F484839

General Info

Members Datasets Scaffolds Average Seq Length
890 471 1780 281

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675902999|2676198706
Length 339
Sequence TRPRPTRPLGAGPSRPQADTGPRAAAETTAAQTTQGRLMGAKLLTISDAVAVVENGMTIGIGGWGSRRKPMALVRALARGPATDLTVVTYGGPDVGLLAAAGKIRKLVSGFVSLDSVPLEPHFRAARQRGEIEFAELDEGMLQWGLLAAAHRLPFLPIRAGLGSDVPATFPGLRTVTSPYDDGEELLAMPALPLDVAFVHANRADAAGNAAFLGPDPYFDDLFCLAARHRVLSCERVVETAELTKEAPVQALRINRMMVDAVVGTPNGAHFTSCVPDYDRDEAFQRVYVTAAGGDGSGWAAFHDRYLAGDEAAYQAAVRADGGSAGRAGDRAREKEGAR

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
78 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
139 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
144 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
145 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
149 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
150 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
166 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
201 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
210 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
211 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
212 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
217 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
218 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
219 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
220 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
221 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
222 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
223 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
224 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
264 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
265 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
266 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
294 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
295 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
296 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
308 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
309 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
310 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
380 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
384 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
385 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
386 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
387 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
388 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
389 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
390 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
391 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
392 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
393 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
394 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
395 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
396 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
397 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
398 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
399 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
400 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
401 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
402 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
403 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
406 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
407 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
408 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
409 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
410 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
411 2508501039 Frankia saprophytica CN3 Isolate Nodule
412 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
413 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
414 2517572101 Frankia sp. DC12 Isolate Nodule
415 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
416 2558860280 Kutzneria sp. 744 Isolate Unclassified
417 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
418 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
419 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
420 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
421 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
422 2643221615 Nocardioides sp. Root224 Isolate Unclassified
423 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
424 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
425 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
426 2643221714 Streptomyces sp. Root264 Isolate Unclassified
427 2687453737 Frankia sp. BMG5.36 Isolate Nodule
428 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
429 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
430 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
431 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
432 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
433 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
434 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
435 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
436 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
437 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
438 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
439 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
440 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
441 2867475112 Streptomyces sp. TM32 Isolate Unclassified
442 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
443 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
444 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
445 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
446 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
447 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
448 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
449 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
450 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
451 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
452 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
453 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
454 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
455 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
456 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
457 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
458 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
459 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
460 8002775197 Frankia nepalensis CN7 Isolate Nodule
461 8002784119 Frankia sp. AgB1.9 Isolate Nodule
462 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
463 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
464 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
465 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
466 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
467 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
468 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
469 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
470 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
471 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.7
Metatranscriptomes 0.34
Isolates 6.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.96
Nodule 0.9
Rhizoplane 3.6
Rhizosphere 81.69
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10040025 3300003323 Bacteria 2668
2 JGI25160J50197_1010407 3300003354 Bacteria 3368
3 JGI25160J50197_1010458 3300003354 Bacteria 3356
4 JGI25407J50210_10000081 3300003373 Bacteria 12363
5 Ga0070658_10191459 3300005327 Bacteria 1724
6 Ga0070683_100029457 3300005329 Bacteria 4971
7 Ga0070683_100297734 3300005329 Bacteria 1534
8 Ga0070670_100083623 3300005331 Bacteria 2742
9 Ga0070666_10042268 3300005335 Bacteria 3049
10 Ga0070680_100048577 3300005336 Bacteria 3458
11 Ga0070689_100055438 3300005340 Bacteria 3072
12 Ga0070661_100063599 3300005344 Bacteria 2711
13 Ga0070668_100356017 3300005347 Bacteria 1240
14 Ga0070671_100080699 3300005355 Bacteria 2720
15 Ga0070659_100050283 3300005366 Bacteria 3277
16 Ga0070667_100102769 3300005367 Bacteria 2470
17 Ga0070667_100107680 3300005367 Bacteria 2414
18 Ga0070667_100634067 3300005367 Bacteria 986
19 Ga0070703_10023561 3300005406 Bacteria 1814
20 Ga0070709_10104308 3300005434 Bacteria 1894
21 Ga0070709_10187981 3300005434 Bacteria 1455
22 Ga0070714_100067196 3300005435 Bacteria 3090
23 Ga0070714_100068939 3300005435 Bacteria 3053
24 Ga0070713_100028430 3300005436 Bacteria 4415
25 Ga0070710_10006047 3300005437 Bacteria 5784
26 Ga0070710_10016463 3300005437 Bacteria 3763
27 Ga0070710_10225363 3300005437 Bacteria 1194
28 Ga0070711_100031168 3300005439 Bacteria 3537
29 Ga0070705_100117759 3300005440 Bacteria 1709
30 Ga0070700_100158614 3300005441 Bacteria 1555
31 Ga0070708_100025454 3300005445 Bacteria 5058
32 Ga0070708_100044914 3300005445 Bacteria 3889
33 Ga0070708_100375522 3300005445 Bacteria 1340
34 Ga0070678_100154134 3300005456 Bacteria 1854
35 Ga0070681_10441366 3300005458 Bacteria 1213
36 Ga0070685_10049747 3300005466 Bacteria 2419
37 Ga0070706_100016148 3300005467 Bacteria 6894
38 Ga0070706_100016968 3300005467 Bacteria 6725
39 Ga0070706_100228843 3300005467 Bacteria 1736
40 Ga0070707_100004155 3300005468 Bacteria 13572
41 Ga0070707_100106016 3300005468 Bacteria 2726
42 Ga0070707_100167375 3300005468 Bacteria 2142
43 Ga0070707_100176786 3300005468 Bacteria 2081
44 Ga0070707_100424089 3300005468 Bacteria 1291
45 Ga0070698_100015348 3300005471 Bacteria 8096
46 Ga0070698_100018403 3300005471 Bacteria 7355
47 Ga0070698_100025986 3300005471 Bacteria 6100
48 Ga0070698_100134954 3300005471 Bacteria 2422
49 Ga0070699_100002522 3300005518 Bacteria 16441
50 Ga0070697_100021918 3300005536 Bacteria 5067
51 Ga0068853_100023230 3300005539 Bacteria 5188
52 Ga0068853_100154615 3300005539 Bacteria 2066
53 Ga0070696_100060878 3300005546 Bacteria 2640
54 Ga0070696_100085507 3300005546 Bacteria 2239
55 Ga0068857_100203416 3300005577 Bacteria 1805
56 Ga0068854_100153122 3300005578 Bacteria 1779
57 Ga0068856_100725043 3300005614 Bacteria 1014
58 Ga0070702_100028819 3300005615 Bacteria 3012
59 Ga0068852_100438944 3300005616 Bacteria 1290
60 Ga0068859_100025600 3300005617 Bacteria 5918
61 Ga0068864_100044738 3300005618 Bacteria 3796
62 Ga0068864_100528700 3300005618 Bacteria 1138
63 Ga0068861_100342670 3300005719 Bacteria 1308
64 Ga0068870_10019102 3300005840 Bacteria 3320
65 Ga0068858_100261004 3300005842 Bacteria 1646
66 Ga0068860_100198649 3300005843 Bacteria 1943
67 Ga0068862_100075379 3300005844 Bacteria 2918
68 Ga0068862_100530158 3300005844 Bacteria 1122
69 Ga0081455_10001268 3300005937 Bacteria 31556
70 Ga0081455_10003534 3300005937 Bacteria 17935
71 Ga0081455_10067728 3300005937 Bacteria 2974
72 Ga0081538_10000315 3300005981 Bacteria 55243
73 Ga0081538_10000932 3300005981 Bacteria 31558
74 Ga0081540_1000188 3300005983 Bacteria 64441
75 Ga0070717_10060271 3300006028 Bacteria 3142
76 Ga0075365_10218685 3300006038 Bacteria 1336
77 Ga0075368_10016792 3300006042 Bacteria 2731
78 Ga0075363_100021875 3300006048 Bacteria 3228
79 Ga0075363_100043968 3300006048 Bacteria 2364
80 Ga0075363_100060783 3300006048 Bacteria 2035
81 Ga0075364_10010007 3300006051 Bacteria 5712
82 Ga0070715_10171694 3300006163 Bacteria 1080
83 Ga0070716_100029013 3300006173 Bacteria 2986
84 Ga0070716_100041933 3300006173 Bacteria 2552
85 Ga0070712_100051032 3300006175 Bacteria 2880
86 Ga0070712_100093601 3300006175 Bacteria 2206
87 Ga0075362_10184607 3300006177 Bacteria 1011
88 Ga0075367_10041724 3300006178 Bacteria 2683
89 Ga0097621_100049091 3300006237 Bacteria 3427
90 Ga0075370_10007144 3300006353 Bacteria 5670
91 Ga0075370_10037124 3300006353 Bacteria 2739
92 Ga0075370_10109591 3300006353 Bacteria 1602
93 Ga0075428_100007298 3300006844 Bacteria 12243
94 Ga0075428_100089273 3300006844 Bacteria 3362
95 Ga0075428_100090269 3300006844 Bacteria 3342
96 Ga0075428_100101552 3300006844 Bacteria 3135
97 Ga0075428_100302914 3300006844 Bacteria 1718
98 Ga0075430_100008076 3300006846 Bacteria 8893
99 Ga0075430_100229387 3300006846 Bacteria 1540
100 Ga0075431_100006028 3300006847 Bacteria 12016
101 Ga0075431_100037157 3300006847 Bacteria 5019
102 Ga0075431_100223301 3300006847 Bacteria 1921
103 Ga0075431_100228498 3300006847 Bacteria 1896
104 Ga0075434_100352523 3300006871 Bacteria 1493
105 Ga0075429_100011730 3300006880 Bacteria 7600
106 Ga0075429_100053239 3300006880 Bacteria 3522
107 Ga0075429_100104872 3300006880 Bacteria 2469
108 Ga0075429_100396134 3300006880 Bacteria 1209
109 Ga0075436_100050628 3300006914 Bacteria 2866
110 Ga0097620_100025599 3300006931 Bacteria 5918
111 Ga0075435_100113261 3300007076 Bacteria 2257
112 Ga0105251_10038345 3300009011 Bacteria 2348
113 Ga0111539_10023318 3300009094 Bacteria 7603
114 Ga0111539_10036801 3300009094 Bacteria 5914
115 Ga0111539_10064417 3300009094 Bacteria 4335
116 Ga0111539_10259001 3300009094 Bacteria 2025
117 Ga0105245_10390252 3300009098 Bacteria 1389
118 Ga0114129_10001936 3300009147 Bacteria 28337
119 Ga0114129_10099336 3300009147 Bacteria 4028
120 Ga0114129_10315297 3300009147 Bacteria 2080
121 Ga0114129_10428911 3300009147 Bacteria 1737
122 Ga0114129_10463534 3300009147 Bacteria 1660
123 Ga0105248_10328846 3300009177 Bacteria 1721
124 Ga0105237_10098385 3300009545 Bacteria 2916
125 Ga0105237_10599090 3300009545 Bacteria 1109
126 Ga0105238_10361731 3300009551 Bacteria 1441
127 Ga0105246_10044376 3300011119 Bacteria 3021
128 Ga0157318_1001287 3300012482 Bacteria 1240
129 Ga0157322_1002177 3300012490 Bacteria 1075
130 Ga0157373_10065925 3300013100 Bacteria 2562
131 Ga0157369_10081935 3300013105 Bacteria 3453
132 Ga0157378_10239937 3300013297 Bacteria 1731
133 Ga0163162_10151807 3300013306 Bacteria 2435
134 Ga0157372_10160063 3300013307 Bacteria 2602
135 Ga0182008_10021672 3300014497 Bacteria 3299
136 Ga0157377_10367882 3300014745 Bacteria 970
137 Ga0157379_10375699 3300014968 Bacteria 1303
138 Ga0163161_10121616 3300017792 Bacteria 1962
139 Ga0206353_11181304 3300020082 Bacteria 1122
140 Ga0224712_10085216 3300022467 Bacteria 1312
141 Ga0207426_1000393 3300025302 Bacteria 74583
142 Ga0207426_1008845 3300025302 Bacteria 4030
143 Ga0207426_1010084 3300025302 Bacteria 3692
144 Ga0207426_1023514 3300025302 Bacteria 2101
145 Ga0207653_10007654 3300025885 Bacteria 3370
146 Ga0207692_10020941 3300025898 Bacteria 2984
147 Ga0207692_10029132 3300025898 Bacteria 2620
148 Ga0207692_10055087 3300025898 Bacteria 2034
149 Ga0207647_10008520 3300025904 Bacteria 7344
150 Ga0207645_10056315 3300025907 Bacteria 2510
151 Ga0207643_10024532 3300025908 Bacteria 3328
152 Ga0207705_10099742 3300025909 Bacteria 2135
153 Ga0207684_10289802 3300025910 Bacteria 1411
154 Ga0207654_10020775 3300025911 Bacteria 3486
155 Ga0207707_10218157 3300025912 Bacteria 1660
156 Ga0207671_10153888 3300025914 Bacteria 1778
157 Ga0207693_10030843 3300025915 Bacteria 4234
158 Ga0207693_10070965 3300025915 Bacteria 2726
159 Ga0207663_10013981 3300025916 Bacteria 4381
160 Ga0207663_10101973 3300025916 Bacteria 1929
161 Ga0207657_10024882 3300025919 Bacteria 5534
162 Ga0207649_10089527 3300025920 Bacteria 2012
163 Ga0207652_10168159 3300025921 Bacteria 1967
164 Ga0207646_10040326 3300025922 Bacteria 4199
165 Ga0207646_10082172 3300025922 Bacteria 2881
166 Ga0207646_10157142 3300025922 Bacteria 2051
167 Ga0207681_10236307 3300025923 Bacteria 1421
168 Ga0207694_10273284 3300025924 Bacteria 1386
169 Ga0207694_10349859 3300025924 Bacteria 1223
170 Ga0207650_10127644 3300025925 Bacteria 1987
171 Ga0207687_10339849 3300025927 Bacteria 1220
172 Ga0207700_10062651 3300025928 Bacteria 2825
173 Ga0207700_10418074 3300025928 Bacteria 1177
174 Ga0207664_10006770 3300025929 Bacteria 7916
175 Ga0207664_10087486 3300025929 Bacteria 2547
176 Ga0207664_10097488 3300025929 Bacteria 2422
177 Ga0207664_10157376 3300025929 Bacteria 1935
178 Ga0207664_10226010 3300025929 Bacteria 1625
179 Ga0207664_10313836 3300025929 Bacteria 1382
180 Ga0207644_10176579 3300025931 Bacteria 1671
181 Ga0207706_10080297 3300025933 Bacteria 2868
182 Ga0207686_10153200 3300025934 Bacteria 1607
183 Ga0207670_10223535 3300025936 Bacteria 1442
184 Ga0207669_10101745 3300025937 Bacteria 1902
185 Ga0207704_10153666 3300025938 Bacteria 1628
186 Ga0207665_10048950 3300025939 Bacteria 2839
187 Ga0207691_10013412 3300025940 Bacteria 7844
188 Ga0207689_10025886 3300025942 Bacteria 4914
189 Ga0207712_10083308 3300025961 Bacteria 2334
190 Ga0207640_10244207 3300025981 Bacteria 1389
191 Ga0207658_10057394 3300025986 Bacteria 2893
192 Ga0207658_10340703 3300025986 Bacteria 1303
193 Ga0207677_10250828 3300026023 Bacteria 1437
194 Ga0207703_10569016 3300026035 Bacteria 1070
195 Ga0207639_10015967 3300026041 Bacteria 5304
196 Ga0207678_10015175 3300026067 Bacteria 6776
197 Ga0207702_10124205 3300026078 Bacteria 2314
198 Ga0207702_10129096 3300026078 Bacteria 2273
199 Ga0207648_10047823 3300026089 Bacteria 3748
200 Ga0207676_10286157 3300026095 Bacteria 1499
201 Ga0207674_10024180 3300026116 Bacteria 6495
202 Ga0207675_100017217 3300026118 Bacteria 6748
203 Ga0207675_100114685 3300026118 Bacteria 2545
204 Ga0207675_100558818 3300026118 Bacteria 1144
205 Ga0207683_10003222 3300026121 Bacteria 14237
206 Ga0207683_10189242 3300026121 Bacteria 1868
207 Ga0207683_10530851 3300026121 Bacteria 1088
208 Ga0207698_10204461 3300026142 Bacteria 1771
209 Ga0207428_10052335 3300027907 Bacteria 3261
210 Ga0268266_10248208 3300028379 Bacteria 1645
211 Ga0265337_1006979 3300028556 Bacteria 4278
212 Ga0265326_10000701 3300028558 Bacteria 12388
213 Ga0265319_1001835 3300028563 Bacteria 12110
214 Ga0265334_10000468 3300028573 Bacteria 20832
215 Ga0265318_10010806 3300028577 Bacteria 3961
216 Ga0265323_10001755 3300028653 Bacteria 10292
217 Ga0265322_10001776 3300028654 Bacteria 6843
218 Ga0265336_10001798 3300028666 Bacteria 9374
219 Ga0307515_10001023 3300028794 Bacteria 63806
220 Ga0307515_10008714 3300028794 Bacteria 19719
221 Ga0307515_10043536 3300028794 Bacteria 6974
222 Ga0307515_10279335 3300028794 Bacteria 1379
223 Ga0265338_10009448 3300028800 Bacteria 11622
224 Ga0265324_10001624 3300029957 Bacteria 12483
225 Ga0307511_10003945 3300030521 Bacteria 15158
226 Ga0307511_10077350 3300030521 Bacteria 2370
227 Ga0307512_10010153 3300030522 Bacteria 9002
228 Ga0307512_10045850 3300030522 Bacteria 3572
229 Ga0307512_10053759 3300030522 Bacteria 3198
230 Ga0265332_10001612 3300031238 Bacteria 12359
231 Ga0265332_10014975 3300031238 Bacteria 3428
232 Ga0265320_10000138 3300031240 Bacteria 62264
233 Ga0265320_10002827 3300031240 Bacteria 11938
234 Ga0265320_10041128 3300031240 Bacteria 2300
235 Ga0265325_10029875 3300031241 Bacteria 2926
236 Ga0265340_10024931 3300031247 Bacteria 3033
237 Ga0265339_10050472 3300031249 Bacteria 2275
238 Ga0307513_10010075 3300031456 Bacteria 11904
239 Ga0307513_10150627 3300031456 Bacteria 2235
240 Ga0307509_10039611 3300031507 Bacteria 5132
241 Ga0307509_10263847 3300031507 Bacteria 1495
242 Ga0307509_10330620 3300031507 Bacteria 1256
243 Ga0265313_10012535 3300031595 Bacteria 5165
244 Ga0307508_10002491 3300031616 Bacteria 19419
245 Ga0307508_10008345 3300031616 Bacteria 9576
246 Ga0307508_10010804 3300031616 Bacteria 8349
247 Ga0307508_10019546 3300031616 Bacteria 6156
248 Ga0307508_10134895 3300031616 Bacteria 2071
249 Ga0307508_10137433 3300031616 Bacteria 2047
250 Ga0307514_10024896 3300031649 Bacteria 4840
251 Ga0307514_10045858 3300031649 Bacteria 3417
252 Ga0265314_10004380 3300031711 Bacteria 13132
253 Ga0265314_10057010 3300031711 Bacteria 2686
254 Ga0265342_10002497 3300031712 Bacteria 15841
255 Ga0316578_10005179 3300031728 Bacteria 6287
256 Ga0307516_10010098 3300031730 Bacteria 10438
257 Ga0307516_10088259 3300031730 Bacteria 2934
258 Ga0307516_10145394 3300031730 Bacteria 2137
259 Ga0307516_10170951 3300031730 Bacteria 1914
260 Ga0316577_10008956 3300031733 Bacteria 5373
261 Ga0307518_10032990 3300031838 Bacteria 3755
262 Ga0307406_10071387 3300031901 Bacteria 2276
263 Ga0307409_100002630 3300031995 Bacteria 9448
264 Ga0307409_100044637 3300031995 Bacteria 3340
265 Ga0307416_100139696 3300032002 Bacteria 2199
266 Ga0307416_100353069 3300032002 Bacteria 1489
267 Ga0307416_100689227 3300032002 Bacteria 1110
268 Ga0307411_10083281 3300032005 Bacteria 2209
269 Ga0307415_100204789 3300032126 Bacteria 1569
270 Ga0307507_10014834 3300033179 Bacteria 9240
271 Ga0307507_10019990 3300033179 Bacteria 7515
272 Ga0307507_10024114 3300033179 Bacteria 6645
273 Ga0307510_10034112 3300033180 Bacteria 5704
274 Ga0307510_10075136 3300033180 Bacteria 3333
275 Ga0307510_10104090 3300033180 Bacteria 2613
276 Ga0373958_0004760 3300034819 Bacteria 2025
277 Ga0373926_0005161 3300035083 Bacteria 4296
278 Ga0373926_0011101 3300035083 Bacteria 3027
279 Ga0373928_0006714 3300035084 Bacteria 2215
280 Ga0373934_0011432 3300035086 Bacteria 3339
281 Ga0373934_0017937 3300035086 Bacteria 2705
282 Ga0373934_0035828 3300035086 Bacteria 1953
283 Ga0373934_0137895 3300035086 Bacteria 997
284 Ga0373944_0001678 3300035089 Bacteria 5602
285 Ga0373944_0007848 3300035089 Bacteria 2870
286 Ga0373952_0031306 3300035092 Bacteria 1182
287 Ga0373923_0017501 3300035111 Bacteria 2743
288 Ga0373923_0021048 3300035111 Bacteria 2541
289 Ga0373923_0035688 3300035111 Bacteria 2026
290 Ga0373923_0085200 3300035111 Bacteria 1375
291 Ga0373936_0000897 3300035113 Bacteria 10623
292 Ga0373936_0015326 3300035113 Bacteria 2937
293 Ga0373936_0044742 3300035113 Bacteria 1782
294 Ga0373941_0003839 3300035115 Bacteria 3442
295 Ga0373945_0000102 3300035116 Bacteria 20195
296 Ga0373945_0015873 3300035116 Bacteria 2537
297 Ga0373953_0023359 3300035117 Bacteria 2340
298 Ga0373953_0039063 3300035117 Bacteria 1880
299 Ga0373953_0111227 3300035117 Bacteria 1158
300 Ga0373954_0011393 3300035118 Bacteria 3940
301 Ga0373956_0018625 3300035119 Bacteria 2941
302 Ga0373956_0039881 3300035119 Bacteria 2082
303 Ga0373956_0108263 3300035119 Bacteria 1292
304 Ga0373956_0134743 3300035119 Bacteria 1158
305 Ga0373960_0137700 3300035121 Bacteria 824
306 Ga0373943_0001235 3300035170 Bacteria 11436
307 Ga0373943_0001490 3300035170 Bacteria 10605
308 Ga0373946_0000368 3300035171 Bacteria 14591
309 Ga0373946_0002080 3300035171 Bacteria 7028
310 Ga0373955_0021970 3300035172 Bacteria 3228
311 Ga0373955_0032095 3300035172 Bacteria 2754
312 Ga0373955_0062513 3300035172 Bacteria 2059
313 Ga0373955_0076643 3300035172 Bacteria 1881
314 Ga0373942_0019301 3300035207 Bacteria 1700
315 Ga0373962_0025142 3300035242 Bacteria 1598
316 Ga0316574_0042226 3300035398 Bacteria 2813
317 Ga0316574_0085640 3300035398 Bacteria 2005
318 Ga0316574_0210866 3300035398 Bacteria 1246
319 Ga0373924_0001722 3300035410 Bacteria 7225
320 Ga0373924_0058745 3300035410 Bacteria 1605
321 Ga0373924_0086828 3300035410 Bacteria 1335
322 Ga0373935_0010906 3300035692 Bacteria 5457
323 Ga0373935_0072779 3300035692 Bacteria 2219
324 Ga0373935_0082515 3300035692 Bacteria 2091
325 Ga0373927_0003543 3300035695 Bacteria 11161
326 Ga0373927_0013721 3300035695 Bacteria 5379
327 Ga0373933_0022630 3300035724 Bacteria 3581
328 Ga0373933_0059594 3300035724 Bacteria 2299
329 Ga0373933_0071887 3300035724 Bacteria 2106
330 Ga0373947_0034067 3300035725 Bacteria 3011
331 Ga0373947_0042205 3300035725 Bacteria 2722
332 Ga0373947_0096176 3300035725 Bacteria 1854
333 Ga0373937_0011349 3300036401 Bacteria 7817
334 Ga0373937_0021455 3300036401 Bacteria 5797
335 Ga0373937_0063803 3300036401 Bacteria 3388
336 Ga0373937_0101050 3300036401 Bacteria 2676
337 Ga0373937_0127236 3300036401 Bacteria 2377
338 Ga0373937_0167344 3300036401 Bacteria 2062
339 Ga0373937_0354273 3300036401 Bacteria 1390
340 Ga0372808_006573 3300036459 Bacteria 1569
341 Ga0316582_0065751 3300036647 Bacteria 2335
342 Ga0316584_0011983 3300036712 Bacteria 6108
343 Ga0373925_0008512 3300037068 Bacteria 7476
344 Ga0373925_0011272 3300037068 Bacteria 6484
345 Ga0373925_0048935 3300037068 Bacteria 3150
346 Ga0373925_0163953 3300037068 Bacteria 1752
347 Ga0395898_0001427 3300037466 Bacteria 33941
348 Ga0395898_0047254 3300037466 Bacteria 4225
349 Ga0395898_0075617 3300037466 Bacteria 3253
350 Ga0395905_0068862 3300037471 Bacteria 3315
351 Ga0395905_0415528 3300037471 Bacteria 1241
352 Ga0436364_0615903 3300037853 Bacteria 1832
353 Ga0395901_0002610 3300038443 Bacteria 18249
354 Ga0395901_0110265 3300038443 Bacteria 2889
355 Ga0395901_0495714 3300038443 Unclassified 1244
356 Ga0395901_0532866 3300038443 Bacteria 1192
357 Ga0436360_0836502 3300039438 Bacteria 1621
358 Ga0439439_0004368 3300041406 Bacteria 3180
359 Ga0439439_0009177 3300041406 Bacteria 2348
360 Ga0451795_1677241 3300041456 Bacteria 1560
361 Ga0451837_0240693 3300041494 Bacteria 1099
362 Ga0451843_1540016 3300041509 Bacteria 1413
363 Ga0451853_0476508 3300041512 Bacteria 1131
364 Ga0451853_1594502 3300041512 Bacteria 6701
365 Ga0451853_2545623 3300041512 Bacteria 2179
366 Ga0439433_0005784 3300041999 Bacteria 2658
367 Ga0439448_0023155 3300042005 Bacteria 1935
368 Ga0439449_0000442 3300042007 Bacteria 15380
369 Ga0439449_0010521 3300042007 Bacteria 3496
370 Ga0439449_0148256 3300042007 Bacteria 875
371 Ga0439450_000437 3300042008 Bacteria 5402
372 Ga0439451_014725 3300042009 Bacteria 1578
373 Ga0439454_004730 3300042011 Bacteria 1587
374 Ga0439457_000676 3300042014 Bacteria 10064
375 Ga0439457_001457 3300042014 Bacteria 7106
376 Ga0439457_031060 3300042014 Bacteria 1184
377 Ga0439463_010119 3300042016 Bacteria 2317
378 Ga0450894_000344 3300042131 Bacteria 8207
379 Ga0450896_000776 3300042133 Bacteria 3586
380 Ga0439460_0002951 3300042461 Bacteria 4099
381 Ga0466969_0165996 3300044656 Bacteria 1013
382 Ga0466972_0013279 3300044658 Bacteria 4135
383 Ga0466965_0000328 3300044683 Bacteria 15868
384 Ga0466965_0005657 3300044683 Bacteria 5639
385 Ga0466966_0004959 3300044684 Bacteria 8748
386 Ga0466966_0009094 3300044684 Bacteria 6580
387 Ga0466966_0017860 3300044684 Bacteria 4684
388 Ga0466966_0121704 3300044684 Bacteria 1602
389 Ga0466961_0001263 3300044693 Bacteria 15604
390 Ga0466961_0005863 3300044693 Bacteria 7782
391 Ga0466961_0011189 3300044693 Bacteria 5736
392 Ga0466961_0105265 3300044693 Bacteria 1776
393 Ga0466963_0002567 3300044694 Bacteria 10186
394 Ga0466963_0359488 3300044694 Bacteria 1026
395 Ga0466964_0004936 3300044706 Bacteria 4930
396 Ga0466971_0000643 3300044719 Bacteria 13885
397 Ga0466970_0000784 3300044765 Bacteria 15349
398 Ga0466970_0115055 3300044765 Bacteria 1470
399 Ga0466957_0000472 3300044842 Bacteria 19985
400 Ga0466959_0001522 3300045049 Bacteria 14235
401 Ga0466959_0066703 3300045049 Bacteria 2610
402 Ga0466959_0072610 3300045049 Bacteria 2490
403 Ga0466958_0000634 3300045836 Bacteria 15090
404 Ga0466958_0129293 3300045836 Bacteria 1585
405 Ga0466967_0001051 3300045976 Bacteria 15191
406 Ga0466967_0053820 3300045976 Bacteria 3539
407 Ga0466967_0206304 3300045976 Bacteria 1863
408 Ga0466967_0216027 3300045976 Bacteria 1820
409 Ga0495617_024824 3300046452 Bacteria 2022
410 Ga0495627_015581 3300046453 Bacteria 2621
411 Ga0495592_0006615 3300046454 Bacteria 8640
412 Ga0495592_0030288 3300046454 Bacteria 4093
413 Ga0495603_0002864 3300046455 Bacteria 10194
414 Ga0495603_0005542 3300046455 Bacteria 7534
415 Ga0495603_0014849 3300046455 Bacteria 4711
416 Ga0495603_0026971 3300046455 Bacteria 3468
417 Ga0495603_0053928 3300046455 Bacteria 2385
418 Ga0495629_0001666 3300046459 Bacteria 17435
419 Ga0495629_0004782 3300046459 Bacteria 10150
420 Ga0495629_0022175 3300046459 Bacteria 4529
421 Ga0495629_0024737 3300046459 Bacteria 4274
422 Ga0495629_0034900 3300046459 Bacteria 3555
423 Ga0495629_0069702 3300046459 Bacteria 2454
424 Ga0495629_0073165 3300046459 Bacteria 2393
425 Ga0495629_0113595 3300046459 Bacteria 1888
426 Ga0495629_0130590 3300046459 Bacteria 1750
427 Ga0495629_0133214 3300046459 Bacteria 1731
428 Ga0495629_0153099 3300046459 Bacteria 1602
429 Ga0495638_0012365 3300046460 Bacteria 5853
430 Ga0495638_0121106 3300046460 Bacteria 1546
431 Ga0495641_0008474 3300046461 Bacteria 6258
432 Ga0495641_0009440 3300046461 Bacteria 5793
433 Ga0495641_0132715 3300046461 Bacteria 1112
434 Ga0495651_0009007 3300046462 Bacteria 7663
435 Ga0495651_0010493 3300046462 Bacteria 7119
436 Ga0495651_0017086 3300046462 Bacteria 5622
437 Ga0495651_0108159 3300046462 Bacteria 2059
438 Ga0495653_0001214 3300046463 Bacteria 19969
439 Ga0495653_0080990 3300046463 Bacteria 2400
440 Ga0495653_0095856 3300046463 Bacteria 2158
441 Ga0495653_0205562 3300046463 Bacteria 1333
442 Ga0495580_0008781 3300046472 Bacteria 8005
443 Ga0495582_0004394 3300046473 Bacteria 7930
444 Ga0495582_0255982 3300046473 Bacteria 1004
445 Ga0495605_0008869 3300046474 Bacteria 5669
446 Ga0495639_0003145 3300046475 Bacteria 7170
447 Ga0495639_0011817 3300046475 Bacteria 3765
448 Ga0495639_0040911 3300046475 Bacteria 2087
449 Ga0495662_0001707 3300046476 Bacteria 10977
450 Ga0495662_0003574 3300046476 Bacteria 7854
451 Ga0495662_0009872 3300046476 Bacteria 4689
452 Ga0495662_0044171 3300046476 Bacteria 2151
453 Ga0495662_0076204 3300046476 Bacteria 1628
454 Ga0495664_0000184 3300046477 Bacteria 30945
455 Ga0495664_0002328 3300046477 Bacteria 10181
456 Ga0495664_0044645 3300046477 Bacteria 2626
457 Ga0495664_0136991 3300046477 Bacteria 1483
458 Ga0495664_0404690 3300046477 Bacteria 819
459 Ga0495594_0006114 3300046499 Bacteria 6189
460 Ga0495594_0008394 3300046499 Bacteria 5323
461 Ga0495594_0030526 3300046499 Bacteria 2917
462 Ga0495594_0032811 3300046499 Bacteria 2820
463 Ga0495594_0093654 3300046499 Bacteria 1685
464 Ga0495594_0110087 3300046499 Bacteria 1553
465 Ga0495594_0111433 3300046499 Bacteria 1543
466 Ga0495607_0043973 3300046501 Bacteria 2636
467 Ga0495583_0043281 3300046506 Bacteria 2097
468 Ga0495606_0005742 3300046507 Bacteria 11732
469 Ga0495608_0013412 3300046511 Bacteria 5683
470 Ga0495608_0058358 3300046511 Bacteria 2544
471 Ga0495608_0063864 3300046511 Bacteria 2414
472 Ga0495608_0068663 3300046511 Bacteria 2317
473 Ga0495608_0075122 3300046511 Bacteria 2202
474 Ga0495608_0364044 3300046511 Bacteria 888
475 Ga0495610_0042111 3300046512 Bacteria 2287
476 Ga0495616_0008908 3300046513 Bacteria 5897
477 Ga0495618_0014476 3300046514 Bacteria 4807
478 Ga0495618_0032698 3300046514 Bacteria 3258
479 Ga0495618_0065678 3300046514 Bacteria 2306
480 Ga0495618_0079885 3300046514 Bacteria 2086
481 Ga0495618_0145919 3300046514 Bacteria 1513
482 Ga0495628_0033227 3300046516 Bacteria 4159
483 Ga0495630_0006677 3300046517 Bacteria 8224
484 Ga0495630_0049167 3300046517 Bacteria 3155
485 Ga0495630_0081602 3300046517 Bacteria 2440
486 Ga0495630_0226183 3300046517 Bacteria 1429
487 Ga0495631_0009264 3300046518 Bacteria 4925
488 Ga0495631_0061236 3300046518 Bacteria 1633
489 Ga0495631_0081809 3300046518 Bacteria 1393
490 Ga0495632_0048168 3300046519 Bacteria 2111
491 Ga0495643_0004562 3300046522 Bacteria 9645
492 Ga0495643_0006557 3300046522 Bacteria 7657
493 Ga0495666_0006244 3300046526 Bacteria 6002
494 Ga0495666_0037822 3300046526 Bacteria 2346
495 Ga0495652_0007161 3300046529 Bacteria 10293
496 Ga0495652_0043559 3300046529 Bacteria 3865
497 Ga0495652_0053311 3300046529 Bacteria 3447
498 Ga0495652_0078497 3300046529 Bacteria 2733
499 Ga0495652_0090878 3300046529 Bacteria 2497
500 Ga0495652_0095641 3300046529 Bacteria 2420
501 Ga0495652_0206649 3300046529 Bacteria 1486
502 Ga0495665_0004164 3300046531 Bacteria 7802
503 Ga0495640_0005846 3300046533 Bacteria 9767
504 Ga0495640_0022993 3300046533 Bacteria 4551
505 Ga0495640_0043655 3300046533 Bacteria 3121
506 Ga0495640_0120217 3300046533 Bacteria 1708
507 Ga0495640_0189615 3300046533 Bacteria 1307
508 Ga0495640_0220981 3300046533 Bacteria 1195
509 Ga0495586_0015426 3300046535 Bacteria 4065
510 Ga0495586_0024514 3300046535 Bacteria 3225
511 Ga0495587_0014610 3300046536 Bacteria 4919
512 Ga0495587_0017545 3300046536 Bacteria 4446
513 Ga0495587_0018474 3300046536 Bacteria 4324
514 Ga0495587_0039454 3300046536 Bacteria 2826
515 Ga0495587_0241667 3300046536 Bacteria 1016
516 Ga0495609_0042577 3300046538 Bacteria 2039
517 Ga0495621_0044258 3300046539 Bacteria 1573
518 Ga0495645_0026887 3300046543 Bacteria 4179
519 Ga0495645_0087937 3300046543 Bacteria 2223
520 Ga0495645_0166048 3300046543 Bacteria 1522
521 Ga0495645_0166643 3300046543 Bacteria 1519
522 Ga0495622_0008189 3300046557 Bacteria 4843
523 Ga0495622_0009969 3300046557 Bacteria 4394
524 Ga0495622_0051079 3300046557 Bacteria 1918
525 Ga0495633_0043381 3300046558 Bacteria 2134
526 Ga0495667_0024685 3300046559 Bacteria 4048
527 Ga0495667_0039298 3300046559 Bacteria 3146
528 Ga0495667_0095860 3300046559 Bacteria 1920
529 Ga0495667_0102688 3300046559 Bacteria 1849
530 Ga0495656_0028467 3300046615 Bacteria 2242
531 Ga0495668_0040924 3300046616 Bacteria 2583
532 Ga0495634_0001856 3300046642 Bacteria 18168
533 Ga0495634_0014109 3300046642 Bacteria 5768
534 Ga0495634_0016947 3300046642 Bacteria 5203
535 Ga0495634_0035105 3300046642 Bacteria 3436
536 Ga0495625_0046943 3300046660 Bacteria 3114
537 Ga0495625_0105648 3300046660 Bacteria 1928
538 Ga0495635_0000882 3300046663 Bacteria 19695
539 Ga0495635_0013819 3300046663 Bacteria 5647
540 Ga0495635_0014775 3300046663 Bacteria 5462
541 Ga0495635_0019345 3300046663 Bacteria 4749
542 Ga0495635_0020363 3300046663 Bacteria 4621
543 Ga0495635_0024816 3300046663 Bacteria 4177
544 Ga0495635_0094700 3300046663 Bacteria 2042
545 Ga0495635_0101508 3300046663 Bacteria 1966
546 Ga0495661_0004029 3300046665 Bacteria 10703
547 Ga0495588_0026212 3300046674 Bacteria 2908
548 Ga0495588_0048893 3300046674 Bacteria 2173
549 Ga0495588_0121219 3300046674 Bacteria 1378
550 Ga0495657_0008798 3300046675 Bacteria 7692
551 Ga0495657_0014628 3300046675 Bacteria 5759
552 Ga0495657_0019322 3300046675 Bacteria 4916
553 Ga0495657_0020933 3300046675 Bacteria 4699
554 Ga0495657_0035867 3300046675 Bacteria 3433
555 Ga0495657_0041525 3300046675 Bacteria 3146
556 Ga0495657_0160428 3300046675 Bacteria 1391
557 Ga0495599_0038790 3300046678 Bacteria 2993
558 Ga0495623_0024776 3300046679 Bacteria 3864
559 Ga0495646_0008763 3300046680 Bacteria 6426
560 Ga0495646_0028527 3300046680 Bacteria 3494
561 Ga0495647_0066323 3300046681 Bacteria 1435
562 Ga0495658_0016427 3300046683 Bacteria 3810
563 Ga0495658_0017379 3300046683 Bacteria 3714
564 Ga0495658_0048437 3300046683 Bacteria 2396
565 Ga0495658_0099586 3300046683 Bacteria 1733
566 Ga0495613_0000275 3300046689 Bacteria 47915
567 Ga0495613_0008460 3300046689 Bacteria 7634
568 Ga0495613_0020388 3300046689 Bacteria 4941
569 Ga0495613_0045071 3300046689 Bacteria 3262
570 Ga0495613_0077433 3300046689 Bacteria 2419
571 Ga0495613_0078488 3300046689 Bacteria 2401
572 Ga0495613_0134843 3300046689 Bacteria 1767
573 Ga0495624_0019157 3300046690 Bacteria 4571
574 Ga0495624_0038585 3300046690 Bacteria 3068
575 Ga0495624_0055962 3300046690 Bacteria 2483
576 Ga0495670_0181699 3300046691 Bacteria 1111
577 Ga0495671_0005347 3300046692 Bacteria 7533
578 Ga0495649_0018624 3300046694 Bacteria 3903
579 Ga0495649_0219733 3300046694 Bacteria 983
580 Ga0495589_0031434 3300046794 Bacteria 2672
581 Ga0495589_0033646 3300046794 Bacteria 2573
582 Ga0495589_0094236 3300046794 Bacteria 1453
583 Ga0495600_0050114 3300046809 Bacteria 2724
584 Ga0495600_0083050 3300046809 Bacteria 2091
585 Ga0495660_0036975 3300046810 Bacteria 2721
586 Ga0495660_0111421 3300046810 Bacteria 1395
587 Ga0495581_0008922 3300047315 Bacteria 5805
588 Ga0495581_0009392 3300047315 Bacteria 5659
589 Ga0495581_0012683 3300047315 Bacteria 4882
590 Ga0495581_0029794 3300047315 Bacteria 3163
591 Ga0495581_0071790 3300047315 Bacteria 2003
592 Ga0495581_0093530 3300047315 Bacteria 1745
593 Ga0495581_0168164 3300047315 Bacteria 1282
594 Ga0495604_0000463 3300047317 Bacteria 36017
595 Ga0495604_0015229 3300047317 Bacteria 6139
596 Ga0495604_0018587 3300047317 Bacteria 5567
597 Ga0495604_0031938 3300047317 Bacteria 4175
598 Ga0495604_0269846 3300047317 Bacteria 1153
599 Ga0495636_0001674 3300047318 Bacteria 8448
600 Ga0495636_0003560 3300047318 Bacteria 6038
601 Ga0495636_0029783 3300047318 Bacteria 2229
602 Ga0495674_0003262 3300047319 Bacteria 15760
603 Ga0495674_0013019 3300047319 Bacteria 7830
604 Ga0495674_0023360 3300047319 Bacteria 5700
605 Ga0495674_0050868 3300047319 Bacteria 3655
606 Ga0495674_0335304 3300047319 Bacteria 1230
607 Ga0495676_0004638 3300047321 Bacteria 12592
608 Ga0495676_0007542 3300047321 Bacteria 9979
609 Ga0495676_0008050 3300047321 Bacteria 9665
610 Ga0495676_0015381 3300047321 Bacteria 6814
611 Ga0495676_0017857 3300047321 Bacteria 6262
612 Ga0495676_0070095 3300047321 Bacteria 2702
613 Ga0495676_0083458 3300047321 Bacteria 2414
614 Ga0495680_0016454 3300047322 Bacteria 6351
615 Ga0495680_0051895 3300047322 Bacteria 3199
616 Ga0495680_0058460 3300047322 Bacteria 2979
617 Ga0495680_0083151 3300047322 Bacteria 2414
618 Ga0495680_0385577 3300047322 Bacteria 970
619 Ga0495687_001642 3300047443 Bacteria 20129
620 Ga0495687_011964 3300047443 Bacteria 4625
621 Ga0495687_026700 3300047443 Bacteria 2713
622 Ga0495687_036833 3300047443 Bacteria 2184
623 Ga0495675_0011900 3300047444 Bacteria 5468
624 Ga0495675_0015034 3300047444 Bacteria 4894
625 Ga0495675_0026207 3300047444 Bacteria 3717
626 Ga0495675_0086600 3300047444 Bacteria 1969
627 Ga0495677_0040359 3300047445 Bacteria 1707
628 Ga0495679_015606 3300047446 Bacteria 2774
629 Ga0495685_000823 3300047447 Bacteria 9464
630 Ga0495685_004583 3300047447 Bacteria 4478
631 Ga0495685_022494 3300047447 Bacteria 2170
632 Ga0495685_028286 3300047447 Bacteria 1928
633 Ga0495685_046360 3300047447 Bacteria 1479
634 Ga0495681_0002257 3300047470 Bacteria 13855
635 Ga0495681_0072356 3300047470 Bacteria 1559
636 Ga0495684_0011065 3300047471 Bacteria 6975
637 Ga0495684_0066462 3300047471 Bacteria 2742
638 Ga0495684_0073026 3300047471 Bacteria 2606
639 Ga0495593_0005975 3300047673 Bacteria 7169
640 Ga0495593_0007187 3300047673 Bacteria 6528
641 Ga0495593_0030323 3300047673 Bacteria 2960
642 Ga0495593_0033811 3300047673 Bacteria 2782
643 Ga0495602_0017076 3300048088 Bacteria 7281
644 Ga0495602_0024146 3300048088 Bacteria 5902
645 Ga0495602_0042907 3300048088 Bacteria 4117
646 Ga0495602_0056569 3300048088 Bacteria 3448
647 Ga0495602_0399228 3300048088 Bacteria 981
648 Ga0495614_0003035 3300048089 Bacteria 7480
649 Ga0495614_0004823 3300048089 Bacteria 6086
650 Ga0495614_0014698 3300048089 Bacteria 3423
651 Ga0495614_0019612 3300048089 Bacteria 2926
652 Ga0495614_0052356 3300048089 Bacteria 1749
653 Ga0495626_0089485 3300048091 Bacteria 1356
654 Ga0496100_0228590 3300048903 Bacteria 1368
655 Ga0496100_0282371 3300048903 Bacteria 1238
656 Ga0496101_0016087 3300048904 Bacteria 5050
657 Ga0496102_0001045 3300048905 Bacteria 25687
658 Ga0496102_0116491 3300048905 Bacteria 2493
659 Ga0496102_0264448 3300048905 Bacteria 1622
660 Ga0496103_0003894 3300048906 Bacteria 9082
661 Ga0496104_0286877 3300048907 Bacteria 1558
662 Ga0496104_0513811 3300048907 Bacteria 1109
663 Ga0496105_0088866 3300048908 Bacteria 2552
664 Ga0496106_0146694 3300048909 Bacteria 1859
665 Ga0496108_0000041 3300048911 Bacteria 147365
666 Ga0496108_0089177 3300048911 Bacteria 2621
667 Ga0496108_0249935 3300048911 Bacteria 1542
668 Ga0496109_0110283 3300048912 Bacteria 2558
669 Ga0496109_0333765 3300048912 Bacteria 1431
670 Ga0496109_0800436 3300048912 Bacteria 880
671 Ga0496110_0193718 3300048913 Bacteria 1846
672 Ga0496110_0243111 3300048913 Bacteria 1638
673 Ga0496110_0335715 3300048913 Bacteria 1377
674 Ga0496111_0121188 3300048914 Bacteria 1932
675 Ga0496111_0313794 3300048914 Bacteria 1162
676 Ga0496112_0684455 3300048915 Bacteria 954
677 Ga0496113_0404797 3300048916 Bacteria 1096
678 Ga0496113_0446067 3300048916 Bacteria 1040
679 Ga0496114_0049306 3300048917 Bacteria 3503
680 Ga0496114_0192011 3300048917 Bacteria 1787
681 Ga0496114_0231219 3300048917 Bacteria 1624
682 Ga0496115_0122516 3300048918 Bacteria 2140
683 Ga0496115_0495226 3300048918 Bacteria 983
684 Ga0496121_0328014 3300048924 Bacteria 1028
685 Ga0496126_0328154 3300048929 Bacteria 1256
686 Ga0495682_0123211 3300049460 Bacteria 928
687 Ga0501031_0002698 3300049568 Bacteria 11292
688 Ga0501031_0058173 3300049568 Bacteria 2519
689 Ga0501032_0003015 3300049569 Bacteria 13063
690 Ga0501032_0029153 3300049569 Bacteria 3790
691 Ga0501033_0011934 3300049570 Bacteria 6638
692 Ga0501033_0157654 3300049570 Bacteria 1635
693 Ga0501034_0013497 3300049571 Bacteria 8410
694 Ga0501036_0007965 3300049572 Bacteria 8672
695 Ga0501036_0008278 3300049572 Bacteria 8524
696 Ga0501036_0023592 3300049572 Bacteria 5184
697 Ga0501037_0026432 3300049573 Bacteria 4291
698 Ga0501037_0030182 3300049573 Bacteria 4006
699 Ga0501037_0070119 3300049573 Bacteria 2551
700 Ga0501038_0172473 3300049574 Bacteria 1750
701 Ga0501038_0233456 3300049574 Bacteria 1463
702 Ga0501038_0383223 3300049574 Bacteria 1090
703 Ga0501039_0015315 3300049575 Bacteria 5869
704 Ga0501039_0015480 3300049575 Bacteria 5839
705 Ga0501040_0002808 3300049576 Bacteria 11233
706 Ga0501040_0318918 3300049576 Bacteria 1111
707 Ga0501041_0004042 3300049577 Bacteria 8473
708 Ga0501041_0025243 3300049577 Bacteria 3572
709 Ga0501042_0019733 3300049578 Bacteria 4686
710 Ga0501043_0006087 3300049579 Bacteria 9694
711 Ga0501043_0093385 3300049579 Bacteria 2365
712 Ga0501046_0008554 3300049580 Bacteria 8906
713 Ga0501046_0009396 3300049580 Bacteria 8452
714 Ga0501046_0025323 3300049580 Bacteria 4857
715 Ga0501047_0004211 3300049581 Bacteria 13548
716 Ga0501047_0079820 3300049581 Bacteria 3146
717 Ga0501048_0000449 3300049582 Bacteria 28924
718 Ga0501048_0015897 3300049582 Bacteria 5552
719 Ga0501048_0052353 3300049582 Bacteria 2905
720 Ga0501048_0236210 3300049582 Bacteria 1297
721 Ga0501069_0068774 3300049585 Bacteria 1982
722 Ga0501070_0008071 3300049586 Bacteria 8910
723 Ga0501071_0045794 3300049587 Bacteria 3140
724 Ga0501071_0063087 3300049587 Bacteria 2686
725 Ga0501072_0006818 3300049588 Bacteria 8671
726 Ga0501072_0179404 3300049588 Bacteria 1689
727 Ga0501073_0043976 3300049589 Bacteria 3148
728 Ga0501073_0321138 3300049589 Bacteria 1069
729 Ga0501074_0071561 3300049590 Bacteria 2493
730 Ga0501074_0107983 3300049590 Bacteria 1992
731 Ga0501075_0004986 3300049591 Bacteria 9056
732 Ga0501075_0012384 3300049591 Bacteria 6061
733 Ga0501076_0005774 3300049592 Bacteria 8926
734 Ga0501076_0019002 3300049592 Bacteria 5243
735 Ga0501076_0246764 3300049592 Bacteria 1461
736 Ga0501076_0250621 3300049592 Bacteria 1449
737 Ga0501076_0280529 3300049592 Bacteria 1365
738 Ga0501077_0004059 3300049593 Bacteria 8837
739 Ga0501077_0006091 3300049593 Bacteria 7361
740 Ga0501077_0023571 3300049593 Bacteria 3903
741 Ga0501079_0022915 3300049741 Bacteria 4794
742 Ga0501080_0263521 3300049742 Bacteria 1570
743 Ga0501081_0006128 3300049743 Bacteria 7795
744 Ga0501081_0172511 3300049743 Bacteria 1562
745 Ga0501081_0430079 3300049743 Bacteria 979
746 Ga0501035_0008532 3300049822 Bacteria 9541
747 Ga0501044_0003264 3300049823 Bacteria 18246
748 Ga0501044_0021427 3300049823 Bacteria 6894
749 Ga0501044_0142336 3300049823 Bacteria 2386
750 Ga0501044_0613756 3300049823 Bacteria 980
751 Ga0501045_0011004 3300049824 Bacteria 6340
752 Ga0501045_0062778 3300049824 Bacteria 2726
753 Ga0501045_0173959 3300049824 Bacteria 1604
754 nmdc:mga03n38_24667_c1 3300050490 Bacteria 2461
755 nmdc:mga00v17_6799_c1 3300050491 Bacteria 6078
756 nmdc:mga0yw44_13821_c1 3300050492 Bacteria 4265
757 nmdc:mga0yw44_233784_c1 3300050492 Bacteria 1220
758 nmdc:mga0yw44_398500_c1 3300050492 Bacteria 930
759 nmdc:mga0yw44_40863_c1 3300050492 Bacteria 2758
760 nmdc:mga0yw44_61479_c1 3300050492 Bacteria 2305
761 nmdc:mga06z11_136856_c1 3300050494 Bacteria 1381
762 nmdc:mga04h51_7073_c1 3300050495 Bacteria 2943
763 nmdc:mga07m45_4884_c1 3300050496 Bacteria 6604
764 nmdc:mga07m45_50513_c1 3300050496 Bacteria 2343
765 nmdc:mga05p37_1050_c1 3300050507 Bacteria 31471
766 nmdc:mga05p37_135768_c1 3300050507 Bacteria 3017
767 nmdc:mga05p37_394608_c1 3300050507 Bacteria 1617
768 nmdc:mga09592_386984_c1 3300050508 Bacteria 1209
769 nmdc:mga09592_6712_c1 3300050508 Bacteria 9368
770 nmdc:mga09592_92890_c1 3300050508 Bacteria 2579
771 nmdc:mga0qj67_116066_c1 3300050509 Bacteria 1469
772 nmdc:mga0qj67_11803_c1 3300050509 Bacteria 6558
773 nmdc:mga06r32_3510_c1 3300050510 Bacteria 14002
774 nmdc:mga06r32_6648_c2 3300050510 Bacteria 2186
775 nmdc:mga06r32_91337_c1 3300050510 Bacteria 2976
776 nmdc:mga08y16_12949_c1 3300050511 Bacteria 8775
777 nmdc:mga08y16_14400_c1 3300050511 Bacteria 8322
778 nmdc:mga08y16_306619_c1 3300050511 Bacteria 1636
779 nmdc:mga08y16_804408_c1 3300050511 Bacteria 933
780 nmdc:mga0rr50_178388_c1 3300050513 Bacteria 1735
781 nmdc:mga0rr50_495106_c1 3300050513 Bacteria 1039
782 nmdc:mga08x19_115516_c1 3300050514 Bacteria 1794
783 nmdc:mga0a205_97637_c1 3300050515 Bacteria 2836
784 Ga0495601_0169948 3300053077 Bacteria 1425
785 Ga0495601_0270446 3300053077 Bacteria 1109
786 Ga0495612_0014714 3300053078 Bacteria 3141
787 Ga0495612_0204730 3300053078 Bacteria 871
788 Ga0500610_0148370 3300053079 Bacteria 1178
789 Ga0495595_0015106 3300053084 Bacteria 3289
790 Ga0495595_0065630 3300053084 Bacteria 1707
791 Ga0495619_0019169 3300053085 Bacteria 4347
792 Ga0495619_0053996 3300053085 Bacteria 2659
793 Ga0495619_0148019 3300053085 Bacteria 1619
794 Ga0500578_0021339 3300053086 Bacteria 4161
795 Ga0500644_0000067 3300053088 Bacteria 61703
796 Ga0500644_0080373 3300053088 Bacteria 1197
797 Ga0500566_0010808 3300053094 Bacteria 5380
798 Ga0500641_0049371 3300053096 Bacteria 1726
799 Ga0500650_0044270 3300053098 Bacteria 2060
800 Ga0500660_057416 3300053100 Bacteria 1892
801 Ga0500553_035329 3300053101 Bacteria 2478
802 Ga0500569_004274 3300053109 Bacteria 2993
803 Ga0500593_000238 3300053117 Bacteria 22609
804 Ga0500614_015348 3300053123 Bacteria 1707
805 Ga0500628_005494 3300053129 Bacteria 2117
806 Ga0500652_003264 3300053131 Bacteria 4904
807 Ga0500658_0003847 3300053134 Bacteria 5647
808 Ga0500561_0001875 3300053137 Bacteria 3469
809 Ga0500568_0000030 3300053139 Bacteria 159567
810 Ga0500573_0040732 3300053140 Bacteria 2683
811 Ga0500573_0089386 3300053140 Bacteria 1742
812 Ga0500600_0004326 3300053149 Bacteria 8331
813 Ga0500616_0003713 3300053153 Bacteria 11401
814 Ga0500616_0020091 3300053153 Bacteria 3755
815 Ga0500633_0004852 3300053160 Bacteria 3133
816 Ga0500634_0003575 3300053161 Bacteria 6956
817 Ga0500587_003027 3300053739 Bacteria 2379
818 Ga0501084_0015814 3300054114 Bacteria 6258
819 Ga0501084_0173421 3300054114 Bacteria 1820
820 Ga0590071_012917 3300059421 Bacteria 1957
821 Ga0590075_018246 3300059424 Bacteria 1734
822 Ga0501082_0010265 3300060353 Bacteria 8063
823 Ga0501082_0103522 3300060353 Bacteria 2462
824 Ga0501082_0301206 3300060353 Bacteria 1396
825 Ga0466962_0000306 3300061719 Bacteria 21050
826 Ga0530510_0004485 3300061734 Bacteria 9662
827 Ga0530510_0017793 3300061734 Bacteria 5038
828 Ga0530510_0160300 3300061734 Bacteria 1664
829 2676198706 2675902999 Bacteria 9438463
830 2508676152 2508501039 Bacteria 9978592
831 2515719625 2515154129 Bacteria 5584369
832 2516083962 2515154202 Bacteria 5471270
833 2517763523 2517572101 Bacteria 6884336
834 2558906891 2558860112 Bacteria 9931328
835 2559423994 2558860280 Bacteria 11429938
836 2585314202 2582581314 Bacteria 11452267
837 2586062554 2585427649 Bacteria 9053857
838 2616694174 2616644814 Bacteria 11555299
839 2616899323 2616644941 Bacteria 8510691
840 2643945267 2643221587 Bacteria 7586415
841 2644089239 2643221615 Bacteria 5487866
842 2644319084 2643221657 Bacteria 5490246
843 2644408413 2643221673 Bacteria 9196637
844 2644432166 2643221677 Bacteria 7584031
845 2644629496 2643221714 Bacteria 9015452
846 2689961581 2687453737 Bacteria 11203906
847 2774843284 2773857921 Bacteria 9435764
848 2785345049 2784746763 Bacteria 9783172
849 2785365940 2784746768 Bacteria 10036182
850 2793980865 2791355406 Bacteria 11364898
851 2808840487 2808606359 Bacteria 9866990
852 2809588267 2808606522 Bacteria 9488490
853 2812333078 2811994874 Bacteria 5367947
854 2812359693 2811994879 Bacteria 9313447
855 2842889807 2842888712 Bacteria 4279094
856 2852638327 2852635781 Bacteria 8251373
857 2862183055 2862178590 Bacteria 8583590
858 2862294027 2862290372 Bacteria 7471434
859 2863406310 2863404153 Bacteria 9672205
860 2867476508 2867475112 Bacteria 6909112
861 2875393212 2875391855 Bacteria 7600475
862 2877684532 2877676314 Bacteria 9512378
863 2899367093 2899359706 Bacteria 10940472
864 2912721740 2912715099 Bacteria 9460473
865 2915771324 2915768154 Bacteria 8424322
866 2918501317 2918501144 Bacteria 8668083
867 2919473068 2919468124 Bacteria 9133025
868 2935395530 2935390628 Bacteria 7043367
869 2946051481 2946045630 Bacteria 8527308
870 2946066217 2946064051 Bacteria 8957905
871 2946074483 2946072368 Bacteria 8999607
872 2947231156 2947224130 Bacteria 9938529
873 2990064342 2990059506 Bacteria 9321252
874 2995464364 2995463766 Bacteria 8577691
875 2997602811 2997600082 Bacteria 9896405
876 3003008784 3002998708 Bacteria 11715108
877 3006488388 3006486233 Bacteria 8157040
878 3006499813 3006493962 Bacteria 8825450
879 8002777961 8002775197 Bacteria 10728764
880 8002789384 8002784119 Bacteria 9788632
881 8008561997 8008558824 Bacteria 10610750
882 8025479558 8025478263 Bacteria 8209203
883 8047893861 8047893842 Bacteria 11723082
884 8048135315 8048127548 Bacteria 11053136
885 8048364877 8048356638 Bacteria 11044339
886 8048370878 8048369669 Bacteria 11666822
887 8048388544 8048379754 Bacteria 11877923
888 8054167575 8054160619 Bacteria 7783213
889 8055072971 8055066027 Bacteria 9479577
890 8056830851 8056829672 Bacteria 9045328
891 rootH1_10040025
892 JGI25160J50197_1010407
893 JGI25160J50197_1010458
894 JGI25407J50210_10000081
895 Ga0070658_10191459
896 Ga0070683_100029457
897 Ga0070683_100297734
898 Ga0070670_100083623
899 Ga0070666_10042268
900 Ga0070680_100048577
901 Ga0070689_100055438
902 Ga0070661_100063599
903 Ga0070668_100356017
904 Ga0070671_100080699
905 Ga0070659_100050283
906 Ga0070667_100102769
907 Ga0070667_100107680
908 Ga0070667_100634067
909 Ga0070703_10023561
910 Ga0070709_10104308
911 Ga0070709_10187981
912 Ga0070714_100067196
913 Ga0070714_100068939
914 Ga0070713_100028430
915 Ga0070710_10006047
916 Ga0070710_10016463
917 Ga0070710_10225363
918 Ga0070711_100031168
919 Ga0070705_100117759
920 Ga0070700_100158614
921 Ga0070708_100025454
922 Ga0070708_100044914
923 Ga0070708_100375522
924 Ga0070678_100154134
925 Ga0070681_10441366
926 Ga0070685_10049747
927 Ga0070706_100016148
928 Ga0070706_100016968
929 Ga0070706_100228843
930 Ga0070707_100004155
931 Ga0070707_100106016
932 Ga0070707_100167375
933 Ga0070707_100176786
934 Ga0070707_100424089
935 Ga0070698_100015348
936 Ga0070698_100018403
937 Ga0070698_100025986
938 Ga0070698_100134954
939 Ga0070699_100002522
940 Ga0070697_100021918
941 Ga0068853_100023230
942 Ga0068853_100154615
943 Ga0070696_100060878
944 Ga0070696_100085507
945 Ga0068857_100203416
946 Ga0068854_100153122
947 Ga0068856_100725043
948 Ga0070702_100028819
949 Ga0068852_100438944
950 Ga0068859_100025600
951 Ga0068864_100044738
952 Ga0068864_100528700
953 Ga0068861_100342670
954 Ga0068870_10019102
955 Ga0068858_100261004
956 Ga0068860_100198649
957 Ga0068862_100075379
958 Ga0068862_100530158
959 Ga0081455_10001268
960 Ga0081455_10003534
961 Ga0081455_10067728
962 Ga0081538_10000315
963 Ga0081538_10000932
964 Ga0081540_1000188
965 Ga0070717_10060271
966 Ga0075365_10218685
967 Ga0075368_10016792
968 Ga0075363_100021875
969 Ga0075363_100043968
970 Ga0075363_100060783
971 Ga0075364_10010007
972 Ga0070715_10171694
973 Ga0070716_100029013
974 Ga0070716_100041933
975 Ga0070712_100051032
976 Ga0070712_100093601
977 Ga0075362_10184607
978 Ga0075367_10041724
979 Ga0097621_100049091
980 Ga0075370_10007144
981 Ga0075370_10037124
982 Ga0075370_10109591
983 Ga0075428_100007298
984 Ga0075428_100089273
985 Ga0075428_100090269
986 Ga0075428_100101552
987 Ga0075428_100302914
988 Ga0075430_100008076
989 Ga0075430_100229387
990 Ga0075431_100006028
991 Ga0075431_100037157
992 Ga0075431_100223301
993 Ga0075431_100228498
994 Ga0075434_100352523
995 Ga0075429_100011730
996 Ga0075429_100053239
997 Ga0075429_100104872
998 Ga0075429_100396134
999 Ga0075436_100050628
1000 Ga0097620_100025599
1001 Ga0075435_100113261
1002 Ga0105251_10038345
1003 Ga0111539_10023318
1004 Ga0111539_10036801
1005 Ga0111539_10064417
1006 Ga0111539_10259001
1007 Ga0105245_10390252
1008 Ga0114129_10001936
1009 Ga0114129_10099336
1010 Ga0114129_10315297
1011 Ga0114129_10428911
1012 Ga0114129_10463534
1013 Ga0105248_10328846
1014 Ga0105237_10098385
1015 Ga0105237_10599090
1016 Ga0105238_10361731
1017 Ga0105246_10044376
1018 Ga0157318_1001287
1019 Ga0157322_1002177
1020 Ga0157373_10065925
1021 Ga0157369_10081935
1022 Ga0157378_10239937
1023 Ga0163162_10151807
1024 Ga0157372_10160063
1025 Ga0182008_10021672
1026 Ga0157377_10367882
1027 Ga0157379_10375699
1028 Ga0163161_10121616
1029 Ga0206353_11181304
1030 Ga0224712_10085216
1031 Ga0207426_1000393
1032 Ga0207426_1008845
1033 Ga0207426_1010084
1034 Ga0207426_1023514
1035 Ga0207653_10007654
1036 Ga0207692_10020941
1037 Ga0207692_10029132
1038 Ga0207692_10055087
1039 Ga0207647_10008520
1040 Ga0207645_10056315
1041 Ga0207643_10024532
1042 Ga0207705_10099742
1043 Ga0207684_10289802
1044 Ga0207654_10020775
1045 Ga0207707_10218157
1046 Ga0207671_10153888
1047 Ga0207693_10030843
1048 Ga0207693_10070965
1049 Ga0207663_10013981
1050 Ga0207663_10101973
1051 Ga0207657_10024882
1052 Ga0207649_10089527
1053 Ga0207652_10168159
1054 Ga0207646_10040326
1055 Ga0207646_10082172
1056 Ga0207646_10157142
1057 Ga0207681_10236307
1058 Ga0207694_10273284
1059 Ga0207694_10349859
1060 Ga0207650_10127644
1061 Ga0207687_10339849
1062 Ga0207700_10062651
1063 Ga0207700_10418074
1064 Ga0207664_10006770
1065 Ga0207664_10087486
1066 Ga0207664_10097488
1067 Ga0207664_10157376
1068 Ga0207664_10226010
1069 Ga0207664_10313836
1070 Ga0207644_10176579
1071 Ga0207706_10080297
1072 Ga0207686_10153200
1073 Ga0207670_10223535
1074 Ga0207669_10101745
1075 Ga0207704_10153666
1076 Ga0207665_10048950
1077 Ga0207691_10013412
1078 Ga0207689_10025886
1079 Ga0207712_10083308
1080 Ga0207640_10244207
1081 Ga0207658_10057394
1082 Ga0207658_10340703
1083 Ga0207677_10250828
1084 Ga0207703_10569016
1085 Ga0207639_10015967
1086 Ga0207678_10015175
1087 Ga0207702_10124205
1088 Ga0207702_10129096
1089 Ga0207648_10047823
1090 Ga0207676_10286157
1091 Ga0207674_10024180
1092 Ga0207675_100017217
1093 Ga0207675_100114685
1094 Ga0207675_100558818
1095 Ga0207683_10003222
1096 Ga0207683_10189242
1097 Ga0207683_10530851
1098 Ga0207698_10204461
1099 Ga0207428_10052335
1100 Ga0268266_10248208
1101 Ga0265337_1006979
1102 Ga0265326_10000701
1103 Ga0265319_1001835
1104 Ga0265334_10000468
1105 Ga0265318_10010806
1106 Ga0265323_10001755
1107 Ga0265322_10001776
1108 Ga0265336_10001798
1109 Ga0307515_10001023
1110 Ga0307515_10008714
1111 Ga0307515_10043536
1112 Ga0307515_10279335
1113 Ga0265338_10009448
1114 Ga0265324_10001624
1115 Ga0307511_10003945
1116 Ga0307511_10077350
1117 Ga0307512_10010153
1118 Ga0307512_10045850
1119 Ga0307512_10053759
1120 Ga0265332_10001612
1121 Ga0265332_10014975
1122 Ga0265320_10000138
1123 Ga0265320_10002827
1124 Ga0265320_10041128
1125 Ga0265325_10029875
1126 Ga0265340_10024931
1127 Ga0265339_10050472
1128 Ga0307513_10010075
1129 Ga0307513_10150627
1130 Ga0307509_10039611
1131 Ga0307509_10263847
1132 Ga0307509_10330620
1133 Ga0265313_10012535
1134 Ga0307508_10002491
1135 Ga0307508_10008345
1136 Ga0307508_10010804
1137 Ga0307508_10019546
1138 Ga0307508_10134895
1139 Ga0307508_10137433
1140 Ga0307514_10024896
1141 Ga0307514_10045858
1142 Ga0265314_10004380
1143 Ga0265314_10057010
1144 Ga0265342_10002497
1145 Ga0316578_10005179
1146 Ga0307516_10010098
1147 Ga0307516_10088259
1148 Ga0307516_10145394
1149 Ga0307516_10170951
1150 Ga0316577_10008956
1151 Ga0307518_10032990
1152 Ga0307406_10071387
1153 Ga0307409_100002630
1154 Ga0307409_100044637
1155 Ga0307416_100139696
1156 Ga0307416_100353069
1157 Ga0307416_100689227
1158 Ga0307411_10083281
1159 Ga0307415_100204789
1160 Ga0307507_10014834
1161 Ga0307507_10019990
1162 Ga0307507_10024114
1163 Ga0307510_10034112
1164 Ga0307510_10075136
1165 Ga0307510_10104090
1166 Ga0373958_0004760
1167 Ga0373926_0005161
1168 Ga0373926_0011101
1169 Ga0373928_0006714
1170 Ga0373934_0011432
1171 Ga0373934_0017937
1172 Ga0373934_0035828
1173 Ga0373934_0137895
1174 Ga0373944_0001678
1175 Ga0373944_0007848
1176 Ga0373952_0031306
1177 Ga0373923_0017501
1178 Ga0373923_0021048
1179 Ga0373923_0035688
1180 Ga0373923_0085200
1181 Ga0373936_0000897
1182 Ga0373936_0015326
1183 Ga0373936_0044742
1184 Ga0373941_0003839
1185 Ga0373945_0000102
1186 Ga0373945_0015873
1187 Ga0373953_0023359
1188 Ga0373953_0039063
1189 Ga0373953_0111227
1190 Ga0373954_0011393
1191 Ga0373956_0018625
1192 Ga0373956_0039881
1193 Ga0373956_0108263
1194 Ga0373956_0134743
1195 Ga0373960_0137700
1196 Ga0373943_0001235
1197 Ga0373943_0001490
1198 Ga0373946_0000368
1199 Ga0373946_0002080
1200 Ga0373955_0021970
1201 Ga0373955_0032095
1202 Ga0373955_0062513
1203 Ga0373955_0076643
1204 Ga0373942_0019301
1205 Ga0373962_0025142
1206 Ga0316574_0042226
1207 Ga0316574_0085640
1208 Ga0316574_0210866
1209 Ga0373924_0001722
1210 Ga0373924_0058745
1211 Ga0373924_0086828
1212 Ga0373935_0010906
1213 Ga0373935_0072779
1214 Ga0373935_0082515
1215 Ga0373927_0003543
1216 Ga0373927_0013721
1217 Ga0373933_0022630
1218 Ga0373933_0059594
1219 Ga0373933_0071887
1220 Ga0373947_0034067
1221 Ga0373947_0042205
1222 Ga0373947_0096176
1223 Ga0373937_0011349
1224 Ga0373937_0021455
1225 Ga0373937_0063803
1226 Ga0373937_0101050
1227 Ga0373937_0127236
1228 Ga0373937_0167344
1229 Ga0373937_0354273
1230 Ga0372808_006573
1231 Ga0316582_0065751
1232 Ga0316584_0011983
1233 Ga0373925_0008512
1234 Ga0373925_0011272
1235 Ga0373925_0048935
1236 Ga0373925_0163953
1237 Ga0395898_0001427
1238 Ga0395898_0047254
1239 Ga0395898_0075617
1240 Ga0395905_0068862
1241 Ga0395905_0415528
1242 Ga0436364_0615903
1243 Ga0395901_0002610
1244 Ga0395901_0110265
1245 Ga0395901_0495714
1246 Ga0395901_0532866
1247 Ga0436360_0836502
1248 Ga0439439_0004368
1249 Ga0439439_0009177
1250 Ga0451795_1677241
1251 Ga0451837_0240693
1252 Ga0451843_1540016
1253 Ga0451853_0476508
1254 Ga0451853_1594502
1255 Ga0451853_2545623
1256 Ga0439433_0005784
1257 Ga0439448_0023155
1258 Ga0439449_0000442
1259 Ga0439449_0010521
1260 Ga0439449_0148256
1261 Ga0439450_000437
1262 Ga0439451_014725
1263 Ga0439454_004730
1264 Ga0439457_000676
1265 Ga0439457_001457
1266 Ga0439457_031060
1267 Ga0439463_010119
1268 Ga0450894_000344
1269 Ga0450896_000776
1270 Ga0439460_0002951
1271 Ga0466969_0165996
1272 Ga0466972_0013279
1273 Ga0466965_0000328
1274 Ga0466965_0005657
1275 Ga0466966_0004959
1276 Ga0466966_0009094
1277 Ga0466966_0017860
1278 Ga0466966_0121704
1279 Ga0466961_0001263
1280 Ga0466961_0005863
1281 Ga0466961_0011189
1282 Ga0466961_0105265
1283 Ga0466963_0002567
1284 Ga0466963_0359488
1285 Ga0466964_0004936
1286 Ga0466971_0000643
1287 Ga0466970_0000784
1288 Ga0466970_0115055
1289 Ga0466957_0000472
1290 Ga0466959_0001522
1291 Ga0466959_0066703
1292 Ga0466959_0072610
1293 Ga0466958_0000634
1294 Ga0466958_0129293
1295 Ga0466967_0001051
1296 Ga0466967_0053820
1297 Ga0466967_0206304
1298 Ga0466967_0216027
1299 Ga0495617_024824
1300 Ga0495627_015581
1301 Ga0495592_0006615
1302 Ga0495592_0030288
1303 Ga0495603_0002864
1304 Ga0495603_0005542
1305 Ga0495603_0014849
1306 Ga0495603_0026971
1307 Ga0495603_0053928
1308 Ga0495629_0001666
1309 Ga0495629_0004782
1310 Ga0495629_0022175
1311 Ga0495629_0024737
1312 Ga0495629_0034900
1313 Ga0495629_0069702
1314 Ga0495629_0073165
1315 Ga0495629_0113595
1316 Ga0495629_0130590
1317 Ga0495629_0133214
1318 Ga0495629_0153099
1319 Ga0495638_0012365
1320 Ga0495638_0121106
1321 Ga0495641_0008474
1322 Ga0495641_0009440
1323 Ga0495641_0132715
1324 Ga0495651_0009007
1325 Ga0495651_0010493
1326 Ga0495651_0017086
1327 Ga0495651_0108159
1328 Ga0495653_0001214
1329 Ga0495653_0080990
1330 Ga0495653_0095856
1331 Ga0495653_0205562
1332 Ga0495580_0008781
1333 Ga0495582_0004394
1334 Ga0495582_0255982
1335 Ga0495605_0008869
1336 Ga0495639_0003145
1337 Ga0495639_0011817
1338 Ga0495639_0040911
1339 Ga0495662_0001707
1340 Ga0495662_0003574
1341 Ga0495662_0009872
1342 Ga0495662_0044171
1343 Ga0495662_0076204
1344 Ga0495664_0000184
1345 Ga0495664_0002328
1346 Ga0495664_0044645
1347 Ga0495664_0136991
1348 Ga0495664_0404690
1349 Ga0495594_0006114
1350 Ga0495594_0008394
1351 Ga0495594_0030526
1352 Ga0495594_0032811
1353 Ga0495594_0093654
1354 Ga0495594_0110087
1355 Ga0495594_0111433
1356 Ga0495607_0043973
1357 Ga0495583_0043281
1358 Ga0495606_0005742
1359 Ga0495608_0013412
1360 Ga0495608_0058358
1361 Ga0495608_0063864
1362 Ga0495608_0068663
1363 Ga0495608_0075122
1364 Ga0495608_0364044
1365 Ga0495610_0042111
1366 Ga0495616_0008908
1367 Ga0495618_0014476
1368 Ga0495618_0032698
1369 Ga0495618_0065678
1370 Ga0495618_0079885
1371 Ga0495618_0145919
1372 Ga0495628_0033227
1373 Ga0495630_0006677
1374 Ga0495630_0049167
1375 Ga0495630_0081602
1376 Ga0495630_0226183
1377 Ga0495631_0009264
1378 Ga0495631_0061236
1379 Ga0495631_0081809
1380 Ga0495632_0048168
1381 Ga0495643_0004562
1382 Ga0495643_0006557
1383 Ga0495666_0006244
1384 Ga0495666_0037822
1385 Ga0495652_0007161
1386 Ga0495652_0043559
1387 Ga0495652_0053311
1388 Ga0495652_0078497
1389 Ga0495652_0090878
1390 Ga0495652_0095641
1391 Ga0495652_0206649
1392 Ga0495665_0004164
1393 Ga0495640_0005846
1394 Ga0495640_0022993
1395 Ga0495640_0043655
1396 Ga0495640_0120217
1397 Ga0495640_0189615
1398 Ga0495640_0220981
1399 Ga0495586_0015426
1400 Ga0495586_0024514
1401 Ga0495587_0014610
1402 Ga0495587_0017545
1403 Ga0495587_0018474
1404 Ga0495587_0039454
1405 Ga0495587_0241667
1406 Ga0495609_0042577
1407 Ga0495621_0044258
1408 Ga0495645_0026887
1409 Ga0495645_0087937
1410 Ga0495645_0166048
1411 Ga0495645_0166643
1412 Ga0495622_0008189
1413 Ga0495622_0009969
1414 Ga0495622_0051079
1415 Ga0495633_0043381
1416 Ga0495667_0024685
1417 Ga0495667_0039298
1418 Ga0495667_0095860
1419 Ga0495667_0102688
1420 Ga0495656_0028467
1421 Ga0495668_0040924
1422 Ga0495634_0001856
1423 Ga0495634_0014109
1424 Ga0495634_0016947
1425 Ga0495634_0035105
1426 Ga0495625_0046943
1427 Ga0495625_0105648
1428 Ga0495635_0000882
1429 Ga0495635_0013819
1430 Ga0495635_0014775
1431 Ga0495635_0019345
1432 Ga0495635_0020363
1433 Ga0495635_0024816
1434 Ga0495635_0094700
1435 Ga0495635_0101508
1436 Ga0495661_0004029
1437 Ga0495588_0026212
1438 Ga0495588_0048893
1439 Ga0495588_0121219
1440 Ga0495657_0008798
1441 Ga0495657_0014628
1442 Ga0495657_0019322
1443 Ga0495657_0020933
1444 Ga0495657_0035867
1445 Ga0495657_0041525
1446 Ga0495657_0160428
1447 Ga0495599_0038790
1448 Ga0495623_0024776
1449 Ga0495646_0008763
1450 Ga0495646_0028527
1451 Ga0495647_0066323
1452 Ga0495658_0016427
1453 Ga0495658_0017379
1454 Ga0495658_0048437
1455 Ga0495658_0099586
1456 Ga0495613_0000275
1457 Ga0495613_0008460
1458 Ga0495613_0020388
1459 Ga0495613_0045071
1460 Ga0495613_0077433
1461 Ga0495613_0078488
1462 Ga0495613_0134843
1463 Ga0495624_0019157
1464 Ga0495624_0038585
1465 Ga0495624_0055962
1466 Ga0495670_0181699
1467 Ga0495671_0005347
1468 Ga0495649_0018624
1469 Ga0495649_0219733
1470 Ga0495589_0031434
1471 Ga0495589_0033646
1472 Ga0495589_0094236
1473 Ga0495600_0050114
1474 Ga0495600_0083050
1475 Ga0495660_0036975
1476 Ga0495660_0111421
1477 Ga0495581_0008922
1478 Ga0495581_0009392
1479 Ga0495581_0012683
1480 Ga0495581_0029794
1481 Ga0495581_0071790
1482 Ga0495581_0093530
1483 Ga0495581_0168164
1484 Ga0495604_0000463
1485 Ga0495604_0015229
1486 Ga0495604_0018587
1487 Ga0495604_0031938
1488 Ga0495604_0269846
1489 Ga0495636_0001674
1490 Ga0495636_0003560
1491 Ga0495636_0029783
1492 Ga0495674_0003262
1493 Ga0495674_0013019
1494 Ga0495674_0023360
1495 Ga0495674_0050868
1496 Ga0495674_0335304
1497 Ga0495676_0004638
1498 Ga0495676_0007542
1499 Ga0495676_0008050
1500 Ga0495676_0015381
1501 Ga0495676_0017857
1502 Ga0495676_0070095
1503 Ga0495676_0083458
1504 Ga0495680_0016454
1505 Ga0495680_0051895
1506 Ga0495680_0058460
1507 Ga0495680_0083151
1508 Ga0495680_0385577
1509 Ga0495687_001642
1510 Ga0495687_011964
1511 Ga0495687_026700
1512 Ga0495687_036833
1513 Ga0495675_0011900
1514 Ga0495675_0015034
1515 Ga0495675_0026207
1516 Ga0495675_0086600
1517 Ga0495677_0040359
1518 Ga0495679_015606
1519 Ga0495685_000823
1520 Ga0495685_004583
1521 Ga0495685_022494
1522 Ga0495685_028286
1523 Ga0495685_046360
1524 Ga0495681_0002257
1525 Ga0495681_0072356
1526 Ga0495684_0011065
1527 Ga0495684_0066462
1528 Ga0495684_0073026
1529 Ga0495593_0005975
1530 Ga0495593_0007187
1531 Ga0495593_0030323
1532 Ga0495593_0033811
1533 Ga0495602_0017076
1534 Ga0495602_0024146
1535 Ga0495602_0042907
1536 Ga0495602_0056569
1537 Ga0495602_0399228
1538 Ga0495614_0003035
1539 Ga0495614_0004823
1540 Ga0495614_0014698
1541 Ga0495614_0019612
1542 Ga0495614_0052356
1543 Ga0495626_0089485
1544 Ga0496100_0228590
1545 Ga0496100_0282371
1546 Ga0496101_0016087
1547 Ga0496102_0001045
1548 Ga0496102_0116491
1549 Ga0496102_0264448
1550 Ga0496103_0003894
1551 Ga0496104_0286877
1552 Ga0496104_0513811
1553 Ga0496105_0088866
1554 Ga0496106_0146694
1555 Ga0496108_0000041
1556 Ga0496108_0089177
1557 Ga0496108_0249935
1558 Ga0496109_0110283
1559 Ga0496109_0333765
1560 Ga0496109_0800436
1561 Ga0496110_0193718
1562 Ga0496110_0243111
1563 Ga0496110_0335715
1564 Ga0496111_0121188
1565 Ga0496111_0313794
1566 Ga0496112_0684455
1567 Ga0496113_0404797
1568 Ga0496113_0446067
1569 Ga0496114_0049306
1570 Ga0496114_0192011
1571 Ga0496114_0231219
1572 Ga0496115_0122516
1573 Ga0496115_0495226
1574 Ga0496121_0328014
1575 Ga0496126_0328154
1576 Ga0495682_0123211
1577 Ga0501031_0002698
1578 Ga0501031_0058173
1579 Ga0501032_0003015
1580 Ga0501032_0029153
1581 Ga0501033_0011934
1582 Ga0501033_0157654
1583 Ga0501034_0013497
1584 Ga0501036_0007965
1585 Ga0501036_0008278
1586 Ga0501036_0023592
1587 Ga0501037_0026432
1588 Ga0501037_0030182
1589 Ga0501037_0070119
1590 Ga0501038_0172473
1591 Ga0501038_0233456
1592 Ga0501038_0383223
1593 Ga0501039_0015315
1594 Ga0501039_0015480
1595 Ga0501040_0002808
1596 Ga0501040_0318918
1597 Ga0501041_0004042
1598 Ga0501041_0025243
1599 Ga0501042_0019733
1600 Ga0501043_0006087
1601 Ga0501043_0093385
1602 Ga0501046_0008554
1603 Ga0501046_0009396
1604 Ga0501046_0025323
1605 Ga0501047_0004211
1606 Ga0501047_0079820
1607 Ga0501048_0000449
1608 Ga0501048_0015897
1609 Ga0501048_0052353
1610 Ga0501048_0236210
1611 Ga0501069_0068774
1612 Ga0501070_0008071
1613 Ga0501071_0045794
1614 Ga0501071_0063087
1615 Ga0501072_0006818
1616 Ga0501072_0179404
1617 Ga0501073_0043976
1618 Ga0501073_0321138
1619 Ga0501074_0071561
1620 Ga0501074_0107983
1621 Ga0501075_0004986
1622 Ga0501075_0012384
1623 Ga0501076_0005774
1624 Ga0501076_0019002
1625 Ga0501076_0246764
1626 Ga0501076_0250621
1627 Ga0501076_0280529
1628 Ga0501077_0004059
1629 Ga0501077_0006091
1630 Ga0501077_0023571
1631 Ga0501079_0022915
1632 Ga0501080_0263521
1633 Ga0501081_0006128
1634 Ga0501081_0172511
1635 Ga0501081_0430079
1636 Ga0501035_0008532
1637 Ga0501044_0003264
1638 Ga0501044_0021427
1639 Ga0501044_0142336
1640 Ga0501044_0613756
1641 Ga0501045_0011004
1642 Ga0501045_0062778
1643 Ga0501045_0173959
1644 nmdc:mga03n38_24667_c1
1645 nmdc:mga00v17_6799_c1
1646 nmdc:mga0yw44_13821_c1
1647 nmdc:mga0yw44_233784_c1
1648 nmdc:mga0yw44_398500_c1
1649 nmdc:mga0yw44_40863_c1
1650 nmdc:mga0yw44_61479_c1
1651 nmdc:mga06z11_136856_c1
1652 nmdc:mga04h51_7073_c1
1653 nmdc:mga07m45_4884_c1
1654 nmdc:mga07m45_50513_c1
1655 nmdc:mga05p37_1050_c1
1656 nmdc:mga05p37_135768_c1
1657 nmdc:mga05p37_394608_c1
1658 nmdc:mga09592_386984_c1
1659 nmdc:mga09592_6712_c1
1660 nmdc:mga09592_92890_c1
1661 nmdc:mga0qj67_116066_c1
1662 nmdc:mga0qj67_11803_c1
1663 nmdc:mga06r32_3510_c1
1664 nmdc:mga06r32_6648_c2
1665 nmdc:mga06r32_91337_c1
1666 nmdc:mga08y16_12949_c1
1667 nmdc:mga08y16_14400_c1
1668 nmdc:mga08y16_306619_c1
1669 nmdc:mga08y16_804408_c1
1670 nmdc:mga0rr50_178388_c1
1671 nmdc:mga0rr50_495106_c1
1672 nmdc:mga08x19_115516_c1
1673 nmdc:mga0a205_97637_c1
1674 Ga0495601_0169948
1675 Ga0495601_0270446
1676 Ga0495612_0014714
1677 Ga0495612_0204730
1678 Ga0500610_0148370
1679 Ga0495595_0015106
1680 Ga0495595_0065630
1681 Ga0495619_0019169
1682 Ga0495619_0053996
1683 Ga0495619_0148019
1684 Ga0500578_0021339
1685 Ga0500644_0000067
1686 Ga0500644_0080373
1687 Ga0500566_0010808
1688 Ga0500641_0049371
1689 Ga0500650_0044270
1690 Ga0500660_057416
1691 Ga0500553_035329
1692 Ga0500569_004274
1693 Ga0500593_000238
1694 Ga0500614_015348
1695 Ga0500628_005494
1696 Ga0500652_003264
1697 Ga0500658_0003847
1698 Ga0500561_0001875
1699 Ga0500568_0000030
1700 Ga0500573_0040732
1701 Ga0500573_0089386
1702 Ga0500600_0004326
1703 Ga0500616_0003713
1704 Ga0500616_0020091
1705 Ga0500633_0004852
1706 Ga0500634_0003575
1707 Ga0500587_003027
1708 Ga0501084_0015814
1709 Ga0501084_0173421
1710 Ga0590071_012917
1711 Ga0590075_018246
1712 Ga0501082_0010265
1713 Ga0501082_0103522
1714 Ga0501082_0301206
1715 Ga0466962_0000306
1716 Ga0530510_0004485
1717 Ga0530510_0017793
1718 Ga0530510_0160300
1719 2676198706
1720 2508676152
1721 2515719625
1722 2516083962
1723 2517763523
1724 2558906891
1725 2559423994
1726 2585314202
1727 2586062554
1728 2616694174
1729 2616899323
1730 2643945267
1731 2644089239
1732 2644319084
1733 2644408413
1734 2644432166
1735 2644629496
1736 2689961581
1737 2774843284
1738 2785345049
1739 2785365940
1740 2793980865
1741 2808840487
1742 2809588267
1743 2812333078
1744 2812359693
1745 2842889807
1746 2852638327
1747 2862183055
1748 2862294027
1749 2863406310
1750 2867476508
1751 2875393212
1752 2877684532
1753 2899367093
1754 2912721740
1755 2915771324
1756 2918501317
1757 2919473068
1758 2935395530
1759 2946051481
1760 2946066217
1761 2946074483
1762 2947231156
1763 2990064342
1764 2995464364
1765 2997602811
1766 3003008784
1767 3006488388
1768 3006499813
1769 8002777961
1770 8002789384
1771 8008561997
1772 8025479558
1773 8047893861
1774 8048135315
1775 8048364877
1776 8048370878
1777 8048388544
1778 8054167575
1779 8055072971
1780 8056830851

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

43

265

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6coj-assembly1.cif.gz_A-2 crystal structure of rhodococcus jostii rha1 ipdab e105a cochea-coa complex 0.9747 2 287
6co9-assembly1.cif.gz_A crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex 0.9744 2 287
6con-assembly2.cif.gz_G crystal structure of mycobacterium tuberculosis ipdab 0.9727 1 285
6coj-assembly1.cif.gz_A-2 crystal structure of rhodococcus jostii rha1 ipdab e105a cochea-coa complex 0.968 2 287
6co9-assembly1.cif.gz_A crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex 0.9678 2 287
ID Description Score Start End Superfamily
1poiA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9175 4 282 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8917 2 227 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8878 2 227 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8497 3 227 3.40.1080.10
1poiA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8443 4 282 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A7K1CYR6-F1-model_v4 Acyl CoA--acetate/3-ketoacid CoA transferase subunit alpha 0.9969 1 107 GO:0008410
AF-A0A258X2E0-F1-model_v4 Acyl CoA--acetate/3-ketoacid CoA transferase subunit alpha 0.9955 6 118 GO:0008410
AF-A0A7K2KTX2-F1-model_v4 Acyl CoA--acetate/3-ketoacid CoA transferase subunit alpha 0.9924 6 287 GO:0008410
AF-F8JSY6-F1-model_v4 Coenzyme A transferase, subunit A 0.9918 2 287 GO:0008410
AF-A0A1G6ITT4-F1-model_v4 Glutaconate CoA-transferase subunit A 0.9901 2 287 GO:0008410

Map