F484892
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 892 | 400 | 1784 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300044683|Ga0466965_0075591|Ga0466965_0075591_944_1678 |
| Length | 244 |
| Sequence | MAPQLEAPPARYDDLTALYVNCTLKRSPQTSNTQGLLDRSIALMRKQGVAVDTLRLVDHDVPPGVSPDMRDEGWERDPWPGEIWPRVLAADILVIGSPTWLGDVSAVTRIFLERLYAMSDQENDQGQYVYLGKVGAAIMTGNDDGYKHGNREILWSLNHMGFAIPPTADSAWNGPAGPGPSYLDEGSGGPEHDFTNMTTTFLTWNLLHVARMLKDAGGIPARGNQPKEWEAGCRFDLPNPEHRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 116 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 175 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 176 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 177 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 188 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 190 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 200 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 205 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 214 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 215 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 216 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 217 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 219 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 220 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 221 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 222 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 223 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 224 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 225 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 226 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 227 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 228 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 229 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 230 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 231 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 232 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 233 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 234 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 235 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 236 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 374 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 375 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 376 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 377 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 381 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 382 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 383 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 384 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 385 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 386 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 387 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 388 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 389 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 390 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 391 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 392 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 393 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 394 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 395 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 396 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 397 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 398 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 399 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 400 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.2 |
| Metatranscriptomes | 0.67 |
| Isolates | 2.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.02 |
| Nodule | 0.11 |
| Rhizoplane | 6.84 |
| Rhizosphere | 88.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466965_0075591 | 3300044683 | Bacteria | 1699 |
| 2 | 2214759121 | 2209111006 | Bacteria | 2967 |
| 3 | ARcpr5oldR_c000806 | 3300000041 | Bacteria | 3530 |
| 4 | ARSoilOldRDRAFT_c000445 | 3300000044 | Bacteria | 4888 |
| 5 | ARCol0yngRDRAFT_1000525 | 3300000652 | Bacteria | 4415 |
| 6 | JGI24738J21930_10031627 | 3300002075 | Bacteria | 1079 |
| 7 | JGI25406J46586_10086470 | 3300003203 | Bacteria | 952 |
| 8 | JGI25407J50210_10021837 | 3300003373 | Bacteria | 1663 |
| 9 | Ga0070658_10074792 | 3300005327 | Bacteria | 2778 |
| 10 | Ga0070683_100123184 | 3300005329 | Bacteria | 2450 |
| 11 | Ga0070683_100135214 | 3300005329 | Bacteria | 2334 |
| 12 | Ga0070683_100662096 | 3300005329 | Bacteria | 1000 |
| 13 | Ga0070690_100080803 | 3300005330 | Bacteria | 2126 |
| 14 | Ga0070670_100092643 | 3300005331 | Bacteria | 2598 |
| 15 | Ga0068868_100186608 | 3300005338 | Bacteria | 1723 |
| 16 | Ga0068868_100288217 | 3300005338 | Bacteria | 1392 |
| 17 | Ga0068868_100522914 | 3300005338 | Bacteria | 1042 |
| 18 | Ga0070660_100001446 | 3300005339 | Bacteria | 16229 |
| 19 | Ga0070689_100065695 | 3300005340 | Bacteria | 2826 |
| 20 | Ga0070689_100463557 | 3300005340 | Bacteria | 1080 |
| 21 | Ga0070687_100037501 | 3300005343 | Bacteria | 2424 |
| 22 | Ga0070661_100066523 | 3300005344 | Bacteria | 2648 |
| 23 | Ga0070692_10003095 | 3300005345 | Bacteria | 6656 |
| 24 | Ga0070668_100332535 | 3300005347 | Bacteria | 1282 |
| 25 | Ga0070669_100067086 | 3300005353 | Bacteria | 2646 |
| 26 | Ga0070675_100007430 | 3300005354 | Bacteria | 8465 |
| 27 | Ga0070675_100090413 | 3300005354 | Bacteria | 2564 |
| 28 | Ga0070671_100160159 | 3300005355 | Bacteria | 1902 |
| 29 | Ga0070674_100155302 | 3300005356 | Bacteria | 1731 |
| 30 | Ga0070674_100166177 | 3300005356 | Bacteria | 1678 |
| 31 | Ga0070688_100084216 | 3300005365 | Bacteria | 2065 |
| 32 | Ga0070688_100138492 | 3300005365 | Bacteria | 1650 |
| 33 | Ga0070659_100015908 | 3300005366 | Bacteria | 5642 |
| 34 | Ga0070659_100025020 | 3300005366 | Bacteria | 4581 |
| 35 | Ga0070667_100016098 | 3300005367 | Bacteria | 6186 |
| 36 | Ga0070714_100002498 | 3300005435 | Bacteria | 13572 |
| 37 | Ga0070714_100016018 | 3300005435 | Bacteria | 6044 |
| 38 | Ga0070714_100191736 | 3300005435 | Bacteria | 1865 |
| 39 | Ga0070713_100050854 | 3300005436 | Bacteria | 3425 |
| 40 | Ga0070713_100385974 | 3300005436 | Bacteria | 1306 |
| 41 | Ga0070710_10205833 | 3300005437 | Bacteria | 1245 |
| 42 | Ga0070701_10088510 | 3300005438 | Bacteria | 1692 |
| 43 | Ga0070711_100210705 | 3300005439 | Bacteria | 1505 |
| 44 | Ga0070700_100076242 | 3300005441 | Bacteria | 2153 |
| 45 | Ga0070708_100033745 | 3300005445 | Bacteria | 4447 |
| 46 | Ga0070663_100006095 | 3300005455 | Bacteria | 7216 |
| 47 | Ga0070663_100253316 | 3300005455 | Bacteria | 1394 |
| 48 | Ga0070678_100001021 | 3300005456 | Bacteria | 14583 |
| 49 | Ga0070678_100005939 | 3300005456 | Bacteria | 7104 |
| 50 | Ga0070678_100232390 | 3300005456 | Bacteria | 1538 |
| 51 | Ga0068867_100108945 | 3300005459 | Bacteria | 2125 |
| 52 | Ga0068867_100161585 | 3300005459 | Bacteria | 1767 |
| 53 | Ga0068867_100273862 | 3300005459 | Bacteria | 1381 |
| 54 | Ga0070685_10113043 | 3300005466 | Bacteria | 1676 |
| 55 | Ga0070706_100157440 | 3300005467 | Bacteria | 2120 |
| 56 | Ga0070707_100002861 | 3300005468 | Bacteria | 16436 |
| 57 | Ga0070707_100122326 | 3300005468 | Bacteria | 2527 |
| 58 | Ga0070698_100081192 | 3300005471 | Bacteria | 3237 |
| 59 | Ga0070698_100202377 | 3300005471 | Bacteria | 1921 |
| 60 | Ga0070699_100575405 | 3300005518 | Bacteria | 1026 |
| 61 | Ga0070684_100009566 | 3300005535 | Bacteria | 7636 |
| 62 | Ga0070684_100195554 | 3300005535 | Bacteria | 1841 |
| 63 | Ga0068853_100010008 | 3300005539 | Bacteria | 7657 |
| 64 | Ga0068853_100095014 | 3300005539 | Bacteria | 2628 |
| 65 | Ga0070672_100103373 | 3300005543 | Bacteria | 2313 |
| 66 | Ga0070686_100060416 | 3300005544 | Bacteria | 2446 |
| 67 | Ga0070686_100152162 | 3300005544 | Bacteria | 1621 |
| 68 | Ga0070693_100078590 | 3300005547 | Bacteria | 1961 |
| 69 | Ga0070704_100080985 | 3300005549 | Bacteria | 2390 |
| 70 | Ga0070704_100287993 | 3300005549 | Bacteria | 1364 |
| 71 | Ga0068855_100631977 | 3300005563 | Bacteria | 1152 |
| 72 | Ga0068855_100648726 | 3300005563 | Bacteria | 1134 |
| 73 | Ga0070664_100007904 | 3300005564 | Bacteria | 8591 |
| 74 | Ga0068857_100016885 | 3300005577 | Bacteria | 6396 |
| 75 | Ga0068854_100015638 | 3300005578 | Bacteria | 5035 |
| 76 | Ga0068854_100683053 | 3300005578 | Bacteria | 885 |
| 77 | Ga0068856_100245697 | 3300005614 | Bacteria | 1805 |
| 78 | Ga0068856_100471133 | 3300005614 | Bacteria | 1277 |
| 79 | Ga0070702_100002161 | 3300005615 | Bacteria | 8360 |
| 80 | Ga0070702_100010445 | 3300005615 | Bacteria | 4573 |
| 81 | Ga0070702_100182869 | 3300005615 | Bacteria | 1373 |
| 82 | Ga0070702_100512832 | 3300005615 | Bacteria | 883 |
| 83 | Ga0068852_100004251 | 3300005616 | Bacteria | 10111 |
| 84 | Ga0068852_100313783 | 3300005616 | Bacteria | 1521 |
| 85 | Ga0068859_100211903 | 3300005617 | Bacteria | 2024 |
| 86 | Ga0068864_100055503 | 3300005618 | Bacteria | 3421 |
| 87 | Ga0068864_100276176 | 3300005618 | Bacteria | 1567 |
| 88 | Ga0068866_10130652 | 3300005718 | Bacteria | 1428 |
| 89 | Ga0068861_100126676 | 3300005719 | Bacteria | 2067 |
| 90 | Ga0068851_10104032 | 3300005834 | Bacteria | 1509 |
| 91 | Ga0068870_10009207 | 3300005840 | Bacteria | 4480 |
| 92 | Ga0068860_100207213 | 3300005843 | Bacteria | 1902 |
| 93 | Ga0081455_10042882 | 3300005937 | Bacteria | 3964 |
| 94 | Ga0081455_10065694 | 3300005937 | Bacteria | 3033 |
| 95 | Ga0081455_10111831 | 3300005937 | Bacteria | 2169 |
| 96 | Ga0081455_10248814 | 3300005937 | Bacteria | 1301 |
| 97 | Ga0081538_10000016 | 3300005981 | Bacteria | 147022 |
| 98 | Ga0081538_10000045 | 3300005981 | Bacteria | 114622 |
| 99 | Ga0081538_10000772 | 3300005981 | Bacteria | 35018 |
| 100 | Ga0081538_10014877 | 3300005981 | Bacteria | 6059 |
| 101 | Ga0081538_10076403 | 3300005981 | Bacteria | 1810 |
| 102 | Ga0081539_10000312 | 3300005985 | Bacteria | 108472 |
| 103 | Ga0081539_10009686 | 3300005985 | Bacteria | 7980 |
| 104 | Ga0070717_10045908 | 3300006028 | Bacteria | 3573 |
| 105 | Ga0075365_10010916 | 3300006038 | Bacteria | 5318 |
| 106 | Ga0075363_100037536 | 3300006048 | Bacteria | 2545 |
| 107 | Ga0075364_10058500 | 3300006051 | Bacteria | 2526 |
| 108 | Ga0075364_10109646 | 3300006051 | Bacteria | 1841 |
| 109 | Ga0075364_10309802 | 3300006051 | Bacteria | 1075 |
| 110 | Ga0070712_100027964 | 3300006175 | Bacteria | 3768 |
| 111 | Ga0097621_100137676 | 3300006237 | Bacteria | 2084 |
| 112 | Ga0068871_100009009 | 3300006358 | Bacteria | 7207 |
| 113 | Ga0075428_100007511 | 3300006844 | Bacteria | 12083 |
| 114 | Ga0075428_100017583 | 3300006844 | Bacteria | 7897 |
| 115 | Ga0075428_100031025 | 3300006844 | Bacteria | 5910 |
| 116 | Ga0075430_100007562 | 3300006846 | Bacteria | 9176 |
| 117 | Ga0075430_100101763 | 3300006846 | Bacteria | 2399 |
| 118 | Ga0075431_100003203 | 3300006847 | Bacteria | 15834 |
| 119 | Ga0075431_100169822 | 3300006847 | Bacteria | 2241 |
| 120 | Ga0075433_10024185 | 3300006852 | Bacteria | 5123 |
| 121 | Ga0075429_100046024 | 3300006880 | Bacteria | 3796 |
| 122 | Ga0075429_100084082 | 3300006880 | Bacteria | 2774 |
| 123 | Ga0068865_100015409 | 3300006881 | Bacteria | 4876 |
| 124 | Ga0068865_100068289 | 3300006881 | Bacteria | 2513 |
| 125 | Ga0068865_100324498 | 3300006881 | Bacteria | 1240 |
| 126 | Ga0068865_100539843 | 3300006881 | Bacteria | 978 |
| 127 | Ga0097620_100211930 | 3300006931 | Bacteria | 2024 |
| 128 | Ga0075435_100482487 | 3300007076 | Bacteria | 1071 |
| 129 | Ga0105251_10051672 | 3300009011 | Bacteria | 1959 |
| 130 | Ga0105240_10199966 | 3300009093 | Bacteria | 2343 |
| 131 | Ga0105240_10261028 | 3300009093 | Bacteria | 1998 |
| 132 | Ga0111539_10026454 | 3300009094 | Bacteria | 7092 |
| 133 | Ga0111539_10122624 | 3300009094 | Bacteria | 3046 |
| 134 | Ga0111539_10370698 | 3300009094 | Bacteria | 1667 |
| 135 | Ga0111539_10481086 | 3300009094 | Bacteria | 1446 |
| 136 | Ga0105245_10004890 | 3300009098 | Bacteria | 11785 |
| 137 | Ga0105245_10033564 | 3300009098 | Bacteria | 4549 |
| 138 | Ga0105245_10043291 | 3300009098 | Bacteria | 4016 |
| 139 | Ga0105245_10055544 | 3300009098 | Bacteria | 3557 |
| 140 | Ga0105245_10110312 | 3300009098 | Bacteria | 2558 |
| 141 | Ga0105245_10239276 | 3300009098 | Bacteria | 1759 |
| 142 | Ga0105245_10359459 | 3300009098 | Bacteria | 1445 |
| 143 | Ga0105245_10368981 | 3300009098 | Bacteria | 1427 |
| 144 | Ga0105245_10780324 | 3300009098 | Bacteria | 993 |
| 145 | Ga0114129_10025060 | 3300009147 | Bacteria | 8453 |
| 146 | Ga0114129_10949323 | 3300009147 | Bacteria | 1086 |
| 147 | Ga0105243_10008877 | 3300009148 | Bacteria | 7692 |
| 148 | Ga0105243_10051955 | 3300009148 | Bacteria | 3244 |
| 149 | Ga0105243_10251287 | 3300009148 | Bacteria | 1579 |
| 150 | Ga0105243_10325123 | 3300009148 | Bacteria | 1403 |
| 151 | Ga0105243_10409966 | 3300009148 | Bacteria | 1261 |
| 152 | Ga0105241_10020035 | 3300009174 | Bacteria | 4940 |
| 153 | Ga0105241_10263768 | 3300009174 | Bacteria | 1465 |
| 154 | Ga0105242_10010764 | 3300009176 | Bacteria | 7021 |
| 155 | Ga0105242_10222899 | 3300009176 | Bacteria | 1686 |
| 156 | Ga0105242_10820728 | 3300009176 | Bacteria | 922 |
| 157 | Ga0105248_10071440 | 3300009177 | Bacteria | 3899 |
| 158 | Ga0105248_10206175 | 3300009177 | Bacteria | 2215 |
| 159 | Ga0105248_10263349 | 3300009177 | Bacteria | 1941 |
| 160 | Ga0105237_10195199 | 3300009545 | Bacteria | 2024 |
| 161 | Ga0105238_10538007 | 3300009551 | Bacteria | 1172 |
| 162 | Ga0105238_10693333 | 3300009551 | Bacteria | 1030 |
| 163 | Ga0105249_10217568 | 3300009553 | Bacteria | 1878 |
| 164 | Ga0105249_10384070 | 3300009553 | Bacteria | 1431 |
| 165 | Ga0105030_105558 | 3300009987 | Bacteria | 1067 |
| 166 | Ga0105239_10036015 | 3300010375 | Bacteria | 5433 |
| 167 | Ga0105239_10152325 | 3300010375 | Bacteria | 2581 |
| 168 | Ga0105239_10382980 | 3300010375 | Bacteria | 1590 |
| 169 | Ga0105246_10014361 | 3300011119 | Bacteria | 4981 |
| 170 | Ga0105246_10049642 | 3300011119 | Bacteria | 2874 |
| 171 | Ga0105246_10206397 | 3300011119 | Bacteria | 1531 |
| 172 | Ga0105246_10376023 | 3300011119 | Bacteria | 1172 |
| 173 | Ga0157373_10051743 | 3300013100 | Bacteria | 2924 |
| 174 | Ga0157370_10123658 | 3300013104 | Bacteria | 2416 |
| 175 | Ga0157369_10426646 | 3300013105 | Bacteria | 1374 |
| 176 | Ga0157374_10040449 | 3300013296 | Bacteria | 4293 |
| 177 | Ga0157374_10493677 | 3300013296 | Bacteria | 1228 |
| 178 | Ga0157378_10007512 | 3300013297 | Bacteria | 9519 |
| 179 | Ga0157378_10538881 | 3300013297 | Bacteria | 1171 |
| 180 | Ga0163162_10732316 | 3300013306 | Bacteria | 1109 |
| 181 | Ga0157372_10112456 | 3300013307 | Bacteria | 3120 |
| 182 | Ga0157372_10201553 | 3300013307 | Bacteria | 2305 |
| 183 | Ga0157372_10453029 | 3300013307 | Bacteria | 1495 |
| 184 | Ga0157375_10097760 | 3300013308 | Bacteria | 3011 |
| 185 | Ga0157375_10147195 | 3300013308 | Bacteria | 2487 |
| 186 | Ga0157375_10519277 | 3300013308 | Bacteria | 1354 |
| 187 | Ga0157375_10605658 | 3300013308 | Bacteria | 1254 |
| 188 | Ga0163163_10001036 | 3300014325 | Bacteria | 23554 |
| 189 | Ga0163163_10107818 | 3300014325 | Bacteria | 2812 |
| 190 | Ga0163163_10142705 | 3300014325 | Bacteria | 2437 |
| 191 | Ga0163163_10371994 | 3300014325 | Bacteria | 1486 |
| 192 | Ga0157380_10099574 | 3300014326 | Bacteria | 2417 |
| 193 | Ga0157377_10061633 | 3300014745 | Bacteria | 2144 |
| 194 | Ga0157377_10274301 | 3300014745 | Bacteria | 1103 |
| 195 | Ga0157379_10092341 | 3300014968 | Bacteria | 2715 |
| 196 | Ga0157379_10642825 | 3300014968 | Bacteria | 993 |
| 197 | Ga0157376_10111221 | 3300014969 | Bacteria | 2411 |
| 198 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 199 | Ga0206356_10654112 | 3300020070 | Bacteria | 1607 |
| 200 | Ga0206349_1649731 | 3300020075 | Bacteria | 2358 |
| 201 | Ga0206352_11228185 | 3300020078 | Bacteria | 2655 |
| 202 | Ga0206350_10518077 | 3300020080 | Unclassified | 1319 |
| 203 | Ga0206353_11815503 | 3300020082 | Bacteria | 2099 |
| 204 | Ga0213876_10004279 | 3300021384 | Bacteria | 8005 |
| 205 | Ga0213876_10044182 | 3300021384 | Bacteria | 2355 |
| 206 | Ga0213875_10003748 | 3300021388 | Bacteria | 8557 |
| 207 | Ga0213875_10015221 | 3300021388 | Bacteria | 3746 |
| 208 | Ga0213875_10036301 | 3300021388 | Bacteria | 2324 |
| 209 | Ga0224712_10082103 | 3300022467 | Bacteria | 1332 |
| 210 | Ga0209758_1007421 | 3300025297 | Bacteria | 7473 |
| 211 | Ga0207692_10197886 | 3300025898 | Bacteria | 1180 |
| 212 | Ga0207642_10050540 | 3300025899 | Bacteria | 1876 |
| 213 | Ga0207688_10012598 | 3300025901 | Bacteria | 4602 |
| 214 | Ga0207688_10068970 | 3300025901 | Bacteria | 2003 |
| 215 | Ga0207688_10076703 | 3300025901 | Bacteria | 1904 |
| 216 | Ga0207688_10293606 | 3300025901 | Bacteria | 993 |
| 217 | Ga0207680_10421928 | 3300025903 | Bacteria | 945 |
| 218 | Ga0207647_10009567 | 3300025904 | Bacteria | 6878 |
| 219 | Ga0207699_10231180 | 3300025906 | Bacteria | 1266 |
| 220 | Ga0207643_10023281 | 3300025908 | Bacteria | 3415 |
| 221 | Ga0207643_10047410 | 3300025908 | Bacteria | 2431 |
| 222 | Ga0207705_10103788 | 3300025909 | Bacteria | 2094 |
| 223 | Ga0207684_10159742 | 3300025910 | Bacteria | 1940 |
| 224 | Ga0207654_10314357 | 3300025911 | Bacteria | 1069 |
| 225 | Ga0207695_10330413 | 3300025913 | Bacteria | 1413 |
| 226 | Ga0207695_10469610 | 3300025913 | Bacteria | 1141 |
| 227 | Ga0207671_10066758 | 3300025914 | Bacteria | 2678 |
| 228 | Ga0207693_10041694 | 3300025915 | Bacteria | 3613 |
| 229 | Ga0207663_10096002 | 3300025916 | Bacteria | 1979 |
| 230 | Ga0207663_10737529 | 3300025916 | Bacteria | 782 |
| 231 | Ga0207660_10026917 | 3300025917 | Bacteria | 3919 |
| 232 | Ga0207657_10003182 | 3300025919 | Bacteria | 17565 |
| 233 | Ga0207657_10005447 | 3300025919 | Bacteria | 13287 |
| 234 | Ga0207649_10302611 | 3300025920 | Bacteria | 1169 |
| 235 | Ga0207649_10412874 | 3300025920 | Bacteria | 1012 |
| 236 | Ga0207652_10299952 | 3300025921 | Bacteria | 1450 |
| 237 | Ga0207646_10031158 | 3300025922 | Bacteria | 4829 |
| 238 | Ga0207646_10159063 | 3300025922 | Bacteria | 2038 |
| 239 | Ga0207681_10103257 | 3300025923 | Bacteria | 2060 |
| 240 | Ga0207694_10678431 | 3300025924 | Bacteria | 869 |
| 241 | Ga0207659_10025594 | 3300025926 | Bacteria | 3967 |
| 242 | Ga0207659_10059037 | 3300025926 | Bacteria | 2756 |
| 243 | Ga0207659_10067402 | 3300025926 | Bacteria | 2600 |
| 244 | Ga0207687_10042898 | 3300025927 | Bacteria | 3115 |
| 245 | Ga0207687_10048147 | 3300025927 | Bacteria | 2958 |
| 246 | Ga0207687_10058801 | 3300025927 | Bacteria | 2706 |
| 247 | Ga0207687_10147504 | 3300025927 | Bacteria | 1791 |
| 248 | Ga0207687_10230135 | 3300025927 | Bacteria | 1464 |
| 249 | Ga0207687_10454510 | 3300025927 | Bacteria | 1063 |
| 250 | Ga0207700_10209649 | 3300025928 | Bacteria | 1647 |
| 251 | Ga0207664_10000846 | 3300025929 | Bacteria | 20755 |
| 252 | Ga0207664_10111852 | 3300025929 | Bacteria | 2272 |
| 253 | Ga0207644_10047471 | 3300025931 | Bacteria | 3065 |
| 254 | Ga0207690_10038745 | 3300025932 | Bacteria | 3104 |
| 255 | Ga0207706_10003766 | 3300025933 | Bacteria | 14468 |
| 256 | Ga0207706_10065509 | 3300025933 | Bacteria | 3199 |
| 257 | Ga0207706_10099837 | 3300025933 | Bacteria | 2554 |
| 258 | Ga0207706_10770546 | 3300025933 | Bacteria | 819 |
| 259 | Ga0207686_10064299 | 3300025934 | Bacteria | 2336 |
| 260 | Ga0207686_10200601 | 3300025934 | Bacteria | 1429 |
| 261 | Ga0207670_10075108 | 3300025936 | Bacteria | 2348 |
| 262 | Ga0207670_10680204 | 3300025936 | Bacteria | 850 |
| 263 | Ga0207669_10124464 | 3300025937 | Bacteria | 1758 |
| 264 | Ga0207669_10254547 | 3300025937 | Bacteria | 1309 |
| 265 | Ga0207669_10363490 | 3300025937 | Bacteria | 1122 |
| 266 | Ga0207704_10020135 | 3300025938 | Bacteria | 3522 |
| 267 | Ga0207704_10359592 | 3300025938 | Bacteria | 1136 |
| 268 | Ga0207704_10387989 | 3300025938 | Bacteria | 1098 |
| 269 | Ga0207691_10016513 | 3300025940 | Bacteria | 7010 |
| 270 | Ga0207691_10143380 | 3300025940 | Bacteria | 2104 |
| 271 | Ga0207661_10029663 | 3300025944 | Bacteria | 4205 |
| 272 | Ga0207661_10033086 | 3300025944 | Bacteria | 4011 |
| 273 | Ga0207661_10092745 | 3300025944 | Bacteria | 2518 |
| 274 | Ga0207661_10111964 | 3300025944 | Bacteria | 2310 |
| 275 | Ga0207661_10419184 | 3300025944 | Bacteria | 1216 |
| 276 | Ga0207679_10109146 | 3300025945 | Bacteria | 2180 |
| 277 | Ga0207667_10514965 | 3300025949 | Bacteria | 1212 |
| 278 | Ga0207651_10202980 | 3300025960 | Bacteria | 1590 |
| 279 | Ga0207651_10586830 | 3300025960 | Bacteria | 973 |
| 280 | Ga0207668_10067654 | 3300025972 | Bacteria | 2537 |
| 281 | Ga0207668_10604685 | 3300025972 | Bacteria | 955 |
| 282 | Ga0207640_10556192 | 3300025981 | Bacteria | 965 |
| 283 | Ga0207658_10023514 | 3300025986 | Bacteria | 4302 |
| 284 | Ga0207677_10213663 | 3300026023 | Bacteria | 1542 |
| 285 | Ga0207639_10029134 | 3300026041 | Bacteria | 4039 |
| 286 | Ga0207678_10012169 | 3300026067 | Bacteria | 7557 |
| 287 | Ga0207678_10114055 | 3300026067 | Bacteria | 2306 |
| 288 | Ga0207708_10015432 | 3300026075 | Bacteria | 5730 |
| 289 | Ga0207708_10094004 | 3300026075 | Bacteria | 2314 |
| 290 | Ga0207702_10229227 | 3300026078 | Bacteria | 1735 |
| 291 | Ga0207648_10019455 | 3300026089 | Bacteria | 6129 |
| 292 | Ga0207648_10148422 | 3300026089 | Bacteria | 2069 |
| 293 | Ga0207648_10299793 | 3300026089 | Bacteria | 1441 |
| 294 | Ga0207676_10197000 | 3300026095 | Bacteria | 1777 |
| 295 | Ga0207676_10296428 | 3300026095 | Bacteria | 1475 |
| 296 | Ga0207676_10388780 | 3300026095 | Bacteria | 1300 |
| 297 | Ga0207676_10404069 | 3300026095 | Bacteria | 1277 |
| 298 | Ga0207674_10011005 | 3300026116 | Bacteria | 10174 |
| 299 | Ga0207674_10555578 | 3300026116 | Bacteria | 1109 |
| 300 | Ga0207675_100157370 | 3300026118 | Bacteria | 2165 |
| 301 | Ga0207675_100163734 | 3300026118 | Bacteria | 2123 |
| 302 | Ga0207683_10016752 | 3300026121 | Bacteria | 6238 |
| 303 | Ga0207683_10019287 | 3300026121 | Bacteria | 5822 |
| 304 | Ga0207683_10292315 | 3300026121 | Bacteria | 1490 |
| 305 | Ga0207698_10013765 | 3300026142 | Bacteria | 5351 |
| 306 | Ga0207428_10000378 | 3300027907 | Bacteria | 56382 |
| 307 | Ga0207428_10166012 | 3300027907 | Bacteria | 1674 |
| 308 | Ga0268266_10175911 | 3300028379 | Bacteria | 1946 |
| 309 | Ga0268266_10961493 | 3300028379 | Bacteria | 826 |
| 310 | Ga0268265_10728437 | 3300028380 | Bacteria | 961 |
| 311 | Ga0268265_11103600 | 3300028380 | Bacteria | 788 |
| 312 | Ga0268264_10069177 | 3300028381 | Bacteria | 2985 |
| 313 | Ga0265319_1000326 | 3300028563 | Bacteria | 35093 |
| 314 | Ga0307517_10078409 | 3300028786 | Bacteria | 2856 |
| 315 | Ga0316575_10149088 | 3300031665 | Bacteria | 964 |
| 316 | Ga0316579_10001209 | 3300031691 | Bacteria | 9259 |
| 317 | Ga0316579_10162720 | 3300031691 | Bacteria | 1078 |
| 318 | Ga0316576_10025391 | 3300031727 | Bacteria | 4148 |
| 319 | Ga0307405_10006740 | 3300031731 | Bacteria | 5678 |
| 320 | Ga0307413_10124069 | 3300031824 | Bacteria | 1755 |
| 321 | Ga0307410_10044704 | 3300031852 | Bacteria | 2944 |
| 322 | Ga0307406_10002597 | 3300031901 | Bacteria | 9837 |
| 323 | Ga0307406_10022614 | 3300031901 | Bacteria | 3732 |
| 324 | Ga0307406_10060580 | 3300031901 | Bacteria | 2441 |
| 325 | Ga0307407_10075849 | 3300031903 | Bacteria | 2017 |
| 326 | Ga0307407_10592598 | 3300031903 | Bacteria | 824 |
| 327 | Ga0307412_10319918 | 3300031911 | Bacteria | 1234 |
| 328 | Ga0307409_100220634 | 3300031995 | Bacteria | 1711 |
| 329 | Ga0307416_100000308 | 3300032002 | Bacteria | 25237 |
| 330 | Ga0307415_100000038 | 3300032126 | Bacteria | 57023 |
| 331 | Ga0307415_100012275 | 3300032126 | Bacteria | 4947 |
| 332 | Ga0307415_100019174 | 3300032126 | Bacteria | 4148 |
| 333 | Ga0307415_100023391 | 3300032126 | Bacteria | 3834 |
| 334 | Ga0307415_100171113 | 3300032126 | Bacteria | 1694 |
| 335 | Ga0373930_0000119 | 3300034816 | Bacteria | 8481 |
| 336 | Ga0373928_0002586 | 3300035084 | Bacteria | 3505 |
| 337 | Ga0373929_0001600 | 3300035085 | Bacteria | 4298 |
| 338 | Ga0373934_0005878 | 3300035086 | Bacteria | 4541 |
| 339 | Ga0373923_0119725 | 3300035111 | Bacteria | 1175 |
| 340 | Ga0373936_0011466 | 3300035113 | Bacteria | 3355 |
| 341 | Ga0373953_0111554 | 3300035117 | Bacteria | 1156 |
| 342 | Ga0373954_0140343 | 3300035118 | Bacteria | 1178 |
| 343 | Ga0373956_0096227 | 3300035119 | Bacteria | 1369 |
| 344 | Ga0373957_0030952 | 3300035120 | Bacteria | 1963 |
| 345 | Ga0373943_0067388 | 3300035170 | Bacteria | 1805 |
| 346 | Ga0373955_0025435 | 3300035172 | Bacteria | 3039 |
| 347 | Ga0316574_0002932 | 3300035398 | Bacteria | 8681 |
| 348 | Ga0316574_0041770 | 3300035398 | Bacteria | 2828 |
| 349 | Ga0316574_0156803 | 3300035398 | Bacteria | 1467 |
| 350 | Ga0373924_0001176 | 3300035410 | Bacteria | 8411 |
| 351 | Ga0373931_0000006 | 3300035691 | Bacteria | 437006 |
| 352 | Ga0373933_0026513 | 3300035724 | Bacteria | 3328 |
| 353 | Ga0373933_0035327 | 3300035724 | Bacteria | 2919 |
| 354 | Ga0373937_0006018 | 3300036401 | Bacteria | 10443 |
| 355 | Ga0373937_0032444 | 3300036401 | Bacteria | 4737 |
| 356 | Ga0373937_0126180 | 3300036401 | Bacteria | 2387 |
| 357 | Ga0373937_0157886 | 3300036401 | Bacteria | 2126 |
| 358 | Ga0316582_0031634 | 3300036647 | Bacteria | 3236 |
| 359 | Ga0316582_0073873 | 3300036647 | Bacteria | 2213 |
| 360 | Ga0316584_0092116 | 3300036712 | Bacteria | 2269 |
| 361 | Ga0395900_0154259 | 3300037418 | Bacteria | 2346 |
| 362 | Ga0395900_0281232 | 3300037418 | Bacteria | 1656 |
| 363 | Ga0395898_0007381 | 3300037466 | Bacteria | 11666 |
| 364 | Ga0395898_0012160 | 3300037466 | Bacteria | 8903 |
| 365 | Ga0395898_0068810 | 3300037466 | Bacteria | 3426 |
| 366 | Ga0395898_0079832 | 3300037466 | Bacteria | 3156 |
| 367 | Ga0395898_0247352 | 3300037466 | Bacteria | 1701 |
| 368 | Ga0395898_0251375 | 3300037466 | Bacteria | 1686 |
| 369 | Ga0316581_0058886 | 3300037588 | Bacteria | 1178 |
| 370 | Ga0436364_0189902 | 3300037853 | Bacteria | 7212 |
| 371 | Ga0436364_1225776 | 3300037853 | Bacteria | 23812 |
| 372 | Ga0436364_1252068 | 3300037853 | Bacteria | 13256 |
| 373 | Ga0395901_0535466 | 3300038443 | Bacteria | 1188 |
| 374 | Ga0395901_0642641 | 3300038443 | Bacteria | 1065 |
| 375 | Ga0400483_000720 | 3300039062 | Bacteria | 5797 |
| 376 | Ga0400483_292200 | 3300039062 | Bacteria | 8086 |
| 377 | Ga0436365_1020474 | 3300039437 | Bacteria | 17081 |
| 378 | Ga0436365_1436221 | 3300039437 | Bacteria | 4761 |
| 379 | Ga0436360_0621662 | 3300039438 | Bacteria | 1844 |
| 380 | Ga0436361_0056987 | 3300039447 | Bacteria | 3783 |
| 381 | Ga0436362_0825065 | 3300039453 | Bacteria | 2123 |
| 382 | Ga0439439_0005362 | 3300041406 | Bacteria | 2925 |
| 383 | Ga0451807_0002334 | 3300041486 | Bacteria | 868 |
| 384 | Ga0451853_2841797 | 3300041512 | Bacteria | 1359 |
| 385 | Ga0439431_0070673 | 3300041997 | Bacteria | 930 |
| 386 | Ga0439433_0007379 | 3300041999 | Bacteria | 2373 |
| 387 | Ga0439448_0033157 | 3300042005 | Bacteria | 1647 |
| 388 | Ga0439449_0008227 | 3300042007 | Bacteria | 3966 |
| 389 | Ga0439456_041905 | 3300042013 | Bacteria | 993 |
| 390 | Ga0439457_003305 | 3300042014 | Bacteria | 4409 |
| 391 | Ga0439462_0054515 | 3300042015 | Bacteria | 1077 |
| 392 | Ga0450898_015809 | 3300042134 | Bacteria | 1282 |
| 393 | Ga0450907_006129 | 3300042146 | Bacteria | 2015 |
| 394 | Ga0439434_0015506 | 3300042435 | Bacteria | 2274 |
| 395 | Ga0466972_0110924 | 3300044658 | Bacteria | 1296 |
| 396 | Ga0466965_0014222 | 3300044683 | Bacteria | 3765 |
| 397 | Ga0466966_0021836 | 3300044684 | Bacteria | 4202 |
| 398 | Ga0466961_0044375 | 3300044693 | Bacteria | 2844 |
| 399 | Ga0466961_0460155 | 3300044693 | Bacteria | 770 |
| 400 | Ga0466963_0037991 | 3300044694 | Bacteria | 3147 |
| 401 | Ga0466963_0128489 | 3300044694 | Bacteria | 1749 |
| 402 | Ga0466971_0010374 | 3300044719 | Bacteria | 4069 |
| 403 | Ga0466968_0001443 | 3300044735 | Bacteria | 8532 |
| 404 | Ga0466970_0006723 | 3300044765 | Bacteria | 5754 |
| 405 | Ga0466957_0026048 | 3300044842 | Bacteria | 3468 |
| 406 | Ga0466957_0039212 | 3300044842 | Bacteria | 2857 |
| 407 | Ga0466959_0042100 | 3300045049 | Bacteria | 3369 |
| 408 | Ga0451576_0648850 | 3300045051 | Bacteria | 1109 |
| 409 | Ga0466958_0008836 | 3300045836 | Bacteria | 5598 |
| 410 | Ga0466958_0025262 | 3300045836 | Bacteria | 3501 |
| 411 | Ga0466958_0038805 | 3300045836 | Bacteria | 2859 |
| 412 | Ga0466958_0185368 | 3300045836 | Bacteria | 1321 |
| 413 | Ga0466967_0003982 | 3300045976 | Bacteria | 9835 |
| 414 | Ga0466967_0042552 | 3300045976 | Bacteria | 3926 |
| 415 | Ga0495617_001801 | 3300046452 | Bacteria | 9121 |
| 416 | Ga0495592_0058817 | 3300046454 | Bacteria | 2833 |
| 417 | Ga0495592_0243030 | 3300046454 | Bacteria | 1193 |
| 418 | Ga0495603_0004204 | 3300046455 | Bacteria | 8575 |
| 419 | Ga0495603_0005639 | 3300046455 | Bacteria | 7483 |
| 420 | Ga0495603_0036031 | 3300046455 | Bacteria | 2970 |
| 421 | Ga0495603_0074981 | 3300046455 | Bacteria | 1986 |
| 422 | Ga0495629_0020306 | 3300046459 | Bacteria | 4743 |
| 423 | Ga0495629_0146484 | 3300046459 | Bacteria | 1642 |
| 424 | Ga0495629_0160288 | 3300046459 | Bacteria | 1563 |
| 425 | Ga0495629_0442409 | 3300046459 | Bacteria | 881 |
| 426 | Ga0495638_0110828 | 3300046460 | Bacteria | 1631 |
| 427 | Ga0495641_0065102 | 3300046461 | Bacteria | 1641 |
| 428 | Ga0495641_0116680 | 3300046461 | Bacteria | 1191 |
| 429 | Ga0495651_0016835 | 3300046462 | Bacteria | 5662 |
| 430 | Ga0495651_0032936 | 3300046462 | Bacteria | 4042 |
| 431 | Ga0495651_0054706 | 3300046462 | Bacteria | 3068 |
| 432 | Ga0495651_0088779 | 3300046462 | Bacteria | 2322 |
| 433 | Ga0495651_0091723 | 3300046462 | Bacteria | 2277 |
| 434 | Ga0495653_0237843 | 3300046463 | Bacteria | 1215 |
| 435 | Ga0495650_0000070 | 3300046471 | Bacteria | 258497 |
| 436 | Ga0495582_0103963 | 3300046473 | Bacteria | 1592 |
| 437 | Ga0495582_0319256 | 3300046473 | Bacteria | 894 |
| 438 | Ga0495605_0070939 | 3300046474 | Bacteria | 1646 |
| 439 | Ga0495662_0002361 | 3300046476 | Bacteria | 9514 |
| 440 | Ga0495662_0003915 | 3300046476 | Bacteria | 7510 |
| 441 | Ga0495662_0056462 | 3300046476 | Bacteria | 1896 |
| 442 | Ga0495664_0002529 | 3300046477 | Bacteria | 9823 |
| 443 | Ga0495664_0031887 | 3300046477 | Bacteria | 3090 |
| 444 | Ga0495664_0059468 | 3300046477 | Bacteria | 2275 |
| 445 | Ga0495664_0258619 | 3300046477 | Bacteria | 1052 |
| 446 | Ga0495585_0011581 | 3300046492 | Bacteria | 5215 |
| 447 | Ga0495594_0000733 | 3300046499 | Bacteria | 16835 |
| 448 | Ga0495594_0020429 | 3300046499 | Bacteria | 3527 |
| 449 | Ga0495594_0029210 | 3300046499 | Bacteria | 2979 |
| 450 | Ga0495594_0159699 | 3300046499 | Bacteria | 1281 |
| 451 | Ga0495596_0133790 | 3300046500 | Bacteria | 962 |
| 452 | Ga0495607_0276367 | 3300046501 | Bacteria | 799 |
| 453 | Ga0495583_0051275 | 3300046506 | Bacteria | 1882 |
| 454 | Ga0495606_0004995 | 3300046507 | Bacteria | 12934 |
| 455 | Ga0495608_0032894 | 3300046511 | Bacteria | 3506 |
| 456 | Ga0495608_0033084 | 3300046511 | Bacteria | 3496 |
| 457 | Ga0495608_0093926 | 3300046511 | Bacteria | 1938 |
| 458 | Ga0495610_0068179 | 3300046512 | Bacteria | 1668 |
| 459 | Ga0495616_0006053 | 3300046513 | Bacteria | 7371 |
| 460 | Ga0495618_0023331 | 3300046514 | Bacteria | 3825 |
| 461 | Ga0495618_0089145 | 3300046514 | Bacteria | 1972 |
| 462 | Ga0495618_0191814 | 3300046514 | Bacteria | 1295 |
| 463 | Ga0495618_0330779 | 3300046514 | Bacteria | 942 |
| 464 | Ga0495620_0003848 | 3300046515 | Bacteria | 8555 |
| 465 | Ga0495620_0006185 | 3300046515 | Bacteria | 6595 |
| 466 | Ga0495628_0144078 | 3300046516 | Bacteria | 1817 |
| 467 | Ga0495628_0207234 | 3300046516 | Bacteria | 1475 |
| 468 | Ga0495630_0028122 | 3300046517 | Bacteria | 4178 |
| 469 | Ga0495630_0030189 | 3300046517 | Bacteria | 4031 |
| 470 | Ga0495630_0082912 | 3300046517 | Bacteria | 2420 |
| 471 | Ga0495630_0106597 | 3300046517 | Bacteria | 2123 |
| 472 | Ga0495631_0004966 | 3300046518 | Bacteria | 7009 |
| 473 | Ga0495643_0002317 | 3300046522 | Bacteria | 15353 |
| 474 | Ga0495648_0086331 | 3300046524 | Bacteria | 1770 |
| 475 | Ga0495642_0052413 | 3300046528 | Bacteria | 1680 |
| 476 | Ga0495652_0149525 | 3300046529 | Bacteria | 1826 |
| 477 | Ga0495652_0215188 | 3300046529 | Bacteria | 1447 |
| 478 | Ga0495640_0000413 | 3300046533 | Bacteria | 30800 |
| 479 | Ga0495640_0009438 | 3300046533 | Bacteria | 7599 |
| 480 | Ga0495640_0019929 | 3300046533 | Bacteria | 4945 |
| 481 | Ga0495640_0050627 | 3300046533 | Bacteria | 2861 |
| 482 | Ga0495587_0029690 | 3300046536 | Bacteria | 3318 |
| 483 | Ga0495609_0200639 | 3300046538 | Bacteria | 834 |
| 484 | Ga0495645_0034152 | 3300046543 | Bacteria | 3711 |
| 485 | Ga0495622_0001692 | 3300046557 | Bacteria | 10905 |
| 486 | Ga0495622_0034464 | 3300046557 | Bacteria | 2361 |
| 487 | Ga0495667_0099742 | 3300046559 | Bacteria | 1880 |
| 488 | Ga0495667_0179425 | 3300046559 | Bacteria | 1359 |
| 489 | Ga0495667_0239290 | 3300046559 | Bacteria | 1156 |
| 490 | Ga0495656_0076601 | 3300046615 | Bacteria | 1499 |
| 491 | Ga0495634_0009612 | 3300046642 | Bacteria | 7124 |
| 492 | Ga0495611_0009878 | 3300046648 | Bacteria | 4037 |
| 493 | Ga0495611_0034602 | 3300046648 | Bacteria | 2234 |
| 494 | Ga0495611_0046955 | 3300046648 | Bacteria | 1937 |
| 495 | Ga0495611_0177455 | 3300046648 | Bacteria | 995 |
| 496 | Ga0495625_0081836 | 3300046660 | Bacteria | 2246 |
| 497 | Ga0495625_0181089 | 3300046660 | Bacteria | 1401 |
| 498 | Ga0495625_0181835 | 3300046660 | Bacteria | 1397 |
| 499 | Ga0495635_0012015 | 3300046663 | Bacteria | 6069 |
| 500 | Ga0495635_0031578 | 3300046663 | Bacteria | 3675 |
| 501 | Ga0495635_0082562 | 3300046663 | Bacteria | 2199 |
| 502 | Ga0495661_0168577 | 3300046665 | Bacteria | 1170 |
| 503 | Ga0495657_0003221 | 3300046675 | Bacteria | 13425 |
| 504 | Ga0495657_0031324 | 3300046675 | Bacteria | 3717 |
| 505 | Ga0495657_0088311 | 3300046675 | Bacteria | 1993 |
| 506 | Ga0495657_0216200 | 3300046675 | Bacteria | 1163 |
| 507 | Ga0495599_0009684 | 3300046678 | Bacteria | 5895 |
| 508 | Ga0495599_0047502 | 3300046678 | Bacteria | 2690 |
| 509 | Ga0495623_0029311 | 3300046679 | Bacteria | 3541 |
| 510 | Ga0495623_0173066 | 3300046679 | Bacteria | 1260 |
| 511 | Ga0495623_0190665 | 3300046679 | Bacteria | 1184 |
| 512 | Ga0495646_0082561 | 3300046680 | Bacteria | 1869 |
| 513 | Ga0495646_0087191 | 3300046680 | Bacteria | 1809 |
| 514 | Ga0495658_0061774 | 3300046683 | Bacteria | 2152 |
| 515 | Ga0495669_0024146 | 3300046684 | Bacteria | 2649 |
| 516 | Ga0495613_0002875 | 3300046689 | Bacteria | 12889 |
| 517 | Ga0495613_0007447 | 3300046689 | Bacteria | 8158 |
| 518 | Ga0495613_0031667 | 3300046689 | Bacteria | 3929 |
| 519 | Ga0495613_0039288 | 3300046689 | Bacteria | 3508 |
| 520 | Ga0495613_0044322 | 3300046689 | Bacteria | 3291 |
| 521 | Ga0495624_0020464 | 3300046690 | Bacteria | 4403 |
| 522 | Ga0495624_0032186 | 3300046690 | Bacteria | 3402 |
| 523 | Ga0495624_0063263 | 3300046690 | Bacteria | 2313 |
| 524 | Ga0495624_0110145 | 3300046690 | Bacteria | 1693 |
| 525 | Ga0495624_0122839 | 3300046690 | Bacteria | 1594 |
| 526 | Ga0495649_0071314 | 3300046694 | Bacteria | 1862 |
| 527 | Ga0495589_0046520 | 3300046794 | Bacteria | 2153 |
| 528 | Ga0495600_0053329 | 3300046809 | Bacteria | 2641 |
| 529 | Ga0495600_0054145 | 3300046809 | Bacteria | 2620 |
| 530 | Ga0495600_0089381 | 3300046809 | Bacteria | 2009 |
| 531 | Ga0495600_0274446 | 3300046809 | Bacteria | 1068 |
| 532 | Ga0495660_0072047 | 3300046810 | Bacteria | 1831 |
| 533 | Ga0495581_0015110 | 3300047315 | Bacteria | 4482 |
| 534 | Ga0495581_0047589 | 3300047315 | Bacteria | 2478 |
| 535 | Ga0495581_0268211 | 3300047315 | Bacteria | 998 |
| 536 | Ga0495604_0033755 | 3300047317 | Bacteria | 4050 |
| 537 | Ga0495604_0253589 | 3300047317 | Bacteria | 1198 |
| 538 | Ga0495604_0259529 | 3300047317 | Bacteria | 1181 |
| 539 | Ga0495674_0089987 | 3300047319 | Bacteria | 2623 |
| 540 | Ga0495674_0273519 | 3300047319 | Bacteria | 1385 |
| 541 | Ga0495674_0295219 | 3300047319 | Bacteria | 1324 |
| 542 | Ga0495672_0105472 | 3300047320 | Bacteria | 1521 |
| 543 | Ga0495676_0001241 | 3300047321 | Bacteria | 21877 |
| 544 | Ga0495676_0001466 | 3300047321 | Bacteria | 20364 |
| 545 | Ga0495676_0004211 | 3300047321 | Bacteria | 13133 |
| 546 | Ga0495676_0016048 | 3300047321 | Bacteria | 6652 |
| 547 | Ga0495676_0017507 | 3300047321 | Bacteria | 6334 |
| 548 | Ga0495676_0023553 | 3300047321 | Bacteria | 5342 |
| 549 | Ga0495676_0028092 | 3300047321 | Bacteria | 4812 |
| 550 | Ga0495676_0054145 | 3300047321 | Bacteria | 3191 |
| 551 | Ga0495680_0023855 | 3300047322 | Bacteria | 5083 |
| 552 | Ga0495680_0034479 | 3300047322 | Bacteria | 4085 |
| 553 | Ga0495680_0062211 | 3300047322 | Bacteria | 2870 |
| 554 | Ga0495680_0177771 | 3300047322 | Bacteria | 1538 |
| 555 | Ga0495683_0001785 | 3300047323 | Bacteria | 13579 |
| 556 | Ga0495683_0063763 | 3300047323 | Bacteria | 1820 |
| 557 | Ga0495687_005851 | 3300047443 | Bacteria | 7696 |
| 558 | Ga0495687_009911 | 3300047443 | Bacteria | 5273 |
| 559 | Ga0495675_0020923 | 3300047444 | Bacteria | 4164 |
| 560 | Ga0495675_0025319 | 3300047444 | Bacteria | 3783 |
| 561 | Ga0495675_0085686 | 3300047444 | Bacteria | 1981 |
| 562 | Ga0495685_004119 | 3300047447 | Bacteria | 4676 |
| 563 | Ga0495685_014455 | 3300047447 | Bacteria | 2682 |
| 564 | Ga0495684_0296387 | 3300047471 | Bacteria | 1162 |
| 565 | Ga0495686_0036002 | 3300047472 | Bacteria | 3178 |
| 566 | Ga0495593_0032815 | 3300047673 | Bacteria | 2829 |
| 567 | Ga0495602_0175623 | 3300048088 | Bacteria | 1658 |
| 568 | Ga0495602_0294683 | 3300048088 | Bacteria | 1189 |
| 569 | Ga0495602_0435880 | 3300048088 | Bacteria | 927 |
| 570 | Ga0495614_0000150 | 3300048089 | Bacteria | 25401 |
| 571 | Ga0495614_0017959 | 3300048089 | Bacteria | 3067 |
| 572 | Ga0495614_0026847 | 3300048089 | Bacteria | 2482 |
| 573 | Ga0496100_0159094 | 3300048903 | Bacteria | 1618 |
| 574 | Ga0496100_0300557 | 3300048903 | Bacteria | 1201 |
| 575 | Ga0496101_0046359 | 3300048904 | Bacteria | 3117 |
| 576 | Ga0496101_0061446 | 3300048904 | Bacteria | 2729 |
| 577 | Ga0496101_0153307 | 3300048904 | Bacteria | 1764 |
| 578 | Ga0496101_0176165 | 3300048904 | Bacteria | 1645 |
| 579 | Ga0496102_0189612 | 3300048905 | Bacteria | 1937 |
| 580 | Ga0496102_0189857 | 3300048905 | Bacteria | 1936 |
| 581 | Ga0496104_0008056 | 3300048907 | Bacteria | 9347 |
| 582 | Ga0496104_0053839 | 3300048907 | Bacteria | 3803 |
| 583 | Ga0496104_0085387 | 3300048907 | Bacteria | 3013 |
| 584 | Ga0496104_0150774 | 3300048907 | Bacteria | 2232 |
| 585 | Ga0496104_0544782 | 3300048907 | Bacteria | 1071 |
| 586 | Ga0496105_0010973 | 3300048908 | Bacteria | 7139 |
| 587 | Ga0496105_0160964 | 3300048908 | Bacteria | 1843 |
| 588 | Ga0496105_0162133 | 3300048908 | Bacteria | 1835 |
| 589 | Ga0496105_0237200 | 3300048908 | Bacteria | 1481 |
| 590 | Ga0496106_0009320 | 3300048909 | Bacteria | 7257 |
| 591 | Ga0496106_0198799 | 3300048909 | Bacteria | 1595 |
| 592 | Ga0496107_0089416 | 3300048910 | Bacteria | 2249 |
| 593 | Ga0496107_0144767 | 3300048910 | Bacteria | 1757 |
| 594 | Ga0496107_0176118 | 3300048910 | Bacteria | 1588 |
| 595 | Ga0496107_0296084 | 3300048910 | Bacteria | 1204 |
| 596 | Ga0496108_0000293 | 3300048911 | Bacteria | 43066 |
| 597 | Ga0496108_0060060 | 3300048911 | Bacteria | 3198 |
| 598 | Ga0496108_0086557 | 3300048911 | Bacteria | 2660 |
| 599 | Ga0496108_0183777 | 3300048911 | Bacteria | 1811 |
| 600 | Ga0496108_0223186 | 3300048911 | Bacteria | 1637 |
| 601 | Ga0496108_0311837 | 3300048911 | Bacteria | 1371 |
| 602 | Ga0496108_0464645 | 3300048911 | Bacteria | 1106 |
| 603 | Ga0496108_0646839 | 3300048911 | Bacteria | 919 |
| 604 | Ga0496109_0007197 | 3300048912 | Bacteria | 9403 |
| 605 | Ga0496109_0012611 | 3300048912 | Bacteria | 7298 |
| 606 | Ga0496109_0121353 | 3300048912 | Bacteria | 2435 |
| 607 | Ga0496109_0172221 | 3300048912 | Bacteria | 2031 |
| 608 | Ga0496109_0275571 | 3300048912 | Bacteria | 1585 |
| 609 | Ga0496110_0000880 | 3300048913 | Bacteria | 21147 |
| 610 | Ga0496110_0033172 | 3300048913 | Bacteria | 4464 |
| 611 | Ga0496110_0071337 | 3300048913 | Bacteria | 3080 |
| 612 | Ga0496110_0153221 | 3300048913 | Bacteria | 2087 |
| 613 | Ga0496110_0452619 | 3300048913 | Bacteria | 1170 |
| 614 | Ga0496111_0005024 | 3300048914 | Bacteria | 8415 |
| 615 | Ga0496111_0043114 | 3300048914 | Bacteria | 3242 |
| 616 | Ga0496111_0104488 | 3300048914 | Bacteria | 2084 |
| 617 | Ga0496111_0163107 | 3300048914 | Bacteria | 1655 |
| 618 | Ga0496111_0631726 | 3300048914 | Bacteria | 782 |
| 619 | Ga0496112_0011598 | 3300048915 | Bacteria | 8059 |
| 620 | Ga0496112_0016781 | 3300048915 | Bacteria | 6867 |
| 621 | Ga0496112_0051890 | 3300048915 | Bacteria | 4023 |
| 622 | Ga0496112_0175717 | 3300048915 | Bacteria | 2106 |
| 623 | Ga0496112_0217858 | 3300048915 | Bacteria | 1865 |
| 624 | Ga0496112_0366669 | 3300048915 | Bacteria | 1382 |
| 625 | Ga0496113_0010588 | 3300048916 | Bacteria | 6104 |
| 626 | Ga0496113_0057206 | 3300048916 | Bacteria | 2930 |
| 627 | Ga0496113_0073771 | 3300048916 | Bacteria | 2600 |
| 628 | Ga0496114_0075013 | 3300048917 | Bacteria | 2848 |
| 629 | Ga0496114_0196333 | 3300048917 | Bacteria | 1766 |
| 630 | Ga0496114_0203748 | 3300048917 | Bacteria | 1733 |
| 631 | Ga0496115_0040943 | 3300048918 | Bacteria | 3684 |
| 632 | Ga0496115_0107713 | 3300048918 | Bacteria | 2288 |
| 633 | Ga0496126_0098323 | 3300048929 | Bacteria | 2564 |
| 634 | Ga0501031_0009266 | 3300049568 | Bacteria | 6395 |
| 635 | Ga0501031_0025633 | 3300049568 | Bacteria | 3846 |
| 636 | Ga0501031_0026270 | 3300049568 | Bacteria | 3796 |
| 637 | Ga0501031_0056338 | 3300049568 | Bacteria | 2561 |
| 638 | Ga0501031_0066662 | 3300049568 | Bacteria | 2345 |
| 639 | Ga0501031_0125631 | 3300049568 | Bacteria | 1676 |
| 640 | Ga0501032_0013085 | 3300049569 | Bacteria | 5909 |
| 641 | Ga0501032_0118468 | 3300049569 | Bacteria | 1751 |
| 642 | Ga0501032_0182899 | 3300049569 | Bacteria | 1372 |
| 643 | Ga0501033_0056501 | 3300049570 | Bacteria | 2901 |
| 644 | Ga0501033_0096607 | 3300049570 | Bacteria | 2159 |
| 645 | Ga0501033_0106603 | 3300049570 | Bacteria | 2041 |
| 646 | Ga0501033_0172139 | 3300049570 | Bacteria | 1555 |
| 647 | Ga0501033_0185551 | 3300049570 | Bacteria | 1490 |
| 648 | Ga0501033_0192366 | 3300049570 | Bacteria | 1460 |
| 649 | Ga0501034_0239307 | 3300049571 | Bacteria | 1762 |
| 650 | Ga0501036_0002610 | 3300049572 | Bacteria | 14211 |
| 651 | Ga0501036_0008942 | 3300049572 | Bacteria | 8233 |
| 652 | Ga0501036_0029691 | 3300049572 | Bacteria | 4619 |
| 653 | Ga0501036_0107440 | 3300049572 | Bacteria | 2359 |
| 654 | Ga0501036_0455888 | 3300049572 | Bacteria | 1065 |
| 655 | Ga0501036_0633269 | 3300049572 | Bacteria | 886 |
| 656 | Ga0501038_0105709 | 3300049574 | Bacteria | 2338 |
| 657 | Ga0501038_0138322 | 3300049574 | Bacteria | 1994 |
| 658 | Ga0501038_0180224 | 3300049574 | Bacteria | 1705 |
| 659 | Ga0501038_0182507 | 3300049574 | Bacteria | 1692 |
| 660 | Ga0501038_0289607 | 3300049574 | Bacteria | 1287 |
| 661 | Ga0501039_0008346 | 3300049575 | Bacteria | 7894 |
| 662 | Ga0501039_0035199 | 3300049575 | Bacteria | 3864 |
| 663 | Ga0501039_0073643 | 3300049575 | Bacteria | 2653 |
| 664 | Ga0501039_0086822 | 3300049575 | Bacteria | 2437 |
| 665 | Ga0501039_0324257 | 3300049575 | Bacteria | 1210 |
| 666 | Ga0501040_0005156 | 3300049576 | Bacteria | 8454 |
| 667 | Ga0501040_0010091 | 3300049576 | Bacteria | 6171 |
| 668 | Ga0501040_0023408 | 3300049576 | Bacteria | 4142 |
| 669 | Ga0501040_0031075 | 3300049576 | Bacteria | 3608 |
| 670 | Ga0501040_0034400 | 3300049576 | Bacteria | 3432 |
| 671 | Ga0501040_0221101 | 3300049576 | Bacteria | 1347 |
| 672 | Ga0501041_0003103 | 3300049577 | Bacteria | 9550 |
| 673 | Ga0501041_0010713 | 3300049577 | Bacteria | 5410 |
| 674 | Ga0501041_0016548 | 3300049577 | Bacteria | 4385 |
| 675 | Ga0501041_0070112 | 3300049577 | Bacteria | 2151 |
| 676 | Ga0501041_0077392 | 3300049577 | Bacteria | 2046 |
| 677 | Ga0501041_0088864 | 3300049577 | Bacteria | 1907 |
| 678 | Ga0501041_0100456 | 3300049577 | Bacteria | 1790 |
| 679 | Ga0501041_0104833 | 3300049577 | Bacteria | 1752 |
| 680 | Ga0501041_0206045 | 3300049577 | Bacteria | 1233 |
| 681 | Ga0501042_0022548 | 3300049578 | Bacteria | 4398 |
| 682 | Ga0501042_0046084 | 3300049578 | Bacteria | 3108 |
| 683 | Ga0501042_0130333 | 3300049578 | Bacteria | 1812 |
| 684 | Ga0501042_0162337 | 3300049578 | Bacteria | 1612 |
| 685 | Ga0501042_0167213 | 3300049578 | Bacteria | 1587 |
| 686 | Ga0501042_0167352 | 3300049578 | Bacteria | 1586 |
| 687 | Ga0501043_0240013 | 3300049579 | Bacteria | 1398 |
| 688 | Ga0501046_0230401 | 3300049580 | Bacteria | 1369 |
| 689 | Ga0501048_0047290 | 3300049582 | Bacteria | 3070 |
| 690 | Ga0501048_0050692 | 3300049582 | Bacteria | 2956 |
| 691 | Ga0501048_0061257 | 3300049582 | Bacteria | 2665 |
| 692 | Ga0501048_0077249 | 3300049582 | Bacteria | 2350 |
| 693 | Ga0501048_0181303 | 3300049582 | Bacteria | 1493 |
| 694 | Ga0501048_0609227 | 3300049582 | Bacteria | 784 |
| 695 | Ga0501067_0028551 | 3300049583 | Bacteria | 3092 |
| 696 | Ga0501067_0146046 | 3300049583 | Bacteria | 1318 |
| 697 | Ga0501068_0002286 | 3300049584 | Bacteria | 10203 |
| 698 | Ga0501068_0003272 | 3300049584 | Bacteria | 8683 |
| 699 | Ga0501068_0020429 | 3300049584 | Bacteria | 3858 |
| 700 | Ga0501068_0050525 | 3300049584 | Bacteria | 2514 |
| 701 | Ga0501068_0190656 | 3300049584 | Bacteria | 1298 |
| 702 | Ga0501069_0022899 | 3300049585 | Bacteria | 3402 |
| 703 | Ga0501069_0032121 | 3300049585 | Bacteria | 2890 |
| 704 | Ga0501070_0139740 | 3300049586 | Bacteria | 2000 |
| 705 | Ga0501071_0000440 | 3300049587 | Bacteria | 20878 |
| 706 | Ga0501071_0012405 | 3300049587 | Bacteria | 5779 |
| 707 | Ga0501071_0027044 | 3300049587 | Bacteria | 4033 |
| 708 | Ga0501071_0028518 | 3300049587 | Bacteria | 3935 |
| 709 | Ga0501071_0035422 | 3300049587 | Bacteria | 3555 |
| 710 | Ga0501071_0040605 | 3300049587 | Bacteria | 3329 |
| 711 | Ga0501071_0043569 | 3300049587 | Bacteria | 3218 |
| 712 | Ga0501071_0073548 | 3300049587 | Bacteria | 2493 |
| 713 | Ga0501071_0109690 | 3300049587 | Bacteria | 2039 |
| 714 | Ga0501071_0163222 | 3300049587 | Bacteria | 1666 |
| 715 | Ga0501071_0172933 | 3300049587 | Bacteria | 1617 |
| 716 | Ga0501071_0196287 | 3300049587 | Bacteria | 1515 |
| 717 | Ga0501072_0006167 | 3300049588 | Bacteria | 9136 |
| 718 | Ga0501072_0033905 | 3300049588 | Bacteria | 4000 |
| 719 | Ga0501072_0085043 | 3300049588 | Bacteria | 2508 |
| 720 | Ga0501072_0135489 | 3300049588 | Bacteria | 1963 |
| 721 | Ga0501072_0170665 | 3300049588 | Bacteria | 1736 |
| 722 | Ga0501072_0185687 | 3300049588 | Bacteria | 1658 |
| 723 | Ga0501072_0318267 | 3300049588 | Bacteria | 1236 |
| 724 | Ga0501073_0079914 | 3300049589 | Bacteria | 2276 |
| 725 | Ga0501074_0078656 | 3300049590 | Bacteria | 2367 |
| 726 | Ga0501074_0079508 | 3300049590 | Bacteria | 2353 |
| 727 | Ga0501074_0099009 | 3300049590 | Bacteria | 2087 |
| 728 | Ga0501074_0132441 | 3300049590 | Bacteria | 1783 |
| 729 | Ga0501074_0206146 | 3300049590 | Bacteria | 1401 |
| 730 | Ga0501075_0013273 | 3300049591 | Bacteria | 5878 |
| 731 | Ga0501075_0015287 | 3300049591 | Bacteria | 5506 |
| 732 | Ga0501075_0023495 | 3300049591 | Bacteria | 4515 |
| 733 | Ga0501075_0029352 | 3300049591 | Bacteria | 4067 |
| 734 | Ga0501075_0030346 | 3300049591 | Bacteria | 4004 |
| 735 | Ga0501075_0046324 | 3300049591 | Bacteria | 3267 |
| 736 | Ga0501075_0061337 | 3300049591 | Bacteria | 2834 |
| 737 | Ga0501075_0062597 | 3300049591 | Bacteria | 2804 |
| 738 | Ga0501075_0146189 | 3300049591 | Bacteria | 1801 |
| 739 | Ga0501075_0311988 | 3300049591 | Bacteria | 1198 |
| 740 | Ga0501075_0379111 | 3300049591 | Bacteria | 1078 |
| 741 | Ga0501075_0556105 | 3300049591 | Bacteria | 876 |
| 742 | Ga0501076_0002090 | 3300049592 | Bacteria | 13694 |
| 743 | Ga0501076_0015330 | 3300049592 | Bacteria | 5790 |
| 744 | Ga0501076_0019824 | 3300049592 | Bacteria | 5144 |
| 745 | Ga0501076_0024242 | 3300049592 | Bacteria | 4687 |
| 746 | Ga0501076_0030848 | 3300049592 | Bacteria | 4177 |
| 747 | Ga0501076_0044961 | 3300049592 | Bacteria | 3485 |
| 748 | Ga0501076_0046163 | 3300049592 | Bacteria | 3441 |
| 749 | Ga0501077_0004026 | 3300049593 | Bacteria | 8869 |
| 750 | Ga0501077_0013254 | 3300049593 | Bacteria | 5166 |
| 751 | Ga0501077_0013556 | 3300049593 | Bacteria | 5112 |
| 752 | Ga0501077_0018472 | 3300049593 | Bacteria | 4412 |
| 753 | Ga0501077_0062543 | 3300049593 | Bacteria | 2361 |
| 754 | Ga0501077_0136315 | 3300049593 | Bacteria | 1557 |
| 755 | Ga0501077_0206223 | 3300049593 | Bacteria | 1249 |
| 756 | Ga0501077_0248653 | 3300049593 | Bacteria | 1130 |
| 757 | Ga0501077_0250540 | 3300049593 | Bacteria | 1126 |
| 758 | Ga0501077_0437296 | 3300049593 | Bacteria | 837 |
| 759 | Ga0501079_0001833 | 3300049741 | Bacteria | 15213 |
| 760 | Ga0501079_0006284 | 3300049741 | Bacteria | 8910 |
| 761 | Ga0501079_0021766 | 3300049741 | Bacteria | 4908 |
| 762 | Ga0501079_0036046 | 3300049741 | Bacteria | 3809 |
| 763 | Ga0501079_0043832 | 3300049741 | Bacteria | 3453 |
| 764 | Ga0501079_0045605 | 3300049741 | Bacteria | 3383 |
| 765 | Ga0501079_0092036 | 3300049741 | Bacteria | 2349 |
| 766 | Ga0501079_0136994 | 3300049741 | Bacteria | 1906 |
| 767 | Ga0501079_0174165 | 3300049741 | Bacteria | 1678 |
| 768 | Ga0501079_0251066 | 3300049741 | Bacteria | 1382 |
| 769 | Ga0501080_0031223 | 3300049742 | Bacteria | 4964 |
| 770 | Ga0501080_0065643 | 3300049742 | Bacteria | 3376 |
| 771 | Ga0501080_0086481 | 3300049742 | Bacteria | 2913 |
| 772 | Ga0501080_0134586 | 3300049742 | Bacteria | 2288 |
| 773 | Ga0501080_0277874 | 3300049742 | Bacteria | 1523 |
| 774 | Ga0501081_0010332 | 3300049743 | Bacteria | 6092 |
| 775 | Ga0501081_0012943 | 3300049743 | Bacteria | 5488 |
| 776 | Ga0501081_0031210 | 3300049743 | Bacteria | 3611 |
| 777 | Ga0501081_0034347 | 3300049743 | Bacteria | 3450 |
| 778 | Ga0501081_0043384 | 3300049743 | Bacteria | 3085 |
| 779 | Ga0501081_0074859 | 3300049743 | Bacteria | 2363 |
| 780 | Ga0501081_0082780 | 3300049743 | Bacteria | 2249 |
| 781 | Ga0501081_0161732 | 3300049743 | Bacteria | 1613 |
| 782 | Ga0501081_0287720 | 3300049743 | Bacteria | 1204 |
| 783 | Ga0501081_0415474 | 3300049743 | Bacteria | 997 |
| 784 | Ga0501083_0002757 | 3300049744 | Bacteria | 12138 |
| 785 | Ga0501083_0005947 | 3300049744 | Bacteria | 8637 |
| 786 | Ga0501083_0087451 | 3300049744 | Bacteria | 2061 |
| 787 | Ga0501083_0293921 | 3300049744 | Bacteria | 1057 |
| 788 | Ga0501035_0009927 | 3300049822 | Bacteria | 8841 |
| 789 | Ga0501035_0057977 | 3300049822 | Bacteria | 3452 |
| 790 | Ga0501035_0081547 | 3300049822 | Bacteria | 2855 |
| 791 | Ga0501035_0308848 | 3300049822 | Bacteria | 1331 |
| 792 | Ga0501035_0668371 | 3300049822 | Bacteria | 841 |
| 793 | Ga0501044_0187980 | 3300049823 | Bacteria | 2029 |
| 794 | Ga0501044_0819541 | 3300049823 | Bacteria | 809 |
| 795 | Ga0501045_0004358 | 3300049824 | Bacteria | 9754 |
| 796 | Ga0501045_0011798 | 3300049824 | Bacteria | 6139 |
| 797 | Ga0501045_0015782 | 3300049824 | Bacteria | 5357 |
| 798 | Ga0501045_0020852 | 3300049824 | Bacteria | 4684 |
| 799 | Ga0501045_0021538 | 3300049824 | Bacteria | 4612 |
| 800 | Ga0501045_0045019 | 3300049824 | Bacteria | 3213 |
| 801 | Ga0501045_0056328 | 3300049824 | Bacteria | 2875 |
| 802 | Ga0501045_0057478 | 3300049824 | Bacteria | 2846 |
| 803 | Ga0501045_0060381 | 3300049824 | Bacteria | 2779 |
| 804 | Ga0501045_0166828 | 3300049824 | Bacteria | 1640 |
| 805 | Ga0501045_0201797 | 3300049824 | Bacteria | 1482 |
| 806 | Ga0501045_0242820 | 3300049824 | Bacteria | 1341 |
| 807 | nmdc:mga03n38_26828_c1 | 3300050490 | Bacteria | 2383 |
| 808 | nmdc:mga00v17_37540_c1 | 3300050491 | Bacteria | 2894 |
| 809 | nmdc:mga00v17_88207_c1 | 3300050491 | Bacteria | 1945 |
| 810 | nmdc:mga0yw44_99777_c1 | 3300050492 | Bacteria | 1848 |
| 811 | nmdc:mga06z11_169126_c1 | 3300050494 | Bacteria | 1254 |
| 812 | nmdc:mga05p37_169956_c1 | 3300050507 | Bacteria | 2659 |
| 813 | nmdc:mga05p37_33330_c1 | 3300050507 | Bacteria | 6309 |
| 814 | nmdc:mga05p37_388934_c1 | 3300050507 | Bacteria | 1632 |
| 815 | nmdc:mga05p37_41889_c2 | 3300050507 | Bacteria | 5226 |
| 816 | nmdc:mga05p37_6690_c1 | 3300050507 | Bacteria | 13589 |
| 817 | nmdc:mga05p37_773513_c1 | 3300050507 | Bacteria | 1055 |
| 818 | nmdc:mga09592_12067_c2 | 3300050508 | Bacteria | 4245 |
| 819 | nmdc:mga09592_21195_c1 | 3300050508 | Bacteria | 5355 |
| 820 | nmdc:mga09592_476842_c1 | 3300050508 | Bacteria | 1075 |
| 821 | nmdc:mga0qj67_242271_c1 | 3300050509 | Bacteria | 1463 |
| 822 | nmdc:mga06r32_15391_c1 | 3300050510 | Bacteria | 6947 |
| 823 | nmdc:mga06r32_59634_c1 | 3300050510 | Bacteria | 3671 |
| 824 | nmdc:mga08y16_111124_c1 | 3300050511 | Bacteria | 2853 |
| 825 | nmdc:mga08y16_158793_c1 | 3300050511 | Bacteria | 2349 |
| 826 | nmdc:mga08y16_339579_c1 | 3300050511 | Bacteria | 1544 |
| 827 | nmdc:mga08y16_384573_c1 | 3300050511 | Bacteria | 1438 |
| 828 | nmdc:mga08y16_61496_c1 | 3300050511 | Bacteria | 3922 |
| 829 | nmdc:mga08y16_6856_c1 | 3300050511 | Bacteria | 11945 |
| 830 | nmdc:mga0n895_213932_c1 | 3300050512 | Bacteria | 1957 |
| 831 | nmdc:mga0a205_241084_c1 | 3300050515 | Bacteria | 1689 |
| 832 | nmdc:mga0a205_30665_c1 | 3300050515 | Bacteria | 5150 |
| 833 | Ga0495601_0009699 | 3300053077 | Bacteria | 5697 |
| 834 | Ga0495601_0162575 | 3300053077 | Bacteria | 1459 |
| 835 | Ga0495595_0022879 | 3300053084 | Bacteria | 2747 |
| 836 | Ga0495619_0017547 | 3300053085 | Bacteria | 4533 |
| 837 | Ga0495619_0105643 | 3300053085 | Bacteria | 1920 |
| 838 | Ga0495619_0371947 | 3300053085 | Bacteria | 988 |
| 839 | Ga0495619_0537704 | 3300053085 | Bacteria | 802 |
| 840 | Ga0500644_0000890 | 3300053088 | Bacteria | 9668 |
| 841 | Ga0500660_028987 | 3300053100 | Bacteria | 2900 |
| 842 | Ga0500553_124654 | 3300053101 | Bacteria | 1053 |
| 843 | Ga0500573_0031492 | 3300053140 | Bacteria | 3061 |
| 844 | Ga0500573_0094408 | 3300053140 | Bacteria | 1687 |
| 845 | Ga0500577_0000132 | 3300053142 | Bacteria | 17972 |
| 846 | Ga0500603_008960 | 3300053150 | Bacteria | 2233 |
| 847 | Ga0501084_0007689 | 3300054114 | Bacteria | 8881 |
| 848 | Ga0501084_0033227 | 3300054114 | Bacteria | 4315 |
| 849 | Ga0501084_0044995 | 3300054114 | Bacteria | 3696 |
| 850 | Ga0501084_0063995 | 3300054114 | Bacteria | 3079 |
| 851 | Ga0501084_0100590 | 3300054114 | Bacteria | 2427 |
| 852 | Ga0501084_0102441 | 3300054114 | Bacteria | 2404 |
| 853 | Ga0501084_0314773 | 3300054114 | Bacteria | 1322 |
| 854 | Ga0501084_0434350 | 3300054114 | Bacteria | 1110 |
| 855 | Ga0501084_0502475 | 3300054114 | Bacteria | 1025 |
| 856 | Ga0501084_0535133 | 3300054114 | Bacteria | 990 |
| 857 | Ga0501082_0002964 | 3300060353 | Bacteria | 14816 |
| 858 | Ga0501082_0009425 | 3300060353 | Bacteria | 8403 |
| 859 | Ga0501082_0009689 | 3300060353 | Bacteria | 8295 |
| 860 | Ga0501082_0145215 | 3300060353 | Bacteria | 2059 |
| 861 | Ga0466962_0021929 | 3300061719 | Bacteria | 3066 |
| 862 | Ga0530510_0001107 | 3300061734 | Bacteria | 17889 |
| 863 | Ga0530510_0003365 | 3300061734 | Bacteria | 11005 |
| 864 | Ga0530510_0006328 | 3300061734 | Bacteria | 8236 |
| 865 | Ga0530510_0006433 | 3300061734 | Bacteria | 8184 |
| 866 | Ga0530510_0008590 | 3300061734 | Bacteria | 7134 |
| 867 | Ga0530510_0051422 | 3300061734 | Bacteria | 2977 |
| 868 | Ga0530510_0065445 | 3300061734 | Bacteria | 2634 |
| 869 | Ga0530510_0077580 | 3300061734 | Bacteria | 2414 |
| 870 | Ga0530510_0091189 | 3300061734 | Bacteria | 2223 |
| 871 | Ga0530510_0109544 | 3300061734 | Bacteria | 2022 |
| 872 | Ga0530510_0147015 | 3300061734 | Bacteria | 1739 |
| 873 | Ga0530510_0472018 | 3300061734 | Bacteria | 950 |
| 874 | 2644627512 | 2643221714 | Bacteria | 9015452 |
| 875 | 2645725346 | 2643221962 | Bacteria | 3874254 |
| 876 | 2812479984 | 2811994917 | Bacteria | 7761064 |
| 877 | 2862284097 | 2862281513 | Bacteria | 9621493 |
| 878 | 2862507750 | 2862507626 | Bacteria | 9425308 |
| 879 | 2862581866 | 2862574272 | Bacteria | 10567477 |
| 880 | 2877677019 | 2877676314 | Bacteria | 9512378 |
| 881 | 2912719111 | 2912715099 | Bacteria | 9460473 |
| 882 | 2946072674 | 2946072368 | Bacteria | 8999607 |
| 883 | 2947225172 | 2947224130 | Bacteria | 9938529 |
| 884 | 2954700772 | 2954691527 | Bacteria | 10720516 |
| 885 | 2954706575 | 2954701450 | Bacteria | 10834262 |
| 886 | 2954713360 | 2954711539 | Bacteria | 10867210 |
| 887 | 2954723321 | 2954721474 | Bacteria | 10456478 |
| 888 | 2954738507 | 2954731030 | Bacteria | 10243860 |
| 889 | 2954742227 | 2954740390 | Bacteria | 10229294 |
| 890 | 2954757366 | 2954749733 | Bacteria | 10366972 |
| 891 | 2990088747 | 2990088156 | Bacteria | 6657676 |
| 892 | 8008575221 | 8008574985 | Bacteria | 7815457 |
| 893 | Ga0466965_0075591 | |||
| 894 | 2214759121 | |||
| 895 | ARcpr5oldR_c000806 | |||
| 896 | ARSoilOldRDRAFT_c000445 | |||
| 897 | ARCol0yngRDRAFT_1000525 | |||
| 898 | JGI24738J21930_10031627 | |||
| 899 | JGI25406J46586_10086470 | |||
| 900 | JGI25407J50210_10021837 | |||
| 901 | Ga0070658_10074792 | |||
| 902 | Ga0070683_100123184 | |||
| 903 | Ga0070683_100135214 | |||
| 904 | Ga0070683_100662096 | |||
| 905 | Ga0070690_100080803 | |||
| 906 | Ga0070670_100092643 | |||
| 907 | Ga0068868_100186608 | |||
| 908 | Ga0068868_100288217 | |||
| 909 | Ga0068868_100522914 | |||
| 910 | Ga0070660_100001446 | |||
| 911 | Ga0070689_100065695 | |||
| 912 | Ga0070689_100463557 | |||
| 913 | Ga0070687_100037501 | |||
| 914 | Ga0070661_100066523 | |||
| 915 | Ga0070692_10003095 | |||
| 916 | Ga0070668_100332535 | |||
| 917 | Ga0070669_100067086 | |||
| 918 | Ga0070675_100007430 | |||
| 919 | Ga0070675_100090413 | |||
| 920 | Ga0070671_100160159 | |||
| 921 | Ga0070674_100155302 | |||
| 922 | Ga0070674_100166177 | |||
| 923 | Ga0070688_100084216 | |||
| 924 | Ga0070688_100138492 | |||
| 925 | Ga0070659_100015908 | |||
| 926 | Ga0070659_100025020 | |||
| 927 | Ga0070667_100016098 | |||
| 928 | Ga0070714_100002498 | |||
| 929 | Ga0070714_100016018 | |||
| 930 | Ga0070714_100191736 | |||
| 931 | Ga0070713_100050854 | |||
| 932 | Ga0070713_100385974 | |||
| 933 | Ga0070710_10205833 | |||
| 934 | Ga0070701_10088510 | |||
| 935 | Ga0070711_100210705 | |||
| 936 | Ga0070700_100076242 | |||
| 937 | Ga0070708_100033745 | |||
| 938 | Ga0070663_100006095 | |||
| 939 | Ga0070663_100253316 | |||
| 940 | Ga0070678_100001021 | |||
| 941 | Ga0070678_100005939 | |||
| 942 | Ga0070678_100232390 | |||
| 943 | Ga0068867_100108945 | |||
| 944 | Ga0068867_100161585 | |||
| 945 | Ga0068867_100273862 | |||
| 946 | Ga0070685_10113043 | |||
| 947 | Ga0070706_100157440 | |||
| 948 | Ga0070707_100002861 | |||
| 949 | Ga0070707_100122326 | |||
| 950 | Ga0070698_100081192 | |||
| 951 | Ga0070698_100202377 | |||
| 952 | Ga0070699_100575405 | |||
| 953 | Ga0070684_100009566 | |||
| 954 | Ga0070684_100195554 | |||
| 955 | Ga0068853_100010008 | |||
| 956 | Ga0068853_100095014 | |||
| 957 | Ga0070672_100103373 | |||
| 958 | Ga0070686_100060416 | |||
| 959 | Ga0070686_100152162 | |||
| 960 | Ga0070693_100078590 | |||
| 961 | Ga0070704_100080985 | |||
| 962 | Ga0070704_100287993 | |||
| 963 | Ga0068855_100631977 | |||
| 964 | Ga0068855_100648726 | |||
| 965 | Ga0070664_100007904 | |||
| 966 | Ga0068857_100016885 | |||
| 967 | Ga0068854_100015638 | |||
| 968 | Ga0068854_100683053 | |||
| 969 | Ga0068856_100245697 | |||
| 970 | Ga0068856_100471133 | |||
| 971 | Ga0070702_100002161 | |||
| 972 | Ga0070702_100010445 | |||
| 973 | Ga0070702_100182869 | |||
| 974 | Ga0070702_100512832 | |||
| 975 | Ga0068852_100004251 | |||
| 976 | Ga0068852_100313783 | |||
| 977 | Ga0068859_100211903 | |||
| 978 | Ga0068864_100055503 | |||
| 979 | Ga0068864_100276176 | |||
| 980 | Ga0068866_10130652 | |||
| 981 | Ga0068861_100126676 | |||
| 982 | Ga0068851_10104032 | |||
| 983 | Ga0068870_10009207 | |||
| 984 | Ga0068860_100207213 | |||
| 985 | Ga0081455_10042882 | |||
| 986 | Ga0081455_10065694 | |||
| 987 | Ga0081455_10111831 | |||
| 988 | Ga0081455_10248814 | |||
| 989 | Ga0081538_10000016 | |||
| 990 | Ga0081538_10000045 | |||
| 991 | Ga0081538_10000772 | |||
| 992 | Ga0081538_10014877 | |||
| 993 | Ga0081538_10076403 | |||
| 994 | Ga0081539_10000312 | |||
| 995 | Ga0081539_10009686 | |||
| 996 | Ga0070717_10045908 | |||
| 997 | Ga0075365_10010916 | |||
| 998 | Ga0075363_100037536 | |||
| 999 | Ga0075364_10058500 | |||
| 1000 | Ga0075364_10109646 | |||
| 1001 | Ga0075364_10309802 | |||
| 1002 | Ga0070712_100027964 | |||
| 1003 | Ga0097621_100137676 | |||
| 1004 | Ga0068871_100009009 | |||
| 1005 | Ga0075428_100007511 | |||
| 1006 | Ga0075428_100017583 | |||
| 1007 | Ga0075428_100031025 | |||
| 1008 | Ga0075430_100007562 | |||
| 1009 | Ga0075430_100101763 | |||
| 1010 | Ga0075431_100003203 | |||
| 1011 | Ga0075431_100169822 | |||
| 1012 | Ga0075433_10024185 | |||
| 1013 | Ga0075429_100046024 | |||
| 1014 | Ga0075429_100084082 | |||
| 1015 | Ga0068865_100015409 | |||
| 1016 | Ga0068865_100068289 | |||
| 1017 | Ga0068865_100324498 | |||
| 1018 | Ga0068865_100539843 | |||
| 1019 | Ga0097620_100211930 | |||
| 1020 | Ga0075435_100482487 | |||
| 1021 | Ga0105251_10051672 | |||
| 1022 | Ga0105240_10199966 | |||
| 1023 | Ga0105240_10261028 | |||
| 1024 | Ga0111539_10026454 | |||
| 1025 | Ga0111539_10122624 | |||
| 1026 | Ga0111539_10370698 | |||
| 1027 | Ga0111539_10481086 | |||
| 1028 | Ga0105245_10004890 | |||
| 1029 | Ga0105245_10033564 | |||
| 1030 | Ga0105245_10043291 | |||
| 1031 | Ga0105245_10055544 | |||
| 1032 | Ga0105245_10110312 | |||
| 1033 | Ga0105245_10239276 | |||
| 1034 | Ga0105245_10359459 | |||
| 1035 | Ga0105245_10368981 | |||
| 1036 | Ga0105245_10780324 | |||
| 1037 | Ga0114129_10025060 | |||
| 1038 | Ga0114129_10949323 | |||
| 1039 | Ga0105243_10008877 | |||
| 1040 | Ga0105243_10051955 | |||
| 1041 | Ga0105243_10251287 | |||
| 1042 | Ga0105243_10325123 | |||
| 1043 | Ga0105243_10409966 | |||
| 1044 | Ga0105241_10020035 | |||
| 1045 | Ga0105241_10263768 | |||
| 1046 | Ga0105242_10010764 | |||
| 1047 | Ga0105242_10222899 | |||
| 1048 | Ga0105242_10820728 | |||
| 1049 | Ga0105248_10071440 | |||
| 1050 | Ga0105248_10206175 | |||
| 1051 | Ga0105248_10263349 | |||
| 1052 | Ga0105237_10195199 | |||
| 1053 | Ga0105238_10538007 | |||
| 1054 | Ga0105238_10693333 | |||
| 1055 | Ga0105249_10217568 | |||
| 1056 | Ga0105249_10384070 | |||
| 1057 | Ga0105030_105558 | |||
| 1058 | Ga0105239_10036015 | |||
| 1059 | Ga0105239_10152325 | |||
| 1060 | Ga0105239_10382980 | |||
| 1061 | Ga0105246_10014361 | |||
| 1062 | Ga0105246_10049642 | |||
| 1063 | Ga0105246_10206397 | |||
| 1064 | Ga0105246_10376023 | |||
| 1065 | Ga0157373_10051743 | |||
| 1066 | Ga0157370_10123658 | |||
| 1067 | Ga0157369_10426646 | |||
| 1068 | Ga0157374_10040449 | |||
| 1069 | Ga0157374_10493677 | |||
| 1070 | Ga0157378_10007512 | |||
| 1071 | Ga0157378_10538881 | |||
| 1072 | Ga0163162_10732316 | |||
| 1073 | Ga0157372_10112456 | |||
| 1074 | Ga0157372_10201553 | |||
| 1075 | Ga0157372_10453029 | |||
| 1076 | Ga0157375_10097760 | |||
| 1077 | Ga0157375_10147195 | |||
| 1078 | Ga0157375_10519277 | |||
| 1079 | Ga0157375_10605658 | |||
| 1080 | Ga0163163_10001036 | |||
| 1081 | Ga0163163_10107818 | |||
| 1082 | Ga0163163_10142705 | |||
| 1083 | Ga0163163_10371994 | |||
| 1084 | Ga0157380_10099574 | |||
| 1085 | Ga0157377_10061633 | |||
| 1086 | Ga0157377_10274301 | |||
| 1087 | Ga0157379_10092341 | |||
| 1088 | Ga0157379_10642825 | |||
| 1089 | Ga0157376_10111221 | |||
| 1090 | Ga0183367_1001 | |||
| 1091 | Ga0206356_10654112 | |||
| 1092 | Ga0206349_1649731 | |||
| 1093 | Ga0206352_11228185 | |||
| 1094 | Ga0206350_10518077 | |||
| 1095 | Ga0206353_11815503 | |||
| 1096 | Ga0213876_10004279 | |||
| 1097 | Ga0213876_10044182 | |||
| 1098 | Ga0213875_10003748 | |||
| 1099 | Ga0213875_10015221 | |||
| 1100 | Ga0213875_10036301 | |||
| 1101 | Ga0224712_10082103 | |||
| 1102 | Ga0209758_1007421 | |||
| 1103 | Ga0207692_10197886 | |||
| 1104 | Ga0207642_10050540 | |||
| 1105 | Ga0207688_10012598 | |||
| 1106 | Ga0207688_10068970 | |||
| 1107 | Ga0207688_10076703 | |||
| 1108 | Ga0207688_10293606 | |||
| 1109 | Ga0207680_10421928 | |||
| 1110 | Ga0207647_10009567 | |||
| 1111 | Ga0207699_10231180 | |||
| 1112 | Ga0207643_10023281 | |||
| 1113 | Ga0207643_10047410 | |||
| 1114 | Ga0207705_10103788 | |||
| 1115 | Ga0207684_10159742 | |||
| 1116 | Ga0207654_10314357 | |||
| 1117 | Ga0207695_10330413 | |||
| 1118 | Ga0207695_10469610 | |||
| 1119 | Ga0207671_10066758 | |||
| 1120 | Ga0207693_10041694 | |||
| 1121 | Ga0207663_10096002 | |||
| 1122 | Ga0207663_10737529 | |||
| 1123 | Ga0207660_10026917 | |||
| 1124 | Ga0207657_10003182 | |||
| 1125 | Ga0207657_10005447 | |||
| 1126 | Ga0207649_10302611 | |||
| 1127 | Ga0207649_10412874 | |||
| 1128 | Ga0207652_10299952 | |||
| 1129 | Ga0207646_10031158 | |||
| 1130 | Ga0207646_10159063 | |||
| 1131 | Ga0207681_10103257 | |||
| 1132 | Ga0207694_10678431 | |||
| 1133 | Ga0207659_10025594 | |||
| 1134 | Ga0207659_10059037 | |||
| 1135 | Ga0207659_10067402 | |||
| 1136 | Ga0207687_10042898 | |||
| 1137 | Ga0207687_10048147 | |||
| 1138 | Ga0207687_10058801 | |||
| 1139 | Ga0207687_10147504 | |||
| 1140 | Ga0207687_10230135 | |||
| 1141 | Ga0207687_10454510 | |||
| 1142 | Ga0207700_10209649 | |||
| 1143 | Ga0207664_10000846 | |||
| 1144 | Ga0207664_10111852 | |||
| 1145 | Ga0207644_10047471 | |||
| 1146 | Ga0207690_10038745 | |||
| 1147 | Ga0207706_10003766 | |||
| 1148 | Ga0207706_10065509 | |||
| 1149 | Ga0207706_10099837 | |||
| 1150 | Ga0207706_10770546 | |||
| 1151 | Ga0207686_10064299 | |||
| 1152 | Ga0207686_10200601 | |||
| 1153 | Ga0207670_10075108 | |||
| 1154 | Ga0207670_10680204 | |||
| 1155 | Ga0207669_10124464 | |||
| 1156 | Ga0207669_10254547 | |||
| 1157 | Ga0207669_10363490 | |||
| 1158 | Ga0207704_10020135 | |||
| 1159 | Ga0207704_10359592 | |||
| 1160 | Ga0207704_10387989 | |||
| 1161 | Ga0207691_10016513 | |||
| 1162 | Ga0207691_10143380 | |||
| 1163 | Ga0207661_10029663 | |||
| 1164 | Ga0207661_10033086 | |||
| 1165 | Ga0207661_10092745 | |||
| 1166 | Ga0207661_10111964 | |||
| 1167 | Ga0207661_10419184 | |||
| 1168 | Ga0207679_10109146 | |||
| 1169 | Ga0207667_10514965 | |||
| 1170 | Ga0207651_10202980 | |||
| 1171 | Ga0207651_10586830 | |||
| 1172 | Ga0207668_10067654 | |||
| 1173 | Ga0207668_10604685 | |||
| 1174 | Ga0207640_10556192 | |||
| 1175 | Ga0207658_10023514 | |||
| 1176 | Ga0207677_10213663 | |||
| 1177 | Ga0207639_10029134 | |||
| 1178 | Ga0207678_10012169 | |||
| 1179 | Ga0207678_10114055 | |||
| 1180 | Ga0207708_10015432 | |||
| 1181 | Ga0207708_10094004 | |||
| 1182 | Ga0207702_10229227 | |||
| 1183 | Ga0207648_10019455 | |||
| 1184 | Ga0207648_10148422 | |||
| 1185 | Ga0207648_10299793 | |||
| 1186 | Ga0207676_10197000 | |||
| 1187 | Ga0207676_10296428 | |||
| 1188 | Ga0207676_10388780 | |||
| 1189 | Ga0207676_10404069 | |||
| 1190 | Ga0207674_10011005 | |||
| 1191 | Ga0207674_10555578 | |||
| 1192 | Ga0207675_100157370 | |||
| 1193 | Ga0207675_100163734 | |||
| 1194 | Ga0207683_10016752 | |||
| 1195 | Ga0207683_10019287 | |||
| 1196 | Ga0207683_10292315 | |||
| 1197 | Ga0207698_10013765 | |||
| 1198 | Ga0207428_10000378 | |||
| 1199 | Ga0207428_10166012 | |||
| 1200 | Ga0268266_10175911 | |||
| 1201 | Ga0268266_10961493 | |||
| 1202 | Ga0268265_10728437 | |||
| 1203 | Ga0268265_11103600 | |||
| 1204 | Ga0268264_10069177 | |||
| 1205 | Ga0265319_1000326 | |||
| 1206 | Ga0307517_10078409 | |||
| 1207 | Ga0316575_10149088 | |||
| 1208 | Ga0316579_10001209 | |||
| 1209 | Ga0316579_10162720 | |||
| 1210 | Ga0316576_10025391 | |||
| 1211 | Ga0307405_10006740 | |||
| 1212 | Ga0307413_10124069 | |||
| 1213 | Ga0307410_10044704 | |||
| 1214 | Ga0307406_10002597 | |||
| 1215 | Ga0307406_10022614 | |||
| 1216 | Ga0307406_10060580 | |||
| 1217 | Ga0307407_10075849 | |||
| 1218 | Ga0307407_10592598 | |||
| 1219 | Ga0307412_10319918 | |||
| 1220 | Ga0307409_100220634 | |||
| 1221 | Ga0307416_100000308 | |||
| 1222 | Ga0307415_100000038 | |||
| 1223 | Ga0307415_100012275 | |||
| 1224 | Ga0307415_100019174 | |||
| 1225 | Ga0307415_100023391 | |||
| 1226 | Ga0307415_100171113 | |||
| 1227 | Ga0373930_0000119 | |||
| 1228 | Ga0373928_0002586 | |||
| 1229 | Ga0373929_0001600 | |||
| 1230 | Ga0373934_0005878 | |||
| 1231 | Ga0373923_0119725 | |||
| 1232 | Ga0373936_0011466 | |||
| 1233 | Ga0373953_0111554 | |||
| 1234 | Ga0373954_0140343 | |||
| 1235 | Ga0373956_0096227 | |||
| 1236 | Ga0373957_0030952 | |||
| 1237 | Ga0373943_0067388 | |||
| 1238 | Ga0373955_0025435 | |||
| 1239 | Ga0316574_0002932 | |||
| 1240 | Ga0316574_0041770 | |||
| 1241 | Ga0316574_0156803 | |||
| 1242 | Ga0373924_0001176 | |||
| 1243 | Ga0373931_0000006 | |||
| 1244 | Ga0373933_0026513 | |||
| 1245 | Ga0373933_0035327 | |||
| 1246 | Ga0373937_0006018 | |||
| 1247 | Ga0373937_0032444 | |||
| 1248 | Ga0373937_0126180 | |||
| 1249 | Ga0373937_0157886 | |||
| 1250 | Ga0316582_0031634 | |||
| 1251 | Ga0316582_0073873 | |||
| 1252 | Ga0316584_0092116 | |||
| 1253 | Ga0395900_0154259 | |||
| 1254 | Ga0395900_0281232 | |||
| 1255 | Ga0395898_0007381 | |||
| 1256 | Ga0395898_0012160 | |||
| 1257 | Ga0395898_0068810 | |||
| 1258 | Ga0395898_0079832 | |||
| 1259 | Ga0395898_0247352 | |||
| 1260 | Ga0395898_0251375 | |||
| 1261 | Ga0316581_0058886 | |||
| 1262 | Ga0436364_0189902 | |||
| 1263 | Ga0436364_1225776 | |||
| 1264 | Ga0436364_1252068 | |||
| 1265 | Ga0395901_0535466 | |||
| 1266 | Ga0395901_0642641 | |||
| 1267 | Ga0400483_000720 | |||
| 1268 | Ga0400483_292200 | |||
| 1269 | Ga0436365_1020474 | |||
| 1270 | Ga0436365_1436221 | |||
| 1271 | Ga0436360_0621662 | |||
| 1272 | Ga0436361_0056987 | |||
| 1273 | Ga0436362_0825065 | |||
| 1274 | Ga0439439_0005362 | |||
| 1275 | Ga0451807_0002334 | |||
| 1276 | Ga0451853_2841797 | |||
| 1277 | Ga0439431_0070673 | |||
| 1278 | Ga0439433_0007379 | |||
| 1279 | Ga0439448_0033157 | |||
| 1280 | Ga0439449_0008227 | |||
| 1281 | Ga0439456_041905 | |||
| 1282 | Ga0439457_003305 | |||
| 1283 | Ga0439462_0054515 | |||
| 1284 | Ga0450898_015809 | |||
| 1285 | Ga0450907_006129 | |||
| 1286 | Ga0439434_0015506 | |||
| 1287 | Ga0466972_0110924 | |||
| 1288 | Ga0466965_0014222 | |||
| 1289 | Ga0466966_0021836 | |||
| 1290 | Ga0466961_0044375 | |||
| 1291 | Ga0466961_0460155 | |||
| 1292 | Ga0466963_0037991 | |||
| 1293 | Ga0466963_0128489 | |||
| 1294 | Ga0466971_0010374 | |||
| 1295 | Ga0466968_0001443 | |||
| 1296 | Ga0466970_0006723 | |||
| 1297 | Ga0466957_0026048 | |||
| 1298 | Ga0466957_0039212 | |||
| 1299 | Ga0466959_0042100 | |||
| 1300 | Ga0451576_0648850 | |||
| 1301 | Ga0466958_0008836 | |||
| 1302 | Ga0466958_0025262 | |||
| 1303 | Ga0466958_0038805 | |||
| 1304 | Ga0466958_0185368 | |||
| 1305 | Ga0466967_0003982 | |||
| 1306 | Ga0466967_0042552 | |||
| 1307 | Ga0495617_001801 | |||
| 1308 | Ga0495592_0058817 | |||
| 1309 | Ga0495592_0243030 | |||
| 1310 | Ga0495603_0004204 | |||
| 1311 | Ga0495603_0005639 | |||
| 1312 | Ga0495603_0036031 | |||
| 1313 | Ga0495603_0074981 | |||
| 1314 | Ga0495629_0020306 | |||
| 1315 | Ga0495629_0146484 | |||
| 1316 | Ga0495629_0160288 | |||
| 1317 | Ga0495629_0442409 | |||
| 1318 | Ga0495638_0110828 | |||
| 1319 | Ga0495641_0065102 | |||
| 1320 | Ga0495641_0116680 | |||
| 1321 | Ga0495651_0016835 | |||
| 1322 | Ga0495651_0032936 | |||
| 1323 | Ga0495651_0054706 | |||
| 1324 | Ga0495651_0088779 | |||
| 1325 | Ga0495651_0091723 | |||
| 1326 | Ga0495653_0237843 | |||
| 1327 | Ga0495650_0000070 | |||
| 1328 | Ga0495582_0103963 | |||
| 1329 | Ga0495582_0319256 | |||
| 1330 | Ga0495605_0070939 | |||
| 1331 | Ga0495662_0002361 | |||
| 1332 | Ga0495662_0003915 | |||
| 1333 | Ga0495662_0056462 | |||
| 1334 | Ga0495664_0002529 | |||
| 1335 | Ga0495664_0031887 | |||
| 1336 | Ga0495664_0059468 | |||
| 1337 | Ga0495664_0258619 | |||
| 1338 | Ga0495585_0011581 | |||
| 1339 | Ga0495594_0000733 | |||
| 1340 | Ga0495594_0020429 | |||
| 1341 | Ga0495594_0029210 | |||
| 1342 | Ga0495594_0159699 | |||
| 1343 | Ga0495596_0133790 | |||
| 1344 | Ga0495607_0276367 | |||
| 1345 | Ga0495583_0051275 | |||
| 1346 | Ga0495606_0004995 | |||
| 1347 | Ga0495608_0032894 | |||
| 1348 | Ga0495608_0033084 | |||
| 1349 | Ga0495608_0093926 | |||
| 1350 | Ga0495610_0068179 | |||
| 1351 | Ga0495616_0006053 | |||
| 1352 | Ga0495618_0023331 | |||
| 1353 | Ga0495618_0089145 | |||
| 1354 | Ga0495618_0191814 | |||
| 1355 | Ga0495618_0330779 | |||
| 1356 | Ga0495620_0003848 | |||
| 1357 | Ga0495620_0006185 | |||
| 1358 | Ga0495628_0144078 | |||
| 1359 | Ga0495628_0207234 | |||
| 1360 | Ga0495630_0028122 | |||
| 1361 | Ga0495630_0030189 | |||
| 1362 | Ga0495630_0082912 | |||
| 1363 | Ga0495630_0106597 | |||
| 1364 | Ga0495631_0004966 | |||
| 1365 | Ga0495643_0002317 | |||
| 1366 | Ga0495648_0086331 | |||
| 1367 | Ga0495642_0052413 | |||
| 1368 | Ga0495652_0149525 | |||
| 1369 | Ga0495652_0215188 | |||
| 1370 | Ga0495640_0000413 | |||
| 1371 | Ga0495640_0009438 | |||
| 1372 | Ga0495640_0019929 | |||
| 1373 | Ga0495640_0050627 | |||
| 1374 | Ga0495587_0029690 | |||
| 1375 | Ga0495609_0200639 | |||
| 1376 | Ga0495645_0034152 | |||
| 1377 | Ga0495622_0001692 | |||
| 1378 | Ga0495622_0034464 | |||
| 1379 | Ga0495667_0099742 | |||
| 1380 | Ga0495667_0179425 | |||
| 1381 | Ga0495667_0239290 | |||
| 1382 | Ga0495656_0076601 | |||
| 1383 | Ga0495634_0009612 | |||
| 1384 | Ga0495611_0009878 | |||
| 1385 | Ga0495611_0034602 | |||
| 1386 | Ga0495611_0046955 | |||
| 1387 | Ga0495611_0177455 | |||
| 1388 | Ga0495625_0081836 | |||
| 1389 | Ga0495625_0181089 | |||
| 1390 | Ga0495625_0181835 | |||
| 1391 | Ga0495635_0012015 | |||
| 1392 | Ga0495635_0031578 | |||
| 1393 | Ga0495635_0082562 | |||
| 1394 | Ga0495661_0168577 | |||
| 1395 | Ga0495657_0003221 | |||
| 1396 | Ga0495657_0031324 | |||
| 1397 | Ga0495657_0088311 | |||
| 1398 | Ga0495657_0216200 | |||
| 1399 | Ga0495599_0009684 | |||
| 1400 | Ga0495599_0047502 | |||
| 1401 | Ga0495623_0029311 | |||
| 1402 | Ga0495623_0173066 | |||
| 1403 | Ga0495623_0190665 | |||
| 1404 | Ga0495646_0082561 | |||
| 1405 | Ga0495646_0087191 | |||
| 1406 | Ga0495658_0061774 | |||
| 1407 | Ga0495669_0024146 | |||
| 1408 | Ga0495613_0002875 | |||
| 1409 | Ga0495613_0007447 | |||
| 1410 | Ga0495613_0031667 | |||
| 1411 | Ga0495613_0039288 | |||
| 1412 | Ga0495613_0044322 | |||
| 1413 | Ga0495624_0020464 | |||
| 1414 | Ga0495624_0032186 | |||
| 1415 | Ga0495624_0063263 | |||
| 1416 | Ga0495624_0110145 | |||
| 1417 | Ga0495624_0122839 | |||
| 1418 | Ga0495649_0071314 | |||
| 1419 | Ga0495589_0046520 | |||
| 1420 | Ga0495600_0053329 | |||
| 1421 | Ga0495600_0054145 | |||
| 1422 | Ga0495600_0089381 | |||
| 1423 | Ga0495600_0274446 | |||
| 1424 | Ga0495660_0072047 | |||
| 1425 | Ga0495581_0015110 | |||
| 1426 | Ga0495581_0047589 | |||
| 1427 | Ga0495581_0268211 | |||
| 1428 | Ga0495604_0033755 | |||
| 1429 | Ga0495604_0253589 | |||
| 1430 | Ga0495604_0259529 | |||
| 1431 | Ga0495674_0089987 | |||
| 1432 | Ga0495674_0273519 | |||
| 1433 | Ga0495674_0295219 | |||
| 1434 | Ga0495672_0105472 | |||
| 1435 | Ga0495676_0001241 | |||
| 1436 | Ga0495676_0001466 | |||
| 1437 | Ga0495676_0004211 | |||
| 1438 | Ga0495676_0016048 | |||
| 1439 | Ga0495676_0017507 | |||
| 1440 | Ga0495676_0023553 | |||
| 1441 | Ga0495676_0028092 | |||
| 1442 | Ga0495676_0054145 | |||
| 1443 | Ga0495680_0023855 | |||
| 1444 | Ga0495680_0034479 | |||
| 1445 | Ga0495680_0062211 | |||
| 1446 | Ga0495680_0177771 | |||
| 1447 | Ga0495683_0001785 | |||
| 1448 | Ga0495683_0063763 | |||
| 1449 | Ga0495687_005851 | |||
| 1450 | Ga0495687_009911 | |||
| 1451 | Ga0495675_0020923 | |||
| 1452 | Ga0495675_0025319 | |||
| 1453 | Ga0495675_0085686 | |||
| 1454 | Ga0495685_004119 | |||
| 1455 | Ga0495685_014455 | |||
| 1456 | Ga0495684_0296387 | |||
| 1457 | Ga0495686_0036002 | |||
| 1458 | Ga0495593_0032815 | |||
| 1459 | Ga0495602_0175623 | |||
| 1460 | Ga0495602_0294683 | |||
| 1461 | Ga0495602_0435880 | |||
| 1462 | Ga0495614_0000150 | |||
| 1463 | Ga0495614_0017959 | |||
| 1464 | Ga0495614_0026847 | |||
| 1465 | Ga0496100_0159094 | |||
| 1466 | Ga0496100_0300557 | |||
| 1467 | Ga0496101_0046359 | |||
| 1468 | Ga0496101_0061446 | |||
| 1469 | Ga0496101_0153307 | |||
| 1470 | Ga0496101_0176165 | |||
| 1471 | Ga0496102_0189612 | |||
| 1472 | Ga0496102_0189857 | |||
| 1473 | Ga0496104_0008056 | |||
| 1474 | Ga0496104_0053839 | |||
| 1475 | Ga0496104_0085387 | |||
| 1476 | Ga0496104_0150774 | |||
| 1477 | Ga0496104_0544782 | |||
| 1478 | Ga0496105_0010973 | |||
| 1479 | Ga0496105_0160964 | |||
| 1480 | Ga0496105_0162133 | |||
| 1481 | Ga0496105_0237200 | |||
| 1482 | Ga0496106_0009320 | |||
| 1483 | Ga0496106_0198799 | |||
| 1484 | Ga0496107_0089416 | |||
| 1485 | Ga0496107_0144767 | |||
| 1486 | Ga0496107_0176118 | |||
| 1487 | Ga0496107_0296084 | |||
| 1488 | Ga0496108_0000293 | |||
| 1489 | Ga0496108_0060060 | |||
| 1490 | Ga0496108_0086557 | |||
| 1491 | Ga0496108_0183777 | |||
| 1492 | Ga0496108_0223186 | |||
| 1493 | Ga0496108_0311837 | |||
| 1494 | Ga0496108_0464645 | |||
| 1495 | Ga0496108_0646839 | |||
| 1496 | Ga0496109_0007197 | |||
| 1497 | Ga0496109_0012611 | |||
| 1498 | Ga0496109_0121353 | |||
| 1499 | Ga0496109_0172221 | |||
| 1500 | Ga0496109_0275571 | |||
| 1501 | Ga0496110_0000880 | |||
| 1502 | Ga0496110_0033172 | |||
| 1503 | Ga0496110_0071337 | |||
| 1504 | Ga0496110_0153221 | |||
| 1505 | Ga0496110_0452619 | |||
| 1506 | Ga0496111_0005024 | |||
| 1507 | Ga0496111_0043114 | |||
| 1508 | Ga0496111_0104488 | |||
| 1509 | Ga0496111_0163107 | |||
| 1510 | Ga0496111_0631726 | |||
| 1511 | Ga0496112_0011598 | |||
| 1512 | Ga0496112_0016781 | |||
| 1513 | Ga0496112_0051890 | |||
| 1514 | Ga0496112_0175717 | |||
| 1515 | Ga0496112_0217858 | |||
| 1516 | Ga0496112_0366669 | |||
| 1517 | Ga0496113_0010588 | |||
| 1518 | Ga0496113_0057206 | |||
| 1519 | Ga0496113_0073771 | |||
| 1520 | Ga0496114_0075013 | |||
| 1521 | Ga0496114_0196333 | |||
| 1522 | Ga0496114_0203748 | |||
| 1523 | Ga0496115_0040943 | |||
| 1524 | Ga0496115_0107713 | |||
| 1525 | Ga0496126_0098323 | |||
| 1526 | Ga0501031_0009266 | |||
| 1527 | Ga0501031_0025633 | |||
| 1528 | Ga0501031_0026270 | |||
| 1529 | Ga0501031_0056338 | |||
| 1530 | Ga0501031_0066662 | |||
| 1531 | Ga0501031_0125631 | |||
| 1532 | Ga0501032_0013085 | |||
| 1533 | Ga0501032_0118468 | |||
| 1534 | Ga0501032_0182899 | |||
| 1535 | Ga0501033_0056501 | |||
| 1536 | Ga0501033_0096607 | |||
| 1537 | Ga0501033_0106603 | |||
| 1538 | Ga0501033_0172139 | |||
| 1539 | Ga0501033_0185551 | |||
| 1540 | Ga0501033_0192366 | |||
| 1541 | Ga0501034_0239307 | |||
| 1542 | Ga0501036_0002610 | |||
| 1543 | Ga0501036_0008942 | |||
| 1544 | Ga0501036_0029691 | |||
| 1545 | Ga0501036_0107440 | |||
| 1546 | Ga0501036_0455888 | |||
| 1547 | Ga0501036_0633269 | |||
| 1548 | Ga0501038_0105709 | |||
| 1549 | Ga0501038_0138322 | |||
| 1550 | Ga0501038_0180224 | |||
| 1551 | Ga0501038_0182507 | |||
| 1552 | Ga0501038_0289607 | |||
| 1553 | Ga0501039_0008346 | |||
| 1554 | Ga0501039_0035199 | |||
| 1555 | Ga0501039_0073643 | |||
| 1556 | Ga0501039_0086822 | |||
| 1557 | Ga0501039_0324257 | |||
| 1558 | Ga0501040_0005156 | |||
| 1559 | Ga0501040_0010091 | |||
| 1560 | Ga0501040_0023408 | |||
| 1561 | Ga0501040_0031075 | |||
| 1562 | Ga0501040_0034400 | |||
| 1563 | Ga0501040_0221101 | |||
| 1564 | Ga0501041_0003103 | |||
| 1565 | Ga0501041_0010713 | |||
| 1566 | Ga0501041_0016548 | |||
| 1567 | Ga0501041_0070112 | |||
| 1568 | Ga0501041_0077392 | |||
| 1569 | Ga0501041_0088864 | |||
| 1570 | Ga0501041_0100456 | |||
| 1571 | Ga0501041_0104833 | |||
| 1572 | Ga0501041_0206045 | |||
| 1573 | Ga0501042_0022548 | |||
| 1574 | Ga0501042_0046084 | |||
| 1575 | Ga0501042_0130333 | |||
| 1576 | Ga0501042_0162337 | |||
| 1577 | Ga0501042_0167213 | |||
| 1578 | Ga0501042_0167352 | |||
| 1579 | Ga0501043_0240013 | |||
| 1580 | Ga0501046_0230401 | |||
| 1581 | Ga0501048_0047290 | |||
| 1582 | Ga0501048_0050692 | |||
| 1583 | Ga0501048_0061257 | |||
| 1584 | Ga0501048_0077249 | |||
| 1585 | Ga0501048_0181303 | |||
| 1586 | Ga0501048_0609227 | |||
| 1587 | Ga0501067_0028551 | |||
| 1588 | Ga0501067_0146046 | |||
| 1589 | Ga0501068_0002286 | |||
| 1590 | Ga0501068_0003272 | |||
| 1591 | Ga0501068_0020429 | |||
| 1592 | Ga0501068_0050525 | |||
| 1593 | Ga0501068_0190656 | |||
| 1594 | Ga0501069_0022899 | |||
| 1595 | Ga0501069_0032121 | |||
| 1596 | Ga0501070_0139740 | |||
| 1597 | Ga0501071_0000440 | |||
| 1598 | Ga0501071_0012405 | |||
| 1599 | Ga0501071_0027044 | |||
| 1600 | Ga0501071_0028518 | |||
| 1601 | Ga0501071_0035422 | |||
| 1602 | Ga0501071_0040605 | |||
| 1603 | Ga0501071_0043569 | |||
| 1604 | Ga0501071_0073548 | |||
| 1605 | Ga0501071_0109690 | |||
| 1606 | Ga0501071_0163222 | |||
| 1607 | Ga0501071_0172933 | |||
| 1608 | Ga0501071_0196287 | |||
| 1609 | Ga0501072_0006167 | |||
| 1610 | Ga0501072_0033905 | |||
| 1611 | Ga0501072_0085043 | |||
| 1612 | Ga0501072_0135489 | |||
| 1613 | Ga0501072_0170665 | |||
| 1614 | Ga0501072_0185687 | |||
| 1615 | Ga0501072_0318267 | |||
| 1616 | Ga0501073_0079914 | |||
| 1617 | Ga0501074_0078656 | |||
| 1618 | Ga0501074_0079508 | |||
| 1619 | Ga0501074_0099009 | |||
| 1620 | Ga0501074_0132441 | |||
| 1621 | Ga0501074_0206146 | |||
| 1622 | Ga0501075_0013273 | |||
| 1623 | Ga0501075_0015287 | |||
| 1624 | Ga0501075_0023495 | |||
| 1625 | Ga0501075_0029352 | |||
| 1626 | Ga0501075_0030346 | |||
| 1627 | Ga0501075_0046324 | |||
| 1628 | Ga0501075_0061337 | |||
| 1629 | Ga0501075_0062597 | |||
| 1630 | Ga0501075_0146189 | |||
| 1631 | Ga0501075_0311988 | |||
| 1632 | Ga0501075_0379111 | |||
| 1633 | Ga0501075_0556105 | |||
| 1634 | Ga0501076_0002090 | |||
| 1635 | Ga0501076_0015330 | |||
| 1636 | Ga0501076_0019824 | |||
| 1637 | Ga0501076_0024242 | |||
| 1638 | Ga0501076_0030848 | |||
| 1639 | Ga0501076_0044961 | |||
| 1640 | Ga0501076_0046163 | |||
| 1641 | Ga0501077_0004026 | |||
| 1642 | Ga0501077_0013254 | |||
| 1643 | Ga0501077_0013556 | |||
| 1644 | Ga0501077_0018472 | |||
| 1645 | Ga0501077_0062543 | |||
| 1646 | Ga0501077_0136315 | |||
| 1647 | Ga0501077_0206223 | |||
| 1648 | Ga0501077_0248653 | |||
| 1649 | Ga0501077_0250540 | |||
| 1650 | Ga0501077_0437296 | |||
| 1651 | Ga0501079_0001833 | |||
| 1652 | Ga0501079_0006284 | |||
| 1653 | Ga0501079_0021766 | |||
| 1654 | Ga0501079_0036046 | |||
| 1655 | Ga0501079_0043832 | |||
| 1656 | Ga0501079_0045605 | |||
| 1657 | Ga0501079_0092036 | |||
| 1658 | Ga0501079_0136994 | |||
| 1659 | Ga0501079_0174165 | |||
| 1660 | Ga0501079_0251066 | |||
| 1661 | Ga0501080_0031223 | |||
| 1662 | Ga0501080_0065643 | |||
| 1663 | Ga0501080_0086481 | |||
| 1664 | Ga0501080_0134586 | |||
| 1665 | Ga0501080_0277874 | |||
| 1666 | Ga0501081_0010332 | |||
| 1667 | Ga0501081_0012943 | |||
| 1668 | Ga0501081_0031210 | |||
| 1669 | Ga0501081_0034347 | |||
| 1670 | Ga0501081_0043384 | |||
| 1671 | Ga0501081_0074859 | |||
| 1672 | Ga0501081_0082780 | |||
| 1673 | Ga0501081_0161732 | |||
| 1674 | Ga0501081_0287720 | |||
| 1675 | Ga0501081_0415474 | |||
| 1676 | Ga0501083_0002757 | |||
| 1677 | Ga0501083_0005947 | |||
| 1678 | Ga0501083_0087451 | |||
| 1679 | Ga0501083_0293921 | |||
| 1680 | Ga0501035_0009927 | |||
| 1681 | Ga0501035_0057977 | |||
| 1682 | Ga0501035_0081547 | |||
| 1683 | Ga0501035_0308848 | |||
| 1684 | Ga0501035_0668371 | |||
| 1685 | Ga0501044_0187980 | |||
| 1686 | Ga0501044_0819541 | |||
| 1687 | Ga0501045_0004358 | |||
| 1688 | Ga0501045_0011798 | |||
| 1689 | Ga0501045_0015782 | |||
| 1690 | Ga0501045_0020852 | |||
| 1691 | Ga0501045_0021538 | |||
| 1692 | Ga0501045_0045019 | |||
| 1693 | Ga0501045_0056328 | |||
| 1694 | Ga0501045_0057478 | |||
| 1695 | Ga0501045_0060381 | |||
| 1696 | Ga0501045_0166828 | |||
| 1697 | Ga0501045_0201797 | |||
| 1698 | Ga0501045_0242820 | |||
| 1699 | nmdc:mga03n38_26828_c1 | |||
| 1700 | nmdc:mga00v17_37540_c1 | |||
| 1701 | nmdc:mga00v17_88207_c1 | |||
| 1702 | nmdc:mga0yw44_99777_c1 | |||
| 1703 | nmdc:mga06z11_169126_c1 | |||
| 1704 | nmdc:mga05p37_169956_c1 | |||
| 1705 | nmdc:mga05p37_33330_c1 | |||
| 1706 | nmdc:mga05p37_388934_c1 | |||
| 1707 | nmdc:mga05p37_41889_c2 | |||
| 1708 | nmdc:mga05p37_6690_c1 | |||
| 1709 | nmdc:mga05p37_773513_c1 | |||
| 1710 | nmdc:mga09592_12067_c2 | |||
| 1711 | nmdc:mga09592_21195_c1 | |||
| 1712 | nmdc:mga09592_476842_c1 | |||
| 1713 | nmdc:mga0qj67_242271_c1 | |||
| 1714 | nmdc:mga06r32_15391_c1 | |||
| 1715 | nmdc:mga06r32_59634_c1 | |||
| 1716 | nmdc:mga08y16_111124_c1 | |||
| 1717 | nmdc:mga08y16_158793_c1 | |||
| 1718 | nmdc:mga08y16_339579_c1 | |||
| 1719 | nmdc:mga08y16_384573_c1 | |||
| 1720 | nmdc:mga08y16_61496_c1 | |||
| 1721 | nmdc:mga08y16_6856_c1 | |||
| 1722 | nmdc:mga0n895_213932_c1 | |||
| 1723 | nmdc:mga0a205_241084_c1 | |||
| 1724 | nmdc:mga0a205_30665_c1 | |||
| 1725 | Ga0495601_0009699 | |||
| 1726 | Ga0495601_0162575 | |||
| 1727 | Ga0495595_0022879 | |||
| 1728 | Ga0495619_0017547 | |||
| 1729 | Ga0495619_0105643 | |||
| 1730 | Ga0495619_0371947 | |||
| 1731 | Ga0495619_0537704 | |||
| 1732 | Ga0500644_0000890 | |||
| 1733 | Ga0500660_028987 | |||
| 1734 | Ga0500553_124654 | |||
| 1735 | Ga0500573_0031492 | |||
| 1736 | Ga0500573_0094408 | |||
| 1737 | Ga0500577_0000132 | |||
| 1738 | Ga0500603_008960 | |||
| 1739 | Ga0501084_0007689 | |||
| 1740 | Ga0501084_0033227 | |||
| 1741 | Ga0501084_0044995 | |||
| 1742 | Ga0501084_0063995 | |||
| 1743 | Ga0501084_0100590 | |||
| 1744 | Ga0501084_0102441 | |||
| 1745 | Ga0501084_0314773 | |||
| 1746 | Ga0501084_0434350 | |||
| 1747 | Ga0501084_0502475 | |||
| 1748 | Ga0501084_0535133 | |||
| 1749 | Ga0501082_0002964 | |||
| 1750 | Ga0501082_0009425 | |||
| 1751 | Ga0501082_0009689 | |||
| 1752 | Ga0501082_0145215 | |||
| 1753 | Ga0466962_0021929 | |||
| 1754 | Ga0530510_0001107 | |||
| 1755 | Ga0530510_0003365 | |||
| 1756 | Ga0530510_0006328 | |||
| 1757 | Ga0530510_0006433 | |||
| 1758 | Ga0530510_0008590 | |||
| 1759 | Ga0530510_0051422 | |||
| 1760 | Ga0530510_0065445 | |||
| 1761 | Ga0530510_0077580 | |||
| 1762 | Ga0530510_0091189 | |||
| 1763 | Ga0530510_0109544 | |||
| 1764 | Ga0530510_0147015 | |||
| 1765 | Ga0530510_0472018 | |||
| 1766 | 2644627512 | |||
| 1767 | 2645725346 | |||
| 1768 | 2812479984 | |||
| 1769 | 2862284097 | |||
| 1770 | 2862507750 | |||
| 1771 | 2862581866 | |||
| 1772 | 2877677019 | |||
| 1773 | 2912719111 | |||
| 1774 | 2946072674 | |||
| 1775 | 2947225172 | |||
| 1776 | 2954700772 | |||
| 1777 | 2954706575 | |||
| 1778 | 2954713360 | |||
| 1779 | 2954723321 | |||
| 1780 | 2954738507 | |||
| 1781 | 2954742227 | |||
| 1782 | 2954757366 | |||
| 1783 | 2990088747 | |||
| 1784 | 8008575221 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mji-assembly1.cif.gz_A | crystal structure of rosb with bound intermediate ohc-rp (8-demethyl-8-formylriboflavin-5'-phosphate) | 0.8408 | 21 | 246 |
| 5wid-assembly2.cif.gz_B | structure of a flavodoxin from the domain archaea | 0.8239 | 21 | 213 |
| 5wid-assembly2.cif.gz_B | structure of a flavodoxin from the domain archaea | 0.8084 | 21 | 213 |
| 1e5d-assembly1.cif.gz_B | rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas | 0.786 | 22 | 217 |
| 2fzv-assembly1.cif.gz_C | crystal structure of an apo form of a flavin-binding protein from shigella flexneri | 0.7726 | 21 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y946_20_176_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9993 | 24 | 177 | 3.40.50.360 |
| af_I6Y946_20_176_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9739 | 24 | 177 | 3.40.50.360 |
| 1a4iA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.8783 | 21 | 61 | 3.40.50.10860 |
| 6gaqB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8047 | 22 | 211 | 3.40.50.360 |
| 6gaqB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.7848 | 22 | 211 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838JS90-F1-model_v4 | NAD(P)H-dependent oxidoreductase | 0.9966 | 15 | 116 |
GO:0016491
|
| AF-A0A259SDW8-F1-model_v4 | Flavodoxin | 0.9961 | 19 | 227 |
|
| AF-A0A7Y3DAD5-F1-model_v4 | Flavodoxin family protein | 0.9929 | 15 | 153 |
GO:0016491
|
| AF-A0A3D2LIX7-F1-model_v4 | deleted | 0.9917 | 17 | 148 |
|
| AF-A0A7D6VNE4-F1-model_v4 | Flavodoxin family protein | 0.9902 | 17 | 246 |
GO:0016491
|