | 3300001990 | JGI24737J22298_10001572 | JGI24737J22298_100015722 | 325 |
| 675 | 3300002070 | JGI24750J21931_1000070 | JGI24750J21931_10000702 | 325 |
| 676 | 3300002074 | JGI24748J21848_1001020 | JGI24748J21848_10010202 | 325 |
| 677 | 3300002077 | JGI24744J21845_10000323 | JGI24744J21845_100003235 | 325 |
| 678 | 3300002239 | JGI24034J26672_10001367 | JGI24034J26672_100013672 | 325 |
| 679 | 3300002244 | JGI24742J22300_10000129 | JGI24742J22300_100001298 | 325 |
| 680 | 3300003187 | JGI25151J46595_10000191 | JGI25151J46595_1000019126 | 325 |
| 681 | 3300003794 | Ga0055531_10019731 | Ga0055531_100197312 | 325 |
| 682 | 3300005290 | Ga0065712_10101414 | Ga0065712_101014142 | 325 |
| 683 | 3300005293 | Ga0065715_10093218 | Ga0065715_100932184 | 325 |
| 684 | 3300005327 | Ga0070658_10012478 | Ga0070658_100124782 | 325 |
| 685 | 3300005328 | Ga0070676_10001835 | Ga0070676_100018358 | 325 |
| 686 | 3300005329 | Ga0070683_100000265 | Ga0070683_10000026528 | 325 |
| 687 | 3300005330 | Ga0070690_100000611 | Ga0070690_1000006115 | 325 |
| 688 | 3300005331 | Ga0070670_100006574 | Ga0070670_1000065742 | 325 |
| 689 | 3300005333 | Ga0070677_10000255 | Ga0070677_100002557 | 325 |
| 690 | 3300005334 | Ga0068869_100000414 | Ga0068869_10000041414 | 325 |
| 691 | 3300005335 | Ga0070666_10011703 | Ga0070666_100117032 | 325 |
| 692 | 3300005336 | Ga0070680_100006661 | Ga0070680_1000066616 | 325 |
| 693 | 3300005336 | Ga0070680_100022435 | Ga0070680_1000224353 | 325 |
| 694 | 3300005337 | Ga0070682_100000132 | Ga0070682_10000013258 | 325 |
| 695 | 3300005338 | Ga0068868_100000463 | Ga0068868_1000004639 | 325 |
| 696 | 3300005339 | Ga0070660_100002285 | Ga0070660_1000022852 | 325 |
| 697 | 3300005339 | Ga0070660_100046768 | Ga0070660_1000467682 | 325 |
| 698 | 3300005340 | Ga0070689_100002422 | Ga0070689_10000242210 | 325 |
| 699 | 3300005341 | Ga0070691_10000350 | Ga0070691_1000035015 | 325 |
| 700 | 3300005343 | Ga0070687_100000102 | Ga0070687_1000001022 | 325 |
| 701 | 3300005344 | Ga0070661_100000425 | Ga0070661_10000042519 | 325 |
| 702 | 3300005345 | Ga0070692_10000122 | Ga0070692_100001222 | 325 |
| 703 | 3300005347 | Ga0070668_100002374 | Ga0070668_1000023748 | 325 |
| 704 | 3300005353 | Ga0070669_100000276 | Ga0070669_10000027628 | 325 |
| 705 | 3300005354 | Ga0070675_100001654 | Ga0070675_10000165415 | 325 |
| 706 | 3300005355 | Ga0070671_100006158 | Ga0070671_1000061587 | 325 |
| 707 | 3300005356 | Ga0070674_100002480 | Ga0070674_1000024802 | 325 |
| 708 | 3300005364 | Ga0070673_100009302 | Ga0070673_1000093022 | 325 |
| 709 | 3300005365 | Ga0070688_100001146 | Ga0070688_10000114612 | 325 |
| 710 | 3300005366 | Ga0070659_100000499 | Ga0070659_10000049912 | 325 |
| 711 | 3300005366 | Ga0070659_100092081 | Ga0070659_1000920812 | 325 |
| 712 | 3300005367 | Ga0070667_100002343 | Ga0070667_1000023432 | 325 |
| 713 | 3300005406 | Ga0070703_10017615 | Ga0070703_100176151 | 325 |
| 714 | 3300005435 | Ga0070714_100050156 | Ga0070714_1000501562 | 325 |
| 715 | 3300005438 | Ga0070701_10001928 | Ga0070701_100019285 | 325 |
| 716 | 3300005440 | Ga0070705_100000882 | Ga0070705_1000008822 | 325 |
| 717 | 3300005441 | Ga0070700_100000703 | Ga0070700_10000070315 | 325 |
| 718 | 3300005444 | Ga0070694_100000564 | Ga0070694_10000056419 | 325 |
| 719 | 3300005445 | Ga0070708_100015600 | Ga0070708_1000156003 | 325 |
| 720 | 3300005455 | Ga0070663_100000585 | Ga0070663_10000058518 | 325 |
| 721 | 3300005456 | Ga0070678_100000016 | Ga0070678_10000001628 | 325 |
| 722 | 3300005457 | Ga0070662_100004979 | Ga0070662_1000049797 | 325 |
| 723 | 3300005458 | Ga0070681_10007759 | Ga0070681_100077598 | 325 |
| 724 | 3300005458 | Ga0070681_10129222 | Ga0070681_101292222 | 325 |
| 725 | 3300005459 | Ga0068867_100005864 | Ga0068867_1000058642 | 325 |
| 726 | 3300005466 | Ga0070685_10000344 | Ga0070685_100003448 | 325 |
| 727 | 3300005518 | Ga0070699_100176037 | Ga0070699_1001760372 | 325 |
| 728 | 3300005530 | Ga0070679_100007467 | Ga0070679_1000074672 | 325 |
| 729 | 3300005535 | Ga0070684_100000022 | Ga0070684_1000000223 | 325 |
| 730 | 3300005539 | Ga0068853_100003353 | Ga0068853_1000033533 | 325 |
| 731 | 3300005543 | Ga0070672_100001103 | Ga0070672_10000110315 | 325 |
| 732 | 3300005544 | Ga0070686_100001787 | Ga0070686_10000178712 | 325 |
| 733 | 3300005545 | Ga0070695_100004150 | Ga0070695_1000041505 | 325 |
| 734 | 3300005546 | Ga0070696_100003993 | Ga0070696_1000039938 | 325 |
| 735 | 3300005547 | Ga0070693_100002004 | Ga0070693_1000020047 | 325 |
| 736 | 3300005548 | Ga0070665_100028373 | Ga0070665_1000283732 | 325 |
| 737 | 3300005549 | Ga0070704_100000115 | Ga0070704_1000001152 | 325 |
| 738 | 3300005563 | Ga0068855_100040602 | Ga0068855_1000406022 | 325 |
| 739 | 3300005564 | Ga0070664_100001943 | Ga0070664_10000194315 | 325 |
| 740 | 3300005577 | Ga0068857_100000142 | Ga0068857_10000014236 | 325 |
| 741 | 3300005578 | Ga0068854_100000440 | Ga0068854_1000004402 | 325 |
| 742 | 3300005614 | Ga0068856_100000520 | Ga0068856_10000052023 | 325 |
| 743 | 3300005615 | Ga0070702_100000122 | Ga0070702_10000012214 | 325 |
| 744 | 3300005616 | Ga0068852_100000793 | Ga0068852_10000079319 | 325 |
| 745 | 3300005616 | Ga0068852_100054482 | Ga0068852_1000544822 | 325 |
| 746 | 3300005617 | Ga0068859_100007603 | Ga0068859_1000076031 | 325 |
| 747 | 3300005618 | Ga0068864_100000333 | Ga0068864_10000033318 | 325 |
| 748 | 3300005718 | Ga0068866_10000216 | Ga0068866_1000021615 | 325 |
| 749 | 3300005719 | Ga0068861_100004268 | Ga0068861_1000042687 | 325 |
| 750 | 3300005840 | Ga0068870_10000230 | Ga0068870_100002302 | 325 |
| 751 | 3300005841 | Ga0068863_100032465 | Ga0068863_1000324652 | 325 |
| 752 | 3300005842 | Ga0068858_100000975 | Ga0068858_1000009757 | 325 |
| 753 | 3300005843 | Ga0068860_100001178 | Ga0068860_1000011782 | 325 |
| 754 | 3300005844 | Ga0068862_100003651 | Ga0068862_10000365112 | 325 |
| 755 | 3300005937 | Ga0081455_10000110 | Ga0081455_1000011060 | 325 |
| 756 | 3300006237 | Ga0097621_100000203 | Ga0097621_10000020319 | 325 |
| 757 | 3300006358 | Ga0068871_100000575 | Ga0068871_10000057516 | 325 |
| 758 | 3300006852 | Ga0075433_10014335 | Ga0075433_100143355 | 325 |
| 759 | 3300006871 | Ga0075434_100145857 | Ga0075434_1001458572 | 325 |
| 760 | 3300006881 | Ga0068865_100003983 | Ga0068865_1000039832 | 325 |
| 761 | 3300006931 | Ga0097620_100007604 | Ga0097620_10000760410 | 325 |
| 762 | 3300007076 | Ga0075435_100086765 | Ga0075435_1000867652 | 325 |
| 763 | 3300009093 | Ga0105240_10106187 | Ga0105240_101061873 | 325 |
| 764 | 3300009094 | Ga0111539_10000265 | Ga0111539_1000026558 | 325 |
| 765 | 3300009098 | Ga0105245_10000230 | Ga0105245_1000023022 | 325 |
| 766 | 3300009148 | Ga0105243_10000776 | Ga0105243_1000077622 | 325 |
| 767 | 3300009174 | Ga0105241_10017650 | Ga0105241_100176505 | 325 |
| 768 | 3300009176 | Ga0105242_10001060 | Ga0105242_1000106018 | 325 |
| 769 | 3300009177 | Ga0105248_10001593 | Ga0105248_100015935 | 325 |
| 770 | 3300009545 | Ga0105237_10010759 | Ga0105237_100107592 | 325 |
| 771 | 3300009551 | Ga0105238_10163899 | Ga0105238_101638992 | 325 |
| 772 | 3300009553 | Ga0105249_10009054 | Ga0105249_100090542 | 325 |
| 773 | 3300010375 | Ga0105239_10000895 | Ga0105239_100008952 | 325 |
| 774 | 3300011119 | Ga0105246_10003698 | Ga0105246_100036987 | 325 |
| 775 | 3300013100 | Ga0157373_10008456 | Ga0157373_100084565 | 325 |
| 776 | 3300013102 | Ga0157371_10068281 | Ga0157371_100682812 | 325 |
| 777 | 3300013105 | Ga0157369_10547915 | Ga0157369_105479151 | 325 |
| 778 | 3300013296 | Ga0157374_10002125 | Ga0157374_1000212513 | 325 |
| 779 | 3300013297 | Ga0157378_10000864 | Ga0157378_1000086420 | 325 |
| 780 | 3300013306 | Ga0163162_10000420 | Ga0163162_1000042019 | 325 |
| 781 | 3300013307 | Ga0157372_10081999 | Ga0157372_100819993 | 325 |
| 782 | 3300013307 | Ga0157372_10393530 | Ga0157372_103935302 | 325 |
| 783 | 3300013308 | Ga0157375_10001160 | Ga0157375_100011602 | 325 |
| 784 | 3300014325 | Ga0163163_10014455 | Ga0163163_100144555 | 325 |
| 785 | 3300014326 | Ga0157380_10000205 | Ga0157380_1000020532 | 325 |
| 786 | 3300014745 | Ga0157377_10000053 | Ga0157377_1000005369 | 325 |
| 787 | 3300014968 | Ga0157379_10000617 | Ga0157379_100006172 | 325 |
| 788 | 3300014969 | Ga0157376_10001214 | Ga0157376_1000121415 | 325 |
| 789 | 3300017792 | Ga0163161_10000555 | Ga0163161_1000055515 | 325 |
| 790 | 3300025271 | Ga0207666_1000014 | Ga0207666_100001414 | 325 |
| 791 | 3300025290 | Ga0207673_1000857 | Ga0207673_10008572 | 325 |
| 792 | 3300025292 | Ga0209676_1005743 | Ga0209676_10057432 | 325 |
| 793 | 3300025294 | Ga0209025_1000008 | Ga0209025_1000008567 | 325 |
| 794 | 3300025294 | Ga0209025_1001200 | Ga0209025_100120035 | 325 |
| 795 | 3300025294 | Ga0209025_1036811 | Ga0209025_10368112 | 325 |
| 796 | 3300025297 | Ga0209758_1001163 | Ga0209758_100116316 | 325 |
| 797 | 3300025298 | Ga0209050_1003788 | Ga0209050_10037889 | 325 |
| 798 | 3300025303 | Ga0209051_1000778 | Ga0209051_100077826 | 325 |
| 799 | 3300025304 | Ga0209257_1003322 | Ga0209257_10033227 | 325 |
| 800 | 3300025315 | Ga0207697_10002418 | Ga0207697_100024182 | 325 |
| 801 | 3300025885 | Ga0207653_10025976 | Ga0207653_100259762 | 325 |
| 802 | 3300025893 | Ga0207682_10000154 | Ga0207682_1000015415 | 325 |
| 803 | 3300025899 | Ga0207642_10000582 | Ga0207642_100005825 | 325 |
| 804 | 3300025901 | Ga0207688_10000140 | Ga0207688_1000014030 | 325 |
| 805 | 3300025903 | Ga0207680_10023329 | Ga0207680_100233292 | 325 |
| 806 | 3300025907 | Ga0207645_10000182 | Ga0207645_1000018230 | 325 |
| 807 | 3300025909 | Ga0207705_10257732 | Ga0207705_102577322 | 325 |
| 808 | 3300025911 | Ga0207654_10020714 | Ga0207654_100207142 | 325 |
| 809 | 3300025912 | Ga0207707_10001647 | Ga0207707_100016472 | 325 |
| 810 | 3300025912 | Ga0207707_10158440 | Ga0207707_101584401 | 325 |
| 811 | 3300025914 | Ga0207671_10019625 | Ga0207671_100196252 | 325 |
| 812 | 3300025917 | Ga0207660_10000007 | Ga0207660_1000000722 | 325 |
| 813 | 3300025918 | Ga0207662_10002310 | Ga0207662_100023102 | 325 |
| 814 | 3300025919 | Ga0207657_10009907 | Ga0207657_100099072 | 325 |
| 815 | 3300025920 | Ga0207649_10000143 | Ga0207649_1000014313 | 325 |
| 816 | 3300025921 | Ga0207652_10000459 | Ga0207652_1000045921 | 325 |
| 817 | 3300025921 | Ga0207652_10018025 | Ga0207652_100180254 | 325 |
| 818 | 3300025923 | Ga0207681_10000506 | Ga0207681_1000050613 | 325 |
| 819 | 3300025924 | Ga0207694_10161762 | Ga0207694_101617622 | 325 |
| 820 | 3300025925 | Ga0207650_10001959 | Ga0207650_1000195913 | 325 |
| 821 | 3300025926 | Ga0207659_10000015 | Ga0207659_10000015123 | 325 |
| 822 | 3300025927 | Ga0207687_10000357 | Ga0207687_1000035722 | 325 |
| 823 | 3300025931 | Ga0207644_10000369 | Ga0207644_1000036911 | 325 |
| 824 | 3300025932 | Ga0207690_10000183 | Ga0207690_1000018312 | 325 |
| 825 | 3300025933 | Ga0207706_10008183 | Ga0207706_100081832 | 325 |
| 826 | 3300025934 | Ga0207686_10000234 | Ga0207686_100002344 | 325 |
| 827 | 3300025935 | Ga0207709_10000081 | Ga0207709_10000081110 | 325 |
| 828 | 3300025936 | Ga0207670_10003127 | Ga0207670_100031276 | 325 |
| 829 | 3300025937 | Ga0207669_10000008 | Ga0207669_1000000839 | 325 |
| 830 | 3300025938 | Ga0207704_10000244 | Ga0207704_1000024422 | 325 |
| 831 | 3300025940 | Ga0207691_10008666 | Ga0207691_100086662 | 325 |
| 832 | 3300025941 | Ga0207711_10001662 | Ga0207711_100016625 | 325 |
| 833 | 3300025942 | Ga0207689_10007527 | Ga0207689_100075272 | 325 |
| 834 | 3300025944 | Ga0207661_10000626 | Ga0207661_1000062614 | 325 |
| 835 | 3300025945 | Ga0207679_10000046 | Ga0207679_1000004691 | 325 |
| 836 | 3300025949 | Ga0207667_10030154 | Ga0207667_100301542 | 325 |
| 837 | 3300025949 | Ga0207667_10500462 | Ga0207667_105004621 | 325 |
| 838 | 3300025960 | Ga0207651_10000850 | Ga0207651_100008509 | 325 |
| 839 | 3300025961 | Ga0207712_10000555 | Ga0207712_1000055514 | 325 |
| 840 | 3300025972 | Ga0207668_10000133 | Ga0207668_1000013344 | 325 |
| 841 | 3300025981 | Ga0207640_10000956 | Ga0207640_100009569 | 325 |
| 842 | 3300025986 | Ga0207658_10000535 | Ga0207658_1000053513 | 325 |
| 843 | 3300026023 | Ga0207677_10000898 | Ga0207677_1000089813 | 325 |
| 844 | 3300026035 | Ga0207703_10002811 | Ga0207703_100028119 | 325 |
| 845 | 3300026041 | Ga0207639_10001004 | Ga0207639_1000100413 | 325 |
| 846 | 3300026067 | Ga0207678_10001462 | Ga0207678_100014622 | 325 |
| 847 | 3300026075 | Ga0207708_10005241 | Ga0207708_100052417 | 325 |
| 848 | 3300026078 | Ga0207702_10034556 | Ga0207702_100345564 | 325 |
| 849 | 3300026078 | Ga0207702_10130770 | Ga0207702_101307702 | 325 |
| 850 | 3300026088 | Ga0207641_10000593 | Ga0207641_1000059328 | 325 |
| 851 | 3300026089 | Ga0207648_10027455 | Ga0207648_100274555 | 325 |
| 852 | 3300026095 | Ga0207676_10001432 | Ga0207676_1000143216 | 325 |
| 853 | 3300026116 | Ga0207674_10012323 | Ga0207674_100123232 | 325 |
| 854 | 3300026118 | Ga0207675_100008687 | Ga0207675_1000086877 | 325 |
| 855 | 3300026121 | Ga0207683_10000002 | Ga0207683_10000002245 | 325 |
| 856 | 3300026142 | Ga0207698_10003217 | Ga0207698_100032172 | 325 |
| 857 | 3300027617 | Ga0210002_1000206 | Ga0210002_10002062 | 325 |
| 858 | 3300027682 | Ga0209971_1003881 | Ga0209971_10038812 | 325 |
| 859 | 3300027717 | Ga0209998_10001772 | Ga0209998_100017722 | 325 |
| 860 | 3300027876 | Ga0209974_10002651 | Ga0209974_100026512 | 325 |
| 861 | 3300027907 | Ga0207428_10000011 | Ga0207428_1000001157 | 325 |
| 862 | 3300027907 | Ga0207428_10000046 | Ga0207428_10000046124 | 325 |
| 863 | 3300028379 | Ga0268266_10024675 | Ga0268266_100246754 | 325 |
| 864 | 3300028380 | Ga0268265_10000117 | Ga0268265_1000011794 | 325 |
| 865 | 3300028381 | Ga0268264_10002676 | Ga0268264_100026762 | 325 |
| 866 | 3300031595 | Ga0265313_10011551 | Ga0265313_100115513 | 325 |
| 867 | 3300031712 | Ga0265342_10001270 | Ga0265342_100012703 | 325 |
| 868 | 3300034819 | Ga0373958_0001846 | Ga0373958_0001846_739_1716 | 325 |
| 869 | 3300035085 | Ga0373929_0001396 | Ga0373929_0001396_2495_3472 | 325 |
| 870 | 3300035090 | Ga0373949_0004019 | Ga0373949_0004019_2022_2999 | 325 |
| 871 | 3300035091 | Ga0373951_0001331 | Ga0373951_0001331_4333_5310 | 325 |
| 872 | 3300035092 | Ga0373952_0000618 | Ga0373952_0000618_4838_5815 | 325 |
| 873 | 3300035112 | Ga0373932_0003969 | Ga0373932_0003969_949_1926 | 325 |
| 874 | 3300035114 | Ga0373939_0000414 | Ga0373939_0000414_1170_2147 | 325 |
| 875 | 3300035241 | Ga0373961_0003176 | Ga0373961_0003176_2826_3803 | 325 |
| 876 | 3300035691 | Ga0373931_0004138 | Ga0373931_0004138_1194_2171 | 325 |
| 877 | 3300046684 | Ga0495669_0032760 | Ga0495669_0032760_376_1353 | 325 |
| 878 | 3300048903 | Ga0496100_0000171 | Ga0496100_0000171_13626_14603 | 325 |
| 879 | 3300048904 | Ga0496101_0002061 | Ga0496101_0002061_1172_2149 | 325 |
| 880 | 3300048905 | Ga0496102_0021505 | Ga0496102_0021505_2160_3137 | 325 |
| 881 | 3300048906 | Ga0496103_0000753 | Ga0496103_0000753_6378_7355 | 325 |
| 882 | 3300048909 | Ga0496106_0000183 | Ga0496106_0000183_8854_9831 | 325 |
| 883 | 3300048910 | Ga0496107_0002635 | Ga0496107_0002635_2032_3009 | 325 |
| 884 | 3300048911 | Ga0496108_0001163 | Ga0496108_0001163_2224_3201 | 325 |
| 885 | 3300048912 | Ga0496109_0002647 | Ga0496109_0002647_1456_2433 | 325 |
| 886 | 3300048913 | Ga0496110_0010742 | Ga0496110_0010742_675_1652 | 325 |
| 887 | 3300048916 | Ga0496113_0010353 | Ga0496113_0010353_1267_2244 | 325 |
| 888 | 3300048917 | Ga0496114_0011160 | Ga0496114_0011160_1916_2893 | 325 |
| 889 | 3300048918 | Ga0496115_0001833 | Ga0496115_0001833_10542_11519 | 325 |
| 890 | 3300048926 | Ga0496123_0027237 | Ga0496123_0027237_795_1790 | 325 |
| 891 | 3300048927 | Ga0496124_0103034 | Ga0496124_0103034_189_1184 | 325 |
| 892 | 3300050511 | nmdc:mga08y16_20491_c1 | nmdc:mga08y16_20491_c1_1272_2249 | 325 |
| 893 | 3300050512 | nmdc:mga0n895_189673_c1 | nmdc:mga0n895_189673_c1_648_1625 | 325 |
| 894 | 3300050513 | nmdc:mga0rr50_126828_c1 | nmdc:mga0rr50_126828_c1_688_1665 | 325 |
| 895 | 3300050515 | nmdc:mga0a205_7989_c1 | nmdc:mga0a205_7989_c1_7599_8576 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pfy-assembly4.cif.gz_D | crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid | 0.9873 | 25 | 325 |
| 2pfz-assembly1.cif.gz_A | crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid | 0.9867 | 26 | 324 |
| 2pfy-assembly4.cif.gz_D | crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid | 0.9841 | 25 | 325 |
| 6wgm-assembly1.cif.gz_A | crystal structure of a marine metagenome trap solute binding protein specific for pyroglutamate (sorcerer ii global ocean sampling expedition, unidentified microbe, scf7180008839099) in complex with co-purified pyroglutamate | 0.984 | 27 | 324 |
| 2pfz-assembly1.cif.gz_A | crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid | 0.977 | 26 | 324 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pfzA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9867 | 26 | 324 | 3.40.190.170 |
| 2pfyD00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9857 | 25 | 325 | 3.40.190.170 |
| 2pfyD00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9824 | 25 | 325 | 3.40.190.170 |
| 2pfzA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.977 | 26 | 324 | 3.40.190.170 |
| 4nf0G00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9327 | 25 | 307 | 3.40.190.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0T5P3P0-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.99 | 23 | 325 |
GO:0042597
GO:0055085 |
| AF-A0A3D0JK86-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.9862 | 104 | 324 |
GO:0055085
|
| AF-A0A3D0JK86-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.9688 | 104 | 324 |
GO:0055085
|
| AF-A0A7U3GLA4-F1-model_v4 | deleted | 0.9612 | 29 | 324 |
|
| AF-A0A6N7XG78-F1-model_v4 | TRAP transporter substrate-binding protein | 0.9585 | 27 | 308 |
GO:0016020
GO:0030288 GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar