F484881
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 892 | 276 | 1784 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100141224|Ga0070708_1001412242 |
| Length | 189 |
| Sequence | MCSNCTGISCSRRSRKPVDMEICRRNDVIEISELDPFLAELLRQIPASTDPEGVSAAEQRLFSPPADPKETEICAEWKLYVNPELRRLFQTATETVAADLEQLRGNEKTFANRSLHIPSNHAEEWLSALNQARLVIAAKYDFTDGELCDHYRSPIGSRRDLSLFQVNFYGFLQEFILRELDGWDQGPGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 206 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 207 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 208 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 209 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 210 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 211 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.29 |
| Rhizosphere | 92.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 41.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070708_100141224 | 3300005445 | Bacteria | 2233 |
| 2 | MRS1b_contig_2830796 | 2162886011 | Unclassified | 878 |
| 3 | CNXas_1000175 | 3300000545 | Bacteria | 10295 |
| 4 | JGI24743J22301_10026090 | 3300001991 | Unclassified | 1135 |
| 5 | JGI24744J21845_10030033 | 3300002077 | Unclassified | 1043 |
| 6 | JGI24035J26624_1000312 | 3300002126 | Bacteria | 4516 |
| 7 | JGI24035J26624_1010694 | 3300002126 | Bacteria | 914 |
| 8 | JGI25406J46586_10000087 | 3300003203 | Bacteria | 42198 |
| 9 | JGI25404J52841_10034122 | 3300003659 | Unclassified | 1084 |
| 10 | JGI25404J52841_10037765 | 3300003659 | Unclassified | 1026 |
| 11 | JGI25405J52794_10002248 | 3300003911 | Bacteria | 3306 |
| 12 | Ga0065714_10074791 | 3300005288 | Bacteria | 2989 |
| 13 | Ga0065704_10004342 | 3300005289 | Bacteria | 3432 |
| 14 | Ga0065704_10007456 | 3300005289 | Bacteria | 2296 |
| 15 | Ga0065704_10208367 | 3300005289 | Bacteria | 1118 |
| 16 | Ga0065704_10224532 | 3300005289 | Bacteria | 1063 |
| 17 | Ga0065704_10276134 | 3300005289 | Unclassified | 932 |
| 18 | Ga0065712_10000626 | 3300005290 | Bacteria | 15083 |
| 19 | Ga0065712_10000905 | 3300005290 | Bacteria | 7878 |
| 20 | Ga0065712_10013724 | 3300005290 | Bacteria | 1634 |
| 21 | Ga0065712_10152655 | 3300005290 | Unclassified | 1358 |
| 22 | Ga0065712_10157591 | 3300005290 | Bacteria | 1324 |
| 23 | Ga0065712_10184093 | 3300005290 | Bacteria | 1178 |
| 24 | Ga0065712_10277231 | 3300005290 | Bacteria | 899 |
| 25 | Ga0065712_10566293 | 3300005290 | Unclassified | 609 |
| 26 | Ga0065715_10000684 | 3300005293 | Bacteria | 9017 |
| 27 | Ga0065715_10096116 | 3300005293 | Bacteria | 3920 |
| 28 | Ga0065715_10119506 | 3300005293 | Bacteria | 2235 |
| 29 | Ga0065715_10139121 | 3300005293 | Unclassified | 1881 |
| 30 | Ga0065715_10155410 | 3300005293 | Bacteria | 1665 |
| 31 | Ga0065715_10183971 | 3300005293 | Bacteria | 1457 |
| 32 | Ga0065715_10254275 | 3300005293 | Unclassified | 1148 |
| 33 | Ga0065715_10254541 | 3300005293 | Bacteria | 1156 |
| 34 | Ga0065715_10346789 | 3300005293 | Bacteria | 958 |
| 35 | Ga0065707_10038280 | 3300005295 | Bacteria | 1196 |
| 36 | Ga0065707_10182607 | 3300005295 | Bacteria | 1409 |
| 37 | Ga0065707_10199640 | 3300005295 | Unclassified | 1317 |
| 38 | Ga0065707_10282882 | 3300005295 | Unclassified | 1043 |
| 39 | Ga0070658_10207669 | 3300005327 | Unclassified | 1654 |
| 40 | Ga0070676_10006832 | 3300005328 | Bacteria | 6112 |
| 41 | Ga0070676_10033669 | 3300005328 | Bacteria | 2940 |
| 42 | Ga0070676_10057069 | 3300005328 | Unclassified | 2309 |
| 43 | Ga0070676_10097729 | 3300005328 | Unclassified | 1809 |
| 44 | Ga0070676_10180338 | 3300005328 | Unclassified | 1372 |
| 45 | Ga0070676_10182136 | 3300005328 | Unclassified | 1366 |
| 46 | Ga0070676_10681466 | 3300005328 | Unclassified | 749 |
| 47 | Ga0070676_10725614 | 3300005328 | Bacteria | 727 |
| 48 | Ga0070683_100072990 | 3300005329 | Bacteria | 3204 |
| 49 | Ga0070683_100429276 | 3300005329 | Unclassified | 1261 |
| 50 | Ga0070683_100482621 | 3300005329 | Unclassified | 1183 |
| 51 | Ga0070690_100034312 | 3300005330 | Bacteria | 3179 |
| 52 | Ga0070690_100043685 | 3300005330 | Bacteria | 2842 |
| 53 | Ga0070690_100184942 | 3300005330 | Bacteria | 1441 |
| 54 | Ga0070690_100310089 | 3300005330 | Bacteria | 1134 |
| 55 | Ga0070690_101026207 | 3300005330 | Bacteria | 651 |
| 56 | Ga0070670_100021803 | 3300005331 | Bacteria | 5509 |
| 57 | Ga0070670_100203823 | 3300005331 | Bacteria | 1719 |
| 58 | Ga0070670_100234460 | 3300005331 | Bacteria | 1597 |
| 59 | Ga0070670_100426207 | 3300005331 | Unclassified | 1173 |
| 60 | Ga0068869_100271954 | 3300005334 | Bacteria | 1360 |
| 61 | Ga0070666_10006905 | 3300005335 | Bacteria | 6995 |
| 62 | Ga0070666_10066253 | 3300005335 | Bacteria | 2450 |
| 63 | Ga0070666_10102611 | 3300005335 | Unclassified | 1973 |
| 64 | Ga0070666_10298572 | 3300005335 | Unclassified | 1147 |
| 65 | Ga0070666_10557803 | 3300005335 | Bacteria | 833 |
| 66 | Ga0070680_100965357 | 3300005336 | Bacteria | 736 |
| 67 | Ga0068868_100078073 | 3300005338 | Bacteria | 2650 |
| 68 | Ga0068868_100161429 | 3300005338 | Bacteria | 1851 |
| 69 | Ga0070660_100278395 | 3300005339 | Bacteria | 1369 |
| 70 | Ga0070660_100292312 | 3300005339 | Bacteria | 1334 |
| 71 | Ga0070689_100002634 | 3300005340 | Bacteria | 11759 |
| 72 | Ga0070689_100086170 | 3300005340 | Bacteria | 2470 |
| 73 | Ga0070689_100087060 | 3300005340 | Bacteria | 2457 |
| 74 | Ga0070689_100176879 | 3300005340 | Bacteria | 1731 |
| 75 | Ga0070687_100466876 | 3300005343 | Bacteria | 843 |
| 76 | Ga0070687_100624047 | 3300005343 | Unclassified | 744 |
| 77 | Ga0070661_100077831 | 3300005344 | Bacteria | 2446 |
| 78 | Ga0070661_100620001 | 3300005344 | Unclassified | 876 |
| 79 | Ga0070692_10057160 | 3300005345 | Bacteria | 2045 |
| 80 | Ga0070668_100007124 | 3300005347 | Bacteria | 8286 |
| 81 | Ga0070668_100029371 | 3300005347 | Bacteria | 4176 |
| 82 | Ga0070668_100034747 | 3300005347 | Unclassified | 3842 |
| 83 | Ga0070668_100059230 | 3300005347 | Bacteria | 2964 |
| 84 | Ga0070668_100127831 | 3300005347 | Bacteria | 2037 |
| 85 | Ga0070668_100401712 | 3300005347 | Unclassified | 1170 |
| 86 | Ga0070668_101459151 | 3300005347 | Unclassified | 625 |
| 87 | Ga0070669_100005219 | 3300005353 | Bacteria | 9389 |
| 88 | Ga0070669_100015119 | 3300005353 | Bacteria | 5498 |
| 89 | Ga0070669_100043415 | 3300005353 | Unclassified | 3274 |
| 90 | Ga0070669_100056295 | 3300005353 | Bacteria | 2883 |
| 91 | Ga0070669_100150851 | 3300005353 | Unclassified | 1799 |
| 92 | Ga0070675_100010416 | 3300005354 | Bacteria | 7264 |
| 93 | Ga0070675_100013878 | 3300005354 | Bacteria | 6343 |
| 94 | Ga0070675_100030993 | 3300005354 | Bacteria | 4320 |
| 95 | Ga0070675_100043862 | 3300005354 | Bacteria | 3657 |
| 96 | Ga0070675_101014387 | 3300005354 | Unclassified | 762 |
| 97 | Ga0070671_100018196 | 3300005355 | Bacteria | 5704 |
| 98 | Ga0070671_100076493 | 3300005355 | Unclassified | 2796 |
| 99 | Ga0070671_100086738 | 3300005355 | Unclassified | 2619 |
| 100 | Ga0070671_100106529 | 3300005355 | Bacteria | 2353 |
| 101 | Ga0070671_100245718 | 3300005355 | Unclassified | 1519 |
| 102 | Ga0070671_100948088 | 3300005355 | Unclassified | 753 |
| 103 | Ga0070674_100018553 | 3300005356 | Bacteria | 4401 |
| 104 | Ga0070674_100021908 | 3300005356 | Bacteria | 4112 |
| 105 | Ga0070674_100142803 | 3300005356 | Unclassified | 1799 |
| 106 | Ga0070674_100509609 | 3300005356 | Bacteria | 1003 |
| 107 | Ga0070674_100864931 | 3300005356 | Unclassified | 785 |
| 108 | Ga0070674_100894038 | 3300005356 | Unclassified | 773 |
| 109 | Ga0070673_100007694 | 3300005364 | Bacteria | 7129 |
| 110 | Ga0070673_100012707 | 3300005364 | Bacteria | 5790 |
| 111 | Ga0070673_100082328 | 3300005364 | Bacteria | 2612 |
| 112 | Ga0070673_100158244 | 3300005364 | Unclassified | 1924 |
| 113 | Ga0070673_100915819 | 3300005364 | Unclassified | 813 |
| 114 | Ga0070673_101580235 | 3300005364 | Bacteria | 619 |
| 115 | Ga0070688_100001014 | 3300005365 | Bacteria | 14119 |
| 116 | Ga0070688_100019023 | 3300005365 | Bacteria | 3975 |
| 117 | Ga0070688_100118515 | 3300005365 | Bacteria | 1770 |
| 118 | Ga0070688_100150872 | 3300005365 | Unclassified | 1588 |
| 119 | Ga0070688_101306497 | 3300005365 | Unclassified | 586 |
| 120 | Ga0070659_100015190 | 3300005366 | Bacteria | 5761 |
| 121 | Ga0070659_100018746 | 3300005366 | Bacteria | 5223 |
| 122 | Ga0070667_100018730 | 3300005367 | Bacteria | 5742 |
| 123 | Ga0070667_100051082 | 3300005367 | Unclassified | 3485 |
| 124 | Ga0070667_100081368 | 3300005367 | Unclassified | 2771 |
| 125 | Ga0070667_100460680 | 3300005367 | Bacteria | 1162 |
| 126 | Ga0070703_10104910 | 3300005406 | Bacteria | 1002 |
| 127 | Ga0070709_10018947 | 3300005434 | Bacteria | 3971 |
| 128 | Ga0070709_10649702 | 3300005434 | Unclassified | 816 |
| 129 | Ga0070709_11203997 | 3300005434 | Unclassified | 609 |
| 130 | Ga0070714_100042855 | 3300005435 | Bacteria | 3825 |
| 131 | Ga0070714_100048583 | 3300005435 | Unclassified | 3609 |
| 132 | Ga0070714_100534016 | 3300005435 | Unclassified | 1121 |
| 133 | Ga0070713_100009589 | 3300005436 | Bacteria | 6944 |
| 134 | Ga0070713_100061038 | 3300005436 | Bacteria | 3154 |
| 135 | Ga0070713_100101766 | 3300005436 | Unclassified | 2489 |
| 136 | Ga0070713_100145613 | 3300005436 | Bacteria | 2102 |
| 137 | Ga0070713_100315406 | 3300005436 | Unclassified | 1443 |
| 138 | Ga0070713_101010218 | 3300005436 | Unclassified | 802 |
| 139 | Ga0070710_10003850 | 3300005437 | Bacteria | 7099 |
| 140 | Ga0070710_10206346 | 3300005437 | Unclassified | 1243 |
| 141 | Ga0070710_10232503 | 3300005437 | Bacteria | 1178 |
| 142 | Ga0070710_10264215 | 3300005437 | Unclassified | 1111 |
| 143 | Ga0070710_10751118 | 3300005437 | Unclassified | 693 |
| 144 | Ga0070711_100008313 | 3300005439 | Bacteria | 6353 |
| 145 | Ga0070711_100173248 | 3300005439 | Unclassified | 1646 |
| 146 | Ga0070711_100193764 | 3300005439 | Bacteria | 1564 |
| 147 | Ga0070711_100219692 | 3300005439 | Unclassified | 1476 |
| 148 | Ga0070711_100331985 | 3300005439 | Unclassified | 1217 |
| 149 | Ga0070711_100913554 | 3300005439 | Unclassified | 750 |
| 150 | Ga0070705_100094700 | 3300005440 | Bacteria | 1870 |
| 151 | Ga0070705_100121072 | 3300005440 | Bacteria | 1690 |
| 152 | Ga0070705_100320040 | 3300005440 | Unclassified | 1119 |
| 153 | Ga0070705_100335696 | 3300005440 | Bacteria | 1096 |
| 154 | Ga0070700_100066401 | 3300005441 | Bacteria | 2290 |
| 155 | Ga0070694_100979022 | 3300005444 | Bacteria | 701 |
| 156 | Ga0070694_101066971 | 3300005444 | Bacteria | 673 |
| 157 | Ga0070708_100001246 | 3300005445 | Bacteria | 19578 |
| 158 | Ga0070708_100014035 | 3300005445 | Bacteria | 6582 |
| 159 | Ga0070708_100041281 | 3300005445 | Bacteria | 4045 |
| 160 | Ga0070708_100071778 | 3300005445 | Bacteria | 3118 |
| 161 | Ga0070708_100108282 | 3300005445 | Bacteria | 2552 |
| 162 | Ga0070708_100168149 | 3300005445 | Bacteria | 2046 |
| 163 | Ga0070708_100209834 | 3300005445 | Bacteria | 1825 |
| 164 | Ga0070708_100331098 | 3300005445 | Unclassified | 1435 |
| 165 | Ga0070708_100672563 | 3300005445 | Bacteria | 975 |
| 166 | Ga0070708_100677399 | 3300005445 | Unclassified | 971 |
| 167 | Ga0070708_101083115 | 3300005445 | Unclassified | 751 |
| 168 | Ga0070663_100021879 | 3300005455 | Bacteria | 4262 |
| 169 | Ga0070663_100030814 | 3300005455 | Bacteria | 3680 |
| 170 | Ga0070678_100053696 | 3300005456 | Bacteria | 2932 |
| 171 | Ga0070678_100078766 | 3300005456 | Bacteria | 2490 |
| 172 | Ga0070678_100139478 | 3300005456 | Unclassified | 1938 |
| 173 | Ga0070662_100010037 | 3300005457 | Bacteria | 6203 |
| 174 | Ga0070662_100035606 | 3300005457 | Bacteria | 3517 |
| 175 | Ga0070662_100184868 | 3300005457 | Bacteria | 1645 |
| 176 | Ga0070662_100279896 | 3300005457 | Bacteria | 1350 |
| 177 | Ga0070662_100339608 | 3300005457 | Bacteria | 1228 |
| 178 | Ga0070662_100985827 | 3300005457 | Unclassified | 721 |
| 179 | Ga0070681_10030785 | 3300005458 | Bacteria | 5385 |
| 180 | Ga0070681_10314375 | 3300005458 | Unclassified | 1476 |
| 181 | Ga0068867_100101497 | 3300005459 | Unclassified | 2198 |
| 182 | Ga0068867_100328765 | 3300005459 | Bacteria | 1269 |
| 183 | Ga0070685_10015868 | 3300005466 | Bacteria | 4006 |
| 184 | Ga0070685_10018427 | 3300005466 | Bacteria | 3753 |
| 185 | Ga0070706_100000269 | 3300005467 | Bacteria | 63203 |
| 186 | Ga0070706_100004511 | 3300005467 | Bacteria | 13413 |
| 187 | Ga0070706_100007002 | 3300005467 | Bacteria | 10634 |
| 188 | Ga0070706_100010420 | 3300005467 | Bacteria | 8631 |
| 189 | Ga0070706_100020333 | 3300005467 | Bacteria | 6116 |
| 190 | Ga0070706_100030390 | 3300005467 | Bacteria | 4977 |
| 191 | Ga0070706_100064264 | 3300005467 | Unclassified | 3392 |
| 192 | Ga0070706_100068685 | 3300005467 | Bacteria | 3277 |
| 193 | Ga0070706_100155064 | 3300005467 | Unclassified | 2138 |
| 194 | Ga0070706_100215389 | 3300005467 | Bacteria | 1793 |
| 195 | Ga0070706_100242551 | 3300005467 | Bacteria | 1683 |
| 196 | Ga0070706_100246388 | 3300005467 | Bacteria | 1668 |
| 197 | Ga0070706_100353306 | 3300005467 | Unclassified | 1370 |
| 198 | Ga0070706_100721770 | 3300005467 | Unclassified | 924 |
| 199 | Ga0070706_100780482 | 3300005467 | Unclassified | 885 |
| 200 | Ga0070706_100862305 | 3300005467 | Bacteria | 837 |
| 201 | Ga0070706_101207220 | 3300005467 | Bacteria | 695 |
| 202 | Ga0070706_101223064 | 3300005467 | Unclassified | 690 |
| 203 | Ga0070707_100021300 | 3300005468 | Bacteria | 6127 |
| 204 | Ga0070707_100029036 | 3300005468 | Bacteria | 5264 |
| 205 | Ga0070707_100040241 | 3300005468 | Bacteria | 4472 |
| 206 | Ga0070707_100082456 | 3300005468 | Unclassified | 3106 |
| 207 | Ga0070707_100174169 | 3300005468 | Unclassified | 2097 |
| 208 | Ga0070707_100179344 | 3300005468 | Unclassified | 2065 |
| 209 | Ga0070707_100252440 | 3300005468 | Bacteria | 1716 |
| 210 | Ga0070707_100268875 | 3300005468 | Unclassified | 1658 |
| 211 | Ga0070707_100287992 | 3300005468 | Bacteria | 1596 |
| 212 | Ga0070707_100757385 | 3300005468 | Bacteria | 934 |
| 213 | Ga0070707_100788599 | 3300005468 | Unclassified | 914 |
| 214 | Ga0070707_101193393 | 3300005468 | Unclassified | 727 |
| 215 | Ga0070698_100001933 | 3300005471 | Bacteria | 23020 |
| 216 | Ga0070698_100498205 | 3300005471 | Unclassified | 1156 |
| 217 | Ga0070698_100815826 | 3300005471 | Bacteria | 877 |
| 218 | Ga0070698_101234527 | 3300005471 | Unclassified | 697 |
| 219 | Ga0070699_100017643 | 3300005518 | Bacteria | 6128 |
| 220 | Ga0070699_100081643 | 3300005518 | Bacteria | 2818 |
| 221 | Ga0070699_100155142 | 3300005518 | Bacteria | 2026 |
| 222 | Ga0070699_100644198 | 3300005518 | Unclassified | 967 |
| 223 | Ga0070699_101605634 | 3300005518 | Unclassified | 596 |
| 224 | Ga0070679_100083609 | 3300005530 | Bacteria | 3180 |
| 225 | Ga0070684_100032398 | 3300005535 | Bacteria | 4454 |
| 226 | Ga0070684_100044817 | 3300005535 | Bacteria | 3827 |
| 227 | Ga0070684_100049498 | 3300005535 | Unclassified | 3647 |
| 228 | Ga0070684_100131389 | 3300005535 | Unclassified | 2259 |
| 229 | Ga0070684_100225139 | 3300005535 | Bacteria | 1711 |
| 230 | Ga0070697_100005205 | 3300005536 | Bacteria | 9993 |
| 231 | Ga0070697_100006587 | 3300005536 | Bacteria | 9003 |
| 232 | Ga0070697_100028885 | 3300005536 | Unclassified | 4444 |
| 233 | Ga0070697_100030661 | 3300005536 | Bacteria | 4320 |
| 234 | Ga0070697_100037478 | 3300005536 | Unclassified | 3918 |
| 235 | Ga0070697_100037985 | 3300005536 | Bacteria | 3889 |
| 236 | Ga0070697_100056434 | 3300005536 | Bacteria | 3195 |
| 237 | Ga0070697_100152222 | 3300005536 | Bacteria | 1950 |
| 238 | Ga0070697_100156565 | 3300005536 | Unclassified | 1923 |
| 239 | Ga0070697_100244168 | 3300005536 | Bacteria | 1534 |
| 240 | Ga0070697_100305785 | 3300005536 | Bacteria | 1367 |
| 241 | Ga0070697_100567572 | 3300005536 | Bacteria | 996 |
| 242 | Ga0070697_101135261 | 3300005536 | Unclassified | 696 |
| 243 | Ga0070672_100004083 | 3300005543 | Bacteria | 9533 |
| 244 | Ga0070672_100024482 | 3300005543 | Bacteria | 4463 |
| 245 | Ga0070672_100074498 | 3300005543 | Bacteria | 2708 |
| 246 | Ga0070672_100171408 | 3300005543 | Unclassified | 1805 |
| 247 | Ga0070672_100179073 | 3300005543 | Unclassified | 1766 |
| 248 | Ga0070672_100380597 | 3300005543 | Unclassified | 1207 |
| 249 | Ga0070672_100398902 | 3300005543 | Unclassified | 1179 |
| 250 | Ga0070672_100544932 | 3300005543 | Bacteria | 1007 |
| 251 | Ga0070686_100043786 | 3300005544 | Unclassified | 2810 |
| 252 | Ga0070693_100243079 | 3300005547 | Bacteria | 1190 |
| 253 | Ga0070665_100016091 | 3300005548 | Bacteria | 7505 |
| 254 | Ga0070665_100041976 | 3300005548 | Bacteria | 4598 |
| 255 | Ga0070665_100194440 | 3300005548 | Bacteria | 2029 |
| 256 | Ga0070665_100219570 | 3300005548 | Bacteria | 1901 |
| 257 | Ga0070665_100506405 | 3300005548 | Unclassified | 1219 |
| 258 | Ga0070665_100966177 | 3300005548 | Bacteria | 864 |
| 259 | Ga0070704_100044622 | 3300005549 | Bacteria | 3081 |
| 260 | Ga0070704_100146156 | 3300005549 | Unclassified | 1853 |
| 261 | Ga0070704_100374619 | 3300005549 | Bacteria | 1208 |
| 262 | Ga0068855_100295577 | 3300005563 | Unclassified | 1794 |
| 263 | Ga0070664_100075886 | 3300005564 | Bacteria | 2887 |
| 264 | Ga0070664_100298699 | 3300005564 | Bacteria | 1455 |
| 265 | Ga0070664_100637840 | 3300005564 | Unclassified | 989 |
| 266 | Ga0070702_100292818 | 3300005615 | Unclassified | 1123 |
| 267 | Ga0068859_100201005 | 3300005617 | Bacteria | 2077 |
| 268 | Ga0068859_101165342 | 3300005617 | Bacteria | 848 |
| 269 | Ga0068866_10159303 | 3300005718 | Bacteria | 1315 |
| 270 | Ga0068866_10703705 | 3300005718 | Unclassified | 693 |
| 271 | Ga0068861_100036591 | 3300005719 | Bacteria | 3645 |
| 272 | Ga0068861_100240392 | 3300005719 | Unclassified | 1540 |
| 273 | Ga0068861_101589970 | 3300005719 | Unclassified | 644 |
| 274 | Ga0068863_100138451 | 3300005841 | Bacteria | 2326 |
| 275 | Ga0068863_100335486 | 3300005841 | Unclassified | 1470 |
| 276 | Ga0068863_100915242 | 3300005841 | Bacteria | 878 |
| 277 | Ga0068863_100947007 | 3300005841 | Bacteria | 862 |
| 278 | Ga0068858_100058111 | 3300005842 | Bacteria | 3576 |
| 279 | Ga0068858_100797227 | 3300005842 | Bacteria | 921 |
| 280 | Ga0068858_101712248 | 3300005842 | Unclassified | 621 |
| 281 | Ga0068860_100026862 | 3300005843 | Bacteria | 5547 |
| 282 | Ga0068860_100412032 | 3300005843 | Bacteria | 1338 |
| 283 | Ga0068860_100565109 | 3300005843 | Unclassified | 1140 |
| 284 | Ga0068862_100350877 | 3300005844 | Bacteria | 1369 |
| 285 | Ga0081455_10001399 | 3300005937 | Bacteria | 29813 |
| 286 | Ga0081455_10011319 | 3300005937 | Bacteria | 8973 |
| 287 | Ga0081455_10016230 | 3300005937 | Bacteria | 7196 |
| 288 | Ga0081455_10024323 | 3300005937 | Bacteria | 5610 |
| 289 | Ga0081455_10026186 | 3300005937 | Bacteria | 5371 |
| 290 | Ga0081455_10027681 | 3300005937 | Bacteria | 5191 |
| 291 | Ga0081455_10360020 | 3300005937 | Bacteria | 1023 |
| 292 | Ga0081455_10388173 | 3300005937 | Bacteria | 973 |
| 293 | Ga0081455_10453528 | 3300005937 | Unclassified | 875 |
| 294 | Ga0081540_1000036 | 3300005983 | Bacteria | 140805 |
| 295 | Ga0081540_1025381 | 3300005983 | Bacteria | 3411 |
| 296 | Ga0081540_1033289 | 3300005983 | Bacteria | 2801 |
| 297 | Ga0081539_10000727 | 3300005985 | Bacteria | 66016 |
| 298 | Ga0081539_10001132 | 3300005985 | Bacteria | 48398 |
| 299 | Ga0081539_10088653 | 3300005985 | Bacteria | 1604 |
| 300 | Ga0070717_10000989 | 3300006028 | Bacteria | 19045 |
| 301 | Ga0070717_10013344 | 3300006028 | Bacteria | 6292 |
| 302 | Ga0070717_10028937 | 3300006028 | Bacteria | 4440 |
| 303 | Ga0070717_10121318 | 3300006028 | Bacteria | 2239 |
| 304 | Ga0070717_10144273 | 3300006028 | Unclassified | 2055 |
| 305 | Ga0070717_10188544 | 3300006028 | Bacteria | 1801 |
| 306 | Ga0070717_10302706 | 3300006028 | Bacteria | 1422 |
| 307 | Ga0070717_10406552 | 3300006028 | Unclassified | 1223 |
| 308 | Ga0070717_11081801 | 3300006028 | Unclassified | 730 |
| 309 | Ga0070715_10053465 | 3300006163 | Unclassified | 1745 |
| 310 | Ga0070716_100239024 | 3300006173 | Unclassified | 1230 |
| 311 | Ga0070716_100594412 | 3300006173 | Unclassified | 831 |
| 312 | Ga0070712_100008008 | 3300006175 | Bacteria | 6627 |
| 313 | Ga0070712_100011301 | 3300006175 | Bacteria | 5657 |
| 314 | Ga0070712_100045849 | 3300006175 | Bacteria | 3020 |
| 315 | Ga0070712_100081663 | 3300006175 | Bacteria | 2343 |
| 316 | Ga0070712_100094353 | 3300006175 | Bacteria | 2199 |
| 317 | Ga0070712_100096439 | 3300006175 | Unclassified | 2177 |
| 318 | Ga0070712_100170006 | 3300006175 | Bacteria | 1690 |
| 319 | Ga0070712_100201180 | 3300006175 | Unclassified | 1565 |
| 320 | Ga0070712_100321903 | 3300006175 | Bacteria | 1258 |
| 321 | Ga0070712_100363458 | 3300006175 | Unclassified | 1187 |
| 322 | Ga0070712_100591734 | 3300006175 | Unclassified | 938 |
| 323 | Ga0097621_100076154 | 3300006237 | Bacteria | 2782 |
| 324 | Ga0097621_100092818 | 3300006237 | Unclassified | 2529 |
| 325 | Ga0097621_100099690 | 3300006237 | Bacteria | 2442 |
| 326 | Ga0097621_100438891 | 3300006237 | Unclassified | 1174 |
| 327 | Ga0068871_100135467 | 3300006358 | Unclassified | 2091 |
| 328 | Ga0068871_100195061 | 3300006358 | Unclassified | 1746 |
| 329 | Ga0068871_100252441 | 3300006358 | Bacteria | 1536 |
| 330 | Ga0068871_100944839 | 3300006358 | Bacteria | 801 |
| 331 | Ga0075428_100881155 | 3300006844 | Unclassified | 950 |
| 332 | Ga0075433_10270533 | 3300006852 | Unclassified | 1506 |
| 333 | Ga0075433_10565652 | 3300006852 | Unclassified | 999 |
| 334 | Ga0075433_10678673 | 3300006852 | Unclassified | 903 |
| 335 | Ga0075434_100195123 | 3300006871 | Bacteria | 2045 |
| 336 | Ga0075434_100288099 | 3300006871 | Unclassified | 1662 |
| 337 | Ga0075434_100313598 | 3300006871 | Unclassified | 1589 |
| 338 | Ga0075434_100662672 | 3300006871 | Unclassified | 1062 |
| 339 | Ga0075434_100691164 | 3300006871 | Unclassified | 1038 |
| 340 | Ga0075429_100811826 | 3300006880 | Unclassified | 819 |
| 341 | Ga0068865_100040646 | 3300006881 | Bacteria | 3162 |
| 342 | Ga0068865_100599774 | 3300006881 | Unclassified | 931 |
| 343 | Ga0075436_100071988 | 3300006914 | Bacteria | 2391 |
| 344 | Ga0097620_100201007 | 3300006931 | Bacteria | 2077 |
| 345 | Ga0097620_101165296 | 3300006931 | Bacteria | 848 |
| 346 | Ga0075435_100502079 | 3300007076 | Unclassified | 1049 |
| 347 | Ga0099795_10043626 | 3300007788 | Unclassified | 1606 |
| 348 | Ga0105240_10271232 | 3300009093 | Unclassified | 1953 |
| 349 | Ga0111539_10250683 | 3300009094 | Bacteria | 2061 |
| 350 | Ga0111539_10794807 | 3300009094 | Unclassified | 1101 |
| 351 | Ga0111539_10903566 | 3300009094 | Bacteria | 1027 |
| 352 | Ga0105245_10523316 | 3300009098 | Bacteria | 1205 |
| 353 | Ga0105245_10680662 | 3300009098 | Bacteria | 1061 |
| 354 | Ga0105245_10896568 | 3300009098 | Unclassified | 928 |
| 355 | Ga0105245_11092012 | 3300009098 | Bacteria | 844 |
| 356 | Ga0105247_10107485 | 3300009101 | Bacteria | 1792 |
| 357 | Ga0105247_10975712 | 3300009101 | Unclassified | 660 |
| 358 | Ga0114129_10108940 | 3300009147 | Bacteria | 3823 |
| 359 | Ga0114129_10343212 | 3300009147 | Unclassified | 1980 |
| 360 | Ga0114129_10550244 | 3300009147 | Unclassified | 1501 |
| 361 | Ga0114129_10652958 | 3300009147 | Unclassified | 1357 |
| 362 | Ga0105243_10273657 | 3300009148 | Bacteria | 1517 |
| 363 | Ga0105243_10431976 | 3300009148 | Bacteria | 1231 |
| 364 | Ga0105243_10602715 | 3300009148 | Unclassified | 1058 |
| 365 | Ga0105243_11641250 | 3300009148 | Unclassified | 670 |
| 366 | Ga0105243_12641502 | 3300009148 | Unclassified | 542 |
| 367 | Ga0105241_10120467 | 3300009174 | Bacteria | 2112 |
| 368 | Ga0105241_11050930 | 3300009174 | Unclassified | 764 |
| 369 | Ga0105242_10077802 | 3300009176 | Bacteria | 2768 |
| 370 | Ga0105242_10142894 | 3300009176 | Unclassified | 2079 |
| 371 | Ga0105242_11018539 | 3300009176 | Unclassified | 837 |
| 372 | Ga0105242_11073914 | 3300009176 | Bacteria | 817 |
| 373 | Ga0105248_10269992 | 3300009177 | Bacteria | 1915 |
| 374 | Ga0105248_10554940 | 3300009177 | Bacteria | 1296 |
| 375 | Ga0105237_11703568 | 3300009545 | Unclassified | 638 |
| 376 | Ga0105238_10943343 | 3300009551 | Bacteria | 882 |
| 377 | Ga0105249_10029493 | 3300009553 | Bacteria | 4955 |
| 378 | Ga0105249_10160954 | 3300009553 | Unclassified | 2169 |
| 379 | Ga0105249_10397580 | 3300009553 | Unclassified | 1408 |
| 380 | Ga0105249_10531582 | 3300009553 | Bacteria | 1224 |
| 381 | Ga0105249_11299070 | 3300009553 | Unclassified | 799 |
| 382 | Ga0099796_10020855 | 3300010159 | Bacteria | 2009 |
| 383 | Ga0099796_10045340 | 3300010159 | Bacteria | 1506 |
| 384 | Ga0099796_10264980 | 3300010159 | Unclassified | 718 |
| 385 | Ga0105239_10003969 | 3300010375 | Bacteria | 17929 |
| 386 | Ga0105239_10646859 | 3300010375 | Unclassified | 1207 |
| 387 | Ga0105239_11213130 | 3300010375 | Bacteria | 869 |
| 388 | Ga0105246_10116656 | 3300011119 | Unclassified | 1971 |
| 389 | Ga0105246_10175519 | 3300011119 | Unclassified | 1645 |
| 390 | Ga0105246_10970379 | 3300011119 | Bacteria | 767 |
| 391 | Ga0157315_1010269 | 3300012508 | Unclassified | 822 |
| 392 | Ga0157371_10066841 | 3300013102 | Bacteria | 2545 |
| 393 | Ga0157371_10526145 | 3300013102 | Unclassified | 875 |
| 394 | Ga0157371_10549419 | 3300013102 | Unclassified | 856 |
| 395 | Ga0157369_11302992 | 3300013105 | Bacteria | 740 |
| 396 | Ga0157374_10009864 | 3300013296 | Bacteria | 8197 |
| 397 | Ga0157374_10017988 | 3300013296 | Bacteria | 6231 |
| 398 | Ga0157374_10027132 | 3300013296 | Bacteria | 5162 |
| 399 | Ga0157374_10045827 | 3300013296 | Bacteria | 4047 |
| 400 | Ga0157374_10059858 | 3300013296 | Bacteria | 3563 |
| 401 | Ga0157374_10078888 | 3300013296 | Bacteria | 3119 |
| 402 | Ga0157374_10118282 | 3300013296 | Bacteria | 2555 |
| 403 | Ga0157374_10158582 | 3300013296 | Unclassified | 2203 |
| 404 | Ga0157374_10292875 | 3300013296 | Bacteria | 1609 |
| 405 | Ga0157374_10303687 | 3300013296 | Unclassified | 1579 |
| 406 | Ga0157374_10330276 | 3300013296 | Unclassified | 1512 |
| 407 | Ga0157374_10544642 | 3300013296 | Bacteria | 1168 |
| 408 | Ga0157374_10856921 | 3300013296 | Bacteria | 926 |
| 409 | Ga0157374_11388829 | 3300013296 | Unclassified | 725 |
| 410 | Ga0157378_10013936 | 3300013297 | Bacteria | 7033 |
| 411 | Ga0157378_10052952 | 3300013297 | Bacteria | 3612 |
| 412 | Ga0157378_10075047 | 3300013297 | Bacteria | 3043 |
| 413 | Ga0157378_10122234 | 3300013297 | Bacteria | 2401 |
| 414 | Ga0157378_10228801 | 3300013297 | Bacteria | 1771 |
| 415 | Ga0157378_10684582 | 3300013297 | Bacteria | 1044 |
| 416 | Ga0157378_10843586 | 3300013297 | Unclassified | 944 |
| 417 | Ga0157378_10847336 | 3300013297 | Unclassified | 942 |
| 418 | Ga0157378_10980328 | 3300013297 | Bacteria | 879 |
| 419 | Ga0157378_11000621 | 3300013297 | Unclassified | 870 |
| 420 | Ga0163162_10006459 | 3300013306 | Bacteria | 11357 |
| 421 | Ga0163162_10104768 | 3300013306 | Unclassified | 2923 |
| 422 | Ga0163162_10137299 | 3300013306 | Unclassified | 2557 |
| 423 | Ga0163162_10141758 | 3300013306 | Bacteria | 2517 |
| 424 | Ga0163162_10171473 | 3300013306 | Unclassified | 2294 |
| 425 | Ga0163162_10172172 | 3300013306 | Bacteria | 2290 |
| 426 | Ga0163162_10307324 | 3300013306 | Unclassified | 1718 |
| 427 | Ga0163162_10426785 | 3300013306 | Bacteria | 1458 |
| 428 | Ga0163162_10438666 | 3300013306 | Bacteria | 1438 |
| 429 | Ga0163162_11167150 | 3300013306 | Bacteria | 873 |
| 430 | Ga0163162_11391466 | 3300013306 | Bacteria | 798 |
| 431 | Ga0157372_10068892 | 3300013307 | Unclassified | 3979 |
| 432 | Ga0157372_10111374 | 3300013307 | Bacteria | 3136 |
| 433 | Ga0157372_10214195 | 3300013307 | Bacteria | 2232 |
| 434 | Ga0157372_12126886 | 3300013307 | Unclassified | 645 |
| 435 | Ga0157375_10023260 | 3300013308 | Bacteria | 5715 |
| 436 | Ga0157375_10030865 | 3300013308 | Bacteria | 5059 |
| 437 | Ga0157375_10039200 | 3300013308 | Bacteria | 4558 |
| 438 | Ga0157375_10089755 | 3300013308 | Unclassified | 3130 |
| 439 | Ga0157375_10259734 | 3300013308 | Bacteria | 1898 |
| 440 | Ga0157375_10712721 | 3300013308 | Bacteria | 1157 |
| 441 | Ga0163163_10015125 | 3300014325 | Bacteria | 7122 |
| 442 | Ga0163163_10439317 | 3300014325 | Unclassified | 1364 |
| 443 | Ga0163163_10897321 | 3300014325 | Bacteria | 950 |
| 444 | Ga0157377_10031453 | 3300014745 | Unclassified | 2884 |
| 445 | Ga0157377_10333367 | 3300014745 | Unclassified | 1012 |
| 446 | Ga0157377_10856919 | 3300014745 | Unclassified | 675 |
| 447 | Ga0157379_10151190 | 3300014968 | Bacteria | 2094 |
| 448 | Ga0157379_10237893 | 3300014968 | Bacteria | 1651 |
| 449 | Ga0157379_10297411 | 3300014968 | Bacteria | 1471 |
| 450 | Ga0157379_10505961 | 3300014968 | Unclassified | 1120 |
| 451 | Ga0157376_10047094 | 3300014969 | Bacteria | 3559 |
| 452 | Ga0157376_10069981 | 3300014969 | Bacteria | 2977 |
| 453 | Ga0157376_10072651 | 3300014969 | Bacteria | 2927 |
| 454 | Ga0157376_10167479 | 3300014969 | Bacteria | 1998 |
| 455 | Ga0157376_10181437 | 3300014969 | Unclassified | 1924 |
| 456 | Ga0157376_10459536 | 3300014969 | Unclassified | 1244 |
| 457 | Ga0157376_10748738 | 3300014969 | Bacteria | 986 |
| 458 | Ga0157376_11776327 | 3300014969 | Unclassified | 653 |
| 459 | Ga0163161_10068564 | 3300017792 | Bacteria | 2592 |
| 460 | Ga0163161_10253544 | 3300017792 | Bacteria | 1372 |
| 461 | Ga0163161_10785455 | 3300017792 | Bacteria | 799 |
| 462 | Ga0207666_1000268 | 3300025271 | Bacteria | 7510 |
| 463 | Ga0207666_1000445 | 3300025271 | Bacteria | 5352 |
| 464 | Ga0207673_1010655 | 3300025290 | Bacteria | 1185 |
| 465 | Ga0207697_10000305 | 3300025315 | Bacteria | 27530 |
| 466 | Ga0207697_10000749 | 3300025315 | Bacteria | 18385 |
| 467 | Ga0207697_10002349 | 3300025315 | Bacteria | 9860 |
| 468 | Ga0207697_10002915 | 3300025315 | Bacteria | 8655 |
| 469 | Ga0207697_10040533 | 3300025315 | Bacteria | 1912 |
| 470 | Ga0207697_10069836 | 3300025315 | Bacteria | 1471 |
| 471 | Ga0207697_10069930 | 3300025315 | Bacteria | 1470 |
| 472 | Ga0207697_10093609 | 3300025315 | Bacteria | 1275 |
| 473 | Ga0207697_10101190 | 3300025315 | Bacteria | 1228 |
| 474 | Ga0207697_10191537 | 3300025315 | Unclassified | 898 |
| 475 | Ga0207697_10261760 | 3300025315 | Bacteria | 766 |
| 476 | Ga0207697_10435088 | 3300025315 | Bacteria | 582 |
| 477 | Ga0207656_10327457 | 3300025321 | Unclassified | 762 |
| 478 | Ga0207696_1063563 | 3300025711 | Bacteria | 1034 |
| 479 | Ga0207682_10031850 | 3300025893 | Bacteria | 2118 |
| 480 | Ga0207692_10007795 | 3300025898 | Bacteria | 4403 |
| 481 | Ga0207692_10059860 | 3300025898 | Bacteria | 1968 |
| 482 | Ga0207692_10164757 | 3300025898 | Unclassified | 1280 |
| 483 | Ga0207710_10462373 | 3300025900 | Bacteria | 656 |
| 484 | Ga0207688_10014931 | 3300025901 | Unclassified | 4213 |
| 485 | Ga0207688_10024140 | 3300025901 | Bacteria | 3333 |
| 486 | Ga0207688_10032890 | 3300025901 | Unclassified | 2866 |
| 487 | Ga0207688_10040485 | 3300025901 | Bacteria | 2590 |
| 488 | Ga0207688_10352592 | 3300025901 | Unclassified | 907 |
| 489 | Ga0207680_10426575 | 3300025903 | Bacteria | 939 |
| 490 | Ga0207680_10492829 | 3300025903 | Bacteria | 872 |
| 491 | Ga0207680_10602004 | 3300025903 | Unclassified | 786 |
| 492 | Ga0207680_10685146 | 3300025903 | Bacteria | 734 |
| 493 | Ga0207647_10056519 | 3300025904 | Bacteria | 2407 |
| 494 | Ga0207685_10048137 | 3300025905 | Bacteria | 1632 |
| 495 | Ga0207685_10102253 | 3300025905 | Bacteria | 1227 |
| 496 | Ga0207699_10702471 | 3300025906 | Unclassified | 740 |
| 497 | Ga0207699_10882727 | 3300025906 | Unclassified | 659 |
| 498 | Ga0207645_10001207 | 3300025907 | Bacteria | 21313 |
| 499 | Ga0207645_10030242 | 3300025907 | Bacteria | 3490 |
| 500 | Ga0207645_10067393 | 3300025907 | Bacteria | 2288 |
| 501 | Ga0207645_10101892 | 3300025907 | Unclassified | 1853 |
| 502 | Ga0207645_10191261 | 3300025907 | Bacteria | 1345 |
| 503 | Ga0207705_10330021 | 3300025909 | Unclassified | 1173 |
| 504 | Ga0207684_10000134 | 3300025910 | Bacteria | 133720 |
| 505 | Ga0207684_10010852 | 3300025910 | Bacteria | 7993 |
| 506 | Ga0207684_10026757 | 3300025910 | Bacteria | 4918 |
| 507 | Ga0207684_10051976 | 3300025910 | Unclassified | 3477 |
| 508 | Ga0207684_10060083 | 3300025910 | Bacteria | 3228 |
| 509 | Ga0207684_10092011 | 3300025910 | Unclassified | 2585 |
| 510 | Ga0207684_10136003 | 3300025910 | Bacteria | 2110 |
| 511 | Ga0207684_10266201 | 3300025910 | Unclassified | 1479 |
| 512 | Ga0207684_10318222 | 3300025910 | Bacteria | 1341 |
| 513 | Ga0207684_10379877 | 3300025910 | Unclassified | 1215 |
| 514 | Ga0207684_10486180 | 3300025910 | Bacteria | 1059 |
| 515 | Ga0207684_10981516 | 3300025910 | Bacteria | 707 |
| 516 | Ga0207707_10035655 | 3300025912 | Bacteria | 4349 |
| 517 | Ga0207671_10215675 | 3300025914 | Unclassified | 1502 |
| 518 | Ga0207693_10001338 | 3300025915 | Bacteria | 21779 |
| 519 | Ga0207693_10052702 | 3300025915 | Bacteria | 3191 |
| 520 | Ga0207693_10063808 | 3300025915 | Bacteria | 2886 |
| 521 | Ga0207693_10085453 | 3300025915 | Unclassified | 2471 |
| 522 | Ga0207693_10114960 | 3300025915 | Unclassified | 2112 |
| 523 | Ga0207693_10142725 | 3300025915 | Bacteria | 1883 |
| 524 | Ga0207693_10311988 | 3300025915 | Unclassified | 1232 |
| 525 | Ga0207693_10485187 | 3300025915 | Unclassified | 965 |
| 526 | Ga0207663_10055090 | 3300025916 | Bacteria | 2493 |
| 527 | Ga0207663_10089367 | 3300025916 | Bacteria | 2040 |
| 528 | Ga0207663_10261454 | 3300025916 | Unclassified | 1278 |
| 529 | Ga0207663_10374212 | 3300025916 | Unclassified | 1084 |
| 530 | Ga0207660_10082617 | 3300025917 | Unclassified | 2364 |
| 531 | Ga0207662_10015959 | 3300025918 | Bacteria | 4233 |
| 532 | Ga0207662_10047476 | 3300025918 | Unclassified | 2543 |
| 533 | Ga0207662_10727218 | 3300025918 | Unclassified | 697 |
| 534 | Ga0207657_10182461 | 3300025919 | Bacteria | 1696 |
| 535 | Ga0207657_10199927 | 3300025919 | Bacteria | 1608 |
| 536 | Ga0207657_10751470 | 3300025919 | Unclassified | 756 |
| 537 | Ga0207652_10117862 | 3300025921 | Unclassified | 2359 |
| 538 | Ga0207646_10022265 | 3300025922 | Bacteria | 5841 |
| 539 | Ga0207646_10041787 | 3300025922 | Bacteria | 4120 |
| 540 | Ga0207646_10100357 | 3300025922 | Unclassified | 2594 |
| 541 | Ga0207646_10102548 | 3300025922 | Bacteria | 2565 |
| 542 | Ga0207646_10153427 | 3300025922 | Unclassified | 2077 |
| 543 | Ga0207646_10236366 | 3300025922 | Bacteria | 1651 |
| 544 | Ga0207646_10296485 | 3300025922 | Bacteria | 1461 |
| 545 | Ga0207646_10550484 | 3300025922 | Unclassified | 1037 |
| 546 | Ga0207646_10640832 | 3300025922 | Unclassified | 952 |
| 547 | Ga0207646_10679888 | 3300025922 | Bacteria | 921 |
| 548 | Ga0207681_10012037 | 3300025923 | Bacteria | 5329 |
| 549 | Ga0207681_10055235 | 3300025923 | Bacteria | 2704 |
| 550 | Ga0207681_10092103 | 3300025923 | Unclassified | 2166 |
| 551 | Ga0207681_10138924 | 3300025923 | Unclassified | 1807 |
| 552 | Ga0207681_10161894 | 3300025923 | Unclassified | 1688 |
| 553 | Ga0207681_10476435 | 3300025923 | Unclassified | 1019 |
| 554 | Ga0207650_10102795 | 3300025925 | Bacteria | 2202 |
| 555 | Ga0207650_10173665 | 3300025925 | Unclassified | 1714 |
| 556 | Ga0207650_10302536 | 3300025925 | Bacteria | 1306 |
| 557 | Ga0207650_10329433 | 3300025925 | Unclassified | 1252 |
| 558 | Ga0207659_10034033 | 3300025926 | Unclassified | 3511 |
| 559 | Ga0207659_10091247 | 3300025926 | Bacteria | 2275 |
| 560 | Ga0207659_10091540 | 3300025926 | Bacteria | 2272 |
| 561 | Ga0207659_10098795 | 3300025926 | Unclassified | 2196 |
| 562 | Ga0207659_10117709 | 3300025926 | Bacteria | 2031 |
| 563 | Ga0207659_10121309 | 3300025926 | Unclassified | 2004 |
| 564 | Ga0207659_10170598 | 3300025926 | Unclassified | 1716 |
| 565 | Ga0207659_10893348 | 3300025926 | Unclassified | 764 |
| 566 | Ga0207687_10077931 | 3300025927 | Bacteria | 2385 |
| 567 | Ga0207687_10174505 | 3300025927 | Bacteria | 1660 |
| 568 | Ga0207687_10375345 | 3300025927 | Unclassified | 1164 |
| 569 | Ga0207687_10387745 | 3300025927 | Unclassified | 1146 |
| 570 | Ga0207687_10924025 | 3300025927 | Bacteria | 747 |
| 571 | Ga0207700_10007438 | 3300025928 | Bacteria | 6692 |
| 572 | Ga0207700_10115020 | 3300025928 | Unclassified | 2171 |
| 573 | Ga0207700_10296271 | 3300025928 | Bacteria | 1395 |
| 574 | Ga0207700_10720980 | 3300025928 | Unclassified | 891 |
| 575 | Ga0207664_10059774 | 3300025929 | Bacteria | 3037 |
| 576 | Ga0207664_10093216 | 3300025929 | Unclassified | 2473 |
| 577 | Ga0207664_10619773 | 3300025929 | Bacteria | 972 |
| 578 | Ga0207664_10640954 | 3300025929 | Bacteria | 955 |
| 579 | Ga0207644_10109616 | 3300025931 | Bacteria | 2086 |
| 580 | Ga0207644_10129688 | 3300025931 | Unclassified | 1929 |
| 581 | Ga0207644_10144973 | 3300025931 | Unclassified | 1832 |
| 582 | Ga0207644_10164028 | 3300025931 | Unclassified | 1729 |
| 583 | Ga0207644_10414778 | 3300025931 | Unclassified | 1102 |
| 584 | Ga0207644_10543823 | 3300025931 | Unclassified | 961 |
| 585 | Ga0207690_10016085 | 3300025932 | Unclassified | 4547 |
| 586 | Ga0207690_10017865 | 3300025932 | Bacteria | 4340 |
| 587 | Ga0207690_10214696 | 3300025932 | Unclassified | 1469 |
| 588 | Ga0207706_10000989 | 3300025933 | Bacteria | 28922 |
| 589 | Ga0207706_10015312 | 3300025933 | Bacteria | 6932 |
| 590 | Ga0207706_10045022 | 3300025933 | Bacteria | 3910 |
| 591 | Ga0207706_10240414 | 3300025933 | Bacteria | 1583 |
| 592 | Ga0207706_10311032 | 3300025933 | Bacteria | 1372 |
| 593 | Ga0207706_10416782 | 3300025933 | Unclassified | 1163 |
| 594 | Ga0207706_10460365 | 3300025933 | Unclassified | 1100 |
| 595 | Ga0207686_10083840 | 3300025934 | Unclassified | 2087 |
| 596 | Ga0207686_11497963 | 3300025934 | Unclassified | 556 |
| 597 | Ga0207709_10294603 | 3300025935 | Bacteria | 1204 |
| 598 | Ga0207670_10009364 | 3300025936 | Bacteria | 5588 |
| 599 | Ga0207670_10126553 | 3300025936 | Bacteria | 1865 |
| 600 | Ga0207670_10329004 | 3300025936 | Bacteria | 1204 |
| 601 | Ga0207669_10257281 | 3300025937 | Unclassified | 1303 |
| 602 | Ga0207704_10279035 | 3300025938 | Unclassified | 1269 |
| 603 | Ga0207704_10510315 | 3300025938 | Unclassified | 971 |
| 604 | Ga0207665_10029353 | 3300025939 | Bacteria | 3636 |
| 605 | Ga0207665_10071887 | 3300025939 | Unclassified | 2362 |
| 606 | Ga0207665_11390091 | 3300025939 | Bacteria | 559 |
| 607 | Ga0207691_10000847 | 3300025940 | Bacteria | 30373 |
| 608 | Ga0207691_10003287 | 3300025940 | Bacteria | 15747 |
| 609 | Ga0207691_10060881 | 3300025940 | Bacteria | 3430 |
| 610 | Ga0207691_10100787 | 3300025940 | Bacteria | 2577 |
| 611 | Ga0207691_10205379 | 3300025940 | Bacteria | 1713 |
| 612 | Ga0207691_10393784 | 3300025940 | Unclassified | 1182 |
| 613 | Ga0207691_10848882 | 3300025940 | Bacteria | 766 |
| 614 | Ga0207689_10060604 | 3300025942 | Bacteria | 3112 |
| 615 | Ga0207661_10075909 | 3300025944 | Bacteria | 2759 |
| 616 | Ga0207661_10088850 | 3300025944 | Bacteria | 2569 |
| 617 | Ga0207661_10472589 | 3300025944 | Unclassified | 1144 |
| 618 | Ga0207661_10915240 | 3300025944 | Unclassified | 808 |
| 619 | Ga0207679_10116924 | 3300025945 | Bacteria | 2115 |
| 620 | Ga0207679_10344760 | 3300025945 | Bacteria | 1297 |
| 621 | Ga0207679_11251812 | 3300025945 | Unclassified | 681 |
| 622 | Ga0207667_10514162 | 3300025949 | Unclassified | 1213 |
| 623 | Ga0207651_10037857 | 3300025960 | Bacteria | 3163 |
| 624 | Ga0207651_10082943 | 3300025960 | Bacteria | 2316 |
| 625 | Ga0207651_10331047 | 3300025960 | Unclassified | 1276 |
| 626 | Ga0207651_10467867 | 3300025960 | Unclassified | 1084 |
| 627 | Ga0207712_10161333 | 3300025961 | Bacteria | 1743 |
| 628 | Ga0207712_10297893 | 3300025961 | Unclassified | 1322 |
| 629 | Ga0207712_11431089 | 3300025961 | Unclassified | 619 |
| 630 | Ga0207668_10089010 | 3300025972 | Bacteria | 2262 |
| 631 | Ga0207668_10161033 | 3300025972 | Bacteria | 1748 |
| 632 | Ga0207668_10205587 | 3300025972 | Bacteria | 1571 |
| 633 | Ga0207668_10216282 | 3300025972 | Unclassified | 1536 |
| 634 | Ga0207668_10246573 | 3300025972 | Unclassified | 1448 |
| 635 | Ga0207668_10311339 | 3300025972 | Unclassified | 1303 |
| 636 | Ga0207668_10548531 | 3300025972 | Unclassified | 1001 |
| 637 | Ga0207658_10067665 | 3300025986 | Bacteria | 2691 |
| 638 | Ga0207658_10178922 | 3300025986 | Bacteria | 1753 |
| 639 | Ga0207658_10245723 | 3300025986 | Unclassified | 1518 |
| 640 | Ga0207658_10998773 | 3300025986 | Bacteria | 763 |
| 641 | Ga0207677_10108448 | 3300026023 | Unclassified | 2062 |
| 642 | Ga0207677_10134711 | 3300026023 | Bacteria | 1881 |
| 643 | Ga0207677_10156284 | 3300026023 | Bacteria | 1766 |
| 644 | Ga0207677_10228020 | 3300026023 | Bacteria | 1498 |
| 645 | Ga0207677_10237647 | 3300026023 | Unclassified | 1472 |
| 646 | Ga0207677_10379662 | 3300026023 | Unclassified | 1192 |
| 647 | Ga0207677_10770261 | 3300026023 | Unclassified | 859 |
| 648 | Ga0207703_10029366 | 3300026035 | Unclassified | 4338 |
| 649 | Ga0207703_10792339 | 3300026035 | Unclassified | 904 |
| 650 | Ga0207678_10014322 | 3300026067 | Bacteria | 6972 |
| 651 | Ga0207678_10670338 | 3300026067 | Unclassified | 912 |
| 652 | Ga0207708_10068379 | 3300026075 | Bacteria | 2719 |
| 653 | Ga0207641_10019247 | 3300026088 | Bacteria | 5602 |
| 654 | Ga0207641_10042174 | 3300026088 | Bacteria | 3827 |
| 655 | Ga0207648_10092561 | 3300026089 | Bacteria | 2643 |
| 656 | Ga0207648_10226205 | 3300026089 | Bacteria | 1664 |
| 657 | Ga0207648_10347627 | 3300026089 | Unclassified | 1336 |
| 658 | Ga0207648_10476660 | 3300026089 | Unclassified | 1139 |
| 659 | Ga0207675_100050517 | 3300026118 | Bacteria | 3880 |
| 660 | Ga0207675_100305166 | 3300026118 | Unclassified | 1551 |
| 661 | Ga0207675_101317458 | 3300026118 | Bacteria | 743 |
| 662 | Ga0207675_101639062 | 3300026118 | Unclassified | 663 |
| 663 | Ga0207683_10049059 | 3300026121 | Bacteria | 3695 |
| 664 | Ga0207683_10201969 | 3300026121 | Unclassified | 1807 |
| 665 | Ga0209179_1027732 | 3300027512 | Bacteria | 1144 |
| 666 | Ga0209974_10043679 | 3300027876 | Bacteria | 1494 |
| 667 | Ga0209974_10058584 | 3300027876 | Bacteria | 1302 |
| 668 | Ga0268266_10008426 | 3300028379 | Bacteria | 9166 |
| 669 | Ga0268266_10011362 | 3300028379 | Bacteria | 7743 |
| 670 | Ga0268266_10013533 | 3300028379 | Bacteria | 7025 |
| 671 | Ga0268266_10013597 | 3300028379 | Bacteria | 7010 |
| 672 | Ga0268266_10169519 | 3300028379 | Bacteria | 1981 |
| 673 | Ga0268265_10269186 | 3300028380 | Bacteria | 1519 |
| 674 | Ga0268264_10066327 | 3300028381 | Unclassified | 3043 |
| 675 | Ga0268264_10073739 | 3300028381 | Unclassified | 2898 |
| 676 | Ga0268264_10159138 | 3300028381 | Unclassified | 2032 |
| 677 | Ga0268264_11349505 | 3300028381 | Bacteria | 723 |
| 678 | Ga0307513_10058975 | 3300031456 | Bacteria | 4076 |
| 679 | Ga0373926_0235552 | 3300035083 | Unclassified | 708 |
| 680 | Ga0373944_0034315 | 3300035089 | Unclassified | 1542 |
| 681 | Ga0373944_0164429 | 3300035089 | Unclassified | 789 |
| 682 | Ga0373944_0202578 | 3300035089 | Unclassified | 719 |
| 683 | Ga0373952_0171847 | 3300035092 | Unclassified | 620 |
| 684 | Ga0373932_0065347 | 3300035112 | Bacteria | 1116 |
| 685 | Ga0373936_0238664 | 3300035113 | Unclassified | 810 |
| 686 | Ga0373945_0190425 | 3300035116 | Unclassified | 848 |
| 687 | Ga0373943_0042898 | 3300035170 | Unclassified | 2194 |
| 688 | Ga0373943_0048045 | 3300035170 | Bacteria | 2089 |
| 689 | Ga0373943_0059092 | 3300035170 | Bacteria | 1910 |
| 690 | Ga0373943_0143888 | 3300035170 | Bacteria | 1287 |
| 691 | Ga0373943_0456090 | 3300035170 | Unclassified | 743 |
| 692 | Ga0373943_0462981 | 3300035170 | Unclassified | 738 |
| 693 | Ga0373943_0534342 | 3300035170 | Unclassified | 687 |
| 694 | Ga0373946_0306263 | 3300035171 | Unclassified | 787 |
| 695 | Ga0373946_0323505 | 3300035171 | Bacteria | 767 |
| 696 | Ga0373946_0353357 | 3300035171 | Unclassified | 735 |
| 697 | Ga0373955_0016730 | 3300035172 | Bacteria | 3614 |
| 698 | Ga0373931_0286781 | 3300035691 | Unclassified | 1013 |
| 699 | Ga0373935_0138898 | 3300035692 | Bacteria | 1640 |
| 700 | Ga0373927_0050079 | 3300035695 | Bacteria | 2700 |
| 701 | Ga0373927_0074251 | 3300035695 | Bacteria | 2202 |
| 702 | Ga0373927_0253645 | 3300035695 | Bacteria | 1156 |
| 703 | Ga0373927_0630315 | 3300035695 | Unclassified | 709 |
| 704 | Ga0373947_0055536 | 3300035725 | Bacteria | 2392 |
| 705 | Ga0373947_0133623 | 3300035725 | Bacteria | 1586 |
| 706 | Ga0373947_0141108 | 3300035725 | Unclassified | 1545 |
| 707 | Ga0373947_0154618 | 3300035725 | Unclassified | 1479 |
| 708 | Ga0373947_0155408 | 3300035725 | Bacteria | 1476 |
| 709 | Ga0373947_0307022 | 3300035725 | Unclassified | 1059 |
| 710 | Ga0373947_0336005 | 3300035725 | Unclassified | 1012 |
| 711 | Ga0373937_0028930 | 3300036401 | Bacteria | 5017 |
| 712 | Ga0373937_0165326 | 3300036401 | Bacteria | 2075 |
| 713 | Ga0373937_0395709 | 3300036401 | Unclassified | 1311 |
| 714 | Ga0373925_0030700 | 3300037068 | Bacteria | 3946 |
| 715 | Ga0373925_0038373 | 3300037068 | Bacteria | 3541 |
| 716 | Ga0373925_0061788 | 3300037068 | Bacteria | 2815 |
| 717 | Ga0373925_0160806 | 3300037068 | Bacteria | 1769 |
| 718 | Ga0373925_0242065 | 3300037068 | Unclassified | 1445 |
| 719 | Ga0373925_0449387 | 3300037068 | Unclassified | 1055 |
| 720 | Ga0373925_0804095 | 3300037068 | Unclassified | 775 |
| 721 | Ga0395899_0034098 | 3300037312 | Bacteria | 3822 |
| 722 | Ga0395899_0203053 | 3300037312 | Unclassified | 1381 |
| 723 | Ga0395899_0205498 | 3300037312 | Bacteria | 1371 |
| 724 | Ga0395900_0004747 | 3300037418 | Bacteria | 14333 |
| 725 | Ga0395900_0027369 | 3300037418 | Bacteria | 5839 |
| 726 | Ga0395900_0207844 | 3300037418 | Bacteria | 1978 |
| 727 | Ga0395900_0879588 | 3300037418 | Unclassified | 820 |
| 728 | Ga0395900_1145092 | 3300037418 | Unclassified | 694 |
| 729 | Ga0395898_0058206 | 3300037466 | Bacteria | 3763 |
| 730 | Ga0395898_0775221 | 3300037466 | Bacteria | 900 |
| 731 | Ga0395898_1307453 | 3300037466 | Unclassified | 654 |
| 732 | Ga0395905_0005772 | 3300037471 | Bacteria | 12581 |
| 733 | Ga0395901_0001709 | 3300038443 | Bacteria | 22672 |
| 734 | Ga0395901_0154269 | 3300038443 | Bacteria | 2412 |
| 735 | Ga0395901_0548172 | 3300038443 | Bacteria | 1172 |
| 736 | Ga0395901_0753039 | 3300038443 | Unclassified | 967 |
| 737 | Ga0395901_0911845 | 3300038443 | Unclassified | 860 |
| 738 | Ga0395901_1068953 | 3300038443 | Bacteria | 779 |
| 739 | Ga0451807_1293021 | 3300041486 | Unclassified | 966 |
| 740 | Ga0451851_1337473 | 3300041507 | Bacteria | 1506 |
| 741 | Ga0451853_1067222 | 3300041512 | Unclassified | 720 |
| 742 | Ga0439448_0075180 | 3300042005 | Unclassified | 1129 |
| 743 | Ga0439451_061813 | 3300042009 | Unclassified | 749 |
| 744 | Ga0439455_0046001 | 3300042012 | Unclassified | 1130 |
| 745 | Ga0439455_0092645 | 3300042012 | Unclassified | 830 |
| 746 | Ga0439458_0020344 | 3300042157 | Unclassified | 1532 |
| 747 | Ga0439464_0045986 | 3300042439 | Unclassified | 1254 |
| 748 | Ga0439464_0177791 | 3300042439 | Unclassified | 673 |
| 749 | Ga0466967_0176308 | 3300045976 | Bacteria | 2014 |
| 750 | Ga0466967_1169049 | 3300045976 | Unclassified | 767 |
| 751 | Ga0495592_0174805 | 3300046454 | Bacteria | 1467 |
| 752 | Ga0495592_0203351 | 3300046454 | Bacteria | 1335 |
| 753 | Ga0495629_0167134 | 3300046459 | Bacteria | 1527 |
| 754 | Ga0495629_0323685 | 3300046459 | Unclassified | 1054 |
| 755 | Ga0495641_0026217 | 3300046461 | Unclassified | 2847 |
| 756 | Ga0495651_0134624 | 3300046462 | Bacteria | 1800 |
| 757 | Ga0495653_0252862 | 3300046463 | Unclassified | 1169 |
| 758 | Ga0495580_0024977 | 3300046472 | Bacteria | 4369 |
| 759 | Ga0495580_0118896 | 3300046472 | Bacteria | 1835 |
| 760 | Ga0495580_0268695 | 3300046472 | Unclassified | 1165 |
| 761 | Ga0495639_0054856 | 3300046475 | Unclassified | 1817 |
| 762 | Ga0495662_0292451 | 3300046476 | Bacteria | 802 |
| 763 | Ga0495664_0310308 | 3300046477 | Unclassified | 952 |
| 764 | Ga0495584_0403452 | 3300046491 | Unclassified | 695 |
| 765 | Ga0495585_0538964 | 3300046492 | Unclassified | 552 |
| 766 | Ga0495594_0062459 | 3300046499 | Unclassified | 2063 |
| 767 | Ga0495608_0427209 | 3300046511 | Unclassified | 808 |
| 768 | Ga0495618_0298917 | 3300046514 | Bacteria | 1000 |
| 769 | Ga0495618_0303106 | 3300046514 | Unclassified | 993 |
| 770 | Ga0495628_0025280 | 3300046516 | Bacteria | 4851 |
| 771 | Ga0495628_0065668 | 3300046516 | Bacteria | 2837 |
| 772 | Ga0495652_0071819 | 3300046529 | Bacteria | 2887 |
| 773 | Ga0495652_0467201 | 3300046529 | Unclassified | 880 |
| 774 | Ga0495665_0113858 | 3300046531 | Unclassified | 1418 |
| 775 | Ga0495640_0338579 | 3300046533 | Bacteria | 930 |
| 776 | Ga0495586_0014965 | 3300046535 | Unclassified | 4123 |
| 777 | Ga0495587_0032871 | 3300046536 | Bacteria | 3133 |
| 778 | Ga0495587_0118785 | 3300046536 | Unclassified | 1515 |
| 779 | Ga0495645_0018884 | 3300046543 | Bacteria | 4959 |
| 780 | Ga0495667_0235171 | 3300046559 | Unclassified | 1168 |
| 781 | Ga0495667_0316346 | 3300046559 | Unclassified | 988 |
| 782 | Ga0495634_0067123 | 3300046642 | Unclassified | 2373 |
| 783 | Ga0495634_0138275 | 3300046642 | Unclassified | 1548 |
| 784 | Ga0495635_0162115 | 3300046663 | Bacteria | 1522 |
| 785 | Ga0495635_0966655 | 3300046663 | Unclassified | 543 |
| 786 | Ga0495657_0297620 | 3300046675 | Bacteria | 963 |
| 787 | Ga0495599_0009881 | 3300046678 | Bacteria | 5839 |
| 788 | Ga0495623_0084428 | 3300046679 | Bacteria | 1959 |
| 789 | Ga0495623_0610767 | 3300046679 | Bacteria | 566 |
| 790 | Ga0495646_0349084 | 3300046680 | Bacteria | 775 |
| 791 | Ga0495647_0151286 | 3300046681 | Unclassified | 995 |
| 792 | Ga0495647_0559416 | 3300046681 | Unclassified | 535 |
| 793 | Ga0495658_0035562 | 3300046683 | Bacteria | 2742 |
| 794 | Ga0495658_0137626 | 3300046683 | Unclassified | 1491 |
| 795 | Ga0495658_0144605 | 3300046683 | Bacteria | 1456 |
| 796 | Ga0495669_0063355 | 3300046684 | Bacteria | 1677 |
| 797 | Ga0495669_0175990 | 3300046684 | Bacteria | 1019 |
| 798 | Ga0495613_0114128 | 3300046689 | Bacteria | 1945 |
| 799 | Ga0495670_0105854 | 3300046691 | Unclassified | 1453 |
| 800 | Ga0495604_0360981 | 3300047317 | Bacteria | 963 |
| 801 | Ga0495674_0095486 | 3300047319 | Bacteria | 2535 |
| 802 | Ga0495674_0106224 | 3300047319 | Bacteria | 2385 |
| 803 | Ga0495674_0537960 | 3300047319 | Bacteria | 931 |
| 804 | Ga0495676_0099662 | 3300047321 | Bacteria | 2153 |
| 805 | Ga0495684_0019922 | 3300047471 | Bacteria | 5169 |
| 806 | Ga0495684_0021901 | 3300047471 | Unclassified | 4921 |
| 807 | Ga0495602_0249500 | 3300048088 | Bacteria | 1323 |
| 808 | Ga0496100_0218524 | 3300048903 | Unclassified | 1397 |
| 809 | Ga0496100_0727553 | 3300048903 | Bacteria | 775 |
| 810 | Ga0496100_0943158 | 3300048903 | Unclassified | 678 |
| 811 | Ga0496101_0008167 | 3300048904 | Bacteria | 6835 |
| 812 | Ga0496101_0086242 | 3300048904 | Bacteria | 2328 |
| 813 | Ga0496101_0088718 | 3300048904 | Bacteria | 2297 |
| 814 | Ga0496101_0572582 | 3300048904 | Bacteria | 893 |
| 815 | Ga0496101_0817184 | 3300048904 | Bacteria | 735 |
| 816 | Ga0496102_0034150 | 3300048905 | Bacteria | 4574 |
| 817 | Ga0496102_0091941 | 3300048905 | Bacteria | 2809 |
| 818 | Ga0496102_0297121 | 3300048905 | Bacteria | 1522 |
| 819 | Ga0496102_0320847 | 3300048905 | Bacteria | 1459 |
| 820 | Ga0496102_1408062 | 3300048905 | Bacteria | 616 |
| 821 | Ga0496103_0035015 | 3300048906 | Bacteria | 3073 |
| 822 | Ga0496103_0064177 | 3300048906 | Unclassified | 2289 |
| 823 | Ga0496103_0088570 | 3300048906 | Bacteria | 1952 |
| 824 | Ga0496104_0038061 | 3300048907 | Unclassified | 4499 |
| 825 | Ga0496104_0137228 | 3300048907 | Bacteria | 2350 |
| 826 | Ga0496104_0270121 | 3300048907 | Unclassified | 1613 |
| 827 | Ga0496105_0067707 | 3300048908 | Bacteria | 2948 |
| 828 | Ga0496105_0664462 | 3300048908 | Bacteria | 803 |
| 829 | Ga0496105_0818715 | 3300048908 | Bacteria | 707 |
| 830 | Ga0496105_1104691 | 3300048908 | Unclassified | 588 |
| 831 | Ga0496106_0003127 | 3300048909 | Bacteria | 12356 |
| 832 | Ga0496106_0045492 | 3300048909 | Bacteria | 3297 |
| 833 | Ga0496106_0179925 | 3300048909 | Bacteria | 1678 |
| 834 | Ga0496107_0071857 | 3300048910 | Unclassified | 2515 |
| 835 | Ga0496107_0170584 | 3300048910 | Bacteria | 1614 |
| 836 | Ga0496108_0002475 | 3300048911 | Bacteria | 14788 |
| 837 | Ga0496108_0124094 | 3300048911 | Bacteria | 2216 |
| 838 | Ga0496109_0002007 | 3300048912 | Bacteria | 16881 |
| 839 | Ga0496109_0126388 | 3300048912 | Bacteria | 2384 |
| 840 | Ga0496109_0192938 | 3300048912 | Unclassified | 1914 |
| 841 | Ga0496109_0224434 | 3300048912 | Bacteria | 1767 |
| 842 | Ga0496109_0555403 | 3300048912 | Bacteria | 1083 |
| 843 | Ga0496109_0680865 | 3300048912 | Unclassified | 966 |
| 844 | Ga0496109_0718451 | 3300048912 | Unclassified | 937 |
| 845 | Ga0496109_0983796 | 3300048912 | Unclassified | 781 |
| 846 | Ga0496110_0167362 | 3300048913 | Bacteria | 1994 |
| 847 | Ga0496110_0314139 | 3300048913 | Unclassified | 1427 |
| 848 | Ga0496110_0427562 | 3300048913 | Unclassified | 1207 |
| 849 | Ga0496110_0901364 | 3300048913 | Bacteria | 790 |
| 850 | Ga0496111_0313276 | 3300048914 | Unclassified | 1163 |
| 851 | Ga0496111_0489422 | 3300048914 | Unclassified | 906 |
| 852 | Ga0496111_0879335 | 3300048914 | Unclassified | 646 |
| 853 | Ga0496112_0021831 | 3300048915 | Bacteria | 6092 |
| 854 | Ga0496112_0039437 | 3300048915 | Bacteria | 4616 |
| 855 | Ga0496112_0072132 | 3300048915 | Bacteria | 3413 |
| 856 | Ga0496112_0154011 | 3300048915 | Bacteria | 2266 |
| 857 | Ga0496112_0410503 | 3300048915 | Bacteria | 1293 |
| 858 | Ga0496112_0483551 | 3300048915 | Unclassified | 1174 |
| 859 | Ga0496112_0978804 | 3300048915 | Bacteria | 766 |
| 860 | Ga0496113_0017817 | 3300048916 | Bacteria | 4937 |
| 861 | Ga0496113_0390114 | 3300048916 | Unclassified | 1118 |
| 862 | Ga0496113_0466479 | 3300048916 | Unclassified | 1015 |
| 863 | Ga0496113_1007540 | 3300048916 | Bacteria | 656 |
| 864 | Ga0496114_0070174 | 3300048917 | Bacteria | 2942 |
| 865 | Ga0496114_0074455 | 3300048917 | Bacteria | 2858 |
| 866 | Ga0496115_0001716 | 3300048918 | Bacteria | 15716 |
| 867 | Ga0496115_0005334 | 3300048918 | Bacteria | 9351 |
| 868 | Ga0496115_0048497 | 3300048918 | Bacteria | 3397 |
| 869 | Ga0496115_0205171 | 3300048918 | Bacteria | 1628 |
| 870 | Ga0496115_0458260 | 3300048918 | Bacteria | 1029 |
| 871 | Ga0496115_0544345 | 3300048918 | Unclassified | 928 |
| 872 | nmdc:mga05p37_11154_c1 | 3300050507 | Bacteria | 10679 |
| 873 | nmdc:mga05p37_1161025_c1 | 3300050507 | Bacteria | 802 |
| 874 | nmdc:mga09592_725692_c1 | 3300050508 | Unclassified | 844 |
| 875 | nmdc:mga08y16_1048857_c1 | 3300050511 | Unclassified | 793 |
| 876 | nmdc:mga08y16_472578_c1 | 3300050511 | Unclassified | 1276 |
| 877 | nmdc:mga0n895_1009093_c1 | 3300050512 | Unclassified | 813 |
| 878 | nmdc:mga0n895_1189287_c1 | 3300050512 | Unclassified | 737 |
| 879 | nmdc:mga0n895_1493430_c1 | 3300050512 | Unclassified | 642 |
| 880 | nmdc:mga0n895_164699_c1 | 3300050512 | Unclassified | 2248 |
| 881 | nmdc:mga0n895_531066_c1 | 3300050512 | Bacteria | 1183 |
| 882 | nmdc:mga0rr50_183777_c1 | 3300050513 | Unclassified | 1710 |
| 883 | nmdc:mga0rr50_616320_c1 | 3300050513 | Unclassified | 925 |
| 884 | nmdc:mga0a205_184866_c1 | 3300050515 | Bacteria | 1977 |
| 885 | nmdc:mga0a205_294939_c1 | 3300050515 | Bacteria | 1495 |
| 886 | Ga0495601_0007392 | 3300053077 | Bacteria | 6438 |
| 887 | Ga0495601_0275630 | 3300053077 | Unclassified | 1097 |
| 888 | Ga0495601_0441413 | 3300053077 | Unclassified | 842 |
| 889 | Ga0495655_0019419 | 3300053083 | Unclassified | 1509 |
| 890 | Ga0495595_0130736 | 3300053084 | Unclassified | 1227 |
| 891 | Ga0495619_0397943 | 3300053085 | Unclassified | 951 |
| 892 | Ga0495619_0555903 | 3300053085 | Unclassified | 787 |
| 893 | Ga0070708_100141224 | |||
| 894 | MRS1b_contig_2830796 | |||
| 895 | CNXas_1000175 | |||
| 896 | JGI24743J22301_10026090 | |||
| 897 | JGI24744J21845_10030033 | |||
| 898 | JGI24035J26624_1000312 | |||
| 899 | JGI24035J26624_1010694 | |||
| 900 | JGI25406J46586_10000087 | |||
| 901 | JGI25404J52841_10034122 | |||
| 902 | JGI25404J52841_10037765 | |||
| 903 | JGI25405J52794_10002248 | |||
| 904 | Ga0065714_10074791 | |||
| 905 | Ga0065704_10004342 | |||
| 906 | Ga0065704_10007456 | |||
| 907 | Ga0065704_10208367 | |||
| 908 | Ga0065704_10224532 | |||
| 909 | Ga0065704_10276134 | |||
| 910 | Ga0065712_10000626 | |||
| 911 | Ga0065712_10000905 | |||
| 912 | Ga0065712_10013724 | |||
| 913 | Ga0065712_10152655 | |||
| 914 | Ga0065712_10157591 | |||
| 915 | Ga0065712_10184093 | |||
| 916 | Ga0065712_10277231 | |||
| 917 | Ga0065712_10566293 | |||
| 918 | Ga0065715_10000684 | |||
| 919 | Ga0065715_10096116 | |||
| 920 | Ga0065715_10119506 | |||
| 921 | Ga0065715_10139121 | |||
| 922 | Ga0065715_10155410 | |||
| 923 | Ga0065715_10183971 | |||
| 924 | Ga0065715_10254275 | |||
| 925 | Ga0065715_10254541 | |||
| 926 | Ga0065715_10346789 | |||
| 927 | Ga0065707_10038280 | |||
| 928 | Ga0065707_10182607 | |||
| 929 | Ga0065707_10199640 | |||
| 930 | Ga0065707_10282882 | |||
| 931 | Ga0070658_10207669 | |||
| 932 | Ga0070676_10006832 | |||
| 933 | Ga0070676_10033669 | |||
| 934 | Ga0070676_10057069 | |||
| 935 | Ga0070676_10097729 | |||
| 936 | Ga0070676_10180338 | |||
| 937 | Ga0070676_10182136 | |||
| 938 | Ga0070676_10681466 | |||
| 939 | Ga0070676_10725614 | |||
| 940 | Ga0070683_100072990 | |||
| 941 | Ga0070683_100429276 | |||
| 942 | Ga0070683_100482621 | |||
| 943 | Ga0070690_100034312 | |||
| 944 | Ga0070690_100043685 | |||
| 945 | Ga0070690_100184942 | |||
| 946 | Ga0070690_100310089 | |||
| 947 | Ga0070690_101026207 | |||
| 948 | Ga0070670_100021803 | |||
| 949 | Ga0070670_100203823 | |||
| 950 | Ga0070670_100234460 | |||
| 951 | Ga0070670_100426207 | |||
| 952 | Ga0068869_100271954 | |||
| 953 | Ga0070666_10006905 | |||
| 954 | Ga0070666_10066253 | |||
| 955 | Ga0070666_10102611 | |||
| 956 | Ga0070666_10298572 | |||
| 957 | Ga0070666_10557803 | |||
| 958 | Ga0070680_100965357 | |||
| 959 | Ga0068868_100078073 | |||
| 960 | Ga0068868_100161429 | |||
| 961 | Ga0070660_100278395 | |||
| 962 | Ga0070660_100292312 | |||
| 963 | Ga0070689_100002634 | |||
| 964 | Ga0070689_100086170 | |||
| 965 | Ga0070689_100087060 | |||
| 966 | Ga0070689_100176879 | |||
| 967 | Ga0070687_100466876 | |||
| 968 | Ga0070687_100624047 | |||
| 969 | Ga0070661_100077831 | |||
| 970 | Ga0070661_100620001 | |||
| 971 | Ga0070692_10057160 | |||
| 972 | Ga0070668_100007124 | |||
| 973 | Ga0070668_100029371 | |||
| 974 | Ga0070668_100034747 | |||
| 975 | Ga0070668_100059230 | |||
| 976 | Ga0070668_100127831 | |||
| 977 | Ga0070668_100401712 | |||
| 978 | Ga0070668_101459151 | |||
| 979 | Ga0070669_100005219 | |||
| 980 | Ga0070669_100015119 | |||
| 981 | Ga0070669_100043415 | |||
| 982 | Ga0070669_100056295 | |||
| 983 | Ga0070669_100150851 | |||
| 984 | Ga0070675_100010416 | |||
| 985 | Ga0070675_100013878 | |||
| 986 | Ga0070675_100030993 | |||
| 987 | Ga0070675_100043862 | |||
| 988 | Ga0070675_101014387 | |||
| 989 | Ga0070671_100018196 | |||
| 990 | Ga0070671_100076493 | |||
| 991 | Ga0070671_100086738 | |||
| 992 | Ga0070671_100106529 | |||
| 993 | Ga0070671_100245718 | |||
| 994 | Ga0070671_100948088 | |||
| 995 | Ga0070674_100018553 | |||
| 996 | Ga0070674_100021908 | |||
| 997 | Ga0070674_100142803 | |||
| 998 | Ga0070674_100509609 | |||
| 999 | Ga0070674_100864931 | |||
| 1000 | Ga0070674_100894038 | |||
| 1001 | Ga0070673_100007694 | |||
| 1002 | Ga0070673_100012707 | |||
| 1003 | Ga0070673_100082328 | |||
| 1004 | Ga0070673_100158244 | |||
| 1005 | Ga0070673_100915819 | |||
| 1006 | Ga0070673_101580235 | |||
| 1007 | Ga0070688_100001014 | |||
| 1008 | Ga0070688_100019023 | |||
| 1009 | Ga0070688_100118515 | |||
| 1010 | Ga0070688_100150872 | |||
| 1011 | Ga0070688_101306497 | |||
| 1012 | Ga0070659_100015190 | |||
| 1013 | Ga0070659_100018746 | |||
| 1014 | Ga0070667_100018730 | |||
| 1015 | Ga0070667_100051082 | |||
| 1016 | Ga0070667_100081368 | |||
| 1017 | Ga0070667_100460680 | |||
| 1018 | Ga0070703_10104910 | |||
| 1019 | Ga0070709_10018947 | |||
| 1020 | Ga0070709_10649702 | |||
| 1021 | Ga0070709_11203997 | |||
| 1022 | Ga0070714_100042855 | |||
| 1023 | Ga0070714_100048583 | |||
| 1024 | Ga0070714_100534016 | |||
| 1025 | Ga0070713_100009589 | |||
| 1026 | Ga0070713_100061038 | |||
| 1027 | Ga0070713_100101766 | |||
| 1028 | Ga0070713_100145613 | |||
| 1029 | Ga0070713_100315406 | |||
| 1030 | Ga0070713_101010218 | |||
| 1031 | Ga0070710_10003850 | |||
| 1032 | Ga0070710_10206346 | |||
| 1033 | Ga0070710_10232503 | |||
| 1034 | Ga0070710_10264215 | |||
| 1035 | Ga0070710_10751118 | |||
| 1036 | Ga0070711_100008313 | |||
| 1037 | Ga0070711_100173248 | |||
| 1038 | Ga0070711_100193764 | |||
| 1039 | Ga0070711_100219692 | |||
| 1040 | Ga0070711_100331985 | |||
| 1041 | Ga0070711_100913554 | |||
| 1042 | Ga0070705_100094700 | |||
| 1043 | Ga0070705_100121072 | |||
| 1044 | Ga0070705_100320040 | |||
| 1045 | Ga0070705_100335696 | |||
| 1046 | Ga0070700_100066401 | |||
| 1047 | Ga0070694_100979022 | |||
| 1048 | Ga0070694_101066971 | |||
| 1049 | Ga0070708_100001246 | |||
| 1050 | Ga0070708_100014035 | |||
| 1051 | Ga0070708_100041281 | |||
| 1052 | Ga0070708_100071778 | |||
| 1053 | Ga0070708_100108282 | |||
| 1054 | Ga0070708_100168149 | |||
| 1055 | Ga0070708_100209834 | |||
| 1056 | Ga0070708_100331098 | |||
| 1057 | Ga0070708_100672563 | |||
| 1058 | Ga0070708_100677399 | |||
| 1059 | Ga0070708_101083115 | |||
| 1060 | Ga0070663_100021879 | |||
| 1061 | Ga0070663_100030814 | |||
| 1062 | Ga0070678_100053696 | |||
| 1063 | Ga0070678_100078766 | |||
| 1064 | Ga0070678_100139478 | |||
| 1065 | Ga0070662_100010037 | |||
| 1066 | Ga0070662_100035606 | |||
| 1067 | Ga0070662_100184868 | |||
| 1068 | Ga0070662_100279896 | |||
| 1069 | Ga0070662_100339608 | |||
| 1070 | Ga0070662_100985827 | |||
| 1071 | Ga0070681_10030785 | |||
| 1072 | Ga0070681_10314375 | |||
| 1073 | Ga0068867_100101497 | |||
| 1074 | Ga0068867_100328765 | |||
| 1075 | Ga0070685_10015868 | |||
| 1076 | Ga0070685_10018427 | |||
| 1077 | Ga0070706_100000269 | |||
| 1078 | Ga0070706_100004511 | |||
| 1079 | Ga0070706_100007002 | |||
| 1080 | Ga0070706_100010420 | |||
| 1081 | Ga0070706_100020333 | |||
| 1082 | Ga0070706_100030390 | |||
| 1083 | Ga0070706_100064264 | |||
| 1084 | Ga0070706_100068685 | |||
| 1085 | Ga0070706_100155064 | |||
| 1086 | Ga0070706_100215389 | |||
| 1087 | Ga0070706_100242551 | |||
| 1088 | Ga0070706_100246388 | |||
| 1089 | Ga0070706_100353306 | |||
| 1090 | Ga0070706_100721770 | |||
| 1091 | Ga0070706_100780482 | |||
| 1092 | Ga0070706_100862305 | |||
| 1093 | Ga0070706_101207220 | |||
| 1094 | Ga0070706_101223064 | |||
| 1095 | Ga0070707_100021300 | |||
| 1096 | Ga0070707_100029036 | |||
| 1097 | Ga0070707_100040241 | |||
| 1098 | Ga0070707_100082456 | |||
| 1099 | Ga0070707_100174169 | |||
| 1100 | Ga0070707_100179344 | |||
| 1101 | Ga0070707_100252440 | |||
| 1102 | Ga0070707_100268875 | |||
| 1103 | Ga0070707_100287992 | |||
| 1104 | Ga0070707_100757385 | |||
| 1105 | Ga0070707_100788599 | |||
| 1106 | Ga0070707_101193393 | |||
| 1107 | Ga0070698_100001933 | |||
| 1108 | Ga0070698_100498205 | |||
| 1109 | Ga0070698_100815826 | |||
| 1110 | Ga0070698_101234527 | |||
| 1111 | Ga0070699_100017643 | |||
| 1112 | Ga0070699_100081643 | |||
| 1113 | Ga0070699_100155142 | |||
| 1114 | Ga0070699_100644198 | |||
| 1115 | Ga0070699_101605634 | |||
| 1116 | Ga0070679_100083609 | |||
| 1117 | Ga0070684_100032398 | |||
| 1118 | Ga0070684_100044817 | |||
| 1119 | Ga0070684_100049498 | |||
| 1120 | Ga0070684_100131389 | |||
| 1121 | Ga0070684_100225139 | |||
| 1122 | Ga0070697_100005205 | |||
| 1123 | Ga0070697_100006587 | |||
| 1124 | Ga0070697_100028885 | |||
| 1125 | Ga0070697_100030661 | |||
| 1126 | Ga0070697_100037478 | |||
| 1127 | Ga0070697_100037985 | |||
| 1128 | Ga0070697_100056434 | |||
| 1129 | Ga0070697_100152222 | |||
| 1130 | Ga0070697_100156565 | |||
| 1131 | Ga0070697_100244168 | |||
| 1132 | Ga0070697_100305785 | |||
| 1133 | Ga0070697_100567572 | |||
| 1134 | Ga0070697_101135261 | |||
| 1135 | Ga0070672_100004083 | |||
| 1136 | Ga0070672_100024482 | |||
| 1137 | Ga0070672_100074498 | |||
| 1138 | Ga0070672_100171408 | |||
| 1139 | Ga0070672_100179073 | |||
| 1140 | Ga0070672_100380597 | |||
| 1141 | Ga0070672_100398902 | |||
| 1142 | Ga0070672_100544932 | |||
| 1143 | Ga0070686_100043786 | |||
| 1144 | Ga0070693_100243079 | |||
| 1145 | Ga0070665_100016091 | |||
| 1146 | Ga0070665_100041976 | |||
| 1147 | Ga0070665_100194440 | |||
| 1148 | Ga0070665_100219570 | |||
| 1149 | Ga0070665_100506405 | |||
| 1150 | Ga0070665_100966177 | |||
| 1151 | Ga0070704_100044622 | |||
| 1152 | Ga0070704_100146156 | |||
| 1153 | Ga0070704_100374619 | |||
| 1154 | Ga0068855_100295577 | |||
| 1155 | Ga0070664_100075886 | |||
| 1156 | Ga0070664_100298699 | |||
| 1157 | Ga0070664_100637840 | |||
| 1158 | Ga0070702_100292818 | |||
| 1159 | Ga0068859_100201005 | |||
| 1160 | Ga0068859_101165342 | |||
| 1161 | Ga0068866_10159303 | |||
| 1162 | Ga0068866_10703705 | |||
| 1163 | Ga0068861_100036591 | |||
| 1164 | Ga0068861_100240392 | |||
| 1165 | Ga0068861_101589970 | |||
| 1166 | Ga0068863_100138451 | |||
| 1167 | Ga0068863_100335486 | |||
| 1168 | Ga0068863_100915242 | |||
| 1169 | Ga0068863_100947007 | |||
| 1170 | Ga0068858_100058111 | |||
| 1171 | Ga0068858_100797227 | |||
| 1172 | Ga0068858_101712248 | |||
| 1173 | Ga0068860_100026862 | |||
| 1174 | Ga0068860_100412032 | |||
| 1175 | Ga0068860_100565109 | |||
| 1176 | Ga0068862_100350877 | |||
| 1177 | Ga0081455_10001399 | |||
| 1178 | Ga0081455_10011319 | |||
| 1179 | Ga0081455_10016230 | |||
| 1180 | Ga0081455_10024323 | |||
| 1181 | Ga0081455_10026186 | |||
| 1182 | Ga0081455_10027681 | |||
| 1183 | Ga0081455_10360020 | |||
| 1184 | Ga0081455_10388173 | |||
| 1185 | Ga0081455_10453528 | |||
| 1186 | Ga0081540_1000036 | |||
| 1187 | Ga0081540_1025381 | |||
| 1188 | Ga0081540_1033289 | |||
| 1189 | Ga0081539_10000727 | |||
| 1190 | Ga0081539_10001132 | |||
| 1191 | Ga0081539_10088653 | |||
| 1192 | Ga0070717_10000989 | |||
| 1193 | Ga0070717_10013344 | |||
| 1194 | Ga0070717_10028937 | |||
| 1195 | Ga0070717_10121318 | |||
| 1196 | Ga0070717_10144273 | |||
| 1197 | Ga0070717_10188544 | |||
| 1198 | Ga0070717_10302706 | |||
| 1199 | Ga0070717_10406552 | |||
| 1200 | Ga0070717_11081801 | |||
| 1201 | Ga0070715_10053465 | |||
| 1202 | Ga0070716_100239024 | |||
| 1203 | Ga0070716_100594412 | |||
| 1204 | Ga0070712_100008008 | |||
| 1205 | Ga0070712_100011301 | |||
| 1206 | Ga0070712_100045849 | |||
| 1207 | Ga0070712_100081663 | |||
| 1208 | Ga0070712_100094353 | |||
| 1209 | Ga0070712_100096439 | |||
| 1210 | Ga0070712_100170006 | |||
| 1211 | Ga0070712_100201180 | |||
| 1212 | Ga0070712_100321903 | |||
| 1213 | Ga0070712_100363458 | |||
| 1214 | Ga0070712_100591734 | |||
| 1215 | Ga0097621_100076154 | |||
| 1216 | Ga0097621_100092818 | |||
| 1217 | Ga0097621_100099690 | |||
| 1218 | Ga0097621_100438891 | |||
| 1219 | Ga0068871_100135467 | |||
| 1220 | Ga0068871_100195061 | |||
| 1221 | Ga0068871_100252441 | |||
| 1222 | Ga0068871_100944839 | |||
| 1223 | Ga0075428_100881155 | |||
| 1224 | Ga0075433_10270533 | |||
| 1225 | Ga0075433_10565652 | |||
| 1226 | Ga0075433_10678673 | |||
| 1227 | Ga0075434_100195123 | |||
| 1228 | Ga0075434_100288099 | |||
| 1229 | Ga0075434_100313598 | |||
| 1230 | Ga0075434_100662672 | |||
| 1231 | Ga0075434_100691164 | |||
| 1232 | Ga0075429_100811826 | |||
| 1233 | Ga0068865_100040646 | |||
| 1234 | Ga0068865_100599774 | |||
| 1235 | Ga0075436_100071988 | |||
| 1236 | Ga0097620_100201007 | |||
| 1237 | Ga0097620_101165296 | |||
| 1238 | Ga0075435_100502079 | |||
| 1239 | Ga0099795_10043626 | |||
| 1240 | Ga0105240_10271232 | |||
| 1241 | Ga0111539_10250683 | |||
| 1242 | Ga0111539_10794807 | |||
| 1243 | Ga0111539_10903566 | |||
| 1244 | Ga0105245_10523316 | |||
| 1245 | Ga0105245_10680662 | |||
| 1246 | Ga0105245_10896568 | |||
| 1247 | Ga0105245_11092012 | |||
| 1248 | Ga0105247_10107485 | |||
| 1249 | Ga0105247_10975712 | |||
| 1250 | Ga0114129_10108940 | |||
| 1251 | Ga0114129_10343212 | |||
| 1252 | Ga0114129_10550244 | |||
| 1253 | Ga0114129_10652958 | |||
| 1254 | Ga0105243_10273657 | |||
| 1255 | Ga0105243_10431976 | |||
| 1256 | Ga0105243_10602715 | |||
| 1257 | Ga0105243_11641250 | |||
| 1258 | Ga0105243_12641502 | |||
| 1259 | Ga0105241_10120467 | |||
| 1260 | Ga0105241_11050930 | |||
| 1261 | Ga0105242_10077802 | |||
| 1262 | Ga0105242_10142894 | |||
| 1263 | Ga0105242_11018539 | |||
| 1264 | Ga0105242_11073914 | |||
| 1265 | Ga0105248_10269992 | |||
| 1266 | Ga0105248_10554940 | |||
| 1267 | Ga0105237_11703568 | |||
| 1268 | Ga0105238_10943343 | |||
| 1269 | Ga0105249_10029493 | |||
| 1270 | Ga0105249_10160954 | |||
| 1271 | Ga0105249_10397580 | |||
| 1272 | Ga0105249_10531582 | |||
| 1273 | Ga0105249_11299070 | |||
| 1274 | Ga0099796_10020855 | |||
| 1275 | Ga0099796_10045340 | |||
| 1276 | Ga0099796_10264980 | |||
| 1277 | Ga0105239_10003969 | |||
| 1278 | Ga0105239_10646859 | |||
| 1279 | Ga0105239_11213130 | |||
| 1280 | Ga0105246_10116656 | |||
| 1281 | Ga0105246_10175519 | |||
| 1282 | Ga0105246_10970379 | |||
| 1283 | Ga0157315_1010269 | |||
| 1284 | Ga0157371_10066841 | |||
| 1285 | Ga0157371_10526145 | |||
| 1286 | Ga0157371_10549419 | |||
| 1287 | Ga0157369_11302992 | |||
| 1288 | Ga0157374_10009864 | |||
| 1289 | Ga0157374_10017988 | |||
| 1290 | Ga0157374_10027132 | |||
| 1291 | Ga0157374_10045827 | |||
| 1292 | Ga0157374_10059858 | |||
| 1293 | Ga0157374_10078888 | |||
| 1294 | Ga0157374_10118282 | |||
| 1295 | Ga0157374_10158582 | |||
| 1296 | Ga0157374_10292875 | |||
| 1297 | Ga0157374_10303687 | |||
| 1298 | Ga0157374_10330276 | |||
| 1299 | Ga0157374_10544642 | |||
| 1300 | Ga0157374_10856921 | |||
| 1301 | Ga0157374_11388829 | |||
| 1302 | Ga0157378_10013936 | |||
| 1303 | Ga0157378_10052952 | |||
| 1304 | Ga0157378_10075047 | |||
| 1305 | Ga0157378_10122234 | |||
| 1306 | Ga0157378_10228801 | |||
| 1307 | Ga0157378_10684582 | |||
| 1308 | Ga0157378_10843586 | |||
| 1309 | Ga0157378_10847336 | |||
| 1310 | Ga0157378_10980328 | |||
| 1311 | Ga0157378_11000621 | |||
| 1312 | Ga0163162_10006459 | |||
| 1313 | Ga0163162_10104768 | |||
| 1314 | Ga0163162_10137299 | |||
| 1315 | Ga0163162_10141758 | |||
| 1316 | Ga0163162_10171473 | |||
| 1317 | Ga0163162_10172172 | |||
| 1318 | Ga0163162_10307324 | |||
| 1319 | Ga0163162_10426785 | |||
| 1320 | Ga0163162_10438666 | |||
| 1321 | Ga0163162_11167150 | |||
| 1322 | Ga0163162_11391466 | |||
| 1323 | Ga0157372_10068892 | |||
| 1324 | Ga0157372_10111374 | |||
| 1325 | Ga0157372_10214195 | |||
| 1326 | Ga0157372_12126886 | |||
| 1327 | Ga0157375_10023260 | |||
| 1328 | Ga0157375_10030865 | |||
| 1329 | Ga0157375_10039200 | |||
| 1330 | Ga0157375_10089755 | |||
| 1331 | Ga0157375_10259734 | |||
| 1332 | Ga0157375_10712721 | |||
| 1333 | Ga0163163_10015125 | |||
| 1334 | Ga0163163_10439317 | |||
| 1335 | Ga0163163_10897321 | |||
| 1336 | Ga0157377_10031453 | |||
| 1337 | Ga0157377_10333367 | |||
| 1338 | Ga0157377_10856919 | |||
| 1339 | Ga0157379_10151190 | |||
| 1340 | Ga0157379_10237893 | |||
| 1341 | Ga0157379_10297411 | |||
| 1342 | Ga0157379_10505961 | |||
| 1343 | Ga0157376_10047094 | |||
| 1344 | Ga0157376_10069981 | |||
| 1345 | Ga0157376_10072651 | |||
| 1346 | Ga0157376_10167479 | |||
| 1347 | Ga0157376_10181437 | |||
| 1348 | Ga0157376_10459536 | |||
| 1349 | Ga0157376_10748738 | |||
| 1350 | Ga0157376_11776327 | |||
| 1351 | Ga0163161_10068564 | |||
| 1352 | Ga0163161_10253544 | |||
| 1353 | Ga0163161_10785455 | |||
| 1354 | Ga0207666_1000268 | |||
| 1355 | Ga0207666_1000445 | |||
| 1356 | Ga0207673_1010655 | |||
| 1357 | Ga0207697_10000305 | |||
| 1358 | Ga0207697_10000749 | |||
| 1359 | Ga0207697_10002349 | |||
| 1360 | Ga0207697_10002915 | |||
| 1361 | Ga0207697_10040533 | |||
| 1362 | Ga0207697_10069836 | |||
| 1363 | Ga0207697_10069930 | |||
| 1364 | Ga0207697_10093609 | |||
| 1365 | Ga0207697_10101190 | |||
| 1366 | Ga0207697_10191537 | |||
| 1367 | Ga0207697_10261760 | |||
| 1368 | Ga0207697_10435088 | |||
| 1369 | Ga0207656_10327457 | |||
| 1370 | Ga0207696_1063563 | |||
| 1371 | Ga0207682_10031850 | |||
| 1372 | Ga0207692_10007795 | |||
| 1373 | Ga0207692_10059860 | |||
| 1374 | Ga0207692_10164757 | |||
| 1375 | Ga0207710_10462373 | |||
| 1376 | Ga0207688_10014931 | |||
| 1377 | Ga0207688_10024140 | |||
| 1378 | Ga0207688_10032890 | |||
| 1379 | Ga0207688_10040485 | |||
| 1380 | Ga0207688_10352592 | |||
| 1381 | Ga0207680_10426575 | |||
| 1382 | Ga0207680_10492829 | |||
| 1383 | Ga0207680_10602004 | |||
| 1384 | Ga0207680_10685146 | |||
| 1385 | Ga0207647_10056519 | |||
| 1386 | Ga0207685_10048137 | |||
| 1387 | Ga0207685_10102253 | |||
| 1388 | Ga0207699_10702471 | |||
| 1389 | Ga0207699_10882727 | |||
| 1390 | Ga0207645_10001207 | |||
| 1391 | Ga0207645_10030242 | |||
| 1392 | Ga0207645_10067393 | |||
| 1393 | Ga0207645_10101892 | |||
| 1394 | Ga0207645_10191261 | |||
| 1395 | Ga0207705_10330021 | |||
| 1396 | Ga0207684_10000134 | |||
| 1397 | Ga0207684_10010852 | |||
| 1398 | Ga0207684_10026757 | |||
| 1399 | Ga0207684_10051976 | |||
| 1400 | Ga0207684_10060083 | |||
| 1401 | Ga0207684_10092011 | |||
| 1402 | Ga0207684_10136003 | |||
| 1403 | Ga0207684_10266201 | |||
| 1404 | Ga0207684_10318222 | |||
| 1405 | Ga0207684_10379877 | |||
| 1406 | Ga0207684_10486180 | |||
| 1407 | Ga0207684_10981516 | |||
| 1408 | Ga0207707_10035655 | |||
| 1409 | Ga0207671_10215675 | |||
| 1410 | Ga0207693_10001338 | |||
| 1411 | Ga0207693_10052702 | |||
| 1412 | Ga0207693_10063808 | |||
| 1413 | Ga0207693_10085453 | |||
| 1414 | Ga0207693_10114960 | |||
| 1415 | Ga0207693_10142725 | |||
| 1416 | Ga0207693_10311988 | |||
| 1417 | Ga0207693_10485187 | |||
| 1418 | Ga0207663_10055090 | |||
| 1419 | Ga0207663_10089367 | |||
| 1420 | Ga0207663_10261454 | |||
| 1421 | Ga0207663_10374212 | |||
| 1422 | Ga0207660_10082617 | |||
| 1423 | Ga0207662_10015959 | |||
| 1424 | Ga0207662_10047476 | |||
| 1425 | Ga0207662_10727218 | |||
| 1426 | Ga0207657_10182461 | |||
| 1427 | Ga0207657_10199927 | |||
| 1428 | Ga0207657_10751470 | |||
| 1429 | Ga0207652_10117862 | |||
| 1430 | Ga0207646_10022265 | |||
| 1431 | Ga0207646_10041787 | |||
| 1432 | Ga0207646_10100357 | |||
| 1433 | Ga0207646_10102548 | |||
| 1434 | Ga0207646_10153427 | |||
| 1435 | Ga0207646_10236366 | |||
| 1436 | Ga0207646_10296485 | |||
| 1437 | Ga0207646_10550484 | |||
| 1438 | Ga0207646_10640832 | |||
| 1439 | Ga0207646_10679888 | |||
| 1440 | Ga0207681_10012037 | |||
| 1441 | Ga0207681_10055235 | |||
| 1442 | Ga0207681_10092103 | |||
| 1443 | Ga0207681_10138924 | |||
| 1444 | Ga0207681_10161894 | |||
| 1445 | Ga0207681_10476435 | |||
| 1446 | Ga0207650_10102795 | |||
| 1447 | Ga0207650_10173665 | |||
| 1448 | Ga0207650_10302536 | |||
| 1449 | Ga0207650_10329433 | |||
| 1450 | Ga0207659_10034033 | |||
| 1451 | Ga0207659_10091247 | |||
| 1452 | Ga0207659_10091540 | |||
| 1453 | Ga0207659_10098795 | |||
| 1454 | Ga0207659_10117709 | |||
| 1455 | Ga0207659_10121309 | |||
| 1456 | Ga0207659_10170598 | |||
| 1457 | Ga0207659_10893348 | |||
| 1458 | Ga0207687_10077931 | |||
| 1459 | Ga0207687_10174505 | |||
| 1460 | Ga0207687_10375345 | |||
| 1461 | Ga0207687_10387745 | |||
| 1462 | Ga0207687_10924025 | |||
| 1463 | Ga0207700_10007438 | |||
| 1464 | Ga0207700_10115020 | |||
| 1465 | Ga0207700_10296271 | |||
| 1466 | Ga0207700_10720980 | |||
| 1467 | Ga0207664_10059774 | |||
| 1468 | Ga0207664_10093216 | |||
| 1469 | Ga0207664_10619773 | |||
| 1470 | Ga0207664_10640954 | |||
| 1471 | Ga0207644_10109616 | |||
| 1472 | Ga0207644_10129688 | |||
| 1473 | Ga0207644_10144973 | |||
| 1474 | Ga0207644_10164028 | |||
| 1475 | Ga0207644_10414778 | |||
| 1476 | Ga0207644_10543823 | |||
| 1477 | Ga0207690_10016085 | |||
| 1478 | Ga0207690_10017865 | |||
| 1479 | Ga0207690_10214696 | |||
| 1480 | Ga0207706_10000989 | |||
| 1481 | Ga0207706_10015312 | |||
| 1482 | Ga0207706_10045022 | |||
| 1483 | Ga0207706_10240414 | |||
| 1484 | Ga0207706_10311032 | |||
| 1485 | Ga0207706_10416782 | |||
| 1486 | Ga0207706_10460365 | |||
| 1487 | Ga0207686_10083840 | |||
| 1488 | Ga0207686_11497963 | |||
| 1489 | Ga0207709_10294603 | |||
| 1490 | Ga0207670_10009364 | |||
| 1491 | Ga0207670_10126553 | |||
| 1492 | Ga0207670_10329004 | |||
| 1493 | Ga0207669_10257281 | |||
| 1494 | Ga0207704_10279035 | |||
| 1495 | Ga0207704_10510315 | |||
| 1496 | Ga0207665_10029353 | |||
| 1497 | Ga0207665_10071887 | |||
| 1498 | Ga0207665_11390091 | |||
| 1499 | Ga0207691_10000847 | |||
| 1500 | Ga0207691_10003287 | |||
| 1501 | Ga0207691_10060881 | |||
| 1502 | Ga0207691_10100787 | |||
| 1503 | Ga0207691_10205379 | |||
| 1504 | Ga0207691_10393784 | |||
| 1505 | Ga0207691_10848882 | |||
| 1506 | Ga0207689_10060604 | |||
| 1507 | Ga0207661_10075909 | |||
| 1508 | Ga0207661_10088850 | |||
| 1509 | Ga0207661_10472589 | |||
| 1510 | Ga0207661_10915240 | |||
| 1511 | Ga0207679_10116924 | |||
| 1512 | Ga0207679_10344760 | |||
| 1513 | Ga0207679_11251812 | |||
| 1514 | Ga0207667_10514162 | |||
| 1515 | Ga0207651_10037857 | |||
| 1516 | Ga0207651_10082943 | |||
| 1517 | Ga0207651_10331047 | |||
| 1518 | Ga0207651_10467867 | |||
| 1519 | Ga0207712_10161333 | |||
| 1520 | Ga0207712_10297893 | |||
| 1521 | Ga0207712_11431089 | |||
| 1522 | Ga0207668_10089010 | |||
| 1523 | Ga0207668_10161033 | |||
| 1524 | Ga0207668_10205587 | |||
| 1525 | Ga0207668_10216282 | |||
| 1526 | Ga0207668_10246573 | |||
| 1527 | Ga0207668_10311339 | |||
| 1528 | Ga0207668_10548531 | |||
| 1529 | Ga0207658_10067665 | |||
| 1530 | Ga0207658_10178922 | |||
| 1531 | Ga0207658_10245723 | |||
| 1532 | Ga0207658_10998773 | |||
| 1533 | Ga0207677_10108448 | |||
| 1534 | Ga0207677_10134711 | |||
| 1535 | Ga0207677_10156284 | |||
| 1536 | Ga0207677_10228020 | |||
| 1537 | Ga0207677_10237647 | |||
| 1538 | Ga0207677_10379662 | |||
| 1539 | Ga0207677_10770261 | |||
| 1540 | Ga0207703_10029366 | |||
| 1541 | Ga0207703_10792339 | |||
| 1542 | Ga0207678_10014322 | |||
| 1543 | Ga0207678_10670338 | |||
| 1544 | Ga0207708_10068379 | |||
| 1545 | Ga0207641_10019247 | |||
| 1546 | Ga0207641_10042174 | |||
| 1547 | Ga0207648_10092561 | |||
| 1548 | Ga0207648_10226205 | |||
| 1549 | Ga0207648_10347627 | |||
| 1550 | Ga0207648_10476660 | |||
| 1551 | Ga0207675_100050517 | |||
| 1552 | Ga0207675_100305166 | |||
| 1553 | Ga0207675_101317458 | |||
| 1554 | Ga0207675_101639062 | |||
| 1555 | Ga0207683_10049059 | |||
| 1556 | Ga0207683_10201969 | |||
| 1557 | Ga0209179_1027732 | |||
| 1558 | Ga0209974_10043679 | |||
| 1559 | Ga0209974_10058584 | |||
| 1560 | Ga0268266_10008426 | |||
| 1561 | Ga0268266_10011362 | |||
| 1562 | Ga0268266_10013533 | |||
| 1563 | Ga0268266_10013597 | |||
| 1564 | Ga0268266_10169519 | |||
| 1565 | Ga0268265_10269186 | |||
| 1566 | Ga0268264_10066327 | |||
| 1567 | Ga0268264_10073739 | |||
| 1568 | Ga0268264_10159138 | |||
| 1569 | Ga0268264_11349505 | |||
| 1570 | Ga0307513_10058975 | |||
| 1571 | Ga0373926_0235552 | |||
| 1572 | Ga0373944_0034315 | |||
| 1573 | Ga0373944_0164429 | |||
| 1574 | Ga0373944_0202578 | |||
| 1575 | Ga0373952_0171847 | |||
| 1576 | Ga0373932_0065347 | |||
| 1577 | Ga0373936_0238664 | |||
| 1578 | Ga0373945_0190425 | |||
| 1579 | Ga0373943_0042898 | |||
| 1580 | Ga0373943_0048045 | |||
| 1581 | Ga0373943_0059092 | |||
| 1582 | Ga0373943_0143888 | |||
| 1583 | Ga0373943_0456090 | |||
| 1584 | Ga0373943_0462981 | |||
| 1585 | Ga0373943_0534342 | |||
| 1586 | Ga0373946_0306263 | |||
| 1587 | Ga0373946_0323505 | |||
| 1588 | Ga0373946_0353357 | |||
| 1589 | Ga0373955_0016730 | |||
| 1590 | Ga0373931_0286781 | |||
| 1591 | Ga0373935_0138898 | |||
| 1592 | Ga0373927_0050079 | |||
| 1593 | Ga0373927_0074251 | |||
| 1594 | Ga0373927_0253645 | |||
| 1595 | Ga0373927_0630315 | |||
| 1596 | Ga0373947_0055536 | |||
| 1597 | Ga0373947_0133623 | |||
| 1598 | Ga0373947_0141108 | |||
| 1599 | Ga0373947_0154618 | |||
| 1600 | Ga0373947_0155408 | |||
| 1601 | Ga0373947_0307022 | |||
| 1602 | Ga0373947_0336005 | |||
| 1603 | Ga0373937_0028930 | |||
| 1604 | Ga0373937_0165326 | |||
| 1605 | Ga0373937_0395709 | |||
| 1606 | Ga0373925_0030700 | |||
| 1607 | Ga0373925_0038373 | |||
| 1608 | Ga0373925_0061788 | |||
| 1609 | Ga0373925_0160806 | |||
| 1610 | Ga0373925_0242065 | |||
| 1611 | Ga0373925_0449387 | |||
| 1612 | Ga0373925_0804095 | |||
| 1613 | Ga0395899_0034098 | |||
| 1614 | Ga0395899_0203053 | |||
| 1615 | Ga0395899_0205498 | |||
| 1616 | Ga0395900_0004747 | |||
| 1617 | Ga0395900_0027369 | |||
| 1618 | Ga0395900_0207844 | |||
| 1619 | Ga0395900_0879588 | |||
| 1620 | Ga0395900_1145092 | |||
| 1621 | Ga0395898_0058206 | |||
| 1622 | Ga0395898_0775221 | |||
| 1623 | Ga0395898_1307453 | |||
| 1624 | Ga0395905_0005772 | |||
| 1625 | Ga0395901_0001709 | |||
| 1626 | Ga0395901_0154269 | |||
| 1627 | Ga0395901_0548172 | |||
| 1628 | Ga0395901_0753039 | |||
| 1629 | Ga0395901_0911845 | |||
| 1630 | Ga0395901_1068953 | |||
| 1631 | Ga0451807_1293021 | |||
| 1632 | Ga0451851_1337473 | |||
| 1633 | Ga0451853_1067222 | |||
| 1634 | Ga0439448_0075180 | |||
| 1635 | Ga0439451_061813 | |||
| 1636 | Ga0439455_0046001 | |||
| 1637 | Ga0439455_0092645 | |||
| 1638 | Ga0439458_0020344 | |||
| 1639 | Ga0439464_0045986 | |||
| 1640 | Ga0439464_0177791 | |||
| 1641 | Ga0466967_0176308 | |||
| 1642 | Ga0466967_1169049 | |||
| 1643 | Ga0495592_0174805 | |||
| 1644 | Ga0495592_0203351 | |||
| 1645 | Ga0495629_0167134 | |||
| 1646 | Ga0495629_0323685 | |||
| 1647 | Ga0495641_0026217 | |||
| 1648 | Ga0495651_0134624 | |||
| 1649 | Ga0495653_0252862 | |||
| 1650 | Ga0495580_0024977 | |||
| 1651 | Ga0495580_0118896 | |||
| 1652 | Ga0495580_0268695 | |||
| 1653 | Ga0495639_0054856 | |||
| 1654 | Ga0495662_0292451 | |||
| 1655 | Ga0495664_0310308 | |||
| 1656 | Ga0495584_0403452 | |||
| 1657 | Ga0495585_0538964 | |||
| 1658 | Ga0495594_0062459 | |||
| 1659 | Ga0495608_0427209 | |||
| 1660 | Ga0495618_0298917 | |||
| 1661 | Ga0495618_0303106 | |||
| 1662 | Ga0495628_0025280 | |||
| 1663 | Ga0495628_0065668 | |||
| 1664 | Ga0495652_0071819 | |||
| 1665 | Ga0495652_0467201 | |||
| 1666 | Ga0495665_0113858 | |||
| 1667 | Ga0495640_0338579 | |||
| 1668 | Ga0495586_0014965 | |||
| 1669 | Ga0495587_0032871 | |||
| 1670 | Ga0495587_0118785 | |||
| 1671 | Ga0495645_0018884 | |||
| 1672 | Ga0495667_0235171 | |||
| 1673 | Ga0495667_0316346 | |||
| 1674 | Ga0495634_0067123 | |||
| 1675 | Ga0495634_0138275 | |||
| 1676 | Ga0495635_0162115 | |||
| 1677 | Ga0495635_0966655 | |||
| 1678 | Ga0495657_0297620 | |||
| 1679 | Ga0495599_0009881 | |||
| 1680 | Ga0495623_0084428 | |||
| 1681 | Ga0495623_0610767 | |||
| 1682 | Ga0495646_0349084 | |||
| 1683 | Ga0495647_0151286 | |||
| 1684 | Ga0495647_0559416 | |||
| 1685 | Ga0495658_0035562 | |||
| 1686 | Ga0495658_0137626 | |||
| 1687 | Ga0495658_0144605 | |||
| 1688 | Ga0495669_0063355 | |||
| 1689 | Ga0495669_0175990 | |||
| 1690 | Ga0495613_0114128 | |||
| 1691 | Ga0495670_0105854 | |||
| 1692 | Ga0495604_0360981 | |||
| 1693 | Ga0495674_0095486 | |||
| 1694 | Ga0495674_0106224 | |||
| 1695 | Ga0495674_0537960 | |||
| 1696 | Ga0495676_0099662 | |||
| 1697 | Ga0495684_0019922 | |||
| 1698 | Ga0495684_0021901 | |||
| 1699 | Ga0495602_0249500 | |||
| 1700 | Ga0496100_0218524 | |||
| 1701 | Ga0496100_0727553 | |||
| 1702 | Ga0496100_0943158 | |||
| 1703 | Ga0496101_0008167 | |||
| 1704 | Ga0496101_0086242 | |||
| 1705 | Ga0496101_0088718 | |||
| 1706 | Ga0496101_0572582 | |||
| 1707 | Ga0496101_0817184 | |||
| 1708 | Ga0496102_0034150 | |||
| 1709 | Ga0496102_0091941 | |||
| 1710 | Ga0496102_0297121 | |||
| 1711 | Ga0496102_0320847 | |||
| 1712 | Ga0496102_1408062 | |||
| 1713 | Ga0496103_0035015 | |||
| 1714 | Ga0496103_0064177 | |||
| 1715 | Ga0496103_0088570 | |||
| 1716 | Ga0496104_0038061 | |||
| 1717 | Ga0496104_0137228 | |||
| 1718 | Ga0496104_0270121 | |||
| 1719 | Ga0496105_0067707 | |||
| 1720 | Ga0496105_0664462 | |||
| 1721 | Ga0496105_0818715 | |||
| 1722 | Ga0496105_1104691 | |||
| 1723 | Ga0496106_0003127 | |||
| 1724 | Ga0496106_0045492 | |||
| 1725 | Ga0496106_0179925 | |||
| 1726 | Ga0496107_0071857 | |||
| 1727 | Ga0496107_0170584 | |||
| 1728 | Ga0496108_0002475 | |||
| 1729 | Ga0496108_0124094 | |||
| 1730 | Ga0496109_0002007 | |||
| 1731 | Ga0496109_0126388 | |||
| 1732 | Ga0496109_0192938 | |||
| 1733 | Ga0496109_0224434 | |||
| 1734 | Ga0496109_0555403 | |||
| 1735 | Ga0496109_0680865 | |||
| 1736 | Ga0496109_0718451 | |||
| 1737 | Ga0496109_0983796 | |||
| 1738 | Ga0496110_0167362 | |||
| 1739 | Ga0496110_0314139 | |||
| 1740 | Ga0496110_0427562 | |||
| 1741 | Ga0496110_0901364 | |||
| 1742 | Ga0496111_0313276 | |||
| 1743 | Ga0496111_0489422 | |||
| 1744 | Ga0496111_0879335 | |||
| 1745 | Ga0496112_0021831 | |||
| 1746 | Ga0496112_0039437 | |||
| 1747 | Ga0496112_0072132 | |||
| 1748 | Ga0496112_0154011 | |||
| 1749 | Ga0496112_0410503 | |||
| 1750 | Ga0496112_0483551 | |||
| 1751 | Ga0496112_0978804 | |||
| 1752 | Ga0496113_0017817 | |||
| 1753 | Ga0496113_0390114 | |||
| 1754 | Ga0496113_0466479 | |||
| 1755 | Ga0496113_1007540 | |||
| 1756 | Ga0496114_0070174 | |||
| 1757 | Ga0496114_0074455 | |||
| 1758 | Ga0496115_0001716 | |||
| 1759 | Ga0496115_0005334 | |||
| 1760 | Ga0496115_0048497 | |||
| 1761 | Ga0496115_0205171 | |||
| 1762 | Ga0496115_0458260 | |||
| 1763 | Ga0496115_0544345 | |||
| 1764 | nmdc:mga05p37_11154_c1 | |||
| 1765 | nmdc:mga05p37_1161025_c1 | |||
| 1766 | nmdc:mga09592_725692_c1 | |||
| 1767 | nmdc:mga08y16_1048857_c1 | |||
| 1768 | nmdc:mga08y16_472578_c1 | |||
| 1769 | nmdc:mga0n895_1009093_c1 | |||
| 1770 | nmdc:mga0n895_1189287_c1 | |||
| 1771 | nmdc:mga0n895_1493430_c1 | |||
| 1772 | nmdc:mga0n895_164699_c1 | |||
| 1773 | nmdc:mga0n895_531066_c1 | |||
| 1774 | nmdc:mga0rr50_183777_c1 | |||
| 1775 | nmdc:mga0rr50_616320_c1 | |||
| 1776 | nmdc:mga0a205_184866_c1 | |||
| 1777 | nmdc:mga0a205_294939_c1 | |||
| 1778 | Ga0495601_0007392 | |||
| 1779 | Ga0495601_0275630 | |||
| 1780 | Ga0495601_0441413 | |||
| 1781 | Ga0495655_0019419 | |||
| 1782 | Ga0495595_0130736 | |||
| 1783 | Ga0495619_0397943 | |||
| 1784 | Ga0495619_0555903 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wy9-assembly1.cif.gz_B | tcur3481-tcur3483 steroid acad g363a variant | 0.4065 | 20 | 162 |
| 2ib0-assembly1.cif.gz_A | crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis | 0.4026 | 20 | 163 |
| 2ib0-assembly1.cif.gz_B | crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis | 0.3891 | 20 | 161 |
| 5flz-assembly1.cif.gz_D | cryo-em structure of gamma-tusc oligomers in a closed conformation | 0.3891 | 84 | 157 |
| 5jsc-assembly1.cif.gz_A-2 | crystal structure of a putative acyl-coa dehydrogenase from burkholderia xenovorans | 0.3734 | 20 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G2J646_1_138_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.4084 | 20 | 162 | 1.20.140.150 |
| af_Q54CS1_1_135_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4081 | 17 | 160 | 1.20.1250.20 |
| 2ib0A01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.3982 | 20 | 162 | 1.20.1260.10 |
| af_Q60304_1_144_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3973 | 18 | 162 | 1.20.1070.10 |
| af_P55344_52_170_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.3948 | 20 | 162 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5Q384-F1-model_v4 | Uncharacterized protein | 0.9883 | 1 | 163 |
|
| AF-A0A2V5QGV8-F1-model_v4 | Uncharacterized protein | 0.9833 | 1 | 152 |
|
| AF-A0A2V5Q384-F1-model_v4 | Uncharacterized protein | 0.9823 | 1 | 163 |
|
| AF-A0A2V5KJ62-F1-model_v4 | Uncharacterized protein | 0.9821 | 1 | 163 |
|
| AF-A0A2V5M9G4-F1-model_v4 | Uncharacterized protein | 0.981 | 19 | 163 |
|