F484881

General Info

Members Datasets Scaffolds Average Seq Length
892 276 1784 166

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100141224|Ga0070708_1001412242
Length 189
Sequence MCSNCTGISCSRRSRKPVDMEICRRNDVIEISELDPFLAELLRQIPASTDPEGVSAAEQRLFSPPADPKETEICAEWKLYVNPELRRLFQTATETVAADLEQLRGNEKTFANRSLHIPSNHAEEWLSALNQARLVIAAKYDFTDGELCDHYRSPIGSRRDLSLFQVNFYGFLQEFILRELDGWDQGPGA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
208 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
209 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
210 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
211 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.29
Rhizosphere 92.38
Stem 0
Stem Tuber 0
Unclassified 41.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100141224 3300005445 Bacteria 2233
2 MRS1b_contig_2830796 2162886011 Unclassified 878
3 CNXas_1000175 3300000545 Bacteria 10295
4 JGI24743J22301_10026090 3300001991 Unclassified 1135
5 JGI24744J21845_10030033 3300002077 Unclassified 1043
6 JGI24035J26624_1000312 3300002126 Bacteria 4516
7 JGI24035J26624_1010694 3300002126 Bacteria 914
8 JGI25406J46586_10000087 3300003203 Bacteria 42198
9 JGI25404J52841_10034122 3300003659 Unclassified 1084
10 JGI25404J52841_10037765 3300003659 Unclassified 1026
11 JGI25405J52794_10002248 3300003911 Bacteria 3306
12 Ga0065714_10074791 3300005288 Bacteria 2989
13 Ga0065704_10004342 3300005289 Bacteria 3432
14 Ga0065704_10007456 3300005289 Bacteria 2296
15 Ga0065704_10208367 3300005289 Bacteria 1118
16 Ga0065704_10224532 3300005289 Bacteria 1063
17 Ga0065704_10276134 3300005289 Unclassified 932
18 Ga0065712_10000626 3300005290 Bacteria 15083
19 Ga0065712_10000905 3300005290 Bacteria 7878
20 Ga0065712_10013724 3300005290 Bacteria 1634
21 Ga0065712_10152655 3300005290 Unclassified 1358
22 Ga0065712_10157591 3300005290 Bacteria 1324
23 Ga0065712_10184093 3300005290 Bacteria 1178
24 Ga0065712_10277231 3300005290 Bacteria 899
25 Ga0065712_10566293 3300005290 Unclassified 609
26 Ga0065715_10000684 3300005293 Bacteria 9017
27 Ga0065715_10096116 3300005293 Bacteria 3920
28 Ga0065715_10119506 3300005293 Bacteria 2235
29 Ga0065715_10139121 3300005293 Unclassified 1881
30 Ga0065715_10155410 3300005293 Bacteria 1665
31 Ga0065715_10183971 3300005293 Bacteria 1457
32 Ga0065715_10254275 3300005293 Unclassified 1148
33 Ga0065715_10254541 3300005293 Bacteria 1156
34 Ga0065715_10346789 3300005293 Bacteria 958
35 Ga0065707_10038280 3300005295 Bacteria 1196
36 Ga0065707_10182607 3300005295 Bacteria 1409
37 Ga0065707_10199640 3300005295 Unclassified 1317
38 Ga0065707_10282882 3300005295 Unclassified 1043
39 Ga0070658_10207669 3300005327 Unclassified 1654
40 Ga0070676_10006832 3300005328 Bacteria 6112
41 Ga0070676_10033669 3300005328 Bacteria 2940
42 Ga0070676_10057069 3300005328 Unclassified 2309
43 Ga0070676_10097729 3300005328 Unclassified 1809
44 Ga0070676_10180338 3300005328 Unclassified 1372
45 Ga0070676_10182136 3300005328 Unclassified 1366
46 Ga0070676_10681466 3300005328 Unclassified 749
47 Ga0070676_10725614 3300005328 Bacteria 727
48 Ga0070683_100072990 3300005329 Bacteria 3204
49 Ga0070683_100429276 3300005329 Unclassified 1261
50 Ga0070683_100482621 3300005329 Unclassified 1183
51 Ga0070690_100034312 3300005330 Bacteria 3179
52 Ga0070690_100043685 3300005330 Bacteria 2842
53 Ga0070690_100184942 3300005330 Bacteria 1441
54 Ga0070690_100310089 3300005330 Bacteria 1134
55 Ga0070690_101026207 3300005330 Bacteria 651
56 Ga0070670_100021803 3300005331 Bacteria 5509
57 Ga0070670_100203823 3300005331 Bacteria 1719
58 Ga0070670_100234460 3300005331 Bacteria 1597
59 Ga0070670_100426207 3300005331 Unclassified 1173
60 Ga0068869_100271954 3300005334 Bacteria 1360
61 Ga0070666_10006905 3300005335 Bacteria 6995
62 Ga0070666_10066253 3300005335 Bacteria 2450
63 Ga0070666_10102611 3300005335 Unclassified 1973
64 Ga0070666_10298572 3300005335 Unclassified 1147
65 Ga0070666_10557803 3300005335 Bacteria 833
66 Ga0070680_100965357 3300005336 Bacteria 736
67 Ga0068868_100078073 3300005338 Bacteria 2650
68 Ga0068868_100161429 3300005338 Bacteria 1851
69 Ga0070660_100278395 3300005339 Bacteria 1369
70 Ga0070660_100292312 3300005339 Bacteria 1334
71 Ga0070689_100002634 3300005340 Bacteria 11759
72 Ga0070689_100086170 3300005340 Bacteria 2470
73 Ga0070689_100087060 3300005340 Bacteria 2457
74 Ga0070689_100176879 3300005340 Bacteria 1731
75 Ga0070687_100466876 3300005343 Bacteria 843
76 Ga0070687_100624047 3300005343 Unclassified 744
77 Ga0070661_100077831 3300005344 Bacteria 2446
78 Ga0070661_100620001 3300005344 Unclassified 876
79 Ga0070692_10057160 3300005345 Bacteria 2045
80 Ga0070668_100007124 3300005347 Bacteria 8286
81 Ga0070668_100029371 3300005347 Bacteria 4176
82 Ga0070668_100034747 3300005347 Unclassified 3842
83 Ga0070668_100059230 3300005347 Bacteria 2964
84 Ga0070668_100127831 3300005347 Bacteria 2037
85 Ga0070668_100401712 3300005347 Unclassified 1170
86 Ga0070668_101459151 3300005347 Unclassified 625
87 Ga0070669_100005219 3300005353 Bacteria 9389
88 Ga0070669_100015119 3300005353 Bacteria 5498
89 Ga0070669_100043415 3300005353 Unclassified 3274
90 Ga0070669_100056295 3300005353 Bacteria 2883
91 Ga0070669_100150851 3300005353 Unclassified 1799
92 Ga0070675_100010416 3300005354 Bacteria 7264
93 Ga0070675_100013878 3300005354 Bacteria 6343
94 Ga0070675_100030993 3300005354 Bacteria 4320
95 Ga0070675_100043862 3300005354 Bacteria 3657
96 Ga0070675_101014387 3300005354 Unclassified 762
97 Ga0070671_100018196 3300005355 Bacteria 5704
98 Ga0070671_100076493 3300005355 Unclassified 2796
99 Ga0070671_100086738 3300005355 Unclassified 2619
100 Ga0070671_100106529 3300005355 Bacteria 2353
101 Ga0070671_100245718 3300005355 Unclassified 1519
102 Ga0070671_100948088 3300005355 Unclassified 753
103 Ga0070674_100018553 3300005356 Bacteria 4401
104 Ga0070674_100021908 3300005356 Bacteria 4112
105 Ga0070674_100142803 3300005356 Unclassified 1799
106 Ga0070674_100509609 3300005356 Bacteria 1003
107 Ga0070674_100864931 3300005356 Unclassified 785
108 Ga0070674_100894038 3300005356 Unclassified 773
109 Ga0070673_100007694 3300005364 Bacteria 7129
110 Ga0070673_100012707 3300005364 Bacteria 5790
111 Ga0070673_100082328 3300005364 Bacteria 2612
112 Ga0070673_100158244 3300005364 Unclassified 1924
113 Ga0070673_100915819 3300005364 Unclassified 813
114 Ga0070673_101580235 3300005364 Bacteria 619
115 Ga0070688_100001014 3300005365 Bacteria 14119
116 Ga0070688_100019023 3300005365 Bacteria 3975
117 Ga0070688_100118515 3300005365 Bacteria 1770
118 Ga0070688_100150872 3300005365 Unclassified 1588
119 Ga0070688_101306497 3300005365 Unclassified 586
120 Ga0070659_100015190 3300005366 Bacteria 5761
121 Ga0070659_100018746 3300005366 Bacteria 5223
122 Ga0070667_100018730 3300005367 Bacteria 5742
123 Ga0070667_100051082 3300005367 Unclassified 3485
124 Ga0070667_100081368 3300005367 Unclassified 2771
125 Ga0070667_100460680 3300005367 Bacteria 1162
126 Ga0070703_10104910 3300005406 Bacteria 1002
127 Ga0070709_10018947 3300005434 Bacteria 3971
128 Ga0070709_10649702 3300005434 Unclassified 816
129 Ga0070709_11203997 3300005434 Unclassified 609
130 Ga0070714_100042855 3300005435 Bacteria 3825
131 Ga0070714_100048583 3300005435 Unclassified 3609
132 Ga0070714_100534016 3300005435 Unclassified 1121
133 Ga0070713_100009589 3300005436 Bacteria 6944
134 Ga0070713_100061038 3300005436 Bacteria 3154
135 Ga0070713_100101766 3300005436 Unclassified 2489
136 Ga0070713_100145613 3300005436 Bacteria 2102
137 Ga0070713_100315406 3300005436 Unclassified 1443
138 Ga0070713_101010218 3300005436 Unclassified 802
139 Ga0070710_10003850 3300005437 Bacteria 7099
140 Ga0070710_10206346 3300005437 Unclassified 1243
141 Ga0070710_10232503 3300005437 Bacteria 1178
142 Ga0070710_10264215 3300005437 Unclassified 1111
143 Ga0070710_10751118 3300005437 Unclassified 693
144 Ga0070711_100008313 3300005439 Bacteria 6353
145 Ga0070711_100173248 3300005439 Unclassified 1646
146 Ga0070711_100193764 3300005439 Bacteria 1564
147 Ga0070711_100219692 3300005439 Unclassified 1476
148 Ga0070711_100331985 3300005439 Unclassified 1217
149 Ga0070711_100913554 3300005439 Unclassified 750
150 Ga0070705_100094700 3300005440 Bacteria 1870
151 Ga0070705_100121072 3300005440 Bacteria 1690
152 Ga0070705_100320040 3300005440 Unclassified 1119
153 Ga0070705_100335696 3300005440 Bacteria 1096
154 Ga0070700_100066401 3300005441 Bacteria 2290
155 Ga0070694_100979022 3300005444 Bacteria 701
156 Ga0070694_101066971 3300005444 Bacteria 673
157 Ga0070708_100001246 3300005445 Bacteria 19578
158 Ga0070708_100014035 3300005445 Bacteria 6582
159 Ga0070708_100041281 3300005445 Bacteria 4045
160 Ga0070708_100071778 3300005445 Bacteria 3118
161 Ga0070708_100108282 3300005445 Bacteria 2552
162 Ga0070708_100168149 3300005445 Bacteria 2046
163 Ga0070708_100209834 3300005445 Bacteria 1825
164 Ga0070708_100331098 3300005445 Unclassified 1435
165 Ga0070708_100672563 3300005445 Bacteria 975
166 Ga0070708_100677399 3300005445 Unclassified 971
167 Ga0070708_101083115 3300005445 Unclassified 751
168 Ga0070663_100021879 3300005455 Bacteria 4262
169 Ga0070663_100030814 3300005455 Bacteria 3680
170 Ga0070678_100053696 3300005456 Bacteria 2932
171 Ga0070678_100078766 3300005456 Bacteria 2490
172 Ga0070678_100139478 3300005456 Unclassified 1938
173 Ga0070662_100010037 3300005457 Bacteria 6203
174 Ga0070662_100035606 3300005457 Bacteria 3517
175 Ga0070662_100184868 3300005457 Bacteria 1645
176 Ga0070662_100279896 3300005457 Bacteria 1350
177 Ga0070662_100339608 3300005457 Bacteria 1228
178 Ga0070662_100985827 3300005457 Unclassified 721
179 Ga0070681_10030785 3300005458 Bacteria 5385
180 Ga0070681_10314375 3300005458 Unclassified 1476
181 Ga0068867_100101497 3300005459 Unclassified 2198
182 Ga0068867_100328765 3300005459 Bacteria 1269
183 Ga0070685_10015868 3300005466 Bacteria 4006
184 Ga0070685_10018427 3300005466 Bacteria 3753
185 Ga0070706_100000269 3300005467 Bacteria 63203
186 Ga0070706_100004511 3300005467 Bacteria 13413
187 Ga0070706_100007002 3300005467 Bacteria 10634
188 Ga0070706_100010420 3300005467 Bacteria 8631
189 Ga0070706_100020333 3300005467 Bacteria 6116
190 Ga0070706_100030390 3300005467 Bacteria 4977
191 Ga0070706_100064264 3300005467 Unclassified 3392
192 Ga0070706_100068685 3300005467 Bacteria 3277
193 Ga0070706_100155064 3300005467 Unclassified 2138
194 Ga0070706_100215389 3300005467 Bacteria 1793
195 Ga0070706_100242551 3300005467 Bacteria 1683
196 Ga0070706_100246388 3300005467 Bacteria 1668
197 Ga0070706_100353306 3300005467 Unclassified 1370
198 Ga0070706_100721770 3300005467 Unclassified 924
199 Ga0070706_100780482 3300005467 Unclassified 885
200 Ga0070706_100862305 3300005467 Bacteria 837
201 Ga0070706_101207220 3300005467 Bacteria 695
202 Ga0070706_101223064 3300005467 Unclassified 690
203 Ga0070707_100021300 3300005468 Bacteria 6127
204 Ga0070707_100029036 3300005468 Bacteria 5264
205 Ga0070707_100040241 3300005468 Bacteria 4472
206 Ga0070707_100082456 3300005468 Unclassified 3106
207 Ga0070707_100174169 3300005468 Unclassified 2097
208 Ga0070707_100179344 3300005468 Unclassified 2065
209 Ga0070707_100252440 3300005468 Bacteria 1716
210 Ga0070707_100268875 3300005468 Unclassified 1658
211 Ga0070707_100287992 3300005468 Bacteria 1596
212 Ga0070707_100757385 3300005468 Bacteria 934
213 Ga0070707_100788599 3300005468 Unclassified 914
214 Ga0070707_101193393 3300005468 Unclassified 727
215 Ga0070698_100001933 3300005471 Bacteria 23020
216 Ga0070698_100498205 3300005471 Unclassified 1156
217 Ga0070698_100815826 3300005471 Bacteria 877
218 Ga0070698_101234527 3300005471 Unclassified 697
219 Ga0070699_100017643 3300005518 Bacteria 6128
220 Ga0070699_100081643 3300005518 Bacteria 2818
221 Ga0070699_100155142 3300005518 Bacteria 2026
222 Ga0070699_100644198 3300005518 Unclassified 967
223 Ga0070699_101605634 3300005518 Unclassified 596
224 Ga0070679_100083609 3300005530 Bacteria 3180
225 Ga0070684_100032398 3300005535 Bacteria 4454
226 Ga0070684_100044817 3300005535 Bacteria 3827
227 Ga0070684_100049498 3300005535 Unclassified 3647
228 Ga0070684_100131389 3300005535 Unclassified 2259
229 Ga0070684_100225139 3300005535 Bacteria 1711
230 Ga0070697_100005205 3300005536 Bacteria 9993
231 Ga0070697_100006587 3300005536 Bacteria 9003
232 Ga0070697_100028885 3300005536 Unclassified 4444
233 Ga0070697_100030661 3300005536 Bacteria 4320
234 Ga0070697_100037478 3300005536 Unclassified 3918
235 Ga0070697_100037985 3300005536 Bacteria 3889
236 Ga0070697_100056434 3300005536 Bacteria 3195
237 Ga0070697_100152222 3300005536 Bacteria 1950
238 Ga0070697_100156565 3300005536 Unclassified 1923
239 Ga0070697_100244168 3300005536 Bacteria 1534
240 Ga0070697_100305785 3300005536 Bacteria 1367
241 Ga0070697_100567572 3300005536 Bacteria 996
242 Ga0070697_101135261 3300005536 Unclassified 696
243 Ga0070672_100004083 3300005543 Bacteria 9533
244 Ga0070672_100024482 3300005543 Bacteria 4463
245 Ga0070672_100074498 3300005543 Bacteria 2708
246 Ga0070672_100171408 3300005543 Unclassified 1805
247 Ga0070672_100179073 3300005543 Unclassified 1766
248 Ga0070672_100380597 3300005543 Unclassified 1207
249 Ga0070672_100398902 3300005543 Unclassified 1179
250 Ga0070672_100544932 3300005543 Bacteria 1007
251 Ga0070686_100043786 3300005544 Unclassified 2810
252 Ga0070693_100243079 3300005547 Bacteria 1190
253 Ga0070665_100016091 3300005548 Bacteria 7505
254 Ga0070665_100041976 3300005548 Bacteria 4598
255 Ga0070665_100194440 3300005548 Bacteria 2029
256 Ga0070665_100219570 3300005548 Bacteria 1901
257 Ga0070665_100506405 3300005548 Unclassified 1219
258 Ga0070665_100966177 3300005548 Bacteria 864
259 Ga0070704_100044622 3300005549 Bacteria 3081
260 Ga0070704_100146156 3300005549 Unclassified 1853
261 Ga0070704_100374619 3300005549 Bacteria 1208
262 Ga0068855_100295577 3300005563 Unclassified 1794
263 Ga0070664_100075886 3300005564 Bacteria 2887
264 Ga0070664_100298699 3300005564 Bacteria 1455
265 Ga0070664_100637840 3300005564 Unclassified 989
266 Ga0070702_100292818 3300005615 Unclassified 1123
267 Ga0068859_100201005 3300005617 Bacteria 2077
268 Ga0068859_101165342 3300005617 Bacteria 848
269 Ga0068866_10159303 3300005718 Bacteria 1315
270 Ga0068866_10703705 3300005718 Unclassified 693
271 Ga0068861_100036591 3300005719 Bacteria 3645
272 Ga0068861_100240392 3300005719 Unclassified 1540
273 Ga0068861_101589970 3300005719 Unclassified 644
274 Ga0068863_100138451 3300005841 Bacteria 2326
275 Ga0068863_100335486 3300005841 Unclassified 1470
276 Ga0068863_100915242 3300005841 Bacteria 878
277 Ga0068863_100947007 3300005841 Bacteria 862
278 Ga0068858_100058111 3300005842 Bacteria 3576
279 Ga0068858_100797227 3300005842 Bacteria 921
280 Ga0068858_101712248 3300005842 Unclassified 621
281 Ga0068860_100026862 3300005843 Bacteria 5547
282 Ga0068860_100412032 3300005843 Bacteria 1338
283 Ga0068860_100565109 3300005843 Unclassified 1140
284 Ga0068862_100350877 3300005844 Bacteria 1369
285 Ga0081455_10001399 3300005937 Bacteria 29813
286 Ga0081455_10011319 3300005937 Bacteria 8973
287 Ga0081455_10016230 3300005937 Bacteria 7196
288 Ga0081455_10024323 3300005937 Bacteria 5610
289 Ga0081455_10026186 3300005937 Bacteria 5371
290 Ga0081455_10027681 3300005937 Bacteria 5191
291 Ga0081455_10360020 3300005937 Bacteria 1023
292 Ga0081455_10388173 3300005937 Bacteria 973
293 Ga0081455_10453528 3300005937 Unclassified 875
294 Ga0081540_1000036 3300005983 Bacteria 140805
295 Ga0081540_1025381 3300005983 Bacteria 3411
296 Ga0081540_1033289 3300005983 Bacteria 2801
297 Ga0081539_10000727 3300005985 Bacteria 66016
298 Ga0081539_10001132 3300005985 Bacteria 48398
299 Ga0081539_10088653 3300005985 Bacteria 1604
300 Ga0070717_10000989 3300006028 Bacteria 19045
301 Ga0070717_10013344 3300006028 Bacteria 6292
302 Ga0070717_10028937 3300006028 Bacteria 4440
303 Ga0070717_10121318 3300006028 Bacteria 2239
304 Ga0070717_10144273 3300006028 Unclassified 2055
305 Ga0070717_10188544 3300006028 Bacteria 1801
306 Ga0070717_10302706 3300006028 Bacteria 1422
307 Ga0070717_10406552 3300006028 Unclassified 1223
308 Ga0070717_11081801 3300006028 Unclassified 730
309 Ga0070715_10053465 3300006163 Unclassified 1745
310 Ga0070716_100239024 3300006173 Unclassified 1230
311 Ga0070716_100594412 3300006173 Unclassified 831
312 Ga0070712_100008008 3300006175 Bacteria 6627
313 Ga0070712_100011301 3300006175 Bacteria 5657
314 Ga0070712_100045849 3300006175 Bacteria 3020
315 Ga0070712_100081663 3300006175 Bacteria 2343
316 Ga0070712_100094353 3300006175 Bacteria 2199
317 Ga0070712_100096439 3300006175 Unclassified 2177
318 Ga0070712_100170006 3300006175 Bacteria 1690
319 Ga0070712_100201180 3300006175 Unclassified 1565
320 Ga0070712_100321903 3300006175 Bacteria 1258
321 Ga0070712_100363458 3300006175 Unclassified 1187
322 Ga0070712_100591734 3300006175 Unclassified 938
323 Ga0097621_100076154 3300006237 Bacteria 2782
324 Ga0097621_100092818 3300006237 Unclassified 2529
325 Ga0097621_100099690 3300006237 Bacteria 2442
326 Ga0097621_100438891 3300006237 Unclassified 1174
327 Ga0068871_100135467 3300006358 Unclassified 2091
328 Ga0068871_100195061 3300006358 Unclassified 1746
329 Ga0068871_100252441 3300006358 Bacteria 1536
330 Ga0068871_100944839 3300006358 Bacteria 801
331 Ga0075428_100881155 3300006844 Unclassified 950
332 Ga0075433_10270533 3300006852 Unclassified 1506
333 Ga0075433_10565652 3300006852 Unclassified 999
334 Ga0075433_10678673 3300006852 Unclassified 903
335 Ga0075434_100195123 3300006871 Bacteria 2045
336 Ga0075434_100288099 3300006871 Unclassified 1662
337 Ga0075434_100313598 3300006871 Unclassified 1589
338 Ga0075434_100662672 3300006871 Unclassified 1062
339 Ga0075434_100691164 3300006871 Unclassified 1038
340 Ga0075429_100811826 3300006880 Unclassified 819
341 Ga0068865_100040646 3300006881 Bacteria 3162
342 Ga0068865_100599774 3300006881 Unclassified 931
343 Ga0075436_100071988 3300006914 Bacteria 2391
344 Ga0097620_100201007 3300006931 Bacteria 2077
345 Ga0097620_101165296 3300006931 Bacteria 848
346 Ga0075435_100502079 3300007076 Unclassified 1049
347 Ga0099795_10043626 3300007788 Unclassified 1606
348 Ga0105240_10271232 3300009093 Unclassified 1953
349 Ga0111539_10250683 3300009094 Bacteria 2061
350 Ga0111539_10794807 3300009094 Unclassified 1101
351 Ga0111539_10903566 3300009094 Bacteria 1027
352 Ga0105245_10523316 3300009098 Bacteria 1205
353 Ga0105245_10680662 3300009098 Bacteria 1061
354 Ga0105245_10896568 3300009098 Unclassified 928
355 Ga0105245_11092012 3300009098 Bacteria 844
356 Ga0105247_10107485 3300009101 Bacteria 1792
357 Ga0105247_10975712 3300009101 Unclassified 660
358 Ga0114129_10108940 3300009147 Bacteria 3823
359 Ga0114129_10343212 3300009147 Unclassified 1980
360 Ga0114129_10550244 3300009147 Unclassified 1501
361 Ga0114129_10652958 3300009147 Unclassified 1357
362 Ga0105243_10273657 3300009148 Bacteria 1517
363 Ga0105243_10431976 3300009148 Bacteria 1231
364 Ga0105243_10602715 3300009148 Unclassified 1058
365 Ga0105243_11641250 3300009148 Unclassified 670
366 Ga0105243_12641502 3300009148 Unclassified 542
367 Ga0105241_10120467 3300009174 Bacteria 2112
368 Ga0105241_11050930 3300009174 Unclassified 764
369 Ga0105242_10077802 3300009176 Bacteria 2768
370 Ga0105242_10142894 3300009176 Unclassified 2079
371 Ga0105242_11018539 3300009176 Unclassified 837
372 Ga0105242_11073914 3300009176 Bacteria 817
373 Ga0105248_10269992 3300009177 Bacteria 1915
374 Ga0105248_10554940 3300009177 Bacteria 1296
375 Ga0105237_11703568 3300009545 Unclassified 638
376 Ga0105238_10943343 3300009551 Bacteria 882
377 Ga0105249_10029493 3300009553 Bacteria 4955
378 Ga0105249_10160954 3300009553 Unclassified 2169
379 Ga0105249_10397580 3300009553 Unclassified 1408
380 Ga0105249_10531582 3300009553 Bacteria 1224
381 Ga0105249_11299070 3300009553 Unclassified 799
382 Ga0099796_10020855 3300010159 Bacteria 2009
383 Ga0099796_10045340 3300010159 Bacteria 1506
384 Ga0099796_10264980 3300010159 Unclassified 718
385 Ga0105239_10003969 3300010375 Bacteria 17929
386 Ga0105239_10646859 3300010375 Unclassified 1207
387 Ga0105239_11213130 3300010375 Bacteria 869
388 Ga0105246_10116656 3300011119 Unclassified 1971
389 Ga0105246_10175519 3300011119 Unclassified 1645
390 Ga0105246_10970379 3300011119 Bacteria 767
391 Ga0157315_1010269 3300012508 Unclassified 822
392 Ga0157371_10066841 3300013102 Bacteria 2545
393 Ga0157371_10526145 3300013102 Unclassified 875
394 Ga0157371_10549419 3300013102 Unclassified 856
395 Ga0157369_11302992 3300013105 Bacteria 740
396 Ga0157374_10009864 3300013296 Bacteria 8197
397 Ga0157374_10017988 3300013296 Bacteria 6231
398 Ga0157374_10027132 3300013296 Bacteria 5162
399 Ga0157374_10045827 3300013296 Bacteria 4047
400 Ga0157374_10059858 3300013296 Bacteria 3563
401 Ga0157374_10078888 3300013296 Bacteria 3119
402 Ga0157374_10118282 3300013296 Bacteria 2555
403 Ga0157374_10158582 3300013296 Unclassified 2203
404 Ga0157374_10292875 3300013296 Bacteria 1609
405 Ga0157374_10303687 3300013296 Unclassified 1579
406 Ga0157374_10330276 3300013296 Unclassified 1512
407 Ga0157374_10544642 3300013296 Bacteria 1168
408 Ga0157374_10856921 3300013296 Bacteria 926
409 Ga0157374_11388829 3300013296 Unclassified 725
410 Ga0157378_10013936 3300013297 Bacteria 7033
411 Ga0157378_10052952 3300013297 Bacteria 3612
412 Ga0157378_10075047 3300013297 Bacteria 3043
413 Ga0157378_10122234 3300013297 Bacteria 2401
414 Ga0157378_10228801 3300013297 Bacteria 1771
415 Ga0157378_10684582 3300013297 Bacteria 1044
416 Ga0157378_10843586 3300013297 Unclassified 944
417 Ga0157378_10847336 3300013297 Unclassified 942
418 Ga0157378_10980328 3300013297 Bacteria 879
419 Ga0157378_11000621 3300013297 Unclassified 870
420 Ga0163162_10006459 3300013306 Bacteria 11357
421 Ga0163162_10104768 3300013306 Unclassified 2923
422 Ga0163162_10137299 3300013306 Unclassified 2557
423 Ga0163162_10141758 3300013306 Bacteria 2517
424 Ga0163162_10171473 3300013306 Unclassified 2294
425 Ga0163162_10172172 3300013306 Bacteria 2290
426 Ga0163162_10307324 3300013306 Unclassified 1718
427 Ga0163162_10426785 3300013306 Bacteria 1458
428 Ga0163162_10438666 3300013306 Bacteria 1438
429 Ga0163162_11167150 3300013306 Bacteria 873
430 Ga0163162_11391466 3300013306 Bacteria 798
431 Ga0157372_10068892 3300013307 Unclassified 3979
432 Ga0157372_10111374 3300013307 Bacteria 3136
433 Ga0157372_10214195 3300013307 Bacteria 2232
434 Ga0157372_12126886 3300013307 Unclassified 645
435 Ga0157375_10023260 3300013308 Bacteria 5715
436 Ga0157375_10030865 3300013308 Bacteria 5059
437 Ga0157375_10039200 3300013308 Bacteria 4558
438 Ga0157375_10089755 3300013308 Unclassified 3130
439 Ga0157375_10259734 3300013308 Bacteria 1898
440 Ga0157375_10712721 3300013308 Bacteria 1157
441 Ga0163163_10015125 3300014325 Bacteria 7122
442 Ga0163163_10439317 3300014325 Unclassified 1364
443 Ga0163163_10897321 3300014325 Bacteria 950
444 Ga0157377_10031453 3300014745 Unclassified 2884
445 Ga0157377_10333367 3300014745 Unclassified 1012
446 Ga0157377_10856919 3300014745 Unclassified 675
447 Ga0157379_10151190 3300014968 Bacteria 2094
448 Ga0157379_10237893 3300014968 Bacteria 1651
449 Ga0157379_10297411 3300014968 Bacteria 1471
450 Ga0157379_10505961 3300014968 Unclassified 1120
451 Ga0157376_10047094 3300014969 Bacteria 3559
452 Ga0157376_10069981 3300014969 Bacteria 2977
453 Ga0157376_10072651 3300014969 Bacteria 2927
454 Ga0157376_10167479 3300014969 Bacteria 1998
455 Ga0157376_10181437 3300014969 Unclassified 1924
456 Ga0157376_10459536 3300014969 Unclassified 1244
457 Ga0157376_10748738 3300014969 Bacteria 986
458 Ga0157376_11776327 3300014969 Unclassified 653
459 Ga0163161_10068564 3300017792 Bacteria 2592
460 Ga0163161_10253544 3300017792 Bacteria 1372
461 Ga0163161_10785455 3300017792 Bacteria 799
462 Ga0207666_1000268 3300025271 Bacteria 7510
463 Ga0207666_1000445 3300025271 Bacteria 5352
464 Ga0207673_1010655 3300025290 Bacteria 1185
465 Ga0207697_10000305 3300025315 Bacteria 27530
466 Ga0207697_10000749 3300025315 Bacteria 18385
467 Ga0207697_10002349 3300025315 Bacteria 9860
468 Ga0207697_10002915 3300025315 Bacteria 8655
469 Ga0207697_10040533 3300025315 Bacteria 1912
470 Ga0207697_10069836 3300025315 Bacteria 1471
471 Ga0207697_10069930 3300025315 Bacteria 1470
472 Ga0207697_10093609 3300025315 Bacteria 1275
473 Ga0207697_10101190 3300025315 Bacteria 1228
474 Ga0207697_10191537 3300025315 Unclassified 898
475 Ga0207697_10261760 3300025315 Bacteria 766
476 Ga0207697_10435088 3300025315 Bacteria 582
477 Ga0207656_10327457 3300025321 Unclassified 762
478 Ga0207696_1063563 3300025711 Bacteria 1034
479 Ga0207682_10031850 3300025893 Bacteria 2118
480 Ga0207692_10007795 3300025898 Bacteria 4403
481 Ga0207692_10059860 3300025898 Bacteria 1968
482 Ga0207692_10164757 3300025898 Unclassified 1280
483 Ga0207710_10462373 3300025900 Bacteria 656
484 Ga0207688_10014931 3300025901 Unclassified 4213
485 Ga0207688_10024140 3300025901 Bacteria 3333
486 Ga0207688_10032890 3300025901 Unclassified 2866
487 Ga0207688_10040485 3300025901 Bacteria 2590
488 Ga0207688_10352592 3300025901 Unclassified 907
489 Ga0207680_10426575 3300025903 Bacteria 939
490 Ga0207680_10492829 3300025903 Bacteria 872
491 Ga0207680_10602004 3300025903 Unclassified 786
492 Ga0207680_10685146 3300025903 Bacteria 734
493 Ga0207647_10056519 3300025904 Bacteria 2407
494 Ga0207685_10048137 3300025905 Bacteria 1632
495 Ga0207685_10102253 3300025905 Bacteria 1227
496 Ga0207699_10702471 3300025906 Unclassified 740
497 Ga0207699_10882727 3300025906 Unclassified 659
498 Ga0207645_10001207 3300025907 Bacteria 21313
499 Ga0207645_10030242 3300025907 Bacteria 3490
500 Ga0207645_10067393 3300025907 Bacteria 2288
501 Ga0207645_10101892 3300025907 Unclassified 1853
502 Ga0207645_10191261 3300025907 Bacteria 1345
503 Ga0207705_10330021 3300025909 Unclassified 1173
504 Ga0207684_10000134 3300025910 Bacteria 133720
505 Ga0207684_10010852 3300025910 Bacteria 7993
506 Ga0207684_10026757 3300025910 Bacteria 4918
507 Ga0207684_10051976 3300025910 Unclassified 3477
508 Ga0207684_10060083 3300025910 Bacteria 3228
509 Ga0207684_10092011 3300025910 Unclassified 2585
510 Ga0207684_10136003 3300025910 Bacteria 2110
511 Ga0207684_10266201 3300025910 Unclassified 1479
512 Ga0207684_10318222 3300025910 Bacteria 1341
513 Ga0207684_10379877 3300025910 Unclassified 1215
514 Ga0207684_10486180 3300025910 Bacteria 1059
515 Ga0207684_10981516 3300025910 Bacteria 707
516 Ga0207707_10035655 3300025912 Bacteria 4349
517 Ga0207671_10215675 3300025914 Unclassified 1502
518 Ga0207693_10001338 3300025915 Bacteria 21779
519 Ga0207693_10052702 3300025915 Bacteria 3191
520 Ga0207693_10063808 3300025915 Bacteria 2886
521 Ga0207693_10085453 3300025915 Unclassified 2471
522 Ga0207693_10114960 3300025915 Unclassified 2112
523 Ga0207693_10142725 3300025915 Bacteria 1883
524 Ga0207693_10311988 3300025915 Unclassified 1232
525 Ga0207693_10485187 3300025915 Unclassified 965
526 Ga0207663_10055090 3300025916 Bacteria 2493
527 Ga0207663_10089367 3300025916 Bacteria 2040
528 Ga0207663_10261454 3300025916 Unclassified 1278
529 Ga0207663_10374212 3300025916 Unclassified 1084
530 Ga0207660_10082617 3300025917 Unclassified 2364
531 Ga0207662_10015959 3300025918 Bacteria 4233
532 Ga0207662_10047476 3300025918 Unclassified 2543
533 Ga0207662_10727218 3300025918 Unclassified 697
534 Ga0207657_10182461 3300025919 Bacteria 1696
535 Ga0207657_10199927 3300025919 Bacteria 1608
536 Ga0207657_10751470 3300025919 Unclassified 756
537 Ga0207652_10117862 3300025921 Unclassified 2359
538 Ga0207646_10022265 3300025922 Bacteria 5841
539 Ga0207646_10041787 3300025922 Bacteria 4120
540 Ga0207646_10100357 3300025922 Unclassified 2594
541 Ga0207646_10102548 3300025922 Bacteria 2565
542 Ga0207646_10153427 3300025922 Unclassified 2077
543 Ga0207646_10236366 3300025922 Bacteria 1651
544 Ga0207646_10296485 3300025922 Bacteria 1461
545 Ga0207646_10550484 3300025922 Unclassified 1037
546 Ga0207646_10640832 3300025922 Unclassified 952
547 Ga0207646_10679888 3300025922 Bacteria 921
548 Ga0207681_10012037 3300025923 Bacteria 5329
549 Ga0207681_10055235 3300025923 Bacteria 2704
550 Ga0207681_10092103 3300025923 Unclassified 2166
551 Ga0207681_10138924 3300025923 Unclassified 1807
552 Ga0207681_10161894 3300025923 Unclassified 1688
553 Ga0207681_10476435 3300025923 Unclassified 1019
554 Ga0207650_10102795 3300025925 Bacteria 2202
555 Ga0207650_10173665 3300025925 Unclassified 1714
556 Ga0207650_10302536 3300025925 Bacteria 1306
557 Ga0207650_10329433 3300025925 Unclassified 1252
558 Ga0207659_10034033 3300025926 Unclassified 3511
559 Ga0207659_10091247 3300025926 Bacteria 2275
560 Ga0207659_10091540 3300025926 Bacteria 2272
561 Ga0207659_10098795 3300025926 Unclassified 2196
562 Ga0207659_10117709 3300025926 Bacteria 2031
563 Ga0207659_10121309 3300025926 Unclassified 2004
564 Ga0207659_10170598 3300025926 Unclassified 1716
565 Ga0207659_10893348 3300025926 Unclassified 764
566 Ga0207687_10077931 3300025927 Bacteria 2385
567 Ga0207687_10174505 3300025927 Bacteria 1660
568 Ga0207687_10375345 3300025927 Unclassified 1164
569 Ga0207687_10387745 3300025927 Unclassified 1146
570 Ga0207687_10924025 3300025927 Bacteria 747
571 Ga0207700_10007438 3300025928 Bacteria 6692
572 Ga0207700_10115020 3300025928 Unclassified 2171
573 Ga0207700_10296271 3300025928 Bacteria 1395
574 Ga0207700_10720980 3300025928 Unclassified 891
575 Ga0207664_10059774 3300025929 Bacteria 3037
576 Ga0207664_10093216 3300025929 Unclassified 2473
577 Ga0207664_10619773 3300025929 Bacteria 972
578 Ga0207664_10640954 3300025929 Bacteria 955
579 Ga0207644_10109616 3300025931 Bacteria 2086
580 Ga0207644_10129688 3300025931 Unclassified 1929
581 Ga0207644_10144973 3300025931 Unclassified 1832
582 Ga0207644_10164028 3300025931 Unclassified 1729
583 Ga0207644_10414778 3300025931 Unclassified 1102
584 Ga0207644_10543823 3300025931 Unclassified 961
585 Ga0207690_10016085 3300025932 Unclassified 4547
586 Ga0207690_10017865 3300025932 Bacteria 4340
587 Ga0207690_10214696 3300025932 Unclassified 1469
588 Ga0207706_10000989 3300025933 Bacteria 28922
589 Ga0207706_10015312 3300025933 Bacteria 6932
590 Ga0207706_10045022 3300025933 Bacteria 3910
591 Ga0207706_10240414 3300025933 Bacteria 1583
592 Ga0207706_10311032 3300025933 Bacteria 1372
593 Ga0207706_10416782 3300025933 Unclassified 1163
594 Ga0207706_10460365 3300025933 Unclassified 1100
595 Ga0207686_10083840 3300025934 Unclassified 2087
596 Ga0207686_11497963 3300025934 Unclassified 556
597 Ga0207709_10294603 3300025935 Bacteria 1204
598 Ga0207670_10009364 3300025936 Bacteria 5588
599 Ga0207670_10126553 3300025936 Bacteria 1865
600 Ga0207670_10329004 3300025936 Bacteria 1204
601 Ga0207669_10257281 3300025937 Unclassified 1303
602 Ga0207704_10279035 3300025938 Unclassified 1269
603 Ga0207704_10510315 3300025938 Unclassified 971
604 Ga0207665_10029353 3300025939 Bacteria 3636
605 Ga0207665_10071887 3300025939 Unclassified 2362
606 Ga0207665_11390091 3300025939 Bacteria 559
607 Ga0207691_10000847 3300025940 Bacteria 30373
608 Ga0207691_10003287 3300025940 Bacteria 15747
609 Ga0207691_10060881 3300025940 Bacteria 3430
610 Ga0207691_10100787 3300025940 Bacteria 2577
611 Ga0207691_10205379 3300025940 Bacteria 1713
612 Ga0207691_10393784 3300025940 Unclassified 1182
613 Ga0207691_10848882 3300025940 Bacteria 766
614 Ga0207689_10060604 3300025942 Bacteria 3112
615 Ga0207661_10075909 3300025944 Bacteria 2759
616 Ga0207661_10088850 3300025944 Bacteria 2569
617 Ga0207661_10472589 3300025944 Unclassified 1144
618 Ga0207661_10915240 3300025944 Unclassified 808
619 Ga0207679_10116924 3300025945 Bacteria 2115
620 Ga0207679_10344760 3300025945 Bacteria 1297
621 Ga0207679_11251812 3300025945 Unclassified 681
622 Ga0207667_10514162 3300025949 Unclassified 1213
623 Ga0207651_10037857 3300025960 Bacteria 3163
624 Ga0207651_10082943 3300025960 Bacteria 2316
625 Ga0207651_10331047 3300025960 Unclassified 1276
626 Ga0207651_10467867 3300025960 Unclassified 1084
627 Ga0207712_10161333 3300025961 Bacteria 1743
628 Ga0207712_10297893 3300025961 Unclassified 1322
629 Ga0207712_11431089 3300025961 Unclassified 619
630 Ga0207668_10089010 3300025972 Bacteria 2262
631 Ga0207668_10161033 3300025972 Bacteria 1748
632 Ga0207668_10205587 3300025972 Bacteria 1571
633 Ga0207668_10216282 3300025972 Unclassified 1536
634 Ga0207668_10246573 3300025972 Unclassified 1448
635 Ga0207668_10311339 3300025972 Unclassified 1303
636 Ga0207668_10548531 3300025972 Unclassified 1001
637 Ga0207658_10067665 3300025986 Bacteria 2691
638 Ga0207658_10178922 3300025986 Bacteria 1753
639 Ga0207658_10245723 3300025986 Unclassified 1518
640 Ga0207658_10998773 3300025986 Bacteria 763
641 Ga0207677_10108448 3300026023 Unclassified 2062
642 Ga0207677_10134711 3300026023 Bacteria 1881
643 Ga0207677_10156284 3300026023 Bacteria 1766
644 Ga0207677_10228020 3300026023 Bacteria 1498
645 Ga0207677_10237647 3300026023 Unclassified 1472
646 Ga0207677_10379662 3300026023 Unclassified 1192
647 Ga0207677_10770261 3300026023 Unclassified 859
648 Ga0207703_10029366 3300026035 Unclassified 4338
649 Ga0207703_10792339 3300026035 Unclassified 904
650 Ga0207678_10014322 3300026067 Bacteria 6972
651 Ga0207678_10670338 3300026067 Unclassified 912
652 Ga0207708_10068379 3300026075 Bacteria 2719
653 Ga0207641_10019247 3300026088 Bacteria 5602
654 Ga0207641_10042174 3300026088 Bacteria 3827
655 Ga0207648_10092561 3300026089 Bacteria 2643
656 Ga0207648_10226205 3300026089 Bacteria 1664
657 Ga0207648_10347627 3300026089 Unclassified 1336
658 Ga0207648_10476660 3300026089 Unclassified 1139
659 Ga0207675_100050517 3300026118 Bacteria 3880
660 Ga0207675_100305166 3300026118 Unclassified 1551
661 Ga0207675_101317458 3300026118 Bacteria 743
662 Ga0207675_101639062 3300026118 Unclassified 663
663 Ga0207683_10049059 3300026121 Bacteria 3695
664 Ga0207683_10201969 3300026121 Unclassified 1807
665 Ga0209179_1027732 3300027512 Bacteria 1144
666 Ga0209974_10043679 3300027876 Bacteria 1494
667 Ga0209974_10058584 3300027876 Bacteria 1302
668 Ga0268266_10008426 3300028379 Bacteria 9166
669 Ga0268266_10011362 3300028379 Bacteria 7743
670 Ga0268266_10013533 3300028379 Bacteria 7025
671 Ga0268266_10013597 3300028379 Bacteria 7010
672 Ga0268266_10169519 3300028379 Bacteria 1981
673 Ga0268265_10269186 3300028380 Bacteria 1519
674 Ga0268264_10066327 3300028381 Unclassified 3043
675 Ga0268264_10073739 3300028381 Unclassified 2898
676 Ga0268264_10159138 3300028381 Unclassified 2032
677 Ga0268264_11349505 3300028381 Bacteria 723
678 Ga0307513_10058975 3300031456 Bacteria 4076
679 Ga0373926_0235552 3300035083 Unclassified 708
680 Ga0373944_0034315 3300035089 Unclassified 1542
681 Ga0373944_0164429 3300035089 Unclassified 789
682 Ga0373944_0202578 3300035089 Unclassified 719
683 Ga0373952_0171847 3300035092 Unclassified 620
684 Ga0373932_0065347 3300035112 Bacteria 1116
685 Ga0373936_0238664 3300035113 Unclassified 810
686 Ga0373945_0190425 3300035116 Unclassified 848
687 Ga0373943_0042898 3300035170 Unclassified 2194
688 Ga0373943_0048045 3300035170 Bacteria 2089
689 Ga0373943_0059092 3300035170 Bacteria 1910
690 Ga0373943_0143888 3300035170 Bacteria 1287
691 Ga0373943_0456090 3300035170 Unclassified 743
692 Ga0373943_0462981 3300035170 Unclassified 738
693 Ga0373943_0534342 3300035170 Unclassified 687
694 Ga0373946_0306263 3300035171 Unclassified 787
695 Ga0373946_0323505 3300035171 Bacteria 767
696 Ga0373946_0353357 3300035171 Unclassified 735
697 Ga0373955_0016730 3300035172 Bacteria 3614
698 Ga0373931_0286781 3300035691 Unclassified 1013
699 Ga0373935_0138898 3300035692 Bacteria 1640
700 Ga0373927_0050079 3300035695 Bacteria 2700
701 Ga0373927_0074251 3300035695 Bacteria 2202
702 Ga0373927_0253645 3300035695 Bacteria 1156
703 Ga0373927_0630315 3300035695 Unclassified 709
704 Ga0373947_0055536 3300035725 Bacteria 2392
705 Ga0373947_0133623 3300035725 Bacteria 1586
706 Ga0373947_0141108 3300035725 Unclassified 1545
707 Ga0373947_0154618 3300035725 Unclassified 1479
708 Ga0373947_0155408 3300035725 Bacteria 1476
709 Ga0373947_0307022 3300035725 Unclassified 1059
710 Ga0373947_0336005 3300035725 Unclassified 1012
711 Ga0373937_0028930 3300036401 Bacteria 5017
712 Ga0373937_0165326 3300036401 Bacteria 2075
713 Ga0373937_0395709 3300036401 Unclassified 1311
714 Ga0373925_0030700 3300037068 Bacteria 3946
715 Ga0373925_0038373 3300037068 Bacteria 3541
716 Ga0373925_0061788 3300037068 Bacteria 2815
717 Ga0373925_0160806 3300037068 Bacteria 1769
718 Ga0373925_0242065 3300037068 Unclassified 1445
719 Ga0373925_0449387 3300037068 Unclassified 1055
720 Ga0373925_0804095 3300037068 Unclassified 775
721 Ga0395899_0034098 3300037312 Bacteria 3822
722 Ga0395899_0203053 3300037312 Unclassified 1381
723 Ga0395899_0205498 3300037312 Bacteria 1371
724 Ga0395900_0004747 3300037418 Bacteria 14333
725 Ga0395900_0027369 3300037418 Bacteria 5839
726 Ga0395900_0207844 3300037418 Bacteria 1978
727 Ga0395900_0879588 3300037418 Unclassified 820
728 Ga0395900_1145092 3300037418 Unclassified 694
729 Ga0395898_0058206 3300037466 Bacteria 3763
730 Ga0395898_0775221 3300037466 Bacteria 900
731 Ga0395898_1307453 3300037466 Unclassified 654
732 Ga0395905_0005772 3300037471 Bacteria 12581
733 Ga0395901_0001709 3300038443 Bacteria 22672
734 Ga0395901_0154269 3300038443 Bacteria 2412
735 Ga0395901_0548172 3300038443 Bacteria 1172
736 Ga0395901_0753039 3300038443 Unclassified 967
737 Ga0395901_0911845 3300038443 Unclassified 860
738 Ga0395901_1068953 3300038443 Bacteria 779
739 Ga0451807_1293021 3300041486 Unclassified 966
740 Ga0451851_1337473 3300041507 Bacteria 1506
741 Ga0451853_1067222 3300041512 Unclassified 720
742 Ga0439448_0075180 3300042005 Unclassified 1129
743 Ga0439451_061813 3300042009 Unclassified 749
744 Ga0439455_0046001 3300042012 Unclassified 1130
745 Ga0439455_0092645 3300042012 Unclassified 830
746 Ga0439458_0020344 3300042157 Unclassified 1532
747 Ga0439464_0045986 3300042439 Unclassified 1254
748 Ga0439464_0177791 3300042439 Unclassified 673
749 Ga0466967_0176308 3300045976 Bacteria 2014
750 Ga0466967_1169049 3300045976 Unclassified 767
751 Ga0495592_0174805 3300046454 Bacteria 1467
752 Ga0495592_0203351 3300046454 Bacteria 1335
753 Ga0495629_0167134 3300046459 Bacteria 1527
754 Ga0495629_0323685 3300046459 Unclassified 1054
755 Ga0495641_0026217 3300046461 Unclassified 2847
756 Ga0495651_0134624 3300046462 Bacteria 1800
757 Ga0495653_0252862 3300046463 Unclassified 1169
758 Ga0495580_0024977 3300046472 Bacteria 4369
759 Ga0495580_0118896 3300046472 Bacteria 1835
760 Ga0495580_0268695 3300046472 Unclassified 1165
761 Ga0495639_0054856 3300046475 Unclassified 1817
762 Ga0495662_0292451 3300046476 Bacteria 802
763 Ga0495664_0310308 3300046477 Unclassified 952
764 Ga0495584_0403452 3300046491 Unclassified 695
765 Ga0495585_0538964 3300046492 Unclassified 552
766 Ga0495594_0062459 3300046499 Unclassified 2063
767 Ga0495608_0427209 3300046511 Unclassified 808
768 Ga0495618_0298917 3300046514 Bacteria 1000
769 Ga0495618_0303106 3300046514 Unclassified 993
770 Ga0495628_0025280 3300046516 Bacteria 4851
771 Ga0495628_0065668 3300046516 Bacteria 2837
772 Ga0495652_0071819 3300046529 Bacteria 2887
773 Ga0495652_0467201 3300046529 Unclassified 880
774 Ga0495665_0113858 3300046531 Unclassified 1418
775 Ga0495640_0338579 3300046533 Bacteria 930
776 Ga0495586_0014965 3300046535 Unclassified 4123
777 Ga0495587_0032871 3300046536 Bacteria 3133
778 Ga0495587_0118785 3300046536 Unclassified 1515
779 Ga0495645_0018884 3300046543 Bacteria 4959
780 Ga0495667_0235171 3300046559 Unclassified 1168
781 Ga0495667_0316346 3300046559 Unclassified 988
782 Ga0495634_0067123 3300046642 Unclassified 2373
783 Ga0495634_0138275 3300046642 Unclassified 1548
784 Ga0495635_0162115 3300046663 Bacteria 1522
785 Ga0495635_0966655 3300046663 Unclassified 543
786 Ga0495657_0297620 3300046675 Bacteria 963
787 Ga0495599_0009881 3300046678 Bacteria 5839
788 Ga0495623_0084428 3300046679 Bacteria 1959
789 Ga0495623_0610767 3300046679 Bacteria 566
790 Ga0495646_0349084 3300046680 Bacteria 775
791 Ga0495647_0151286 3300046681 Unclassified 995
792 Ga0495647_0559416 3300046681 Unclassified 535
793 Ga0495658_0035562 3300046683 Bacteria 2742
794 Ga0495658_0137626 3300046683 Unclassified 1491
795 Ga0495658_0144605 3300046683 Bacteria 1456
796 Ga0495669_0063355 3300046684 Bacteria 1677
797 Ga0495669_0175990 3300046684 Bacteria 1019
798 Ga0495613_0114128 3300046689 Bacteria 1945
799 Ga0495670_0105854 3300046691 Unclassified 1453
800 Ga0495604_0360981 3300047317 Bacteria 963
801 Ga0495674_0095486 3300047319 Bacteria 2535
802 Ga0495674_0106224 3300047319 Bacteria 2385
803 Ga0495674_0537960 3300047319 Bacteria 931
804 Ga0495676_0099662 3300047321 Bacteria 2153
805 Ga0495684_0019922 3300047471 Bacteria 5169
806 Ga0495684_0021901 3300047471 Unclassified 4921
807 Ga0495602_0249500 3300048088 Bacteria 1323
808 Ga0496100_0218524 3300048903 Unclassified 1397
809 Ga0496100_0727553 3300048903 Bacteria 775
810 Ga0496100_0943158 3300048903 Unclassified 678
811 Ga0496101_0008167 3300048904 Bacteria 6835
812 Ga0496101_0086242 3300048904 Bacteria 2328
813 Ga0496101_0088718 3300048904 Bacteria 2297
814 Ga0496101_0572582 3300048904 Bacteria 893
815 Ga0496101_0817184 3300048904 Bacteria 735
816 Ga0496102_0034150 3300048905 Bacteria 4574
817 Ga0496102_0091941 3300048905 Bacteria 2809
818 Ga0496102_0297121 3300048905 Bacteria 1522
819 Ga0496102_0320847 3300048905 Bacteria 1459
820 Ga0496102_1408062 3300048905 Bacteria 616
821 Ga0496103_0035015 3300048906 Bacteria 3073
822 Ga0496103_0064177 3300048906 Unclassified 2289
823 Ga0496103_0088570 3300048906 Bacteria 1952
824 Ga0496104_0038061 3300048907 Unclassified 4499
825 Ga0496104_0137228 3300048907 Bacteria 2350
826 Ga0496104_0270121 3300048907 Unclassified 1613
827 Ga0496105_0067707 3300048908 Bacteria 2948
828 Ga0496105_0664462 3300048908 Bacteria 803
829 Ga0496105_0818715 3300048908 Bacteria 707
830 Ga0496105_1104691 3300048908 Unclassified 588
831 Ga0496106_0003127 3300048909 Bacteria 12356
832 Ga0496106_0045492 3300048909 Bacteria 3297
833 Ga0496106_0179925 3300048909 Bacteria 1678
834 Ga0496107_0071857 3300048910 Unclassified 2515
835 Ga0496107_0170584 3300048910 Bacteria 1614
836 Ga0496108_0002475 3300048911 Bacteria 14788
837 Ga0496108_0124094 3300048911 Bacteria 2216
838 Ga0496109_0002007 3300048912 Bacteria 16881
839 Ga0496109_0126388 3300048912 Bacteria 2384
840 Ga0496109_0192938 3300048912 Unclassified 1914
841 Ga0496109_0224434 3300048912 Bacteria 1767
842 Ga0496109_0555403 3300048912 Bacteria 1083
843 Ga0496109_0680865 3300048912 Unclassified 966
844 Ga0496109_0718451 3300048912 Unclassified 937
845 Ga0496109_0983796 3300048912 Unclassified 781
846 Ga0496110_0167362 3300048913 Bacteria 1994
847 Ga0496110_0314139 3300048913 Unclassified 1427
848 Ga0496110_0427562 3300048913 Unclassified 1207
849 Ga0496110_0901364 3300048913 Bacteria 790
850 Ga0496111_0313276 3300048914 Unclassified 1163
851 Ga0496111_0489422 3300048914 Unclassified 906
852 Ga0496111_0879335 3300048914 Unclassified 646
853 Ga0496112_0021831 3300048915 Bacteria 6092
854 Ga0496112_0039437 3300048915 Bacteria 4616
855 Ga0496112_0072132 3300048915 Bacteria 3413
856 Ga0496112_0154011 3300048915 Bacteria 2266
857 Ga0496112_0410503 3300048915 Bacteria 1293
858 Ga0496112_0483551 3300048915 Unclassified 1174
859 Ga0496112_0978804 3300048915 Bacteria 766
860 Ga0496113_0017817 3300048916 Bacteria 4937
861 Ga0496113_0390114 3300048916 Unclassified 1118
862 Ga0496113_0466479 3300048916 Unclassified 1015
863 Ga0496113_1007540 3300048916 Bacteria 656
864 Ga0496114_0070174 3300048917 Bacteria 2942
865 Ga0496114_0074455 3300048917 Bacteria 2858
866 Ga0496115_0001716 3300048918 Bacteria 15716
867 Ga0496115_0005334 3300048918 Bacteria 9351
868 Ga0496115_0048497 3300048918 Bacteria 3397
869 Ga0496115_0205171 3300048918 Bacteria 1628
870 Ga0496115_0458260 3300048918 Bacteria 1029
871 Ga0496115_0544345 3300048918 Unclassified 928
872 nmdc:mga05p37_11154_c1 3300050507 Bacteria 10679
873 nmdc:mga05p37_1161025_c1 3300050507 Bacteria 802
874 nmdc:mga09592_725692_c1 3300050508 Unclassified 844
875 nmdc:mga08y16_1048857_c1 3300050511 Unclassified 793
876 nmdc:mga08y16_472578_c1 3300050511 Unclassified 1276
877 nmdc:mga0n895_1009093_c1 3300050512 Unclassified 813
878 nmdc:mga0n895_1189287_c1 3300050512 Unclassified 737
879 nmdc:mga0n895_1493430_c1 3300050512 Unclassified 642
880 nmdc:mga0n895_164699_c1 3300050512 Unclassified 2248
881 nmdc:mga0n895_531066_c1 3300050512 Bacteria 1183
882 nmdc:mga0rr50_183777_c1 3300050513 Unclassified 1710
883 nmdc:mga0rr50_616320_c1 3300050513 Unclassified 925
884 nmdc:mga0a205_184866_c1 3300050515 Bacteria 1977
885 nmdc:mga0a205_294939_c1 3300050515 Bacteria 1495
886 Ga0495601_0007392 3300053077 Bacteria 6438
887 Ga0495601_0275630 3300053077 Unclassified 1097
888 Ga0495601_0441413 3300053077 Unclassified 842
889 Ga0495655_0019419 3300053083 Unclassified 1509
890 Ga0495595_0130736 3300053084 Unclassified 1227
891 Ga0495619_0397943 3300053085 Unclassified 951
892 Ga0495619_0555903 3300053085 Unclassified 787
893 Ga0070708_100141224
894 MRS1b_contig_2830796
895 CNXas_1000175
896 JGI24743J22301_10026090
897 JGI24744J21845_10030033
898 JGI24035J26624_1000312
899 JGI24035J26624_1010694
900 JGI25406J46586_10000087
901 JGI25404J52841_10034122
902 JGI25404J52841_10037765
903 JGI25405J52794_10002248
904 Ga0065714_10074791
905 Ga0065704_10004342
906 Ga0065704_10007456
907 Ga0065704_10208367
908 Ga0065704_10224532
909 Ga0065704_10276134
910 Ga0065712_10000626
911 Ga0065712_10000905
912 Ga0065712_10013724
913 Ga0065712_10152655
914 Ga0065712_10157591
915 Ga0065712_10184093
916 Ga0065712_10277231
917 Ga0065712_10566293
918 Ga0065715_10000684
919 Ga0065715_10096116
920 Ga0065715_10119506
921 Ga0065715_10139121
922 Ga0065715_10155410
923 Ga0065715_10183971
924 Ga0065715_10254275
925 Ga0065715_10254541
926 Ga0065715_10346789
927 Ga0065707_10038280
928 Ga0065707_10182607
929 Ga0065707_10199640
930 Ga0065707_10282882
931 Ga0070658_10207669
932 Ga0070676_10006832
933 Ga0070676_10033669
934 Ga0070676_10057069
935 Ga0070676_10097729
936 Ga0070676_10180338
937 Ga0070676_10182136
938 Ga0070676_10681466
939 Ga0070676_10725614
940 Ga0070683_100072990
941 Ga0070683_100429276
942 Ga0070683_100482621
943 Ga0070690_100034312
944 Ga0070690_100043685
945 Ga0070690_100184942
946 Ga0070690_100310089
947 Ga0070690_101026207
948 Ga0070670_100021803
949 Ga0070670_100203823
950 Ga0070670_100234460
951 Ga0070670_100426207
952 Ga0068869_100271954
953 Ga0070666_10006905
954 Ga0070666_10066253
955 Ga0070666_10102611
956 Ga0070666_10298572
957 Ga0070666_10557803
958 Ga0070680_100965357
959 Ga0068868_100078073
960 Ga0068868_100161429
961 Ga0070660_100278395
962 Ga0070660_100292312
963 Ga0070689_100002634
964 Ga0070689_100086170
965 Ga0070689_100087060
966 Ga0070689_100176879
967 Ga0070687_100466876
968 Ga0070687_100624047
969 Ga0070661_100077831
970 Ga0070661_100620001
971 Ga0070692_10057160
972 Ga0070668_100007124
973 Ga0070668_100029371
974 Ga0070668_100034747
975 Ga0070668_100059230
976 Ga0070668_100127831
977 Ga0070668_100401712
978 Ga0070668_101459151
979 Ga0070669_100005219
980 Ga0070669_100015119
981 Ga0070669_100043415
982 Ga0070669_100056295
983 Ga0070669_100150851
984 Ga0070675_100010416
985 Ga0070675_100013878
986 Ga0070675_100030993
987 Ga0070675_100043862
988 Ga0070675_101014387
989 Ga0070671_100018196
990 Ga0070671_100076493
991 Ga0070671_100086738
992 Ga0070671_100106529
993 Ga0070671_100245718
994 Ga0070671_100948088
995 Ga0070674_100018553
996 Ga0070674_100021908
997 Ga0070674_100142803
998 Ga0070674_100509609
999 Ga0070674_100864931
1000 Ga0070674_100894038
1001 Ga0070673_100007694
1002 Ga0070673_100012707
1003 Ga0070673_100082328
1004 Ga0070673_100158244
1005 Ga0070673_100915819
1006 Ga0070673_101580235
1007 Ga0070688_100001014
1008 Ga0070688_100019023
1009 Ga0070688_100118515
1010 Ga0070688_100150872
1011 Ga0070688_101306497
1012 Ga0070659_100015190
1013 Ga0070659_100018746
1014 Ga0070667_100018730
1015 Ga0070667_100051082
1016 Ga0070667_100081368
1017 Ga0070667_100460680
1018 Ga0070703_10104910
1019 Ga0070709_10018947
1020 Ga0070709_10649702
1021 Ga0070709_11203997
1022 Ga0070714_100042855
1023 Ga0070714_100048583
1024 Ga0070714_100534016
1025 Ga0070713_100009589
1026 Ga0070713_100061038
1027 Ga0070713_100101766
1028 Ga0070713_100145613
1029 Ga0070713_100315406
1030 Ga0070713_101010218
1031 Ga0070710_10003850
1032 Ga0070710_10206346
1033 Ga0070710_10232503
1034 Ga0070710_10264215
1035 Ga0070710_10751118
1036 Ga0070711_100008313
1037 Ga0070711_100173248
1038 Ga0070711_100193764
1039 Ga0070711_100219692
1040 Ga0070711_100331985
1041 Ga0070711_100913554
1042 Ga0070705_100094700
1043 Ga0070705_100121072
1044 Ga0070705_100320040
1045 Ga0070705_100335696
1046 Ga0070700_100066401
1047 Ga0070694_100979022
1048 Ga0070694_101066971
1049 Ga0070708_100001246
1050 Ga0070708_100014035
1051 Ga0070708_100041281
1052 Ga0070708_100071778
1053 Ga0070708_100108282
1054 Ga0070708_100168149
1055 Ga0070708_100209834
1056 Ga0070708_100331098
1057 Ga0070708_100672563
1058 Ga0070708_100677399
1059 Ga0070708_101083115
1060 Ga0070663_100021879
1061 Ga0070663_100030814
1062 Ga0070678_100053696
1063 Ga0070678_100078766
1064 Ga0070678_100139478
1065 Ga0070662_100010037
1066 Ga0070662_100035606
1067 Ga0070662_100184868
1068 Ga0070662_100279896
1069 Ga0070662_100339608
1070 Ga0070662_100985827
1071 Ga0070681_10030785
1072 Ga0070681_10314375
1073 Ga0068867_100101497
1074 Ga0068867_100328765
1075 Ga0070685_10015868
1076 Ga0070685_10018427
1077 Ga0070706_100000269
1078 Ga0070706_100004511
1079 Ga0070706_100007002
1080 Ga0070706_100010420
1081 Ga0070706_100020333
1082 Ga0070706_100030390
1083 Ga0070706_100064264
1084 Ga0070706_100068685
1085 Ga0070706_100155064
1086 Ga0070706_100215389
1087 Ga0070706_100242551
1088 Ga0070706_100246388
1089 Ga0070706_100353306
1090 Ga0070706_100721770
1091 Ga0070706_100780482
1092 Ga0070706_100862305
1093 Ga0070706_101207220
1094 Ga0070706_101223064
1095 Ga0070707_100021300
1096 Ga0070707_100029036
1097 Ga0070707_100040241
1098 Ga0070707_100082456
1099 Ga0070707_100174169
1100 Ga0070707_100179344
1101 Ga0070707_100252440
1102 Ga0070707_100268875
1103 Ga0070707_100287992
1104 Ga0070707_100757385
1105 Ga0070707_100788599
1106 Ga0070707_101193393
1107 Ga0070698_100001933
1108 Ga0070698_100498205
1109 Ga0070698_100815826
1110 Ga0070698_101234527
1111 Ga0070699_100017643
1112 Ga0070699_100081643
1113 Ga0070699_100155142
1114 Ga0070699_100644198
1115 Ga0070699_101605634
1116 Ga0070679_100083609
1117 Ga0070684_100032398
1118 Ga0070684_100044817
1119 Ga0070684_100049498
1120 Ga0070684_100131389
1121 Ga0070684_100225139
1122 Ga0070697_100005205
1123 Ga0070697_100006587
1124 Ga0070697_100028885
1125 Ga0070697_100030661
1126 Ga0070697_100037478
1127 Ga0070697_100037985
1128 Ga0070697_100056434
1129 Ga0070697_100152222
1130 Ga0070697_100156565
1131 Ga0070697_100244168
1132 Ga0070697_100305785
1133 Ga0070697_100567572
1134 Ga0070697_101135261
1135 Ga0070672_100004083
1136 Ga0070672_100024482
1137 Ga0070672_100074498
1138 Ga0070672_100171408
1139 Ga0070672_100179073
1140 Ga0070672_100380597
1141 Ga0070672_100398902
1142 Ga0070672_100544932
1143 Ga0070686_100043786
1144 Ga0070693_100243079
1145 Ga0070665_100016091
1146 Ga0070665_100041976
1147 Ga0070665_100194440
1148 Ga0070665_100219570
1149 Ga0070665_100506405
1150 Ga0070665_100966177
1151 Ga0070704_100044622
1152 Ga0070704_100146156
1153 Ga0070704_100374619
1154 Ga0068855_100295577
1155 Ga0070664_100075886
1156 Ga0070664_100298699
1157 Ga0070664_100637840
1158 Ga0070702_100292818
1159 Ga0068859_100201005
1160 Ga0068859_101165342
1161 Ga0068866_10159303
1162 Ga0068866_10703705
1163 Ga0068861_100036591
1164 Ga0068861_100240392
1165 Ga0068861_101589970
1166 Ga0068863_100138451
1167 Ga0068863_100335486
1168 Ga0068863_100915242
1169 Ga0068863_100947007
1170 Ga0068858_100058111
1171 Ga0068858_100797227
1172 Ga0068858_101712248
1173 Ga0068860_100026862
1174 Ga0068860_100412032
1175 Ga0068860_100565109
1176 Ga0068862_100350877
1177 Ga0081455_10001399
1178 Ga0081455_10011319
1179 Ga0081455_10016230
1180 Ga0081455_10024323
1181 Ga0081455_10026186
1182 Ga0081455_10027681
1183 Ga0081455_10360020
1184 Ga0081455_10388173
1185 Ga0081455_10453528
1186 Ga0081540_1000036
1187 Ga0081540_1025381
1188 Ga0081540_1033289
1189 Ga0081539_10000727
1190 Ga0081539_10001132
1191 Ga0081539_10088653
1192 Ga0070717_10000989
1193 Ga0070717_10013344
1194 Ga0070717_10028937
1195 Ga0070717_10121318
1196 Ga0070717_10144273
1197 Ga0070717_10188544
1198 Ga0070717_10302706
1199 Ga0070717_10406552
1200 Ga0070717_11081801
1201 Ga0070715_10053465
1202 Ga0070716_100239024
1203 Ga0070716_100594412
1204 Ga0070712_100008008
1205 Ga0070712_100011301
1206 Ga0070712_100045849
1207 Ga0070712_100081663
1208 Ga0070712_100094353
1209 Ga0070712_100096439
1210 Ga0070712_100170006
1211 Ga0070712_100201180
1212 Ga0070712_100321903
1213 Ga0070712_100363458
1214 Ga0070712_100591734
1215 Ga0097621_100076154
1216 Ga0097621_100092818
1217 Ga0097621_100099690
1218 Ga0097621_100438891
1219 Ga0068871_100135467
1220 Ga0068871_100195061
1221 Ga0068871_100252441
1222 Ga0068871_100944839
1223 Ga0075428_100881155
1224 Ga0075433_10270533
1225 Ga0075433_10565652
1226 Ga0075433_10678673
1227 Ga0075434_100195123
1228 Ga0075434_100288099
1229 Ga0075434_100313598
1230 Ga0075434_100662672
1231 Ga0075434_100691164
1232 Ga0075429_100811826
1233 Ga0068865_100040646
1234 Ga0068865_100599774
1235 Ga0075436_100071988
1236 Ga0097620_100201007
1237 Ga0097620_101165296
1238 Ga0075435_100502079
1239 Ga0099795_10043626
1240 Ga0105240_10271232
1241 Ga0111539_10250683
1242 Ga0111539_10794807
1243 Ga0111539_10903566
1244 Ga0105245_10523316
1245 Ga0105245_10680662
1246 Ga0105245_10896568
1247 Ga0105245_11092012
1248 Ga0105247_10107485
1249 Ga0105247_10975712
1250 Ga0114129_10108940
1251 Ga0114129_10343212
1252 Ga0114129_10550244
1253 Ga0114129_10652958
1254 Ga0105243_10273657
1255 Ga0105243_10431976
1256 Ga0105243_10602715
1257 Ga0105243_11641250
1258 Ga0105243_12641502
1259 Ga0105241_10120467
1260 Ga0105241_11050930
1261 Ga0105242_10077802
1262 Ga0105242_10142894
1263 Ga0105242_11018539
1264 Ga0105242_11073914
1265 Ga0105248_10269992
1266 Ga0105248_10554940
1267 Ga0105237_11703568
1268 Ga0105238_10943343
1269 Ga0105249_10029493
1270 Ga0105249_10160954
1271 Ga0105249_10397580
1272 Ga0105249_10531582
1273 Ga0105249_11299070
1274 Ga0099796_10020855
1275 Ga0099796_10045340
1276 Ga0099796_10264980
1277 Ga0105239_10003969
1278 Ga0105239_10646859
1279 Ga0105239_11213130
1280 Ga0105246_10116656
1281 Ga0105246_10175519
1282 Ga0105246_10970379
1283 Ga0157315_1010269
1284 Ga0157371_10066841
1285 Ga0157371_10526145
1286 Ga0157371_10549419
1287 Ga0157369_11302992
1288 Ga0157374_10009864
1289 Ga0157374_10017988
1290 Ga0157374_10027132
1291 Ga0157374_10045827
1292 Ga0157374_10059858
1293 Ga0157374_10078888
1294 Ga0157374_10118282
1295 Ga0157374_10158582
1296 Ga0157374_10292875
1297 Ga0157374_10303687
1298 Ga0157374_10330276
1299 Ga0157374_10544642
1300 Ga0157374_10856921
1301 Ga0157374_11388829
1302 Ga0157378_10013936
1303 Ga0157378_10052952
1304 Ga0157378_10075047
1305 Ga0157378_10122234
1306 Ga0157378_10228801
1307 Ga0157378_10684582
1308 Ga0157378_10843586
1309 Ga0157378_10847336
1310 Ga0157378_10980328
1311 Ga0157378_11000621
1312 Ga0163162_10006459
1313 Ga0163162_10104768
1314 Ga0163162_10137299
1315 Ga0163162_10141758
1316 Ga0163162_10171473
1317 Ga0163162_10172172
1318 Ga0163162_10307324
1319 Ga0163162_10426785
1320 Ga0163162_10438666
1321 Ga0163162_11167150
1322 Ga0163162_11391466
1323 Ga0157372_10068892
1324 Ga0157372_10111374
1325 Ga0157372_10214195
1326 Ga0157372_12126886
1327 Ga0157375_10023260
1328 Ga0157375_10030865
1329 Ga0157375_10039200
1330 Ga0157375_10089755
1331 Ga0157375_10259734
1332 Ga0157375_10712721
1333 Ga0163163_10015125
1334 Ga0163163_10439317
1335 Ga0163163_10897321
1336 Ga0157377_10031453
1337 Ga0157377_10333367
1338 Ga0157377_10856919
1339 Ga0157379_10151190
1340 Ga0157379_10237893
1341 Ga0157379_10297411
1342 Ga0157379_10505961
1343 Ga0157376_10047094
1344 Ga0157376_10069981
1345 Ga0157376_10072651
1346 Ga0157376_10167479
1347 Ga0157376_10181437
1348 Ga0157376_10459536
1349 Ga0157376_10748738
1350 Ga0157376_11776327
1351 Ga0163161_10068564
1352 Ga0163161_10253544
1353 Ga0163161_10785455
1354 Ga0207666_1000268
1355 Ga0207666_1000445
1356 Ga0207673_1010655
1357 Ga0207697_10000305
1358 Ga0207697_10000749
1359 Ga0207697_10002349
1360 Ga0207697_10002915
1361 Ga0207697_10040533
1362 Ga0207697_10069836
1363 Ga0207697_10069930
1364 Ga0207697_10093609
1365 Ga0207697_10101190
1366 Ga0207697_10191537
1367 Ga0207697_10261760
1368 Ga0207697_10435088
1369 Ga0207656_10327457
1370 Ga0207696_1063563
1371 Ga0207682_10031850
1372 Ga0207692_10007795
1373 Ga0207692_10059860
1374 Ga0207692_10164757
1375 Ga0207710_10462373
1376 Ga0207688_10014931
1377 Ga0207688_10024140
1378 Ga0207688_10032890
1379 Ga0207688_10040485
1380 Ga0207688_10352592
1381 Ga0207680_10426575
1382 Ga0207680_10492829
1383 Ga0207680_10602004
1384 Ga0207680_10685146
1385 Ga0207647_10056519
1386 Ga0207685_10048137
1387 Ga0207685_10102253
1388 Ga0207699_10702471
1389 Ga0207699_10882727
1390 Ga0207645_10001207
1391 Ga0207645_10030242
1392 Ga0207645_10067393
1393 Ga0207645_10101892
1394 Ga0207645_10191261
1395 Ga0207705_10330021
1396 Ga0207684_10000134
1397 Ga0207684_10010852
1398 Ga0207684_10026757
1399 Ga0207684_10051976
1400 Ga0207684_10060083
1401 Ga0207684_10092011
1402 Ga0207684_10136003
1403 Ga0207684_10266201
1404 Ga0207684_10318222
1405 Ga0207684_10379877
1406 Ga0207684_10486180
1407 Ga0207684_10981516
1408 Ga0207707_10035655
1409 Ga0207671_10215675
1410 Ga0207693_10001338
1411 Ga0207693_10052702
1412 Ga0207693_10063808
1413 Ga0207693_10085453
1414 Ga0207693_10114960
1415 Ga0207693_10142725
1416 Ga0207693_10311988
1417 Ga0207693_10485187
1418 Ga0207663_10055090
1419 Ga0207663_10089367
1420 Ga0207663_10261454
1421 Ga0207663_10374212
1422 Ga0207660_10082617
1423 Ga0207662_10015959
1424 Ga0207662_10047476
1425 Ga0207662_10727218
1426 Ga0207657_10182461
1427 Ga0207657_10199927
1428 Ga0207657_10751470
1429 Ga0207652_10117862
1430 Ga0207646_10022265
1431 Ga0207646_10041787
1432 Ga0207646_10100357
1433 Ga0207646_10102548
1434 Ga0207646_10153427
1435 Ga0207646_10236366
1436 Ga0207646_10296485
1437 Ga0207646_10550484
1438 Ga0207646_10640832
1439 Ga0207646_10679888
1440 Ga0207681_10012037
1441 Ga0207681_10055235
1442 Ga0207681_10092103
1443 Ga0207681_10138924
1444 Ga0207681_10161894
1445 Ga0207681_10476435
1446 Ga0207650_10102795
1447 Ga0207650_10173665
1448 Ga0207650_10302536
1449 Ga0207650_10329433
1450 Ga0207659_10034033
1451 Ga0207659_10091247
1452 Ga0207659_10091540
1453 Ga0207659_10098795
1454 Ga0207659_10117709
1455 Ga0207659_10121309
1456 Ga0207659_10170598
1457 Ga0207659_10893348
1458 Ga0207687_10077931
1459 Ga0207687_10174505
1460 Ga0207687_10375345
1461 Ga0207687_10387745
1462 Ga0207687_10924025
1463 Ga0207700_10007438
1464 Ga0207700_10115020
1465 Ga0207700_10296271
1466 Ga0207700_10720980
1467 Ga0207664_10059774
1468 Ga0207664_10093216
1469 Ga0207664_10619773
1470 Ga0207664_10640954
1471 Ga0207644_10109616
1472 Ga0207644_10129688
1473 Ga0207644_10144973
1474 Ga0207644_10164028
1475 Ga0207644_10414778
1476 Ga0207644_10543823
1477 Ga0207690_10016085
1478 Ga0207690_10017865
1479 Ga0207690_10214696
1480 Ga0207706_10000989
1481 Ga0207706_10015312
1482 Ga0207706_10045022
1483 Ga0207706_10240414
1484 Ga0207706_10311032
1485 Ga0207706_10416782
1486 Ga0207706_10460365
1487 Ga0207686_10083840
1488 Ga0207686_11497963
1489 Ga0207709_10294603
1490 Ga0207670_10009364
1491 Ga0207670_10126553
1492 Ga0207670_10329004
1493 Ga0207669_10257281
1494 Ga0207704_10279035
1495 Ga0207704_10510315
1496 Ga0207665_10029353
1497 Ga0207665_10071887
1498 Ga0207665_11390091
1499 Ga0207691_10000847
1500 Ga0207691_10003287
1501 Ga0207691_10060881
1502 Ga0207691_10100787
1503 Ga0207691_10205379
1504 Ga0207691_10393784
1505 Ga0207691_10848882
1506 Ga0207689_10060604
1507 Ga0207661_10075909
1508 Ga0207661_10088850
1509 Ga0207661_10472589
1510 Ga0207661_10915240
1511 Ga0207679_10116924
1512 Ga0207679_10344760
1513 Ga0207679_11251812
1514 Ga0207667_10514162
1515 Ga0207651_10037857
1516 Ga0207651_10082943
1517 Ga0207651_10331047
1518 Ga0207651_10467867
1519 Ga0207712_10161333
1520 Ga0207712_10297893
1521 Ga0207712_11431089
1522 Ga0207668_10089010
1523 Ga0207668_10161033
1524 Ga0207668_10205587
1525 Ga0207668_10216282
1526 Ga0207668_10246573
1527 Ga0207668_10311339
1528 Ga0207668_10548531
1529 Ga0207658_10067665
1530 Ga0207658_10178922
1531 Ga0207658_10245723
1532 Ga0207658_10998773
1533 Ga0207677_10108448
1534 Ga0207677_10134711
1535 Ga0207677_10156284
1536 Ga0207677_10228020
1537 Ga0207677_10237647
1538 Ga0207677_10379662
1539 Ga0207677_10770261
1540 Ga0207703_10029366
1541 Ga0207703_10792339
1542 Ga0207678_10014322
1543 Ga0207678_10670338
1544 Ga0207708_10068379
1545 Ga0207641_10019247
1546 Ga0207641_10042174
1547 Ga0207648_10092561
1548 Ga0207648_10226205
1549 Ga0207648_10347627
1550 Ga0207648_10476660
1551 Ga0207675_100050517
1552 Ga0207675_100305166
1553 Ga0207675_101317458
1554 Ga0207675_101639062
1555 Ga0207683_10049059
1556 Ga0207683_10201969
1557 Ga0209179_1027732
1558 Ga0209974_10043679
1559 Ga0209974_10058584
1560 Ga0268266_10008426
1561 Ga0268266_10011362
1562 Ga0268266_10013533
1563 Ga0268266_10013597
1564 Ga0268266_10169519
1565 Ga0268265_10269186
1566 Ga0268264_10066327
1567 Ga0268264_10073739
1568 Ga0268264_10159138
1569 Ga0268264_11349505
1570 Ga0307513_10058975
1571 Ga0373926_0235552
1572 Ga0373944_0034315
1573 Ga0373944_0164429
1574 Ga0373944_0202578
1575 Ga0373952_0171847
1576 Ga0373932_0065347
1577 Ga0373936_0238664
1578 Ga0373945_0190425
1579 Ga0373943_0042898
1580 Ga0373943_0048045
1581 Ga0373943_0059092
1582 Ga0373943_0143888
1583 Ga0373943_0456090
1584 Ga0373943_0462981
1585 Ga0373943_0534342
1586 Ga0373946_0306263
1587 Ga0373946_0323505
1588 Ga0373946_0353357
1589 Ga0373955_0016730
1590 Ga0373931_0286781
1591 Ga0373935_0138898
1592 Ga0373927_0050079
1593 Ga0373927_0074251
1594 Ga0373927_0253645
1595 Ga0373927_0630315
1596 Ga0373947_0055536
1597 Ga0373947_0133623
1598 Ga0373947_0141108
1599 Ga0373947_0154618
1600 Ga0373947_0155408
1601 Ga0373947_0307022
1602 Ga0373947_0336005
1603 Ga0373937_0028930
1604 Ga0373937_0165326
1605 Ga0373937_0395709
1606 Ga0373925_0030700
1607 Ga0373925_0038373
1608 Ga0373925_0061788
1609 Ga0373925_0160806
1610 Ga0373925_0242065
1611 Ga0373925_0449387
1612 Ga0373925_0804095
1613 Ga0395899_0034098
1614 Ga0395899_0203053
1615 Ga0395899_0205498
1616 Ga0395900_0004747
1617 Ga0395900_0027369
1618 Ga0395900_0207844
1619 Ga0395900_0879588
1620 Ga0395900_1145092
1621 Ga0395898_0058206
1622 Ga0395898_0775221
1623 Ga0395898_1307453
1624 Ga0395905_0005772
1625 Ga0395901_0001709
1626 Ga0395901_0154269
1627 Ga0395901_0548172
1628 Ga0395901_0753039
1629 Ga0395901_0911845
1630 Ga0395901_1068953
1631 Ga0451807_1293021
1632 Ga0451851_1337473
1633 Ga0451853_1067222
1634 Ga0439448_0075180
1635 Ga0439451_061813
1636 Ga0439455_0046001
1637 Ga0439455_0092645
1638 Ga0439458_0020344
1639 Ga0439464_0045986
1640 Ga0439464_0177791
1641 Ga0466967_0176308
1642 Ga0466967_1169049
1643 Ga0495592_0174805
1644 Ga0495592_0203351
1645 Ga0495629_0167134
1646 Ga0495629_0323685
1647 Ga0495641_0026217
1648 Ga0495651_0134624
1649 Ga0495653_0252862
1650 Ga0495580_0024977
1651 Ga0495580_0118896
1652 Ga0495580_0268695
1653 Ga0495639_0054856
1654 Ga0495662_0292451
1655 Ga0495664_0310308
1656 Ga0495584_0403452
1657 Ga0495585_0538964
1658 Ga0495594_0062459
1659 Ga0495608_0427209
1660 Ga0495618_0298917
1661 Ga0495618_0303106
1662 Ga0495628_0025280
1663 Ga0495628_0065668
1664 Ga0495652_0071819
1665 Ga0495652_0467201
1666 Ga0495665_0113858
1667 Ga0495640_0338579
1668 Ga0495586_0014965
1669 Ga0495587_0032871
1670 Ga0495587_0118785
1671 Ga0495645_0018884
1672 Ga0495667_0235171
1673 Ga0495667_0316346
1674 Ga0495634_0067123
1675 Ga0495634_0138275
1676 Ga0495635_0162115
1677 Ga0495635_0966655
1678 Ga0495657_0297620
1679 Ga0495599_0009881
1680 Ga0495623_0084428
1681 Ga0495623_0610767
1682 Ga0495646_0349084
1683 Ga0495647_0151286
1684 Ga0495647_0559416
1685 Ga0495658_0035562
1686 Ga0495658_0137626
1687 Ga0495658_0144605
1688 Ga0495669_0063355
1689 Ga0495669_0175990
1690 Ga0495613_0114128
1691 Ga0495670_0105854
1692 Ga0495604_0360981
1693 Ga0495674_0095486
1694 Ga0495674_0106224
1695 Ga0495674_0537960
1696 Ga0495676_0099662
1697 Ga0495684_0019922
1698 Ga0495684_0021901
1699 Ga0495602_0249500
1700 Ga0496100_0218524
1701 Ga0496100_0727553
1702 Ga0496100_0943158
1703 Ga0496101_0008167
1704 Ga0496101_0086242
1705 Ga0496101_0088718
1706 Ga0496101_0572582
1707 Ga0496101_0817184
1708 Ga0496102_0034150
1709 Ga0496102_0091941
1710 Ga0496102_0297121
1711 Ga0496102_0320847
1712 Ga0496102_1408062
1713 Ga0496103_0035015
1714 Ga0496103_0064177
1715 Ga0496103_0088570
1716 Ga0496104_0038061
1717 Ga0496104_0137228
1718 Ga0496104_0270121
1719 Ga0496105_0067707
1720 Ga0496105_0664462
1721 Ga0496105_0818715
1722 Ga0496105_1104691
1723 Ga0496106_0003127
1724 Ga0496106_0045492
1725 Ga0496106_0179925
1726 Ga0496107_0071857
1727 Ga0496107_0170584
1728 Ga0496108_0002475
1729 Ga0496108_0124094
1730 Ga0496109_0002007
1731 Ga0496109_0126388
1732 Ga0496109_0192938
1733 Ga0496109_0224434
1734 Ga0496109_0555403
1735 Ga0496109_0680865
1736 Ga0496109_0718451
1737 Ga0496109_0983796
1738 Ga0496110_0167362
1739 Ga0496110_0314139
1740 Ga0496110_0427562
1741 Ga0496110_0901364
1742 Ga0496111_0313276
1743 Ga0496111_0489422
1744 Ga0496111_0879335
1745 Ga0496112_0021831
1746 Ga0496112_0039437
1747 Ga0496112_0072132
1748 Ga0496112_0154011
1749 Ga0496112_0410503
1750 Ga0496112_0483551
1751 Ga0496112_0978804
1752 Ga0496113_0017817
1753 Ga0496113_0390114
1754 Ga0496113_0466479
1755 Ga0496113_1007540
1756 Ga0496114_0070174
1757 Ga0496114_0074455
1758 Ga0496115_0001716
1759 Ga0496115_0005334
1760 Ga0496115_0048497
1761 Ga0496115_0205171
1762 Ga0496115_0458260
1763 Ga0496115_0544345
1764 nmdc:mga05p37_11154_c1
1765 nmdc:mga05p37_1161025_c1
1766 nmdc:mga09592_725692_c1
1767 nmdc:mga08y16_1048857_c1
1768 nmdc:mga08y16_472578_c1
1769 nmdc:mga0n895_1009093_c1
1770 nmdc:mga0n895_1189287_c1
1771 nmdc:mga0n895_1493430_c1
1772 nmdc:mga0n895_164699_c1
1773 nmdc:mga0n895_531066_c1
1774 nmdc:mga0rr50_183777_c1
1775 nmdc:mga0rr50_616320_c1
1776 nmdc:mga0a205_184866_c1
1777 nmdc:mga0a205_294939_c1
1778 Ga0495601_0007392
1779 Ga0495601_0275630
1780 Ga0495601_0441413
1781 Ga0495655_0019419
1782 Ga0495595_0130736
1783 Ga0495619_0397943
1784 Ga0495619_0555903

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09438

DUF2017

Domain of unknown function (DUF2017)

25

180

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wy9-assembly1.cif.gz_B tcur3481-tcur3483 steroid acad g363a variant 0.4065 20 162
2ib0-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.4026 20 163
2ib0-assembly1.cif.gz_B crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.3891 20 161
5flz-assembly1.cif.gz_D cryo-em structure of gamma-tusc oligomers in a closed conformation 0.3891 84 157
5jsc-assembly1.cif.gz_A-2 crystal structure of a putative acyl-coa dehydrogenase from burkholderia xenovorans 0.3734 20 160
ID Description Score Start End Superfamily
af_G2J646_1_138_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4084 20 162 1.20.140.150
af_Q54CS1_1_135_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4081 17 160 1.20.1250.20
2ib0A01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3982 20 162 1.20.1260.10
af_Q60304_1_144_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3973 18 162 1.20.1070.10
af_P55344_52_170_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3948 20 162 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2V5Q384-F1-model_v4 Uncharacterized protein 0.9883 1 163
AF-A0A2V5QGV8-F1-model_v4 Uncharacterized protein 0.9833 1 152
AF-A0A2V5Q384-F1-model_v4 Uncharacterized protein 0.9823 1 163
AF-A0A2V5KJ62-F1-model_v4 Uncharacterized protein 0.9821 1 163
AF-A0A2V5M9G4-F1-model_v4 Uncharacterized protein 0.981 19 163

Map