F484760

General Info

Members Datasets Scaffolds Average Seq Length
888 374 1776 117

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10310361|Ga0207705_103103613
Length 123
Sequence MVEAGMAYTVIHLDEIEGSGPGGAVKFVRRELGCEAFGINWFDLPPNAEGFEHSESESQQEEVNVIVRGSGVYRVEGEEIPFTAGSVFRFDPETTRQPVAGPDGFSMVAVGARRGSYEPRGPF

Samples

Sample ID Description Type Environment
1 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
96 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
97 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
98 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
178 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
179 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
180 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
199 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
200 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
235 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
236 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
237 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
238 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
239 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
240 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
241 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
242 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
243 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
244 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
245 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
246 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
247 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
248 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
261 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
285 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
293 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
302 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
303 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
304 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
305 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
306 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
312 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
322 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
323 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
324 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
327 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
328 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
329 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
374 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.15
Rhizosphere 86.71
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207705_10310361 3300025909 Bacteria 1211
2 JGI24747J21853_1006910 3300001978 Bacteria 1083
3 Ga0070658_10214997 3300005327 Bacteria 1625
4 Ga0070658_11505640 3300005327 Bacteria 583
5 Ga0070676_10064194 3300005328 Bacteria 2189
6 Ga0070683_100096654 3300005329 Bacteria 2778
7 Ga0070683_100245581 3300005329 Bacteria 1703
8 Ga0070683_100868727 3300005329 Bacteria 865
9 Ga0070690_100087734 3300005330 Bacteria 2044
10 Ga0070690_100244039 3300005330 Bacteria 1268
11 Ga0070690_100727309 3300005330 Bacteria 764
12 Ga0070677_10237783 3300005333 Bacteria 898
13 Ga0068869_101448719 3300005334 Bacteria 609
14 Ga0068869_102011293 3300005334 Bacteria 519
15 Ga0070680_100158864 3300005336 Bacteria 1899
16 Ga0070680_100437331 3300005336 Bacteria 1117
17 Ga0070680_100492302 3300005336 Bacteria 1049
18 Ga0070680_100553461 3300005336 Unclassified 986
19 Ga0070682_100079003 3300005337 Bacteria 2124
20 Ga0070682_100674747 3300005337 Bacteria 825
21 Ga0070682_100685957 3300005337 Bacteria 820
22 Ga0068868_100115192 3300005338 Bacteria 2188
23 Ga0070660_100034617 3300005339 Bacteria 3817
24 Ga0070660_101331948 3300005339 Bacteria 609
25 Ga0070689_100800757 3300005340 Bacteria 829
26 Ga0070691_10029015 3300005341 Bacteria 2587
27 Ga0070691_10045164 3300005341 Bacteria 2090
28 Ga0070687_100328147 3300005343 Bacteria 980
29 Ga0070661_100237313 3300005344 Bacteria 1403
30 Ga0070661_100481706 3300005344 Bacteria 991
31 Ga0070661_100604296 3300005344 Bacteria 887
32 Ga0070692_10262680 3300005345 Bacteria 1038
33 Ga0070668_100008900 3300005347 Bacteria 7453
34 Ga0070669_100708097 3300005353 Bacteria 851
35 Ga0070671_100036444 3300005355 Bacteria 4079
36 Ga0070671_100270080 3300005355 Bacteria 1445
37 Ga0070674_100054194 3300005356 Bacteria 2772
38 Ga0070673_100890805 3300005364 Bacteria 825
39 Ga0070673_101466109 3300005364 Bacteria 643
40 Ga0070688_100208855 3300005365 Bacteria 1370
41 Ga0070659_100167627 3300005366 Bacteria 1798
42 Ga0070659_100227894 3300005366 Bacteria 1539
43 Ga0070659_100495673 3300005366 Bacteria 1041
44 Ga0070709_10108314 3300005434 Bacteria 1863
45 Ga0070709_10119745 3300005434 Bacteria 1782
46 Ga0070709_10340368 3300005434 Bacteria 1106
47 Ga0070709_10496036 3300005434 Bacteria 927
48 Ga0070714_100019301 3300005435 Bacteria 5549
49 Ga0070714_100330749 3300005435 Bacteria 1427
50 Ga0070714_100787181 3300005435 Bacteria 920
51 Ga0070714_101242233 3300005435 Bacteria 727
52 Ga0070714_101441249 3300005435 Bacteria 672
53 Ga0070713_100097441 3300005436 Bacteria 2541
54 Ga0070713_100202706 3300005436 Bacteria 1792
55 Ga0070713_100285468 3300005436 Bacteria 1515
56 Ga0070713_100423921 3300005436 Bacteria 1246
57 Ga0070713_101411837 3300005436 Bacteria 675
58 Ga0070713_102437997 3300005436 Bacteria 506
59 Ga0070710_10024705 3300005437 Bacteria 3173
60 Ga0070710_10414210 3300005437 Bacteria 906
61 Ga0070701_10158099 3300005438 Bacteria 1310
62 Ga0070711_100089862 3300005439 Bacteria 2210
63 Ga0070711_100228315 3300005439 Bacteria 1450
64 Ga0070711_100319098 3300005439 Bacteria 1241
65 Ga0070711_100669251 3300005439 Bacteria 872
66 Ga0070711_101269094 3300005439 Unclassified 638
67 Ga0070705_100156183 3300005440 Bacteria 1519
68 Ga0070705_100875318 3300005440 Bacteria 720
69 Ga0070705_100974375 3300005440 Bacteria 687
70 Ga0070700_100196922 3300005441 Bacteria 1413
71 Ga0070694_100059196 3300005444 Bacteria 2608
72 Ga0070694_100328708 3300005444 Bacteria 1179
73 Ga0070708_100754521 3300005445 Bacteria 915
74 Ga0070708_102140812 3300005445 Bacteria 517
75 Ga0070663_100635999 3300005455 Bacteria 901
76 Ga0070678_100239721 3300005456 Bacteria 1516
77 Ga0070678_100325492 3300005456 Bacteria 1314
78 Ga0070678_100781822 3300005456 Bacteria 865
79 Ga0070678_102390172 3300005456 Unclassified 502
80 Ga0070662_100008721 3300005457 Bacteria 6611
81 Ga0070662_100237158 3300005457 Bacteria 1461
82 Ga0070681_10027461 3300005458 Bacteria 5722
83 Ga0070681_10077887 3300005458 Bacteria 3272
84 Ga0070681_10229331 3300005458 Bacteria 1771
85 Ga0068867_100054467 3300005459 Bacteria 2955
86 Ga0068867_100189901 3300005459 Bacteria 1639
87 Ga0070707_100000967 3300005468 Bacteria 28411
88 Ga0070707_100134608 3300005468 Bacteria 2404
89 Ga0070707_100403499 3300005468 Bacteria 1327
90 Ga0070698_100610216 3300005471 Bacteria 1031
91 Ga0070698_100694159 3300005471 Bacteria 960
92 Ga0070698_101981704 3300005471 Bacteria 535
93 Ga0070699_101739811 3300005518 Bacteria 571
94 Ga0070679_100006446 3300005530 Bacteria 10935
95 Ga0070679_101091185 3300005530 Bacteria 743
96 Ga0070684_100040658 3300005535 Bacteria 4005
97 Ga0070684_100458323 3300005535 Bacteria 1179
98 Ga0070684_101196991 3300005535 Bacteria 715
99 Ga0070684_101340286 3300005535 Bacteria 674
100 Ga0070684_101565328 3300005535 Bacteria 621
101 Ga0068853_100422032 3300005539 Bacteria 1251
102 Ga0070686_100112133 3300005544 Bacteria 1860
103 Ga0070686_100142743 3300005544 Bacteria 1668
104 Ga0070686_100297652 3300005544 Bacteria 1196
105 Ga0070695_100000009 3300005545 Bacteria 87710
106 Ga0070695_100141563 3300005545 Bacteria 1668
107 Ga0070695_100543623 3300005545 Bacteria 905
108 Ga0070695_100584542 3300005545 Bacteria 875
109 Ga0070696_100212780 3300005546 Bacteria 1447
110 Ga0070693_100003302 3300005547 Bacteria 7495
111 Ga0070693_100069549 3300005547 Bacteria 2069
112 Ga0070693_100413061 3300005547 Bacteria 938
113 Ga0070693_100528831 3300005547 Bacteria 841
114 Ga0070704_100012668 3300005549 Bacteria 5217
115 Ga0070704_100283519 3300005549 Bacteria 1374
116 Ga0070704_101454039 3300005549 Bacteria 630
117 Ga0070704_101946505 3300005549 Bacteria 545
118 Ga0068855_100032708 3300005563 Bacteria 6210
119 Ga0068855_100082269 3300005563 Bacteria 3731
120 Ga0068855_100303528 3300005563 Bacteria 1767
121 Ga0070664_100996173 3300005564 Bacteria 787
122 Ga0070664_101154495 3300005564 Bacteria 730
123 Ga0068857_100257582 3300005577 Bacteria 1601
124 Ga0068854_100341191 3300005578 Bacteria 1223
125 Ga0068854_100824455 3300005578 Bacteria 810
126 Ga0068854_100850445 3300005578 Bacteria 799
127 Ga0068856_100097876 3300005614 Bacteria 2923
128 Ga0068856_100437262 3300005614 Bacteria 1328
129 Ga0068856_100532957 3300005614 Bacteria 1195
130 Ga0068856_100723351 3300005614 Bacteria 1016
131 Ga0070702_100301540 3300005615 Bacteria 1109
132 Ga0070702_100566861 3300005615 Bacteria 846
133 Ga0070702_100766208 3300005615 Bacteria 743
134 Ga0068852_101310903 3300005616 Bacteria 746
135 Ga0068852_102590928 3300005616 Bacteria 527
136 Ga0068859_101824474 3300005617 Bacteria 672
137 Ga0068864_102292695 3300005618 Unclassified 546
138 Ga0068866_10100190 3300005718 Bacteria 1597
139 Ga0068866_10290382 3300005718 Bacteria 1017
140 Ga0068861_100029766 3300005719 Bacteria 3996
141 Ga0068870_10333177 3300005840 Bacteria 968
142 Ga0068870_10393666 3300005840 Bacteria 900
143 Ga0068870_10616755 3300005840 Bacteria 739
144 Ga0068858_101441321 3300005842 Bacteria 679
145 Ga0068860_100203149 3300005843 Bacteria 1921
146 Ga0068860_101336447 3300005843 Bacteria 738
147 Ga0081455_10049608 3300005937 Bacteria 3617
148 Ga0081455_10226310 3300005937 Bacteria 1383
149 Ga0081540_1002206 3300005983 Bacteria 16084
150 Ga0081540_1004965 3300005983 Bacteria 10004
151 Ga0081540_1019109 3300005983 Bacteria 4179
152 Ga0070717_10049690 3300006028 Bacteria 3444
153 Ga0070717_10349183 3300006028 Bacteria 1322
154 Ga0070717_10881246 3300006028 Bacteria 815
155 Ga0070717_11267049 3300006028 Bacteria 670
156 Ga0070717_11639233 3300006028 Bacteria 583
157 Ga0075432_10020216 3300006058 Bacteria 2276
158 Ga0070715_10035033 3300006163 Bacteria 2062
159 Ga0070715_10077106 3300006163 Bacteria 1503
160 Ga0070716_100006144 3300006173 Bacteria 5861
161 Ga0070712_100004553 3300006175 Bacteria 8561
162 Ga0070712_100076280 3300006175 Bacteria 2413
163 Ga0070712_100280096 3300006175 Bacteria 1343
164 Ga0070712_100398231 3300006175 Bacteria 1136
165 Ga0070712_100780616 3300006175 Bacteria 819
166 Ga0070712_100951634 3300006175 Bacteria 742
167 Ga0097621_100006460 3300006237 Bacteria 8324
168 Ga0097621_100383618 3300006237 Bacteria 1255
169 Ga0068871_100050403 3300006358 Bacteria 3367
170 Ga0068871_100207648 3300006358 Bacteria 1693
171 Ga0068871_101423430 3300006358 Bacteria 654
172 Ga0075428_100083136 3300006844 Bacteria 3493
173 Ga0075431_100387039 3300006847 Bacteria 1401
174 Ga0075431_101578009 3300006847 Bacteria 614
175 Ga0075433_10293640 3300006852 Bacteria 1439
176 Ga0075433_11185935 3300006852 Bacteria 663
177 Ga0075434_100732293 3300006871 Unclassified 1006
178 Ga0075434_101700409 3300006871 Bacteria 639
179 Ga0068865_100100953 3300006881 Bacteria 2112
180 Ga0068865_100685292 3300006881 Bacteria 874
181 Ga0075436_100013277 3300006914 Bacteria 5644
182 Ga0097620_101824343 3300006931 Bacteria 672
183 Ga0075435_101179798 3300007076 Bacteria 670
184 Ga0105240_10355411 3300009093 Bacteria 1661
185 Ga0105240_10476997 3300009093 Bacteria 1391
186 Ga0105240_10610132 3300009093 Bacteria 1200
187 Ga0105240_11242895 3300009093 Bacteria 787
188 Ga0105240_12240362 3300009093 Bacteria 566
189 Ga0111539_10410005 3300009094 Bacteria 1578
190 Ga0105245_10013780 3300009098 Bacteria 7041
191 Ga0105245_10026118 3300009098 Bacteria 5139
192 Ga0105245_10518679 3300009098 Bacteria 1210
193 Ga0105245_10693134 3300009098 Bacteria 1051
194 Ga0105245_11495577 3300009098 Bacteria 726
195 Ga0105247_11185946 3300009101 Bacteria 607
196 Ga0114129_10127217 3300009147 Bacteria 3502
197 Ga0114129_10646867 3300009147 Bacteria 1365
198 Ga0105243_10073149 3300009148 Bacteria 2777
199 Ga0105243_10919750 3300009148 Unclassified 871
200 Ga0105241_10115929 3300009174 Bacteria 2151
201 Ga0105241_10123497 3300009174 Bacteria 2088
202 Ga0105242_10034248 3300009176 Bacteria 4072
203 Ga0105242_11025086 3300009176 Bacteria 835
204 Ga0105248_11455954 3300009177 Bacteria 775
205 Ga0105248_11902870 3300009177 Bacteria 675
206 Ga0105238_11929748 3300009551 Bacteria 624
207 Ga0105249_10036463 3300009553 Bacteria 4461
208 Ga0105249_11263099 3300009553 Bacteria 810
209 Ga0105249_11401905 3300009553 Bacteria 771
210 Ga0105239_10288743 3300010375 Bacteria 1847
211 Ga0105239_11502672 3300010375 Bacteria 778
212 Ga0105239_13186436 3300010375 Bacteria 534
213 Ga0105239_13336546 3300010375 Bacteria 522
214 Ga0105246_11325773 3300011119 Bacteria 668
215 Ga0157320_1005704 3300012481 Unclassified 839
216 Ga0157335_1017402 3300012492 Bacteria 651
217 Ga0157326_1010442 3300012513 Bacteria 1035
218 Ga0157338_1014109 3300012515 Bacteria 856
219 Ga0157370_10824133 3300013104 Bacteria 844
220 Ga0157370_11536358 3300013104 Bacteria 598
221 Ga0157370_11661908 3300013104 Bacteria 573
222 Ga0157369_10133899 3300013105 Bacteria 2625
223 Ga0157369_10420997 3300013105 Bacteria 1384
224 Ga0157369_10739500 3300013105 Bacteria 1012
225 Ga0157369_11602354 3300013105 Bacteria 662
226 Ga0157374_11599158 3300013296 Bacteria 676
227 Ga0157378_10372589 3300013297 Bacteria 1400
228 Ga0157378_10591455 3300013297 Bacteria 1120
229 Ga0157378_11047068 3300013297 Bacteria 852
230 Ga0163162_10148770 3300013306 Bacteria 2459
231 Ga0163162_10418116 3300013306 Bacteria 1473
232 Ga0157372_10598071 3300013307 Bacteria 1286
233 Ga0157372_10930138 3300013307 Bacteria 1008
234 Ga0157372_11066462 3300013307 Bacteria 935
235 Ga0157372_11666247 3300013307 Bacteria 734
236 Ga0157372_12677178 3300013307 Bacteria 572
237 Ga0157372_12830914 3300013307 Unclassified 556
238 Ga0157375_12933610 3300013308 Unclassified 570
239 Ga0163163_10566358 3300014325 Bacteria 1199
240 Ga0157380_10858141 3300014326 Bacteria 930
241 Ga0157380_10874668 3300014326 Bacteria 922
242 Ga0157380_12056882 3300014326 Unclassified 633
243 Ga0182008_10001169 3300014497 Bacteria 18115
244 Ga0182008_10119715 3300014497 Bacteria 1308
245 Ga0182008_10168623 3300014497 Bacteria 1104
246 Ga0182008_10341121 3300014497 Bacteria 792
247 Ga0182008_10712614 3300014497 Unclassified 574
248 Ga0157377_10197782 3300014745 Bacteria 1274
249 Ga0157379_11262358 3300014968 Bacteria 712
250 Ga0157376_10569500 3300014969 Bacteria 1123
251 Ga0157376_10590546 3300014969 Bacteria 1104
252 Ga0182006_1022982 3300015261 Bacteria 2585
253 Ga0182007_10001522 3300015262 Bacteria 12380
254 Ga0163161_10063249 3300017792 Bacteria 2697
255 Ga0163161_10770946 3300017792 Bacteria 806
256 Ga0163161_11330915 3300017792 Bacteria 625
257 Ga0206356_10046714 3300020070 Bacteria 904
258 Ga0206356_10965810 3300020070 Bacteria 1370
259 Ga0206356_11478238 3300020070 Bacteria 794
260 Ga0206353_11369135 3300020082 Bacteria 561
261 Ga0206353_12063587 3300020082 Bacteria 559
262 Ga0213874_10276159 3300021377 Bacteria 626
263 Ga0213876_10005302 3300021384 Bacteria 7095
264 Ga0213876_10028074 3300021384 Bacteria 2967
265 Ga0213875_10038452 3300021388 Bacteria 2254
266 Ga0224712_10313497 3300022467 Bacteria 736
267 Ga0207682_10293859 3300025893 Bacteria 761
268 Ga0207682_10320831 3300025893 Bacteria 727
269 Ga0207692_10065988 3300025898 Bacteria 1890
270 Ga0207692_11054955 3300025898 Bacteria 537
271 Ga0207642_10186144 3300025899 Bacteria 1135
272 Ga0207688_10063170 3300025901 Bacteria 2089
273 Ga0207647_10332625 3300025904 Bacteria 862
274 Ga0207685_10020349 3300025905 Bacteria 2204
275 Ga0207699_10984660 3300025906 Unclassified 623
276 Ga0207645_10066177 3300025907 Bacteria 2310
277 Ga0207705_10637834 3300025909 Bacteria 828
278 Ga0207705_11195903 3300025909 Bacteria 583
279 Ga0207654_10609118 3300025911 Bacteria 780
280 Ga0207707_10049188 3300025912 Bacteria 3673
281 Ga0207707_10181967 3300025912 Bacteria 1835
282 Ga0207707_10527304 3300025912 Bacteria 1005
283 Ga0207707_10653453 3300025912 Bacteria 886
284 Ga0207695_10074697 3300025913 Bacteria 3451
285 Ga0207695_10128005 3300025913 Bacteria 2499
286 Ga0207695_10417182 3300025913 Bacteria 1226
287 Ga0207695_11277298 3300025913 Bacteria 614
288 Ga0207693_10002091 3300025915 Bacteria 17432
289 Ga0207693_10007849 3300025915 Bacteria 8760
290 Ga0207693_10183540 3300025915 Bacteria 1647
291 Ga0207693_10507060 3300025915 Bacteria 942
292 Ga0207693_10788172 3300025915 Bacteria 733
293 Ga0207663_10116855 3300025916 Bacteria 1819
294 Ga0207663_10245785 3300025916 Bacteria 1314
295 Ga0207660_10170917 3300025917 Bacteria 1682
296 Ga0207660_10356550 3300025917 Bacteria 1173
297 Ga0207660_10606465 3300025917 Bacteria 892
298 Ga0207660_10955576 3300025917 Bacteria 699
299 Ga0207662_10130970 3300025918 Bacteria 1581
300 Ga0207657_10359135 3300025919 Bacteria 1148
301 Ga0207657_10449252 3300025919 Bacteria 1011
302 Ga0207657_11141354 3300025919 Bacteria 594
303 Ga0207649_10759244 3300025920 Bacteria 755
304 Ga0207652_10219888 3300025921 Bacteria 1711
305 Ga0207652_10367007 3300025921 Bacteria 1299
306 Ga0207652_11612064 3300025921 Bacteria 553
307 Ga0207646_10000523 3300025922 Bacteria 51093
308 Ga0207646_10318001 3300025922 Bacteria 1407
309 Ga0207646_11231577 3300025922 Bacteria 655
310 Ga0207681_10018104 3300025923 Bacteria 4435
311 Ga0207687_10101930 3300025927 Bacteria 2114
312 Ga0207687_10743455 3300025927 Bacteria 834
313 Ga0207687_10854308 3300025927 Bacteria 778
314 Ga0207700_10128074 3300025928 Bacteria 2068
315 Ga0207700_10184237 3300025928 Bacteria 1750
316 Ga0207700_10282486 3300025928 Bacteria 1428
317 Ga0207700_10885651 3300025928 Bacteria 799
318 Ga0207664_10142470 3300025929 Bacteria 2029
319 Ga0207664_10461442 3300025929 Bacteria 1134
320 Ga0207664_10548951 3300025929 Bacteria 1037
321 Ga0207664_11219602 3300025929 Bacteria 671
322 Ga0207644_10142480 3300025931 Bacteria 1847
323 Ga0207644_10179265 3300025931 Bacteria 1659
324 Ga0207644_10649900 3300025931 Unclassified 878
325 Ga0207690_10748113 3300025932 Bacteria 806
326 Ga0207706_10010184 3300025933 Bacteria 8603
327 Ga0207706_10022429 3300025933 Bacteria 5666
328 Ga0207686_11106383 3300025934 Bacteria 646
329 Ga0207686_11341484 3300025934 Bacteria 588
330 Ga0207709_10076211 3300025935 Bacteria 2146
331 Ga0207709_10299165 3300025935 Bacteria 1196
332 Ga0207709_10691095 3300025935 Bacteria 816
333 Ga0207670_11689852 3300025936 Bacteria 538
334 Ga0207669_10443420 3300025937 Bacteria 1027
335 Ga0207669_11170438 3300025937 Bacteria 651
336 Ga0207704_10697646 3300025938 Bacteria 840
337 Ga0207665_10070562 3300025939 Bacteria 2384
338 Ga0207665_10270465 3300025939 Bacteria 1262
339 Ga0207665_10485910 3300025939 Bacteria 952
340 Ga0207665_11353103 3300025939 Bacteria 567
341 Ga0207691_10483206 3300025940 Bacteria 1053
342 Ga0207691_10981706 3300025940 Bacteria 705
343 Ga0207711_11269610 3300025941 Bacteria 678
344 Ga0207689_10352300 3300025942 Bacteria 1224
345 Ga0207689_10979129 3300025942 Bacteria 714
346 Ga0207661_10401928 3300025944 Bacteria 1242
347 Ga0207661_12075005 3300025944 Unclassified 514
348 Ga0207667_10081446 3300025949 Bacteria 3354
349 Ga0207667_10133805 3300025949 Bacteria 2553
350 Ga0207667_11080268 3300025949 Bacteria 786
351 Ga0207651_10909356 3300025960 Bacteria 784
352 Ga0207712_10036215 3300025961 Bacteria 3359
353 Ga0207712_10059963 3300025961 Bacteria 2696
354 Ga0207668_10006182 3300025972 Bacteria 7066
355 Ga0207668_10156377 3300025972 Bacteria 1772
356 Ga0207640_10332213 3300025981 Bacteria 1214
357 Ga0207640_12091273 3300025981 Unclassified 513
358 Ga0207640_12150726 3300025981 Bacteria 506
359 Ga0207658_10232325 3300025986 Bacteria 1558
360 Ga0207677_10200562 3300026023 Bacteria 1585
361 Ga0207639_10859284 3300026041 Bacteria 847
362 Ga0207639_11614805 3300026041 Bacteria 608
363 Ga0207678_10286798 3300026067 Bacteria 1414
364 Ga0207678_10734082 3300026067 Bacteria 870
365 Ga0207678_10819604 3300026067 Bacteria 822
366 Ga0207708_10116305 3300026075 Bacteria 2080
367 Ga0207702_10089121 3300026078 Bacteria 2697
368 Ga0207702_11833783 3300026078 Bacteria 598
369 Ga0207648_10021873 3300026089 Bacteria 5745
370 Ga0207648_10271840 3300026089 Bacteria 1514
371 Ga0207676_12218869 3300026095 Unclassified 547
372 Ga0207674_10815924 3300026116 Bacteria 900
373 Ga0207675_100002763 3300026118 Bacteria 17252
374 Ga0207675_100043272 3300026118 Bacteria 4206
375 Ga0207683_10003820 3300026121 Bacteria 13052
376 Ga0207683_10126854 3300026121 Bacteria 2293
377 Ga0207683_10261572 3300026121 Bacteria 1580
378 Ga0207698_10639715 3300026142 Bacteria 1052
379 Ga0207428_10001749 3300027907 Bacteria 22235
380 Ga0268265_12330138 3300028380 Bacteria 542
381 Ga0268264_10301904 3300028381 Bacteria 1508
382 Ga0268264_11082515 3300028381 Bacteria 810
383 Ga0265319_1253164 3300028563 Bacteria 537
384 Ga0265334_10057519 3300028573 Bacteria 1473
385 Ga0265318_10312988 3300028577 Bacteria 573
386 Ga0265322_10004957 3300028654 Bacteria 3948
387 Ga0265338_10016797 3300028800 Bacteria 7927
388 Ga0265338_10333043 3300028800 Bacteria 1096
389 Ga0265332_10075196 3300031238 Bacteria 1436
390 Ga0265320_10069464 3300031240 Bacteria 1663
391 Ga0265325_10009897 3300031241 Bacteria 5547
392 Ga0265340_10048790 3300031247 Bacteria 2058
393 Ga0265340_10298514 3300031247 Bacteria 715
394 Ga0265339_10043531 3300031249 Bacteria 2482
395 Ga0265331_10101001 3300031250 Bacteria 1327
396 Ga0265327_10003899 3300031251 Bacteria 13720
397 Ga0265316_10004010 3300031344 Bacteria 14745
398 Ga0265313_10004245 3300031595 Bacteria 11111
399 Ga0265314_10010034 3300031711 Bacteria 7939
400 Ga0265342_10302641 3300031712 Bacteria 842
401 Ga0307412_10926851 3300031911 Bacteria 765
402 Ga0307409_102874281 3300031995 Bacteria 509
403 Ga0307416_100161639 3300032002 Bacteria 2071
404 Ga0307416_100222961 3300032002 Bacteria 1810
405 Ga0307411_10957721 3300032005 Unclassified 764
406 Ga0307415_100210936 3300032126 Unclassified 1549
407 Ga0373950_0075882 3300034818 Bacteria 695
408 Ga0373959_0135283 3300034820 Bacteria 613
409 Ga0373929_0037565 3300035085 Bacteria 1062
410 Ga0373940_0017271 3300035088 Bacteria 1798
411 Ga0373944_0025477 3300035089 Bacteria 1741
412 Ga0373944_0085325 3300035089 Bacteria 1049
413 Ga0373932_0150808 3300035112 Bacteria 797
414 Ga0373936_0122021 3300035113 Bacteria 1114
415 Ga0373941_0286350 3300035115 Bacteria 653
416 Ga0373945_0015131 3300035116 Bacteria 2593
417 Ga0373953_0377228 3300035117 Bacteria 623
418 Ga0373956_0063617 3300035119 Bacteria 1674
419 Ga0373956_0319531 3300035119 Bacteria 740
420 Ga0373956_0496352 3300035119 Bacteria 582
421 Ga0373957_0091442 3300035120 Bacteria 1210
422 Ga0373960_0020482 3300035121 Bacteria 1749
423 Ga0373960_0104494 3300035121 Bacteria 922
424 Ga0373943_0012237 3300035170 Bacteria 3861
425 Ga0373943_0244534 3300035170 Bacteria 1006
426 Ga0373943_0410276 3300035170 Bacteria 783
427 Ga0373946_0162870 3300035171 Bacteria 1048
428 Ga0373946_0613394 3300035171 Unclassified 565
429 Ga0373946_0681011 3300035171 Bacteria 537
430 Ga0373955_0354823 3300035172 Unclassified 888
431 Ga0373942_0022656 3300035207 Bacteria 1596
432 Ga0373942_0116200 3300035207 Bacteria 832
433 Ga0373961_0011219 3300035241 Bacteria 2221
434 Ga0373961_0136555 3300035241 Bacteria 825
435 Ga0373962_0078265 3300035242 Bacteria 999
436 Ga0373924_0040038 3300035410 Bacteria 1917
437 Ga0373924_0132210 3300035410 Bacteria 1086
438 Ga0373924_0302778 3300035410 Bacteria 710
439 Ga0373931_0119213 3300035691 Bacteria 1506
440 Ga0373931_0275425 3300035691 Bacteria 1031
441 Ga0373935_0012688 3300035692 Bacteria 5071
442 Ga0373935_0487032 3300035692 Bacteria 894
443 Ga0373933_0189374 3300035724 Bacteria 1314
444 Ga0373947_0000770 3300035725 Bacteria 19222
445 Ga0373947_0117301 3300035725 Bacteria 1689
446 Ga0373947_0644671 3300035725 Unclassified 722
447 Ga0373947_0776078 3300035725 Unclassified 654
448 Ga0373937_0246279 3300036401 Bacteria 1684
449 Ga0373937_1321019 3300036401 Bacteria 669
450 Ga0373925_0010352 3300037068 Bacteria 6767
451 Ga0373925_1507147 3300037068 Unclassified 550
452 Ga0395899_0058245 3300037312 Bacteria 2850
453 Ga0395899_0153479 3300037312 Bacteria 1631
454 Ga0395899_0201751 3300037312 Bacteria 1386
455 Ga0395900_0002122 3300037418 Bacteria 22181
456 Ga0395900_0116281 3300037418 Bacteria 2744
457 Ga0395900_0117438 3300037418 Unclassified 2729
458 Ga0395900_0231295 3300037418 Bacteria 1859
459 Ga0395900_1037516 3300037418 Unclassified 739
460 Ga0395900_1907004 3300037418 Unclassified 505
461 Ga0395898_0002136 3300037466 Bacteria 24363
462 Ga0395898_0002238 3300037466 Bacteria 23529
463 Ga0395898_0002255 3300037466 Bacteria 23396
464 Ga0395898_0555735 3300037466 Bacteria 1090
465 Ga0395898_0580892 3300037466 Unclassified 1063
466 Ga0395898_0643479 3300037466 Bacteria 1003
467 Ga0395905_0001065 3300037471 Bacteria 34603
468 Ga0395905_0037126 3300037471 Bacteria 4575
469 Ga0395905_0160047 3300037471 Bacteria 2116
470 Ga0395905_0279215 3300037471 Bacteria 1556
471 Ga0395905_0342275 3300037471 Bacteria 1387
472 Ga0395905_1870246 3300037471 Bacteria 506
473 Ga0436364_1051529 3300037853 Bacteria 8650
474 Ga0436364_1273932 3300037853 Unclassified 1502
475 Ga0395901_0001460 3300038443 Bacteria 24601
476 Ga0395901_0035317 3300038443 Bacteria 5163
477 Ga0395901_0046527 3300038443 Bacteria 4507
478 Ga0395901_0227484 3300038443 Bacteria 1948
479 Ga0395901_0249917 3300038443 Bacteria 1848
480 Ga0395901_0518386 3300038443 Bacteria 1211
481 Ga0395901_0625265 3300038443 Bacteria 1083
482 Ga0395901_0736963 3300038443 Bacteria 980
483 Ga0395901_1826107 3300038443 Bacteria 557
484 Ga0242420_008053 3300038996 Bacteria 1702
485 Ga0436365_0121270 3300039437 Bacteria 19985
486 Ga0436365_0273214 3300039437 Bacteria 14739
487 Ga0436363_0200906 3300039450 Bacteria 622
488 Ga0436363_1222508 3300039450 Bacteria 4057
489 Ga0436363_1712560 3300039450 Bacteria 8995
490 Ga0436362_0095914 3300039453 Unclassified 760
491 Ga0439461_0001353 3300041410 Bacteria 3776
492 Ga0439466_0041059 3300041411 Bacteria 1545
493 Ga0451793_1370022 3300041452 Bacteria 524
494 Ga0451798_0027903 3300041458 Unclassified 510
495 Ga0451800_0747455 3300041459 Bacteria 1008
496 Ga0451800_1532795 3300041459 Bacteria 661
497 Ga0451835_0166831 3300041492 Bacteria 1041
498 Ga0451835_0846564 3300041492 Unclassified 664
499 Ga0451835_0929677 3300041492 Bacteria 652
500 Ga0451847_0010074 3300041503 Bacteria 711
501 Ga0451853_0301340 3300041512 Bacteria 969
502 Ga0451853_0680311 3300041512 Bacteria 572
503 Ga0451853_1808990 3300041512 Bacteria 807
504 Ga0451853_3331639 3300041512 Bacteria 1274
505 Ga0439431_0052794 3300041997 Unclassified 1057
506 Ga0439448_0007089 3300042005 Bacteria 3239
507 Ga0439448_0106857 3300042005 Unclassified 954
508 Ga0439463_109490 3300042016 Bacteria 713
509 Ga0450907_055649 3300042146 Bacteria 681
510 Ga0439446_0018685 3300042156 Bacteria 1944
511 Ga0439458_0052133 3300042157 Bacteria 1011
512 Ga0439464_0063108 3300042439 Bacteria 1087
513 Ga0466969_0027273 3300044656 Bacteria 2925
514 Ga0466972_0161594 3300044658 Bacteria 1052
515 Ga0466972_0327463 3300044658 Bacteria 716
516 Ga0466965_0013055 3300044683 Bacteria 3915
517 Ga0466965_0049575 3300044683 Bacteria 2082
518 Ga0466965_0225456 3300044683 Bacteria 1000
519 Ga0466966_0044313 3300044684 Bacteria 2848
520 Ga0466966_0431375 3300044684 Bacteria 792
521 Ga0466961_0005586 3300044693 Bacteria 7943
522 Ga0466961_0024499 3300044693 Bacteria 3881
523 Ga0466961_0143729 3300044693 Bacteria 1493
524 Ga0466961_0150883 3300044693 Bacteria 1451
525 Ga0466961_0932536 3300044693 Bacteria 516
526 Ga0466963_0000482 3300044694 Bacteria 18580
527 Ga0466963_0001696 3300044694 Bacteria 12006
528 Ga0466963_0002627 3300044694 Bacteria 10094
529 Ga0466963_0005909 3300044694 Bacteria 7205
530 Ga0466963_0010624 3300044694 Bacteria 5581
531 Ga0466963_0019739 3300044694 Bacteria 4233
532 Ga0466963_0021423 3300044694 Bacteria 4077
533 Ga0466963_0031970 3300044694 Bacteria 3404
534 Ga0466963_0032835 3300044694 Bacteria 3364
535 Ga0466963_0063913 3300044694 Bacteria 2464
536 Ga0466963_0064531 3300044694 Bacteria 2453
537 Ga0466963_0102989 3300044694 Bacteria 1955
538 Ga0466963_0109960 3300044694 Bacteria 1891
539 Ga0466963_0145955 3300044694 Bacteria 1641
540 Ga0466963_0241941 3300044694 Bacteria 1266
541 Ga0466963_0748485 3300044694 Bacteria 689
542 Ga0466963_1043130 3300044694 Unclassified 575
543 Ga0466963_1293195 3300044694 Bacteria 512
544 Ga0466964_0003414 3300044706 Bacteria 5796
545 Ga0466964_0020297 3300044706 Bacteria 2558
546 Ga0466964_0028446 3300044706 Bacteria 2202
547 Ga0466964_0054369 3300044706 Bacteria 1650
548 Ga0466964_0059776 3300044706 Bacteria 1583
549 Ga0466964_0095620 3300044706 Bacteria 1300
550 Ga0466964_0846665 3300044706 Unclassified 520
551 Ga0466971_0001805 3300044719 Bacteria 9086
552 Ga0466971_0004784 3300044719 Bacteria 5858
553 Ga0466971_0032012 3300044719 Bacteria 2356
554 Ga0466971_0250426 3300044719 Bacteria 844
555 Ga0466968_0008584 3300044735 Bacteria 3915
556 Ga0466968_0042076 3300044735 Bacteria 1930
557 Ga0466968_0060638 3300044735 Bacteria 1631
558 Ga0466970_0065140 3300044765 Bacteria 1955
559 Ga0466970_0127942 3300044765 Bacteria 1394
560 Ga0466970_0661671 3300044765 Bacteria 608
561 Ga0466957_0005137 3300044842 Bacteria 7316
562 Ga0466957_0011744 3300044842 Bacteria 5061
563 Ga0466957_0012546 3300044842 Bacteria 4905
564 Ga0466957_0013491 3300044842 Bacteria 4739
565 Ga0466957_0077694 3300044842 Bacteria 2063
566 Ga0466957_0081326 3300044842 Bacteria 2017
567 Ga0466957_0110669 3300044842 Bacteria 1741
568 Ga0466957_0174778 3300044842 Bacteria 1400
569 Ga0466957_0318325 3300044842 Bacteria 1049
570 Ga0466957_0831405 3300044842 Bacteria 657
571 Ga0466957_0991743 3300044842 Bacteria 603
572 Ga0466957_1014522 3300044842 Bacteria 596
573 Ga0466960_0002382 3300044901 Bacteria 7074
574 Ga0466960_0132182 3300044901 Bacteria 1318
575 Ga0466960_0394034 3300044901 Bacteria 797
576 Ga0466959_0006797 3300045049 Bacteria 7970
577 Ga0466959_0018649 3300045049 Bacteria 5095
578 Ga0466959_0060966 3300045049 Bacteria 2744
579 Ga0466959_0080902 3300045049 Bacteria 2341
580 Ga0466959_0346746 3300045049 Bacteria 1013
581 Ga0451576_0038025 3300045051 Bacteria 5095
582 Ga0451576_0666637 3300045051 Bacteria 1093
583 Ga0466958_0008945 3300045836 Bacteria 5565
584 Ga0466958_0009049 3300045836 Bacteria 5531
585 Ga0466958_0016619 3300045836 Bacteria 4240
586 Ga0466958_0062518 3300045836 Bacteria 2269
587 Ga0466958_0079202 3300045836 Bacteria 2020
588 Ga0466958_0101134 3300045836 Bacteria 1792
589 Ga0466958_0102677 3300045836 Bacteria 1779
590 Ga0466958_0242179 3300045836 Bacteria 1152
591 Ga0466958_0279987 3300045836 Bacteria 1069
592 Ga0466958_0571334 3300045836 Bacteria 735
593 Ga0466958_0644566 3300045836 Bacteria 689
594 Ga0466958_0841803 3300045836 Bacteria 598
595 Ga0466967_0004099 3300045976 Bacteria 9735
596 Ga0466967_0004107 3300045976 Bacteria 9726
597 Ga0466967_0005413 3300045976 Bacteria 8843
598 Ga0466967_0012096 3300045976 Bacteria 6581
599 Ga0466967_0014265 3300045976 Bacteria 6181
600 Ga0466967_0017302 3300045976 Bacteria 5718
601 Ga0466967_0020252 3300045976 Bacteria 5371
602 Ga0466967_0022553 3300045976 Bacteria 5141
603 Ga0466967_0029598 3300045976 Bacteria 4585
604 Ga0466967_0035194 3300045976 Bacteria 4259
605 Ga0466967_0074064 3300045976 Bacteria 3057
606 Ga0466967_0079712 3300045976 Bacteria 2952
607 Ga0466967_0086218 3300045976 Bacteria 2844
608 Ga0466967_0099691 3300045976 Bacteria 2653
609 Ga0466967_0116230 3300045976 Bacteria 2464
610 Ga0466967_0125915 3300045976 Bacteria 2373
611 Ga0466967_0323418 3300045976 Bacteria 1488
612 Ga0466967_0360417 3300045976 Bacteria 1409
613 Ga0466967_0364602 3300045976 Bacteria 1400
614 Ga0466967_0378473 3300045976 Bacteria 1374
615 Ga0466967_0453245 3300045976 Unclassified 1254
616 Ga0466967_0469006 3300045976 Bacteria 1232
617 Ga0466967_0482680 3300045976 Bacteria 1214
618 Ga0466967_0936154 3300045976 Bacteria 862
619 Ga0466967_1463707 3300045976 Bacteria 680
620 Ga0466967_1542779 3300045976 Bacteria 661
621 Ga0495592_0114079 3300046454 Bacteria 1909
622 Ga0495592_0256156 3300046454 Bacteria 1154
623 Ga0495592_0345395 3300046454 Bacteria 955
624 Ga0495603_0001930 3300046455 Bacteria 12224
625 Ga0495603_0124722 3300046455 Bacteria 1501
626 Ga0495629_0237331 3300046459 Bacteria 1256
627 Ga0495629_0278455 3300046459 Bacteria 1148
628 Ga0495641_0000786 3300046461 Bacteria 26874
629 Ga0495641_0100366 3300046461 Bacteria 1291
630 Ga0495641_0131141 3300046461 Bacteria 1119
631 Ga0495651_0644355 3300046462 Bacteria 665
632 Ga0495653_0096938 3300046463 Bacteria 2143
633 Ga0495653_0409014 3300046463 Bacteria 861
634 Ga0495653_0606428 3300046463 Bacteria 672
635 Ga0495580_0055313 3300046472 Bacteria 2797
636 Ga0495582_0010387 3300046473 Bacteria 5123
637 Ga0495582_0067084 3300046473 Bacteria 1982
638 Ga0495582_0595524 3300046473 Unclassified 640
639 Ga0495605_0227158 3300046474 Bacteria 805
640 Ga0495664_0051708 3300046477 Bacteria 2440
641 Ga0495664_0108708 3300046477 Bacteria 1673
642 Ga0495664_0169292 3300046477 Bacteria 1325
643 Ga0495584_0256072 3300046491 Bacteria 890
644 Ga0495584_0577490 3300046491 Bacteria 573
645 Ga0495585_0369235 3300046492 Bacteria 695
646 Ga0495594_0000915 3300046499 Bacteria 15329
647 Ga0495596_0188540 3300046500 Bacteria 802
648 Ga0495596_0226109 3300046500 Bacteria 727
649 Ga0495607_0151633 3300046501 Bacteria 1186
650 Ga0495608_0092973 3300046511 Bacteria 1949
651 Ga0495608_0123724 3300046511 Bacteria 1657
652 Ga0495608_0279230 3300046511 Unclassified 1037
653 Ga0495618_0071215 3300046514 Bacteria 2212
654 Ga0495628_0085846 3300046516 Bacteria 2441
655 Ga0495628_0647580 3300046516 Bacteria 750
656 Ga0495630_0123181 3300046517 Bacteria 1967
657 Ga0495630_0210989 3300046517 Bacteria 1482
658 Ga0495630_0234103 3300046517 Bacteria 1403
659 Ga0495630_0314789 3300046517 Bacteria 1196
660 Ga0495644_0280587 3300046523 Bacteria 650
661 Ga0495663_0081448 3300046525 Bacteria 1043
662 Ga0495663_0094968 3300046525 Bacteria 976
663 Ga0495666_0219681 3300046526 Bacteria 871
664 Ga0495652_0081495 3300046529 Bacteria 2669
665 Ga0495652_0116214 3300046529 Bacteria 2142
666 Ga0495665_0227013 3300046531 Bacteria 965
667 Ga0495640_0180087 3300046533 Bacteria 1347
668 Ga0495586_0043514 3300046535 Bacteria 2419
669 Ga0495587_0044347 3300046536 Bacteria 2645
670 Ga0495587_0143362 3300046536 Bacteria 1362
671 Ga0495598_0117107 3300046537 Bacteria 899
672 Ga0495609_0140515 3300046538 Bacteria 1031
673 Ga0495645_0103084 3300046543 Bacteria 2027
674 Ga0495645_0132161 3300046543 Bacteria 1748
675 Ga0495645_0193256 3300046543 Bacteria 1385
676 Ga0495633_0403859 3300046558 Bacteria 618
677 Ga0495667_0092464 3300046559 Bacteria 1958
678 Ga0495667_0155978 3300046559 Bacteria 1469
679 Ga0495667_0220125 3300046559 Bacteria 1212
680 Ga0495656_0146080 3300046615 Bacteria 1138
681 Ga0495668_0840823 3300046616 Bacteria 509
682 Ga0495634_0243979 3300046642 Bacteria 1101
683 Ga0495634_0281943 3300046642 Bacteria 1009
684 Ga0495634_0389748 3300046642 Bacteria 829
685 Ga0495635_0062124 3300046663 Bacteria 2565
686 Ga0495635_0492222 3300046663 Bacteria 808
687 Ga0495588_0000409 3300046674 Bacteria 23658
688 Ga0495588_0337224 3300046674 Bacteria 793
689 Ga0495657_0037606 3300046675 Bacteria 3335
690 Ga0495657_0041833 3300046675 Bacteria 3133
691 Ga0495657_0111758 3300046675 Bacteria 1730
692 Ga0495599_0197172 3300046678 Bacteria 1237
693 Ga0495599_0262786 3300046678 Bacteria 1048
694 Ga0495623_0145720 3300046679 Bacteria 1404
695 Ga0495623_0315708 3300046679 Bacteria 859
696 Ga0495646_0069904 3300046680 Bacteria 2070
697 Ga0495646_0184746 3300046680 Archaea 1142
698 Ga0495646_0243112 3300046680 Bacteria 966
699 Ga0495647_0342795 3300046681 Bacteria 679
700 Ga0495658_0259714 3300046683 Bacteria 1093
701 Ga0495658_0427233 3300046683 Bacteria 845
702 Ga0495658_0463872 3300046683 Bacteria 810
703 Ga0495658_0657365 3300046683 Bacteria 671
704 Ga0495669_0332549 3300046684 Bacteria 734
705 Ga0495613_0127540 3300046689 Bacteria 1824
706 Ga0495613_0514952 3300046689 Bacteria 804
707 Ga0495624_0073114 3300046690 Bacteria 2132
708 Ga0495624_0534026 3300046690 Bacteria 701
709 Ga0495671_0237456 3300046692 Bacteria 881
710 Ga0495589_0171618 3300046794 Bacteria 1031
711 Ga0495589_0301721 3300046794 Bacteria 742
712 Ga0495600_0113701 3300046809 Bacteria 1762
713 Ga0495581_0283797 3300047315 Bacteria 968
714 Ga0495604_0134778 3300047317 Bacteria 1771
715 Ga0495604_0189034 3300047317 Bacteria 1436
716 Ga0495604_0439752 3300047317 Bacteria 853
717 Ga0495636_0280623 3300047318 Bacteria 776
718 Ga0495674_0009149 3300047319 Bacteria 9414
719 Ga0495674_0366446 3300047319 Bacteria 1167
720 Ga0495676_0002605 3300047321 Bacteria 16101
721 Ga0495676_0343465 3300047321 Bacteria 999
722 Ga0495676_0776768 3300047321 Bacteria 617
723 Ga0495680_0035962 3300047322 Bacteria 3982
724 Ga0495680_0090783 3300047322 Bacteria 2291
725 Ga0495680_0300605 3300047322 Bacteria 1127
726 Ga0495675_0109435 3300047444 Bacteria 1725
727 Ga0495675_0152363 3300047444 Bacteria 1428
728 Ga0495675_0383214 3300047444 Bacteria 822
729 Ga0495677_0101844 3300047445 Bacteria 1088
730 Ga0495679_140961 3300047446 Bacteria 651
731 Ga0495685_130002 3300047447 Bacteria 824
732 Ga0495684_0139049 3300047471 Bacteria 1821
733 Ga0495684_0231196 3300047471 Bacteria 1352
734 Ga0495684_0761143 3300047471 Bacteria 636
735 Ga0495593_0391779 3300047673 Bacteria 695
736 Ga0495602_0107144 3300048088 Bacteria 2279
737 Ga0495602_0273527 3300048088 Bacteria 1247
738 Ga0495602_0441664 3300048088 Bacteria 920
739 Ga0495602_0676779 3300048088 Unclassified 702
740 Ga0495614_0400067 3300048089 Bacteria 645
741 Ga0495615_0133843 3300048090 Bacteria 727
742 Ga0495626_0276658 3300048091 Bacteria 668
743 Ga0496100_0105848 3300048903 Bacteria 1946
744 Ga0496100_0148417 3300048903 Bacteria 1669
745 Ga0496100_0474573 3300048903 Bacteria 961
746 Ga0496100_0544531 3300048903 Bacteria 897
747 Ga0496100_0553661 3300048903 Bacteria 890
748 Ga0496101_0002385 3300048904 Bacteria 11528
749 Ga0496101_0031469 3300048904 Bacteria 3730
750 Ga0496101_0069766 3300048904 Bacteria 2572
751 Ga0496101_0136326 3300048904 Bacteria 1868
752 Ga0496101_0161836 3300048904 Bacteria 1717
753 Ga0496101_0319198 3300048904 Bacteria 1219
754 Ga0496101_0592054 3300048904 Bacteria 877
755 Ga0496102_0027799 3300048905 Bacteria 5051
756 Ga0496102_0047206 3300048905 Bacteria 3912
757 Ga0496102_0225608 3300048905 Bacteria 1766
758 Ga0496102_0434203 3300048905 Bacteria 1233
759 Ga0496102_0484384 3300048905 Bacteria 1158
760 Ga0496102_0490579 3300048905 Bacteria 1150
761 Ga0496102_0656975 3300048905 Bacteria 972
762 Ga0496102_0722089 3300048905 Bacteria 919
763 Ga0496103_0004252 3300048906 Bacteria 8701
764 Ga0496103_0064727 3300048906 Bacteria 2279
765 Ga0496103_0105344 3300048906 Bacteria 1788
766 Ga0496103_0178071 3300048906 Bacteria 1366
767 Ga0496103_0207904 3300048906 Bacteria 1259
768 Ga0496103_0969970 3300048906 Bacteria 530
769 Ga0496104_0003324 3300048907 Bacteria 13881
770 Ga0496104_0051079 3300048907 Bacteria 3901
771 Ga0496104_0225497 3300048907 Bacteria 1786
772 Ga0496104_0420465 3300048907 Bacteria 1248
773 Ga0496104_0949496 3300048907 Bacteria 764
774 Ga0496105_0002977 3300048908 Bacteria 12447
775 Ga0496105_0008104 3300048908 Bacteria 8169
776 Ga0496105_0026004 3300048908 Bacteria 4770
777 Ga0496105_0066590 3300048908 Bacteria 2974
778 Ga0496105_0540614 3300048908 Bacteria 910
779 Ga0496105_0575369 3300048908 Bacteria 877
780 Ga0496105_1075531 3300048908 Bacteria 598
781 Ga0496106_0012098 3300048909 Bacteria 6368
782 Ga0496106_0127162 3300048909 Bacteria 1996
783 Ga0496106_0265348 3300048909 Bacteria 1374
784 Ga0496106_0612959 3300048909 Bacteria 871
785 Ga0496106_0709396 3300048909 Bacteria 801
786 Ga0496106_0776200 3300048909 Bacteria 761
787 Ga0496106_1063525 3300048909 Unclassified 635
788 Ga0496107_0006099 3300048910 Bacteria 8281
789 Ga0496107_0021698 3300048910 Bacteria 4537
790 Ga0496107_0086348 3300048910 Bacteria 2290
791 Ga0496107_0123295 3300048910 Bacteria 1909
792 Ga0496107_0247076 3300048910 Unclassified 1328
793 Ga0496107_0551706 3300048910 Bacteria 853
794 Ga0496107_0648666 3300048910 Bacteria 778
795 Ga0496108_0019950 3300048911 Bacteria 5505
796 Ga0496108_0063050 3300048911 Bacteria 3121
797 Ga0496108_0563048 3300048911 Bacteria 994
798 Ga0496108_1004203 3300048911 Bacteria 712
799 Ga0496109_0008605 3300048912 Bacteria 8687
800 Ga0496109_0027881 3300048912 Bacteria 5047
801 Ga0496109_0428340 3300048912 Bacteria 1250
802 Ga0496109_0813664 3300048912 Bacteria 872
803 Ga0496109_1333195 3300048912 Bacteria 653
804 Ga0496110_0002261 3300048913 Bacteria 14390
805 Ga0496110_0003921 3300048913 Bacteria 11446
806 Ga0496110_0126092 3300048913 Bacteria 2310
807 Ga0496110_1047074 3300048913 Bacteria 724
808 Ga0496110_1213158 3300048913 Unclassified 663
809 Ga0496111_0004014 3300048914 Bacteria 9239
810 Ga0496111_0004077 3300048914 Bacteria 9174
811 Ga0496111_0089764 3300048914 Bacteria 2251
812 Ga0496111_0502209 3300048914 Bacteria 893
813 Ga0496112_0036941 3300048915 Bacteria 4767
814 Ga0496112_0046394 3300048915 Bacteria 4261
815 Ga0496112_0375293 3300048915 Bacteria 1363
816 Ga0496112_0484273 3300048915 Bacteria 1173
817 Ga0496112_0713205 3300048915 Bacteria 931
818 Ga0496112_1356435 3300048915 Bacteria 626
819 Ga0496113_0000346 3300048916 Bacteria 22110
820 Ga0496113_0006351 3300048916 Bacteria 7478
821 Ga0496113_0050632 3300048916 Bacteria 3097
822 Ga0496113_0103365 3300048916 Bacteria 2210
823 Ga0496113_0126973 3300048916 Bacteria 1998
824 Ga0496113_0773037 3300048916 Bacteria 764
825 Ga0496114_0072608 3300048917 Bacteria 2894
826 Ga0496114_0102828 3300048917 Bacteria 2441
827 Ga0496114_0123532 3300048917 Bacteria 2229
828 Ga0496114_0347187 3300048917 Bacteria 1312
829 Ga0496114_0378997 3300048917 Bacteria 1252
830 Ga0496114_0605939 3300048917 Unclassified 965
831 Ga0496114_1069565 3300048917 Bacteria 691
832 Ga0496115_0008562 3300048918 Bacteria 7574
833 Ga0496115_0076075 3300048918 Bacteria 2728
834 Ga0496115_0178383 3300048918 Bacteria 1756
835 Ga0496115_0235598 3300048918 Bacteria 1509
836 Ga0496115_0606708 3300048918 Bacteria 870
837 Ga0496115_0649385 3300048918 Bacteria 834
838 Ga0501034_0141036 3300049571 Bacteria 2389
839 Ga0501034_0203796 3300049571 Bacteria 1935
840 Ga0501046_0410639 3300049580 Bacteria 977
841 Ga0501047_0038554 3300049581 Bacteria 4623
842 Ga0501047_0245662 3300049581 Bacteria 1639
843 Ga0501047_0547734 3300049581 Bacteria 981
844 Ga0501067_0003180 3300049583 Bacteria 9064
845 Ga0501067_0084376 3300049583 Bacteria 1762
846 Ga0501067_0546618 3300049583 Bacteria 648
847 Ga0501067_0657488 3300049583 Unclassified 588
848 Ga0501068_0075511 3300049584 Bacteria 2062
849 Ga0501069_0008869 3300049585 Bacteria 5301
850 Ga0501069_0306865 3300049585 Bacteria 931
851 Ga0501069_0323748 3300049585 Bacteria 906
852 Ga0501070_0017966 3300049586 Bacteria 5936
853 Ga0501070_0259444 3300049586 Bacteria 1421
854 Ga0501070_0402268 3300049586 Bacteria 1107
855 Ga0501072_0007341 3300049588 Bacteria 8360
856 Ga0501073_0097117 3300049589 Bacteria 2046
857 Ga0501074_0299801 3300049590 Bacteria 1141
858 Ga0501079_0177313 3300049741 Bacteria 1662
859 Ga0501080_0005292 3300049742 Bacteria 11491
860 Ga0501080_0147180 3300049742 Bacteria 2177
861 Ga0501080_0208549 3300049742 Bacteria 1791
862 Ga0501080_1149996 3300049742 Bacteria 669
863 Ga0501083_0000319 3300049744 Bacteria 30507
864 Ga0501044_0171108 3300049823 Bacteria 2144
865 Ga0501044_1062408 3300049823 Bacteria 680
866 nmdc:mga05p37_761467_c1 3300050507 Bacteria 1066
867 nmdc:mga05p37_98452_c1 3300050507 Bacteria 3602
868 nmdc:mga09592_158300_c1 3300050508 Bacteria 1955
869 nmdc:mga06r32_480382_c1 3300050510 Bacteria 1221
870 nmdc:mga08y16_311019_c1 3300050511 Bacteria 1623
871 nmdc:mga0n895_508543_c1 3300050512 Unclassified 1213
872 nmdc:mga0n895_82527_c1 3300050512 Bacteria 3205
873 nmdc:mga0rr50_52393_c1 3300050513 Bacteria 3033
874 nmdc:mga08x19_21068_c1 3300050514 Bacteria 4021
875 nmdc:mga08x19_276428_c1 3300050514 Bacteria 1163
876 nmdc:mga0a205_1282466_c1 3300050515 Bacteria 580
877 nmdc:mga0a205_156435_c1 3300050515 Bacteria 2178
878 nmdc:mga0a205_189614_c1 3300050515 Bacteria 1949
879 Ga0495601_0132143 3300053077 Bacteria 1626
880 Ga0495601_0230638 3300053077 Bacteria 1209
881 Ga0495601_0448397 3300053077 Unclassified 835
882 Ga0495595_0090235 3300053084 Bacteria 1469
883 Ga0495619_1085232 3300053085 Unclassified 533
884 Ga0501084_0624802 3300054114 Unclassified 910
885 Ga0587079_219935 3300059647 Bacteria 527
886 Ga0466962_0000661 3300061719 Bacteria 15283
887 Ga0466962_0007279 3300061719 Bacteria 5305
888 Ga0530510_0105987 3300061734 Bacteria 2057
889 Ga0207705_10310361
890 JGI24747J21853_1006910
891 Ga0070658_10214997
892 Ga0070658_11505640
893 Ga0070676_10064194
894 Ga0070683_100096654
895 Ga0070683_100245581
896 Ga0070683_100868727
897 Ga0070690_100087734
898 Ga0070690_100244039
899 Ga0070690_100727309
900 Ga0070677_10237783
901 Ga0068869_101448719
902 Ga0068869_102011293
903 Ga0070680_100158864
904 Ga0070680_100437331
905 Ga0070680_100492302
906 Ga0070680_100553461
907 Ga0070682_100079003
908 Ga0070682_100674747
909 Ga0070682_100685957
910 Ga0068868_100115192
911 Ga0070660_100034617
912 Ga0070660_101331948
913 Ga0070689_100800757
914 Ga0070691_10029015
915 Ga0070691_10045164
916 Ga0070687_100328147
917 Ga0070661_100237313
918 Ga0070661_100481706
919 Ga0070661_100604296
920 Ga0070692_10262680
921 Ga0070668_100008900
922 Ga0070669_100708097
923 Ga0070671_100036444
924 Ga0070671_100270080
925 Ga0070674_100054194
926 Ga0070673_100890805
927 Ga0070673_101466109
928 Ga0070688_100208855
929 Ga0070659_100167627
930 Ga0070659_100227894
931 Ga0070659_100495673
932 Ga0070709_10108314
933 Ga0070709_10119745
934 Ga0070709_10340368
935 Ga0070709_10496036
936 Ga0070714_100019301
937 Ga0070714_100330749
938 Ga0070714_100787181
939 Ga0070714_101242233
940 Ga0070714_101441249
941 Ga0070713_100097441
942 Ga0070713_100202706
943 Ga0070713_100285468
944 Ga0070713_100423921
945 Ga0070713_101411837
946 Ga0070713_102437997
947 Ga0070710_10024705
948 Ga0070710_10414210
949 Ga0070701_10158099
950 Ga0070711_100089862
951 Ga0070711_100228315
952 Ga0070711_100319098
953 Ga0070711_100669251
954 Ga0070711_101269094
955 Ga0070705_100156183
956 Ga0070705_100875318
957 Ga0070705_100974375
958 Ga0070700_100196922
959 Ga0070694_100059196
960 Ga0070694_100328708
961 Ga0070708_100754521
962 Ga0070708_102140812
963 Ga0070663_100635999
964 Ga0070678_100239721
965 Ga0070678_100325492
966 Ga0070678_100781822
967 Ga0070678_102390172
968 Ga0070662_100008721
969 Ga0070662_100237158
970 Ga0070681_10027461
971 Ga0070681_10077887
972 Ga0070681_10229331
973 Ga0068867_100054467
974 Ga0068867_100189901
975 Ga0070707_100000967
976 Ga0070707_100134608
977 Ga0070707_100403499
978 Ga0070698_100610216
979 Ga0070698_100694159
980 Ga0070698_101981704
981 Ga0070699_101739811
982 Ga0070679_100006446
983 Ga0070679_101091185
984 Ga0070684_100040658
985 Ga0070684_100458323
986 Ga0070684_101196991
987 Ga0070684_101340286
988 Ga0070684_101565328
989 Ga0068853_100422032
990 Ga0070686_100112133
991 Ga0070686_100142743
992 Ga0070686_100297652
993 Ga0070695_100000009
994 Ga0070695_100141563
995 Ga0070695_100543623
996 Ga0070695_100584542
997 Ga0070696_100212780
998 Ga0070693_100003302
999 Ga0070693_100069549
1000 Ga0070693_100413061
1001 Ga0070693_100528831
1002 Ga0070704_100012668
1003 Ga0070704_100283519
1004 Ga0070704_101454039
1005 Ga0070704_101946505
1006 Ga0068855_100032708
1007 Ga0068855_100082269
1008 Ga0068855_100303528
1009 Ga0070664_100996173
1010 Ga0070664_101154495
1011 Ga0068857_100257582
1012 Ga0068854_100341191
1013 Ga0068854_100824455
1014 Ga0068854_100850445
1015 Ga0068856_100097876
1016 Ga0068856_100437262
1017 Ga0068856_100532957
1018 Ga0068856_100723351
1019 Ga0070702_100301540
1020 Ga0070702_100566861
1021 Ga0070702_100766208
1022 Ga0068852_101310903
1023 Ga0068852_102590928
1024 Ga0068859_101824474
1025 Ga0068864_102292695
1026 Ga0068866_10100190
1027 Ga0068866_10290382
1028 Ga0068861_100029766
1029 Ga0068870_10333177
1030 Ga0068870_10393666
1031 Ga0068870_10616755
1032 Ga0068858_101441321
1033 Ga0068860_100203149
1034 Ga0068860_101336447
1035 Ga0081455_10049608
1036 Ga0081455_10226310
1037 Ga0081540_1002206
1038 Ga0081540_1004965
1039 Ga0081540_1019109
1040 Ga0070717_10049690
1041 Ga0070717_10349183
1042 Ga0070717_10881246
1043 Ga0070717_11267049
1044 Ga0070717_11639233
1045 Ga0075432_10020216
1046 Ga0070715_10035033
1047 Ga0070715_10077106
1048 Ga0070716_100006144
1049 Ga0070712_100004553
1050 Ga0070712_100076280
1051 Ga0070712_100280096
1052 Ga0070712_100398231
1053 Ga0070712_100780616
1054 Ga0070712_100951634
1055 Ga0097621_100006460
1056 Ga0097621_100383618
1057 Ga0068871_100050403
1058 Ga0068871_100207648
1059 Ga0068871_101423430
1060 Ga0075428_100083136
1061 Ga0075431_100387039
1062 Ga0075431_101578009
1063 Ga0075433_10293640
1064 Ga0075433_11185935
1065 Ga0075434_100732293
1066 Ga0075434_101700409
1067 Ga0068865_100100953
1068 Ga0068865_100685292
1069 Ga0075436_100013277
1070 Ga0097620_101824343
1071 Ga0075435_101179798
1072 Ga0105240_10355411
1073 Ga0105240_10476997
1074 Ga0105240_10610132
1075 Ga0105240_11242895
1076 Ga0105240_12240362
1077 Ga0111539_10410005
1078 Ga0105245_10013780
1079 Ga0105245_10026118
1080 Ga0105245_10518679
1081 Ga0105245_10693134
1082 Ga0105245_11495577
1083 Ga0105247_11185946
1084 Ga0114129_10127217
1085 Ga0114129_10646867
1086 Ga0105243_10073149
1087 Ga0105243_10919750
1088 Ga0105241_10115929
1089 Ga0105241_10123497
1090 Ga0105242_10034248
1091 Ga0105242_11025086
1092 Ga0105248_11455954
1093 Ga0105248_11902870
1094 Ga0105238_11929748
1095 Ga0105249_10036463
1096 Ga0105249_11263099
1097 Ga0105249_11401905
1098 Ga0105239_10288743
1099 Ga0105239_11502672
1100 Ga0105239_13186436
1101 Ga0105239_13336546
1102 Ga0105246_11325773
1103 Ga0157320_1005704
1104 Ga0157335_1017402
1105 Ga0157326_1010442
1106 Ga0157338_1014109
1107 Ga0157370_10824133
1108 Ga0157370_11536358
1109 Ga0157370_11661908
1110 Ga0157369_10133899
1111 Ga0157369_10420997
1112 Ga0157369_10739500
1113 Ga0157369_11602354
1114 Ga0157374_11599158
1115 Ga0157378_10372589
1116 Ga0157378_10591455
1117 Ga0157378_11047068
1118 Ga0163162_10148770
1119 Ga0163162_10418116
1120 Ga0157372_10598071
1121 Ga0157372_10930138
1122 Ga0157372_11066462
1123 Ga0157372_11666247
1124 Ga0157372_12677178
1125 Ga0157372_12830914
1126 Ga0157375_12933610
1127 Ga0163163_10566358
1128 Ga0157380_10858141
1129 Ga0157380_10874668
1130 Ga0157380_12056882
1131 Ga0182008_10001169
1132 Ga0182008_10119715
1133 Ga0182008_10168623
1134 Ga0182008_10341121
1135 Ga0182008_10712614
1136 Ga0157377_10197782
1137 Ga0157379_11262358
1138 Ga0157376_10569500
1139 Ga0157376_10590546
1140 Ga0182006_1022982
1141 Ga0182007_10001522
1142 Ga0163161_10063249
1143 Ga0163161_10770946
1144 Ga0163161_11330915
1145 Ga0206356_10046714
1146 Ga0206356_10965810
1147 Ga0206356_11478238
1148 Ga0206353_11369135
1149 Ga0206353_12063587
1150 Ga0213874_10276159
1151 Ga0213876_10005302
1152 Ga0213876_10028074
1153 Ga0213875_10038452
1154 Ga0224712_10313497
1155 Ga0207682_10293859
1156 Ga0207682_10320831
1157 Ga0207692_10065988
1158 Ga0207692_11054955
1159 Ga0207642_10186144
1160 Ga0207688_10063170
1161 Ga0207647_10332625
1162 Ga0207685_10020349
1163 Ga0207699_10984660
1164 Ga0207645_10066177
1165 Ga0207705_10637834
1166 Ga0207705_11195903
1167 Ga0207654_10609118
1168 Ga0207707_10049188
1169 Ga0207707_10181967
1170 Ga0207707_10527304
1171 Ga0207707_10653453
1172 Ga0207695_10074697
1173 Ga0207695_10128005
1174 Ga0207695_10417182
1175 Ga0207695_11277298
1176 Ga0207693_10002091
1177 Ga0207693_10007849
1178 Ga0207693_10183540
1179 Ga0207693_10507060
1180 Ga0207693_10788172
1181 Ga0207663_10116855
1182 Ga0207663_10245785
1183 Ga0207660_10170917
1184 Ga0207660_10356550
1185 Ga0207660_10606465
1186 Ga0207660_10955576
1187 Ga0207662_10130970
1188 Ga0207657_10359135
1189 Ga0207657_10449252
1190 Ga0207657_11141354
1191 Ga0207649_10759244
1192 Ga0207652_10219888
1193 Ga0207652_10367007
1194 Ga0207652_11612064
1195 Ga0207646_10000523
1196 Ga0207646_10318001
1197 Ga0207646_11231577
1198 Ga0207681_10018104
1199 Ga0207687_10101930
1200 Ga0207687_10743455
1201 Ga0207687_10854308
1202 Ga0207700_10128074
1203 Ga0207700_10184237
1204 Ga0207700_10282486
1205 Ga0207700_10885651
1206 Ga0207664_10142470
1207 Ga0207664_10461442
1208 Ga0207664_10548951
1209 Ga0207664_11219602
1210 Ga0207644_10142480
1211 Ga0207644_10179265
1212 Ga0207644_10649900
1213 Ga0207690_10748113
1214 Ga0207706_10010184
1215 Ga0207706_10022429
1216 Ga0207686_11106383
1217 Ga0207686_11341484
1218 Ga0207709_10076211
1219 Ga0207709_10299165
1220 Ga0207709_10691095
1221 Ga0207670_11689852
1222 Ga0207669_10443420
1223 Ga0207669_11170438
1224 Ga0207704_10697646
1225 Ga0207665_10070562
1226 Ga0207665_10270465
1227 Ga0207665_10485910
1228 Ga0207665_11353103
1229 Ga0207691_10483206
1230 Ga0207691_10981706
1231 Ga0207711_11269610
1232 Ga0207689_10352300
1233 Ga0207689_10979129
1234 Ga0207661_10401928
1235 Ga0207661_12075005
1236 Ga0207667_10081446
1237 Ga0207667_10133805
1238 Ga0207667_11080268
1239 Ga0207651_10909356
1240 Ga0207712_10036215
1241 Ga0207712_10059963
1242 Ga0207668_10006182
1243 Ga0207668_10156377
1244 Ga0207640_10332213
1245 Ga0207640_12091273
1246 Ga0207640_12150726
1247 Ga0207658_10232325
1248 Ga0207677_10200562
1249 Ga0207639_10859284
1250 Ga0207639_11614805
1251 Ga0207678_10286798
1252 Ga0207678_10734082
1253 Ga0207678_10819604
1254 Ga0207708_10116305
1255 Ga0207702_10089121
1256 Ga0207702_11833783
1257 Ga0207648_10021873
1258 Ga0207648_10271840
1259 Ga0207676_12218869
1260 Ga0207674_10815924
1261 Ga0207675_100002763
1262 Ga0207675_100043272
1263 Ga0207683_10003820
1264 Ga0207683_10126854
1265 Ga0207683_10261572
1266 Ga0207698_10639715
1267 Ga0207428_10001749
1268 Ga0268265_12330138
1269 Ga0268264_10301904
1270 Ga0268264_11082515
1271 Ga0265319_1253164
1272 Ga0265334_10057519
1273 Ga0265318_10312988
1274 Ga0265322_10004957
1275 Ga0265338_10016797
1276 Ga0265338_10333043
1277 Ga0265332_10075196
1278 Ga0265320_10069464
1279 Ga0265325_10009897
1280 Ga0265340_10048790
1281 Ga0265340_10298514
1282 Ga0265339_10043531
1283 Ga0265331_10101001
1284 Ga0265327_10003899
1285 Ga0265316_10004010
1286 Ga0265313_10004245
1287 Ga0265314_10010034
1288 Ga0265342_10302641
1289 Ga0307412_10926851
1290 Ga0307409_102874281
1291 Ga0307416_100161639
1292 Ga0307416_100222961
1293 Ga0307411_10957721
1294 Ga0307415_100210936
1295 Ga0373950_0075882
1296 Ga0373959_0135283
1297 Ga0373929_0037565
1298 Ga0373940_0017271
1299 Ga0373944_0025477
1300 Ga0373944_0085325
1301 Ga0373932_0150808
1302 Ga0373936_0122021
1303 Ga0373941_0286350
1304 Ga0373945_0015131
1305 Ga0373953_0377228
1306 Ga0373956_0063617
1307 Ga0373956_0319531
1308 Ga0373956_0496352
1309 Ga0373957_0091442
1310 Ga0373960_0020482
1311 Ga0373960_0104494
1312 Ga0373943_0012237
1313 Ga0373943_0244534
1314 Ga0373943_0410276
1315 Ga0373946_0162870
1316 Ga0373946_0613394
1317 Ga0373946_0681011
1318 Ga0373955_0354823
1319 Ga0373942_0022656
1320 Ga0373942_0116200
1321 Ga0373961_0011219
1322 Ga0373961_0136555
1323 Ga0373962_0078265
1324 Ga0373924_0040038
1325 Ga0373924_0132210
1326 Ga0373924_0302778
1327 Ga0373931_0119213
1328 Ga0373931_0275425
1329 Ga0373935_0012688
1330 Ga0373935_0487032
1331 Ga0373933_0189374
1332 Ga0373947_0000770
1333 Ga0373947_0117301
1334 Ga0373947_0644671
1335 Ga0373947_0776078
1336 Ga0373937_0246279
1337 Ga0373937_1321019
1338 Ga0373925_0010352
1339 Ga0373925_1507147
1340 Ga0395899_0058245
1341 Ga0395899_0153479
1342 Ga0395899_0201751
1343 Ga0395900_0002122
1344 Ga0395900_0116281
1345 Ga0395900_0117438
1346 Ga0395900_0231295
1347 Ga0395900_1037516
1348 Ga0395900_1907004
1349 Ga0395898_0002136
1350 Ga0395898_0002238
1351 Ga0395898_0002255
1352 Ga0395898_0555735
1353 Ga0395898_0580892
1354 Ga0395898_0643479
1355 Ga0395905_0001065
1356 Ga0395905_0037126
1357 Ga0395905_0160047
1358 Ga0395905_0279215
1359 Ga0395905_0342275
1360 Ga0395905_1870246
1361 Ga0436364_1051529
1362 Ga0436364_1273932
1363 Ga0395901_0001460
1364 Ga0395901_0035317
1365 Ga0395901_0046527
1366 Ga0395901_0227484
1367 Ga0395901_0249917
1368 Ga0395901_0518386
1369 Ga0395901_0625265
1370 Ga0395901_0736963
1371 Ga0395901_1826107
1372 Ga0242420_008053
1373 Ga0436365_0121270
1374 Ga0436365_0273214
1375 Ga0436363_0200906
1376 Ga0436363_1222508
1377 Ga0436363_1712560
1378 Ga0436362_0095914
1379 Ga0439461_0001353
1380 Ga0439466_0041059
1381 Ga0451793_1370022
1382 Ga0451798_0027903
1383 Ga0451800_0747455
1384 Ga0451800_1532795
1385 Ga0451835_0166831
1386 Ga0451835_0846564
1387 Ga0451835_0929677
1388 Ga0451847_0010074
1389 Ga0451853_0301340
1390 Ga0451853_0680311
1391 Ga0451853_1808990
1392 Ga0451853_3331639
1393 Ga0439431_0052794
1394 Ga0439448_0007089
1395 Ga0439448_0106857
1396 Ga0439463_109490
1397 Ga0450907_055649
1398 Ga0439446_0018685
1399 Ga0439458_0052133
1400 Ga0439464_0063108
1401 Ga0466969_0027273
1402 Ga0466972_0161594
1403 Ga0466972_0327463
1404 Ga0466965_0013055
1405 Ga0466965_0049575
1406 Ga0466965_0225456
1407 Ga0466966_0044313
1408 Ga0466966_0431375
1409 Ga0466961_0005586
1410 Ga0466961_0024499
1411 Ga0466961_0143729
1412 Ga0466961_0150883
1413 Ga0466961_0932536
1414 Ga0466963_0000482
1415 Ga0466963_0001696
1416 Ga0466963_0002627
1417 Ga0466963_0005909
1418 Ga0466963_0010624
1419 Ga0466963_0019739
1420 Ga0466963_0021423
1421 Ga0466963_0031970
1422 Ga0466963_0032835
1423 Ga0466963_0063913
1424 Ga0466963_0064531
1425 Ga0466963_0102989
1426 Ga0466963_0109960
1427 Ga0466963_0145955
1428 Ga0466963_0241941
1429 Ga0466963_0748485
1430 Ga0466963_1043130
1431 Ga0466963_1293195
1432 Ga0466964_0003414
1433 Ga0466964_0020297
1434 Ga0466964_0028446
1435 Ga0466964_0054369
1436 Ga0466964_0059776
1437 Ga0466964_0095620
1438 Ga0466964_0846665
1439 Ga0466971_0001805
1440 Ga0466971_0004784
1441 Ga0466971_0032012
1442 Ga0466971_0250426
1443 Ga0466968_0008584
1444 Ga0466968_0042076
1445 Ga0466968_0060638
1446 Ga0466970_0065140
1447 Ga0466970_0127942
1448 Ga0466970_0661671
1449 Ga0466957_0005137
1450 Ga0466957_0011744
1451 Ga0466957_0012546
1452 Ga0466957_0013491
1453 Ga0466957_0077694
1454 Ga0466957_0081326
1455 Ga0466957_0110669
1456 Ga0466957_0174778
1457 Ga0466957_0318325
1458 Ga0466957_0831405
1459 Ga0466957_0991743
1460 Ga0466957_1014522
1461 Ga0466960_0002382
1462 Ga0466960_0132182
1463 Ga0466960_0394034
1464 Ga0466959_0006797
1465 Ga0466959_0018649
1466 Ga0466959_0060966
1467 Ga0466959_0080902
1468 Ga0466959_0346746
1469 Ga0451576_0038025
1470 Ga0451576_0666637
1471 Ga0466958_0008945
1472 Ga0466958_0009049
1473 Ga0466958_0016619
1474 Ga0466958_0062518
1475 Ga0466958_0079202
1476 Ga0466958_0101134
1477 Ga0466958_0102677
1478 Ga0466958_0242179
1479 Ga0466958_0279987
1480 Ga0466958_0571334
1481 Ga0466958_0644566
1482 Ga0466958_0841803
1483 Ga0466967_0004099
1484 Ga0466967_0004107
1485 Ga0466967_0005413
1486 Ga0466967_0012096
1487 Ga0466967_0014265
1488 Ga0466967_0017302
1489 Ga0466967_0020252
1490 Ga0466967_0022553
1491 Ga0466967_0029598
1492 Ga0466967_0035194
1493 Ga0466967_0074064
1494 Ga0466967_0079712
1495 Ga0466967_0086218
1496 Ga0466967_0099691
1497 Ga0466967_0116230
1498 Ga0466967_0125915
1499 Ga0466967_0323418
1500 Ga0466967_0360417
1501 Ga0466967_0364602
1502 Ga0466967_0378473
1503 Ga0466967_0453245
1504 Ga0466967_0469006
1505 Ga0466967_0482680
1506 Ga0466967_0936154
1507 Ga0466967_1463707
1508 Ga0466967_1542779
1509 Ga0495592_0114079
1510 Ga0495592_0256156
1511 Ga0495592_0345395
1512 Ga0495603_0001930
1513 Ga0495603_0124722
1514 Ga0495629_0237331
1515 Ga0495629_0278455
1516 Ga0495641_0000786
1517 Ga0495641_0100366
1518 Ga0495641_0131141
1519 Ga0495651_0644355
1520 Ga0495653_0096938
1521 Ga0495653_0409014
1522 Ga0495653_0606428
1523 Ga0495580_0055313
1524 Ga0495582_0010387
1525 Ga0495582_0067084
1526 Ga0495582_0595524
1527 Ga0495605_0227158
1528 Ga0495664_0051708
1529 Ga0495664_0108708
1530 Ga0495664_0169292
1531 Ga0495584_0256072
1532 Ga0495584_0577490
1533 Ga0495585_0369235
1534 Ga0495594_0000915
1535 Ga0495596_0188540
1536 Ga0495596_0226109
1537 Ga0495607_0151633
1538 Ga0495608_0092973
1539 Ga0495608_0123724
1540 Ga0495608_0279230
1541 Ga0495618_0071215
1542 Ga0495628_0085846
1543 Ga0495628_0647580
1544 Ga0495630_0123181
1545 Ga0495630_0210989
1546 Ga0495630_0234103
1547 Ga0495630_0314789
1548 Ga0495644_0280587
1549 Ga0495663_0081448
1550 Ga0495663_0094968
1551 Ga0495666_0219681
1552 Ga0495652_0081495
1553 Ga0495652_0116214
1554 Ga0495665_0227013
1555 Ga0495640_0180087
1556 Ga0495586_0043514
1557 Ga0495587_0044347
1558 Ga0495587_0143362
1559 Ga0495598_0117107
1560 Ga0495609_0140515
1561 Ga0495645_0103084
1562 Ga0495645_0132161
1563 Ga0495645_0193256
1564 Ga0495633_0403859
1565 Ga0495667_0092464
1566 Ga0495667_0155978
1567 Ga0495667_0220125
1568 Ga0495656_0146080
1569 Ga0495668_0840823
1570 Ga0495634_0243979
1571 Ga0495634_0281943
1572 Ga0495634_0389748
1573 Ga0495635_0062124
1574 Ga0495635_0492222
1575 Ga0495588_0000409
1576 Ga0495588_0337224
1577 Ga0495657_0037606
1578 Ga0495657_0041833
1579 Ga0495657_0111758
1580 Ga0495599_0197172
1581 Ga0495599_0262786
1582 Ga0495623_0145720
1583 Ga0495623_0315708
1584 Ga0495646_0069904
1585 Ga0495646_0184746
1586 Ga0495646_0243112
1587 Ga0495647_0342795
1588 Ga0495658_0259714
1589 Ga0495658_0427233
1590 Ga0495658_0463872
1591 Ga0495658_0657365
1592 Ga0495669_0332549
1593 Ga0495613_0127540
1594 Ga0495613_0514952
1595 Ga0495624_0073114
1596 Ga0495624_0534026
1597 Ga0495671_0237456
1598 Ga0495589_0171618
1599 Ga0495589_0301721
1600 Ga0495600_0113701
1601 Ga0495581_0283797
1602 Ga0495604_0134778
1603 Ga0495604_0189034
1604 Ga0495604_0439752
1605 Ga0495636_0280623
1606 Ga0495674_0009149
1607 Ga0495674_0366446
1608 Ga0495676_0002605
1609 Ga0495676_0343465
1610 Ga0495676_0776768
1611 Ga0495680_0035962
1612 Ga0495680_0090783
1613 Ga0495680_0300605
1614 Ga0495675_0109435
1615 Ga0495675_0152363
1616 Ga0495675_0383214
1617 Ga0495677_0101844
1618 Ga0495679_140961
1619 Ga0495685_130002
1620 Ga0495684_0139049
1621 Ga0495684_0231196
1622 Ga0495684_0761143
1623 Ga0495593_0391779
1624 Ga0495602_0107144
1625 Ga0495602_0273527
1626 Ga0495602_0441664
1627 Ga0495602_0676779
1628 Ga0495614_0400067
1629 Ga0495615_0133843
1630 Ga0495626_0276658
1631 Ga0496100_0105848
1632 Ga0496100_0148417
1633 Ga0496100_0474573
1634 Ga0496100_0544531
1635 Ga0496100_0553661
1636 Ga0496101_0002385
1637 Ga0496101_0031469
1638 Ga0496101_0069766
1639 Ga0496101_0136326
1640 Ga0496101_0161836
1641 Ga0496101_0319198
1642 Ga0496101_0592054
1643 Ga0496102_0027799
1644 Ga0496102_0047206
1645 Ga0496102_0225608
1646 Ga0496102_0434203
1647 Ga0496102_0484384
1648 Ga0496102_0490579
1649 Ga0496102_0656975
1650 Ga0496102_0722089
1651 Ga0496103_0004252
1652 Ga0496103_0064727
1653 Ga0496103_0105344
1654 Ga0496103_0178071
1655 Ga0496103_0207904
1656 Ga0496103_0969970
1657 Ga0496104_0003324
1658 Ga0496104_0051079
1659 Ga0496104_0225497
1660 Ga0496104_0420465
1661 Ga0496104_0949496
1662 Ga0496105_0002977
1663 Ga0496105_0008104
1664 Ga0496105_0026004
1665 Ga0496105_0066590
1666 Ga0496105_0540614
1667 Ga0496105_0575369
1668 Ga0496105_1075531
1669 Ga0496106_0012098
1670 Ga0496106_0127162
1671 Ga0496106_0265348
1672 Ga0496106_0612959
1673 Ga0496106_0709396
1674 Ga0496106_0776200
1675 Ga0496106_1063525
1676 Ga0496107_0006099
1677 Ga0496107_0021698
1678 Ga0496107_0086348
1679 Ga0496107_0123295
1680 Ga0496107_0247076
1681 Ga0496107_0551706
1682 Ga0496107_0648666
1683 Ga0496108_0019950
1684 Ga0496108_0063050
1685 Ga0496108_0563048
1686 Ga0496108_1004203
1687 Ga0496109_0008605
1688 Ga0496109_0027881
1689 Ga0496109_0428340
1690 Ga0496109_0813664
1691 Ga0496109_1333195
1692 Ga0496110_0002261
1693 Ga0496110_0003921
1694 Ga0496110_0126092
1695 Ga0496110_1047074
1696 Ga0496110_1213158
1697 Ga0496111_0004014
1698 Ga0496111_0004077
1699 Ga0496111_0089764
1700 Ga0496111_0502209
1701 Ga0496112_0036941
1702 Ga0496112_0046394
1703 Ga0496112_0375293
1704 Ga0496112_0484273
1705 Ga0496112_0713205
1706 Ga0496112_1356435
1707 Ga0496113_0000346
1708 Ga0496113_0006351
1709 Ga0496113_0050632
1710 Ga0496113_0103365
1711 Ga0496113_0126973
1712 Ga0496113_0773037
1713 Ga0496114_0072608
1714 Ga0496114_0102828
1715 Ga0496114_0123532
1716 Ga0496114_0347187
1717 Ga0496114_0378997
1718 Ga0496114_0605939
1719 Ga0496114_1069565
1720 Ga0496115_0008562
1721 Ga0496115_0076075
1722 Ga0496115_0178383
1723 Ga0496115_0235598
1724 Ga0496115_0606708
1725 Ga0496115_0649385
1726 Ga0501034_0141036
1727 Ga0501034_0203796
1728 Ga0501046_0410639
1729 Ga0501047_0038554
1730 Ga0501047_0245662
1731 Ga0501047_0547734
1732 Ga0501067_0003180
1733 Ga0501067_0084376
1734 Ga0501067_0546618
1735 Ga0501067_0657488
1736 Ga0501068_0075511
1737 Ga0501069_0008869
1738 Ga0501069_0306865
1739 Ga0501069_0323748
1740 Ga0501070_0017966
1741 Ga0501070_0259444
1742 Ga0501070_0402268
1743 Ga0501072_0007341
1744 Ga0501073_0097117
1745 Ga0501074_0299801
1746 Ga0501079_0177313
1747 Ga0501080_0005292
1748 Ga0501080_0147180
1749 Ga0501080_0208549
1750 Ga0501080_1149996
1751 Ga0501083_0000319
1752 Ga0501044_0171108
1753 Ga0501044_1062408
1754 nmdc:mga05p37_761467_c1
1755 nmdc:mga05p37_98452_c1
1756 nmdc:mga09592_158300_c1
1757 nmdc:mga06r32_480382_c1
1758 nmdc:mga08y16_311019_c1
1759 nmdc:mga0n895_508543_c1
1760 nmdc:mga0n895_82527_c1
1761 nmdc:mga0rr50_52393_c1
1762 nmdc:mga08x19_21068_c1
1763 nmdc:mga08x19_276428_c1
1764 nmdc:mga0a205_1282466_c1
1765 nmdc:mga0a205_156435_c1
1766 nmdc:mga0a205_189614_c1
1767 Ga0495601_0132143
1768 Ga0495601_0230638
1769 Ga0495601_0448397
1770 Ga0495595_0090235
1771 Ga0495619_1085232
1772 Ga0501084_0624802
1773 Ga0587079_219935
1774 Ga0466962_0000661
1775 Ga0466962_0007279
1776 Ga0530510_0105987

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.9234 31 106
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.9078 29 106
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.894 31 108
5fpz-assembly1.cif.gz_A-2 the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. 0.8936 20 109
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.891 31 106
ID Description Score Start End Superfamily
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9173 32 109 2.60.120.10
2h0vB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9139 32 106 2.60.120.10
3cewA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9066 19 115 2.60.120.10
5wxuB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9 31 108 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8999 29 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538MVR0-F1-model_v4 Cupin domain-containing protein 0.9943 1 118
AF-A0A538CV03-F1-model_v4 Cupin domain-containing protein 0.9884 1 98
AF-A0A538MVR0-F1-model_v4 Cupin domain-containing protein 0.986 1 118
AF-A0A538KJQ7-F1-model_v4 Cupin domain-containing protein 0.9853 1 118
AF-A0A538CV03-F1-model_v4 Cupin domain-containing protein 0.9785 1 98

Map