F484760
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 888 | 374 | 1776 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300025909|Ga0207705_10310361|Ga0207705_103103613 |
| Length | 123 |
| Sequence | MVEAGMAYTVIHLDEIEGSGPGGAVKFVRRELGCEAFGINWFDLPPNAEGFEHSESESQQEEVNVIVRGSGVYRVEGEEIPFTAGSVFRFDPETTRQPVAGPDGFSMVAVGARRGSYEPRGPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 96 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 97 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 98 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 235 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 236 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 240 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 241 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 242 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 243 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 244 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 245 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 246 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 247 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 248 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 256 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 257 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 258 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 261 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 262 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 374 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.79 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.15 |
| Rhizosphere | 86.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207705_10310361 | 3300025909 | Bacteria | 1211 |
| 2 | JGI24747J21853_1006910 | 3300001978 | Bacteria | 1083 |
| 3 | Ga0070658_10214997 | 3300005327 | Bacteria | 1625 |
| 4 | Ga0070658_11505640 | 3300005327 | Bacteria | 583 |
| 5 | Ga0070676_10064194 | 3300005328 | Bacteria | 2189 |
| 6 | Ga0070683_100096654 | 3300005329 | Bacteria | 2778 |
| 7 | Ga0070683_100245581 | 3300005329 | Bacteria | 1703 |
| 8 | Ga0070683_100868727 | 3300005329 | Bacteria | 865 |
| 9 | Ga0070690_100087734 | 3300005330 | Bacteria | 2044 |
| 10 | Ga0070690_100244039 | 3300005330 | Bacteria | 1268 |
| 11 | Ga0070690_100727309 | 3300005330 | Bacteria | 764 |
| 12 | Ga0070677_10237783 | 3300005333 | Bacteria | 898 |
| 13 | Ga0068869_101448719 | 3300005334 | Bacteria | 609 |
| 14 | Ga0068869_102011293 | 3300005334 | Bacteria | 519 |
| 15 | Ga0070680_100158864 | 3300005336 | Bacteria | 1899 |
| 16 | Ga0070680_100437331 | 3300005336 | Bacteria | 1117 |
| 17 | Ga0070680_100492302 | 3300005336 | Bacteria | 1049 |
| 18 | Ga0070680_100553461 | 3300005336 | Unclassified | 986 |
| 19 | Ga0070682_100079003 | 3300005337 | Bacteria | 2124 |
| 20 | Ga0070682_100674747 | 3300005337 | Bacteria | 825 |
| 21 | Ga0070682_100685957 | 3300005337 | Bacteria | 820 |
| 22 | Ga0068868_100115192 | 3300005338 | Bacteria | 2188 |
| 23 | Ga0070660_100034617 | 3300005339 | Bacteria | 3817 |
| 24 | Ga0070660_101331948 | 3300005339 | Bacteria | 609 |
| 25 | Ga0070689_100800757 | 3300005340 | Bacteria | 829 |
| 26 | Ga0070691_10029015 | 3300005341 | Bacteria | 2587 |
| 27 | Ga0070691_10045164 | 3300005341 | Bacteria | 2090 |
| 28 | Ga0070687_100328147 | 3300005343 | Bacteria | 980 |
| 29 | Ga0070661_100237313 | 3300005344 | Bacteria | 1403 |
| 30 | Ga0070661_100481706 | 3300005344 | Bacteria | 991 |
| 31 | Ga0070661_100604296 | 3300005344 | Bacteria | 887 |
| 32 | Ga0070692_10262680 | 3300005345 | Bacteria | 1038 |
| 33 | Ga0070668_100008900 | 3300005347 | Bacteria | 7453 |
| 34 | Ga0070669_100708097 | 3300005353 | Bacteria | 851 |
| 35 | Ga0070671_100036444 | 3300005355 | Bacteria | 4079 |
| 36 | Ga0070671_100270080 | 3300005355 | Bacteria | 1445 |
| 37 | Ga0070674_100054194 | 3300005356 | Bacteria | 2772 |
| 38 | Ga0070673_100890805 | 3300005364 | Bacteria | 825 |
| 39 | Ga0070673_101466109 | 3300005364 | Bacteria | 643 |
| 40 | Ga0070688_100208855 | 3300005365 | Bacteria | 1370 |
| 41 | Ga0070659_100167627 | 3300005366 | Bacteria | 1798 |
| 42 | Ga0070659_100227894 | 3300005366 | Bacteria | 1539 |
| 43 | Ga0070659_100495673 | 3300005366 | Bacteria | 1041 |
| 44 | Ga0070709_10108314 | 3300005434 | Bacteria | 1863 |
| 45 | Ga0070709_10119745 | 3300005434 | Bacteria | 1782 |
| 46 | Ga0070709_10340368 | 3300005434 | Bacteria | 1106 |
| 47 | Ga0070709_10496036 | 3300005434 | Bacteria | 927 |
| 48 | Ga0070714_100019301 | 3300005435 | Bacteria | 5549 |
| 49 | Ga0070714_100330749 | 3300005435 | Bacteria | 1427 |
| 50 | Ga0070714_100787181 | 3300005435 | Bacteria | 920 |
| 51 | Ga0070714_101242233 | 3300005435 | Bacteria | 727 |
| 52 | Ga0070714_101441249 | 3300005435 | Bacteria | 672 |
| 53 | Ga0070713_100097441 | 3300005436 | Bacteria | 2541 |
| 54 | Ga0070713_100202706 | 3300005436 | Bacteria | 1792 |
| 55 | Ga0070713_100285468 | 3300005436 | Bacteria | 1515 |
| 56 | Ga0070713_100423921 | 3300005436 | Bacteria | 1246 |
| 57 | Ga0070713_101411837 | 3300005436 | Bacteria | 675 |
| 58 | Ga0070713_102437997 | 3300005436 | Bacteria | 506 |
| 59 | Ga0070710_10024705 | 3300005437 | Bacteria | 3173 |
| 60 | Ga0070710_10414210 | 3300005437 | Bacteria | 906 |
| 61 | Ga0070701_10158099 | 3300005438 | Bacteria | 1310 |
| 62 | Ga0070711_100089862 | 3300005439 | Bacteria | 2210 |
| 63 | Ga0070711_100228315 | 3300005439 | Bacteria | 1450 |
| 64 | Ga0070711_100319098 | 3300005439 | Bacteria | 1241 |
| 65 | Ga0070711_100669251 | 3300005439 | Bacteria | 872 |
| 66 | Ga0070711_101269094 | 3300005439 | Unclassified | 638 |
| 67 | Ga0070705_100156183 | 3300005440 | Bacteria | 1519 |
| 68 | Ga0070705_100875318 | 3300005440 | Bacteria | 720 |
| 69 | Ga0070705_100974375 | 3300005440 | Bacteria | 687 |
| 70 | Ga0070700_100196922 | 3300005441 | Bacteria | 1413 |
| 71 | Ga0070694_100059196 | 3300005444 | Bacteria | 2608 |
| 72 | Ga0070694_100328708 | 3300005444 | Bacteria | 1179 |
| 73 | Ga0070708_100754521 | 3300005445 | Bacteria | 915 |
| 74 | Ga0070708_102140812 | 3300005445 | Bacteria | 517 |
| 75 | Ga0070663_100635999 | 3300005455 | Bacteria | 901 |
| 76 | Ga0070678_100239721 | 3300005456 | Bacteria | 1516 |
| 77 | Ga0070678_100325492 | 3300005456 | Bacteria | 1314 |
| 78 | Ga0070678_100781822 | 3300005456 | Bacteria | 865 |
| 79 | Ga0070678_102390172 | 3300005456 | Unclassified | 502 |
| 80 | Ga0070662_100008721 | 3300005457 | Bacteria | 6611 |
| 81 | Ga0070662_100237158 | 3300005457 | Bacteria | 1461 |
| 82 | Ga0070681_10027461 | 3300005458 | Bacteria | 5722 |
| 83 | Ga0070681_10077887 | 3300005458 | Bacteria | 3272 |
| 84 | Ga0070681_10229331 | 3300005458 | Bacteria | 1771 |
| 85 | Ga0068867_100054467 | 3300005459 | Bacteria | 2955 |
| 86 | Ga0068867_100189901 | 3300005459 | Bacteria | 1639 |
| 87 | Ga0070707_100000967 | 3300005468 | Bacteria | 28411 |
| 88 | Ga0070707_100134608 | 3300005468 | Bacteria | 2404 |
| 89 | Ga0070707_100403499 | 3300005468 | Bacteria | 1327 |
| 90 | Ga0070698_100610216 | 3300005471 | Bacteria | 1031 |
| 91 | Ga0070698_100694159 | 3300005471 | Bacteria | 960 |
| 92 | Ga0070698_101981704 | 3300005471 | Bacteria | 535 |
| 93 | Ga0070699_101739811 | 3300005518 | Bacteria | 571 |
| 94 | Ga0070679_100006446 | 3300005530 | Bacteria | 10935 |
| 95 | Ga0070679_101091185 | 3300005530 | Bacteria | 743 |
| 96 | Ga0070684_100040658 | 3300005535 | Bacteria | 4005 |
| 97 | Ga0070684_100458323 | 3300005535 | Bacteria | 1179 |
| 98 | Ga0070684_101196991 | 3300005535 | Bacteria | 715 |
| 99 | Ga0070684_101340286 | 3300005535 | Bacteria | 674 |
| 100 | Ga0070684_101565328 | 3300005535 | Bacteria | 621 |
| 101 | Ga0068853_100422032 | 3300005539 | Bacteria | 1251 |
| 102 | Ga0070686_100112133 | 3300005544 | Bacteria | 1860 |
| 103 | Ga0070686_100142743 | 3300005544 | Bacteria | 1668 |
| 104 | Ga0070686_100297652 | 3300005544 | Bacteria | 1196 |
| 105 | Ga0070695_100000009 | 3300005545 | Bacteria | 87710 |
| 106 | Ga0070695_100141563 | 3300005545 | Bacteria | 1668 |
| 107 | Ga0070695_100543623 | 3300005545 | Bacteria | 905 |
| 108 | Ga0070695_100584542 | 3300005545 | Bacteria | 875 |
| 109 | Ga0070696_100212780 | 3300005546 | Bacteria | 1447 |
| 110 | Ga0070693_100003302 | 3300005547 | Bacteria | 7495 |
| 111 | Ga0070693_100069549 | 3300005547 | Bacteria | 2069 |
| 112 | Ga0070693_100413061 | 3300005547 | Bacteria | 938 |
| 113 | Ga0070693_100528831 | 3300005547 | Bacteria | 841 |
| 114 | Ga0070704_100012668 | 3300005549 | Bacteria | 5217 |
| 115 | Ga0070704_100283519 | 3300005549 | Bacteria | 1374 |
| 116 | Ga0070704_101454039 | 3300005549 | Bacteria | 630 |
| 117 | Ga0070704_101946505 | 3300005549 | Bacteria | 545 |
| 118 | Ga0068855_100032708 | 3300005563 | Bacteria | 6210 |
| 119 | Ga0068855_100082269 | 3300005563 | Bacteria | 3731 |
| 120 | Ga0068855_100303528 | 3300005563 | Bacteria | 1767 |
| 121 | Ga0070664_100996173 | 3300005564 | Bacteria | 787 |
| 122 | Ga0070664_101154495 | 3300005564 | Bacteria | 730 |
| 123 | Ga0068857_100257582 | 3300005577 | Bacteria | 1601 |
| 124 | Ga0068854_100341191 | 3300005578 | Bacteria | 1223 |
| 125 | Ga0068854_100824455 | 3300005578 | Bacteria | 810 |
| 126 | Ga0068854_100850445 | 3300005578 | Bacteria | 799 |
| 127 | Ga0068856_100097876 | 3300005614 | Bacteria | 2923 |
| 128 | Ga0068856_100437262 | 3300005614 | Bacteria | 1328 |
| 129 | Ga0068856_100532957 | 3300005614 | Bacteria | 1195 |
| 130 | Ga0068856_100723351 | 3300005614 | Bacteria | 1016 |
| 131 | Ga0070702_100301540 | 3300005615 | Bacteria | 1109 |
| 132 | Ga0070702_100566861 | 3300005615 | Bacteria | 846 |
| 133 | Ga0070702_100766208 | 3300005615 | Bacteria | 743 |
| 134 | Ga0068852_101310903 | 3300005616 | Bacteria | 746 |
| 135 | Ga0068852_102590928 | 3300005616 | Bacteria | 527 |
| 136 | Ga0068859_101824474 | 3300005617 | Bacteria | 672 |
| 137 | Ga0068864_102292695 | 3300005618 | Unclassified | 546 |
| 138 | Ga0068866_10100190 | 3300005718 | Bacteria | 1597 |
| 139 | Ga0068866_10290382 | 3300005718 | Bacteria | 1017 |
| 140 | Ga0068861_100029766 | 3300005719 | Bacteria | 3996 |
| 141 | Ga0068870_10333177 | 3300005840 | Bacteria | 968 |
| 142 | Ga0068870_10393666 | 3300005840 | Bacteria | 900 |
| 143 | Ga0068870_10616755 | 3300005840 | Bacteria | 739 |
| 144 | Ga0068858_101441321 | 3300005842 | Bacteria | 679 |
| 145 | Ga0068860_100203149 | 3300005843 | Bacteria | 1921 |
| 146 | Ga0068860_101336447 | 3300005843 | Bacteria | 738 |
| 147 | Ga0081455_10049608 | 3300005937 | Bacteria | 3617 |
| 148 | Ga0081455_10226310 | 3300005937 | Bacteria | 1383 |
| 149 | Ga0081540_1002206 | 3300005983 | Bacteria | 16084 |
| 150 | Ga0081540_1004965 | 3300005983 | Bacteria | 10004 |
| 151 | Ga0081540_1019109 | 3300005983 | Bacteria | 4179 |
| 152 | Ga0070717_10049690 | 3300006028 | Bacteria | 3444 |
| 153 | Ga0070717_10349183 | 3300006028 | Bacteria | 1322 |
| 154 | Ga0070717_10881246 | 3300006028 | Bacteria | 815 |
| 155 | Ga0070717_11267049 | 3300006028 | Bacteria | 670 |
| 156 | Ga0070717_11639233 | 3300006028 | Bacteria | 583 |
| 157 | Ga0075432_10020216 | 3300006058 | Bacteria | 2276 |
| 158 | Ga0070715_10035033 | 3300006163 | Bacteria | 2062 |
| 159 | Ga0070715_10077106 | 3300006163 | Bacteria | 1503 |
| 160 | Ga0070716_100006144 | 3300006173 | Bacteria | 5861 |
| 161 | Ga0070712_100004553 | 3300006175 | Bacteria | 8561 |
| 162 | Ga0070712_100076280 | 3300006175 | Bacteria | 2413 |
| 163 | Ga0070712_100280096 | 3300006175 | Bacteria | 1343 |
| 164 | Ga0070712_100398231 | 3300006175 | Bacteria | 1136 |
| 165 | Ga0070712_100780616 | 3300006175 | Bacteria | 819 |
| 166 | Ga0070712_100951634 | 3300006175 | Bacteria | 742 |
| 167 | Ga0097621_100006460 | 3300006237 | Bacteria | 8324 |
| 168 | Ga0097621_100383618 | 3300006237 | Bacteria | 1255 |
| 169 | Ga0068871_100050403 | 3300006358 | Bacteria | 3367 |
| 170 | Ga0068871_100207648 | 3300006358 | Bacteria | 1693 |
| 171 | Ga0068871_101423430 | 3300006358 | Bacteria | 654 |
| 172 | Ga0075428_100083136 | 3300006844 | Bacteria | 3493 |
| 173 | Ga0075431_100387039 | 3300006847 | Bacteria | 1401 |
| 174 | Ga0075431_101578009 | 3300006847 | Bacteria | 614 |
| 175 | Ga0075433_10293640 | 3300006852 | Bacteria | 1439 |
| 176 | Ga0075433_11185935 | 3300006852 | Bacteria | 663 |
| 177 | Ga0075434_100732293 | 3300006871 | Unclassified | 1006 |
| 178 | Ga0075434_101700409 | 3300006871 | Bacteria | 639 |
| 179 | Ga0068865_100100953 | 3300006881 | Bacteria | 2112 |
| 180 | Ga0068865_100685292 | 3300006881 | Bacteria | 874 |
| 181 | Ga0075436_100013277 | 3300006914 | Bacteria | 5644 |
| 182 | Ga0097620_101824343 | 3300006931 | Bacteria | 672 |
| 183 | Ga0075435_101179798 | 3300007076 | Bacteria | 670 |
| 184 | Ga0105240_10355411 | 3300009093 | Bacteria | 1661 |
| 185 | Ga0105240_10476997 | 3300009093 | Bacteria | 1391 |
| 186 | Ga0105240_10610132 | 3300009093 | Bacteria | 1200 |
| 187 | Ga0105240_11242895 | 3300009093 | Bacteria | 787 |
| 188 | Ga0105240_12240362 | 3300009093 | Bacteria | 566 |
| 189 | Ga0111539_10410005 | 3300009094 | Bacteria | 1578 |
| 190 | Ga0105245_10013780 | 3300009098 | Bacteria | 7041 |
| 191 | Ga0105245_10026118 | 3300009098 | Bacteria | 5139 |
| 192 | Ga0105245_10518679 | 3300009098 | Bacteria | 1210 |
| 193 | Ga0105245_10693134 | 3300009098 | Bacteria | 1051 |
| 194 | Ga0105245_11495577 | 3300009098 | Bacteria | 726 |
| 195 | Ga0105247_11185946 | 3300009101 | Bacteria | 607 |
| 196 | Ga0114129_10127217 | 3300009147 | Bacteria | 3502 |
| 197 | Ga0114129_10646867 | 3300009147 | Bacteria | 1365 |
| 198 | Ga0105243_10073149 | 3300009148 | Bacteria | 2777 |
| 199 | Ga0105243_10919750 | 3300009148 | Unclassified | 871 |
| 200 | Ga0105241_10115929 | 3300009174 | Bacteria | 2151 |
| 201 | Ga0105241_10123497 | 3300009174 | Bacteria | 2088 |
| 202 | Ga0105242_10034248 | 3300009176 | Bacteria | 4072 |
| 203 | Ga0105242_11025086 | 3300009176 | Bacteria | 835 |
| 204 | Ga0105248_11455954 | 3300009177 | Bacteria | 775 |
| 205 | Ga0105248_11902870 | 3300009177 | Bacteria | 675 |
| 206 | Ga0105238_11929748 | 3300009551 | Bacteria | 624 |
| 207 | Ga0105249_10036463 | 3300009553 | Bacteria | 4461 |
| 208 | Ga0105249_11263099 | 3300009553 | Bacteria | 810 |
| 209 | Ga0105249_11401905 | 3300009553 | Bacteria | 771 |
| 210 | Ga0105239_10288743 | 3300010375 | Bacteria | 1847 |
| 211 | Ga0105239_11502672 | 3300010375 | Bacteria | 778 |
| 212 | Ga0105239_13186436 | 3300010375 | Bacteria | 534 |
| 213 | Ga0105239_13336546 | 3300010375 | Bacteria | 522 |
| 214 | Ga0105246_11325773 | 3300011119 | Bacteria | 668 |
| 215 | Ga0157320_1005704 | 3300012481 | Unclassified | 839 |
| 216 | Ga0157335_1017402 | 3300012492 | Bacteria | 651 |
| 217 | Ga0157326_1010442 | 3300012513 | Bacteria | 1035 |
| 218 | Ga0157338_1014109 | 3300012515 | Bacteria | 856 |
| 219 | Ga0157370_10824133 | 3300013104 | Bacteria | 844 |
| 220 | Ga0157370_11536358 | 3300013104 | Bacteria | 598 |
| 221 | Ga0157370_11661908 | 3300013104 | Bacteria | 573 |
| 222 | Ga0157369_10133899 | 3300013105 | Bacteria | 2625 |
| 223 | Ga0157369_10420997 | 3300013105 | Bacteria | 1384 |
| 224 | Ga0157369_10739500 | 3300013105 | Bacteria | 1012 |
| 225 | Ga0157369_11602354 | 3300013105 | Bacteria | 662 |
| 226 | Ga0157374_11599158 | 3300013296 | Bacteria | 676 |
| 227 | Ga0157378_10372589 | 3300013297 | Bacteria | 1400 |
| 228 | Ga0157378_10591455 | 3300013297 | Bacteria | 1120 |
| 229 | Ga0157378_11047068 | 3300013297 | Bacteria | 852 |
| 230 | Ga0163162_10148770 | 3300013306 | Bacteria | 2459 |
| 231 | Ga0163162_10418116 | 3300013306 | Bacteria | 1473 |
| 232 | Ga0157372_10598071 | 3300013307 | Bacteria | 1286 |
| 233 | Ga0157372_10930138 | 3300013307 | Bacteria | 1008 |
| 234 | Ga0157372_11066462 | 3300013307 | Bacteria | 935 |
| 235 | Ga0157372_11666247 | 3300013307 | Bacteria | 734 |
| 236 | Ga0157372_12677178 | 3300013307 | Bacteria | 572 |
| 237 | Ga0157372_12830914 | 3300013307 | Unclassified | 556 |
| 238 | Ga0157375_12933610 | 3300013308 | Unclassified | 570 |
| 239 | Ga0163163_10566358 | 3300014325 | Bacteria | 1199 |
| 240 | Ga0157380_10858141 | 3300014326 | Bacteria | 930 |
| 241 | Ga0157380_10874668 | 3300014326 | Bacteria | 922 |
| 242 | Ga0157380_12056882 | 3300014326 | Unclassified | 633 |
| 243 | Ga0182008_10001169 | 3300014497 | Bacteria | 18115 |
| 244 | Ga0182008_10119715 | 3300014497 | Bacteria | 1308 |
| 245 | Ga0182008_10168623 | 3300014497 | Bacteria | 1104 |
| 246 | Ga0182008_10341121 | 3300014497 | Bacteria | 792 |
| 247 | Ga0182008_10712614 | 3300014497 | Unclassified | 574 |
| 248 | Ga0157377_10197782 | 3300014745 | Bacteria | 1274 |
| 249 | Ga0157379_11262358 | 3300014968 | Bacteria | 712 |
| 250 | Ga0157376_10569500 | 3300014969 | Bacteria | 1123 |
| 251 | Ga0157376_10590546 | 3300014969 | Bacteria | 1104 |
| 252 | Ga0182006_1022982 | 3300015261 | Bacteria | 2585 |
| 253 | Ga0182007_10001522 | 3300015262 | Bacteria | 12380 |
| 254 | Ga0163161_10063249 | 3300017792 | Bacteria | 2697 |
| 255 | Ga0163161_10770946 | 3300017792 | Bacteria | 806 |
| 256 | Ga0163161_11330915 | 3300017792 | Bacteria | 625 |
| 257 | Ga0206356_10046714 | 3300020070 | Bacteria | 904 |
| 258 | Ga0206356_10965810 | 3300020070 | Bacteria | 1370 |
| 259 | Ga0206356_11478238 | 3300020070 | Bacteria | 794 |
| 260 | Ga0206353_11369135 | 3300020082 | Bacteria | 561 |
| 261 | Ga0206353_12063587 | 3300020082 | Bacteria | 559 |
| 262 | Ga0213874_10276159 | 3300021377 | Bacteria | 626 |
| 263 | Ga0213876_10005302 | 3300021384 | Bacteria | 7095 |
| 264 | Ga0213876_10028074 | 3300021384 | Bacteria | 2967 |
| 265 | Ga0213875_10038452 | 3300021388 | Bacteria | 2254 |
| 266 | Ga0224712_10313497 | 3300022467 | Bacteria | 736 |
| 267 | Ga0207682_10293859 | 3300025893 | Bacteria | 761 |
| 268 | Ga0207682_10320831 | 3300025893 | Bacteria | 727 |
| 269 | Ga0207692_10065988 | 3300025898 | Bacteria | 1890 |
| 270 | Ga0207692_11054955 | 3300025898 | Bacteria | 537 |
| 271 | Ga0207642_10186144 | 3300025899 | Bacteria | 1135 |
| 272 | Ga0207688_10063170 | 3300025901 | Bacteria | 2089 |
| 273 | Ga0207647_10332625 | 3300025904 | Bacteria | 862 |
| 274 | Ga0207685_10020349 | 3300025905 | Bacteria | 2204 |
| 275 | Ga0207699_10984660 | 3300025906 | Unclassified | 623 |
| 276 | Ga0207645_10066177 | 3300025907 | Bacteria | 2310 |
| 277 | Ga0207705_10637834 | 3300025909 | Bacteria | 828 |
| 278 | Ga0207705_11195903 | 3300025909 | Bacteria | 583 |
| 279 | Ga0207654_10609118 | 3300025911 | Bacteria | 780 |
| 280 | Ga0207707_10049188 | 3300025912 | Bacteria | 3673 |
| 281 | Ga0207707_10181967 | 3300025912 | Bacteria | 1835 |
| 282 | Ga0207707_10527304 | 3300025912 | Bacteria | 1005 |
| 283 | Ga0207707_10653453 | 3300025912 | Bacteria | 886 |
| 284 | Ga0207695_10074697 | 3300025913 | Bacteria | 3451 |
| 285 | Ga0207695_10128005 | 3300025913 | Bacteria | 2499 |
| 286 | Ga0207695_10417182 | 3300025913 | Bacteria | 1226 |
| 287 | Ga0207695_11277298 | 3300025913 | Bacteria | 614 |
| 288 | Ga0207693_10002091 | 3300025915 | Bacteria | 17432 |
| 289 | Ga0207693_10007849 | 3300025915 | Bacteria | 8760 |
| 290 | Ga0207693_10183540 | 3300025915 | Bacteria | 1647 |
| 291 | Ga0207693_10507060 | 3300025915 | Bacteria | 942 |
| 292 | Ga0207693_10788172 | 3300025915 | Bacteria | 733 |
| 293 | Ga0207663_10116855 | 3300025916 | Bacteria | 1819 |
| 294 | Ga0207663_10245785 | 3300025916 | Bacteria | 1314 |
| 295 | Ga0207660_10170917 | 3300025917 | Bacteria | 1682 |
| 296 | Ga0207660_10356550 | 3300025917 | Bacteria | 1173 |
| 297 | Ga0207660_10606465 | 3300025917 | Bacteria | 892 |
| 298 | Ga0207660_10955576 | 3300025917 | Bacteria | 699 |
| 299 | Ga0207662_10130970 | 3300025918 | Bacteria | 1581 |
| 300 | Ga0207657_10359135 | 3300025919 | Bacteria | 1148 |
| 301 | Ga0207657_10449252 | 3300025919 | Bacteria | 1011 |
| 302 | Ga0207657_11141354 | 3300025919 | Bacteria | 594 |
| 303 | Ga0207649_10759244 | 3300025920 | Bacteria | 755 |
| 304 | Ga0207652_10219888 | 3300025921 | Bacteria | 1711 |
| 305 | Ga0207652_10367007 | 3300025921 | Bacteria | 1299 |
| 306 | Ga0207652_11612064 | 3300025921 | Bacteria | 553 |
| 307 | Ga0207646_10000523 | 3300025922 | Bacteria | 51093 |
| 308 | Ga0207646_10318001 | 3300025922 | Bacteria | 1407 |
| 309 | Ga0207646_11231577 | 3300025922 | Bacteria | 655 |
| 310 | Ga0207681_10018104 | 3300025923 | Bacteria | 4435 |
| 311 | Ga0207687_10101930 | 3300025927 | Bacteria | 2114 |
| 312 | Ga0207687_10743455 | 3300025927 | Bacteria | 834 |
| 313 | Ga0207687_10854308 | 3300025927 | Bacteria | 778 |
| 314 | Ga0207700_10128074 | 3300025928 | Bacteria | 2068 |
| 315 | Ga0207700_10184237 | 3300025928 | Bacteria | 1750 |
| 316 | Ga0207700_10282486 | 3300025928 | Bacteria | 1428 |
| 317 | Ga0207700_10885651 | 3300025928 | Bacteria | 799 |
| 318 | Ga0207664_10142470 | 3300025929 | Bacteria | 2029 |
| 319 | Ga0207664_10461442 | 3300025929 | Bacteria | 1134 |
| 320 | Ga0207664_10548951 | 3300025929 | Bacteria | 1037 |
| 321 | Ga0207664_11219602 | 3300025929 | Bacteria | 671 |
| 322 | Ga0207644_10142480 | 3300025931 | Bacteria | 1847 |
| 323 | Ga0207644_10179265 | 3300025931 | Bacteria | 1659 |
| 324 | Ga0207644_10649900 | 3300025931 | Unclassified | 878 |
| 325 | Ga0207690_10748113 | 3300025932 | Bacteria | 806 |
| 326 | Ga0207706_10010184 | 3300025933 | Bacteria | 8603 |
| 327 | Ga0207706_10022429 | 3300025933 | Bacteria | 5666 |
| 328 | Ga0207686_11106383 | 3300025934 | Bacteria | 646 |
| 329 | Ga0207686_11341484 | 3300025934 | Bacteria | 588 |
| 330 | Ga0207709_10076211 | 3300025935 | Bacteria | 2146 |
| 331 | Ga0207709_10299165 | 3300025935 | Bacteria | 1196 |
| 332 | Ga0207709_10691095 | 3300025935 | Bacteria | 816 |
| 333 | Ga0207670_11689852 | 3300025936 | Bacteria | 538 |
| 334 | Ga0207669_10443420 | 3300025937 | Bacteria | 1027 |
| 335 | Ga0207669_11170438 | 3300025937 | Bacteria | 651 |
| 336 | Ga0207704_10697646 | 3300025938 | Bacteria | 840 |
| 337 | Ga0207665_10070562 | 3300025939 | Bacteria | 2384 |
| 338 | Ga0207665_10270465 | 3300025939 | Bacteria | 1262 |
| 339 | Ga0207665_10485910 | 3300025939 | Bacteria | 952 |
| 340 | Ga0207665_11353103 | 3300025939 | Bacteria | 567 |
| 341 | Ga0207691_10483206 | 3300025940 | Bacteria | 1053 |
| 342 | Ga0207691_10981706 | 3300025940 | Bacteria | 705 |
| 343 | Ga0207711_11269610 | 3300025941 | Bacteria | 678 |
| 344 | Ga0207689_10352300 | 3300025942 | Bacteria | 1224 |
| 345 | Ga0207689_10979129 | 3300025942 | Bacteria | 714 |
| 346 | Ga0207661_10401928 | 3300025944 | Bacteria | 1242 |
| 347 | Ga0207661_12075005 | 3300025944 | Unclassified | 514 |
| 348 | Ga0207667_10081446 | 3300025949 | Bacteria | 3354 |
| 349 | Ga0207667_10133805 | 3300025949 | Bacteria | 2553 |
| 350 | Ga0207667_11080268 | 3300025949 | Bacteria | 786 |
| 351 | Ga0207651_10909356 | 3300025960 | Bacteria | 784 |
| 352 | Ga0207712_10036215 | 3300025961 | Bacteria | 3359 |
| 353 | Ga0207712_10059963 | 3300025961 | Bacteria | 2696 |
| 354 | Ga0207668_10006182 | 3300025972 | Bacteria | 7066 |
| 355 | Ga0207668_10156377 | 3300025972 | Bacteria | 1772 |
| 356 | Ga0207640_10332213 | 3300025981 | Bacteria | 1214 |
| 357 | Ga0207640_12091273 | 3300025981 | Unclassified | 513 |
| 358 | Ga0207640_12150726 | 3300025981 | Bacteria | 506 |
| 359 | Ga0207658_10232325 | 3300025986 | Bacteria | 1558 |
| 360 | Ga0207677_10200562 | 3300026023 | Bacteria | 1585 |
| 361 | Ga0207639_10859284 | 3300026041 | Bacteria | 847 |
| 362 | Ga0207639_11614805 | 3300026041 | Bacteria | 608 |
| 363 | Ga0207678_10286798 | 3300026067 | Bacteria | 1414 |
| 364 | Ga0207678_10734082 | 3300026067 | Bacteria | 870 |
| 365 | Ga0207678_10819604 | 3300026067 | Bacteria | 822 |
| 366 | Ga0207708_10116305 | 3300026075 | Bacteria | 2080 |
| 367 | Ga0207702_10089121 | 3300026078 | Bacteria | 2697 |
| 368 | Ga0207702_11833783 | 3300026078 | Bacteria | 598 |
| 369 | Ga0207648_10021873 | 3300026089 | Bacteria | 5745 |
| 370 | Ga0207648_10271840 | 3300026089 | Bacteria | 1514 |
| 371 | Ga0207676_12218869 | 3300026095 | Unclassified | 547 |
| 372 | Ga0207674_10815924 | 3300026116 | Bacteria | 900 |
| 373 | Ga0207675_100002763 | 3300026118 | Bacteria | 17252 |
| 374 | Ga0207675_100043272 | 3300026118 | Bacteria | 4206 |
| 375 | Ga0207683_10003820 | 3300026121 | Bacteria | 13052 |
| 376 | Ga0207683_10126854 | 3300026121 | Bacteria | 2293 |
| 377 | Ga0207683_10261572 | 3300026121 | Bacteria | 1580 |
| 378 | Ga0207698_10639715 | 3300026142 | Bacteria | 1052 |
| 379 | Ga0207428_10001749 | 3300027907 | Bacteria | 22235 |
| 380 | Ga0268265_12330138 | 3300028380 | Bacteria | 542 |
| 381 | Ga0268264_10301904 | 3300028381 | Bacteria | 1508 |
| 382 | Ga0268264_11082515 | 3300028381 | Bacteria | 810 |
| 383 | Ga0265319_1253164 | 3300028563 | Bacteria | 537 |
| 384 | Ga0265334_10057519 | 3300028573 | Bacteria | 1473 |
| 385 | Ga0265318_10312988 | 3300028577 | Bacteria | 573 |
| 386 | Ga0265322_10004957 | 3300028654 | Bacteria | 3948 |
| 387 | Ga0265338_10016797 | 3300028800 | Bacteria | 7927 |
| 388 | Ga0265338_10333043 | 3300028800 | Bacteria | 1096 |
| 389 | Ga0265332_10075196 | 3300031238 | Bacteria | 1436 |
| 390 | Ga0265320_10069464 | 3300031240 | Bacteria | 1663 |
| 391 | Ga0265325_10009897 | 3300031241 | Bacteria | 5547 |
| 392 | Ga0265340_10048790 | 3300031247 | Bacteria | 2058 |
| 393 | Ga0265340_10298514 | 3300031247 | Bacteria | 715 |
| 394 | Ga0265339_10043531 | 3300031249 | Bacteria | 2482 |
| 395 | Ga0265331_10101001 | 3300031250 | Bacteria | 1327 |
| 396 | Ga0265327_10003899 | 3300031251 | Bacteria | 13720 |
| 397 | Ga0265316_10004010 | 3300031344 | Bacteria | 14745 |
| 398 | Ga0265313_10004245 | 3300031595 | Bacteria | 11111 |
| 399 | Ga0265314_10010034 | 3300031711 | Bacteria | 7939 |
| 400 | Ga0265342_10302641 | 3300031712 | Bacteria | 842 |
| 401 | Ga0307412_10926851 | 3300031911 | Bacteria | 765 |
| 402 | Ga0307409_102874281 | 3300031995 | Bacteria | 509 |
| 403 | Ga0307416_100161639 | 3300032002 | Bacteria | 2071 |
| 404 | Ga0307416_100222961 | 3300032002 | Bacteria | 1810 |
| 405 | Ga0307411_10957721 | 3300032005 | Unclassified | 764 |
| 406 | Ga0307415_100210936 | 3300032126 | Unclassified | 1549 |
| 407 | Ga0373950_0075882 | 3300034818 | Bacteria | 695 |
| 408 | Ga0373959_0135283 | 3300034820 | Bacteria | 613 |
| 409 | Ga0373929_0037565 | 3300035085 | Bacteria | 1062 |
| 410 | Ga0373940_0017271 | 3300035088 | Bacteria | 1798 |
| 411 | Ga0373944_0025477 | 3300035089 | Bacteria | 1741 |
| 412 | Ga0373944_0085325 | 3300035089 | Bacteria | 1049 |
| 413 | Ga0373932_0150808 | 3300035112 | Bacteria | 797 |
| 414 | Ga0373936_0122021 | 3300035113 | Bacteria | 1114 |
| 415 | Ga0373941_0286350 | 3300035115 | Bacteria | 653 |
| 416 | Ga0373945_0015131 | 3300035116 | Bacteria | 2593 |
| 417 | Ga0373953_0377228 | 3300035117 | Bacteria | 623 |
| 418 | Ga0373956_0063617 | 3300035119 | Bacteria | 1674 |
| 419 | Ga0373956_0319531 | 3300035119 | Bacteria | 740 |
| 420 | Ga0373956_0496352 | 3300035119 | Bacteria | 582 |
| 421 | Ga0373957_0091442 | 3300035120 | Bacteria | 1210 |
| 422 | Ga0373960_0020482 | 3300035121 | Bacteria | 1749 |
| 423 | Ga0373960_0104494 | 3300035121 | Bacteria | 922 |
| 424 | Ga0373943_0012237 | 3300035170 | Bacteria | 3861 |
| 425 | Ga0373943_0244534 | 3300035170 | Bacteria | 1006 |
| 426 | Ga0373943_0410276 | 3300035170 | Bacteria | 783 |
| 427 | Ga0373946_0162870 | 3300035171 | Bacteria | 1048 |
| 428 | Ga0373946_0613394 | 3300035171 | Unclassified | 565 |
| 429 | Ga0373946_0681011 | 3300035171 | Bacteria | 537 |
| 430 | Ga0373955_0354823 | 3300035172 | Unclassified | 888 |
| 431 | Ga0373942_0022656 | 3300035207 | Bacteria | 1596 |
| 432 | Ga0373942_0116200 | 3300035207 | Bacteria | 832 |
| 433 | Ga0373961_0011219 | 3300035241 | Bacteria | 2221 |
| 434 | Ga0373961_0136555 | 3300035241 | Bacteria | 825 |
| 435 | Ga0373962_0078265 | 3300035242 | Bacteria | 999 |
| 436 | Ga0373924_0040038 | 3300035410 | Bacteria | 1917 |
| 437 | Ga0373924_0132210 | 3300035410 | Bacteria | 1086 |
| 438 | Ga0373924_0302778 | 3300035410 | Bacteria | 710 |
| 439 | Ga0373931_0119213 | 3300035691 | Bacteria | 1506 |
| 440 | Ga0373931_0275425 | 3300035691 | Bacteria | 1031 |
| 441 | Ga0373935_0012688 | 3300035692 | Bacteria | 5071 |
| 442 | Ga0373935_0487032 | 3300035692 | Bacteria | 894 |
| 443 | Ga0373933_0189374 | 3300035724 | Bacteria | 1314 |
| 444 | Ga0373947_0000770 | 3300035725 | Bacteria | 19222 |
| 445 | Ga0373947_0117301 | 3300035725 | Bacteria | 1689 |
| 446 | Ga0373947_0644671 | 3300035725 | Unclassified | 722 |
| 447 | Ga0373947_0776078 | 3300035725 | Unclassified | 654 |
| 448 | Ga0373937_0246279 | 3300036401 | Bacteria | 1684 |
| 449 | Ga0373937_1321019 | 3300036401 | Bacteria | 669 |
| 450 | Ga0373925_0010352 | 3300037068 | Bacteria | 6767 |
| 451 | Ga0373925_1507147 | 3300037068 | Unclassified | 550 |
| 452 | Ga0395899_0058245 | 3300037312 | Bacteria | 2850 |
| 453 | Ga0395899_0153479 | 3300037312 | Bacteria | 1631 |
| 454 | Ga0395899_0201751 | 3300037312 | Bacteria | 1386 |
| 455 | Ga0395900_0002122 | 3300037418 | Bacteria | 22181 |
| 456 | Ga0395900_0116281 | 3300037418 | Bacteria | 2744 |
| 457 | Ga0395900_0117438 | 3300037418 | Unclassified | 2729 |
| 458 | Ga0395900_0231295 | 3300037418 | Bacteria | 1859 |
| 459 | Ga0395900_1037516 | 3300037418 | Unclassified | 739 |
| 460 | Ga0395900_1907004 | 3300037418 | Unclassified | 505 |
| 461 | Ga0395898_0002136 | 3300037466 | Bacteria | 24363 |
| 462 | Ga0395898_0002238 | 3300037466 | Bacteria | 23529 |
| 463 | Ga0395898_0002255 | 3300037466 | Bacteria | 23396 |
| 464 | Ga0395898_0555735 | 3300037466 | Bacteria | 1090 |
| 465 | Ga0395898_0580892 | 3300037466 | Unclassified | 1063 |
| 466 | Ga0395898_0643479 | 3300037466 | Bacteria | 1003 |
| 467 | Ga0395905_0001065 | 3300037471 | Bacteria | 34603 |
| 468 | Ga0395905_0037126 | 3300037471 | Bacteria | 4575 |
| 469 | Ga0395905_0160047 | 3300037471 | Bacteria | 2116 |
| 470 | Ga0395905_0279215 | 3300037471 | Bacteria | 1556 |
| 471 | Ga0395905_0342275 | 3300037471 | Bacteria | 1387 |
| 472 | Ga0395905_1870246 | 3300037471 | Bacteria | 506 |
| 473 | Ga0436364_1051529 | 3300037853 | Bacteria | 8650 |
| 474 | Ga0436364_1273932 | 3300037853 | Unclassified | 1502 |
| 475 | Ga0395901_0001460 | 3300038443 | Bacteria | 24601 |
| 476 | Ga0395901_0035317 | 3300038443 | Bacteria | 5163 |
| 477 | Ga0395901_0046527 | 3300038443 | Bacteria | 4507 |
| 478 | Ga0395901_0227484 | 3300038443 | Bacteria | 1948 |
| 479 | Ga0395901_0249917 | 3300038443 | Bacteria | 1848 |
| 480 | Ga0395901_0518386 | 3300038443 | Bacteria | 1211 |
| 481 | Ga0395901_0625265 | 3300038443 | Bacteria | 1083 |
| 482 | Ga0395901_0736963 | 3300038443 | Bacteria | 980 |
| 483 | Ga0395901_1826107 | 3300038443 | Bacteria | 557 |
| 484 | Ga0242420_008053 | 3300038996 | Bacteria | 1702 |
| 485 | Ga0436365_0121270 | 3300039437 | Bacteria | 19985 |
| 486 | Ga0436365_0273214 | 3300039437 | Bacteria | 14739 |
| 487 | Ga0436363_0200906 | 3300039450 | Bacteria | 622 |
| 488 | Ga0436363_1222508 | 3300039450 | Bacteria | 4057 |
| 489 | Ga0436363_1712560 | 3300039450 | Bacteria | 8995 |
| 490 | Ga0436362_0095914 | 3300039453 | Unclassified | 760 |
| 491 | Ga0439461_0001353 | 3300041410 | Bacteria | 3776 |
| 492 | Ga0439466_0041059 | 3300041411 | Bacteria | 1545 |
| 493 | Ga0451793_1370022 | 3300041452 | Bacteria | 524 |
| 494 | Ga0451798_0027903 | 3300041458 | Unclassified | 510 |
| 495 | Ga0451800_0747455 | 3300041459 | Bacteria | 1008 |
| 496 | Ga0451800_1532795 | 3300041459 | Bacteria | 661 |
| 497 | Ga0451835_0166831 | 3300041492 | Bacteria | 1041 |
| 498 | Ga0451835_0846564 | 3300041492 | Unclassified | 664 |
| 499 | Ga0451835_0929677 | 3300041492 | Bacteria | 652 |
| 500 | Ga0451847_0010074 | 3300041503 | Bacteria | 711 |
| 501 | Ga0451853_0301340 | 3300041512 | Bacteria | 969 |
| 502 | Ga0451853_0680311 | 3300041512 | Bacteria | 572 |
| 503 | Ga0451853_1808990 | 3300041512 | Bacteria | 807 |
| 504 | Ga0451853_3331639 | 3300041512 | Bacteria | 1274 |
| 505 | Ga0439431_0052794 | 3300041997 | Unclassified | 1057 |
| 506 | Ga0439448_0007089 | 3300042005 | Bacteria | 3239 |
| 507 | Ga0439448_0106857 | 3300042005 | Unclassified | 954 |
| 508 | Ga0439463_109490 | 3300042016 | Bacteria | 713 |
| 509 | Ga0450907_055649 | 3300042146 | Bacteria | 681 |
| 510 | Ga0439446_0018685 | 3300042156 | Bacteria | 1944 |
| 511 | Ga0439458_0052133 | 3300042157 | Bacteria | 1011 |
| 512 | Ga0439464_0063108 | 3300042439 | Bacteria | 1087 |
| 513 | Ga0466969_0027273 | 3300044656 | Bacteria | 2925 |
| 514 | Ga0466972_0161594 | 3300044658 | Bacteria | 1052 |
| 515 | Ga0466972_0327463 | 3300044658 | Bacteria | 716 |
| 516 | Ga0466965_0013055 | 3300044683 | Bacteria | 3915 |
| 517 | Ga0466965_0049575 | 3300044683 | Bacteria | 2082 |
| 518 | Ga0466965_0225456 | 3300044683 | Bacteria | 1000 |
| 519 | Ga0466966_0044313 | 3300044684 | Bacteria | 2848 |
| 520 | Ga0466966_0431375 | 3300044684 | Bacteria | 792 |
| 521 | Ga0466961_0005586 | 3300044693 | Bacteria | 7943 |
| 522 | Ga0466961_0024499 | 3300044693 | Bacteria | 3881 |
| 523 | Ga0466961_0143729 | 3300044693 | Bacteria | 1493 |
| 524 | Ga0466961_0150883 | 3300044693 | Bacteria | 1451 |
| 525 | Ga0466961_0932536 | 3300044693 | Bacteria | 516 |
| 526 | Ga0466963_0000482 | 3300044694 | Bacteria | 18580 |
| 527 | Ga0466963_0001696 | 3300044694 | Bacteria | 12006 |
| 528 | Ga0466963_0002627 | 3300044694 | Bacteria | 10094 |
| 529 | Ga0466963_0005909 | 3300044694 | Bacteria | 7205 |
| 530 | Ga0466963_0010624 | 3300044694 | Bacteria | 5581 |
| 531 | Ga0466963_0019739 | 3300044694 | Bacteria | 4233 |
| 532 | Ga0466963_0021423 | 3300044694 | Bacteria | 4077 |
| 533 | Ga0466963_0031970 | 3300044694 | Bacteria | 3404 |
| 534 | Ga0466963_0032835 | 3300044694 | Bacteria | 3364 |
| 535 | Ga0466963_0063913 | 3300044694 | Bacteria | 2464 |
| 536 | Ga0466963_0064531 | 3300044694 | Bacteria | 2453 |
| 537 | Ga0466963_0102989 | 3300044694 | Bacteria | 1955 |
| 538 | Ga0466963_0109960 | 3300044694 | Bacteria | 1891 |
| 539 | Ga0466963_0145955 | 3300044694 | Bacteria | 1641 |
| 540 | Ga0466963_0241941 | 3300044694 | Bacteria | 1266 |
| 541 | Ga0466963_0748485 | 3300044694 | Bacteria | 689 |
| 542 | Ga0466963_1043130 | 3300044694 | Unclassified | 575 |
| 543 | Ga0466963_1293195 | 3300044694 | Bacteria | 512 |
| 544 | Ga0466964_0003414 | 3300044706 | Bacteria | 5796 |
| 545 | Ga0466964_0020297 | 3300044706 | Bacteria | 2558 |
| 546 | Ga0466964_0028446 | 3300044706 | Bacteria | 2202 |
| 547 | Ga0466964_0054369 | 3300044706 | Bacteria | 1650 |
| 548 | Ga0466964_0059776 | 3300044706 | Bacteria | 1583 |
| 549 | Ga0466964_0095620 | 3300044706 | Bacteria | 1300 |
| 550 | Ga0466964_0846665 | 3300044706 | Unclassified | 520 |
| 551 | Ga0466971_0001805 | 3300044719 | Bacteria | 9086 |
| 552 | Ga0466971_0004784 | 3300044719 | Bacteria | 5858 |
| 553 | Ga0466971_0032012 | 3300044719 | Bacteria | 2356 |
| 554 | Ga0466971_0250426 | 3300044719 | Bacteria | 844 |
| 555 | Ga0466968_0008584 | 3300044735 | Bacteria | 3915 |
| 556 | Ga0466968_0042076 | 3300044735 | Bacteria | 1930 |
| 557 | Ga0466968_0060638 | 3300044735 | Bacteria | 1631 |
| 558 | Ga0466970_0065140 | 3300044765 | Bacteria | 1955 |
| 559 | Ga0466970_0127942 | 3300044765 | Bacteria | 1394 |
| 560 | Ga0466970_0661671 | 3300044765 | Bacteria | 608 |
| 561 | Ga0466957_0005137 | 3300044842 | Bacteria | 7316 |
| 562 | Ga0466957_0011744 | 3300044842 | Bacteria | 5061 |
| 563 | Ga0466957_0012546 | 3300044842 | Bacteria | 4905 |
| 564 | Ga0466957_0013491 | 3300044842 | Bacteria | 4739 |
| 565 | Ga0466957_0077694 | 3300044842 | Bacteria | 2063 |
| 566 | Ga0466957_0081326 | 3300044842 | Bacteria | 2017 |
| 567 | Ga0466957_0110669 | 3300044842 | Bacteria | 1741 |
| 568 | Ga0466957_0174778 | 3300044842 | Bacteria | 1400 |
| 569 | Ga0466957_0318325 | 3300044842 | Bacteria | 1049 |
| 570 | Ga0466957_0831405 | 3300044842 | Bacteria | 657 |
| 571 | Ga0466957_0991743 | 3300044842 | Bacteria | 603 |
| 572 | Ga0466957_1014522 | 3300044842 | Bacteria | 596 |
| 573 | Ga0466960_0002382 | 3300044901 | Bacteria | 7074 |
| 574 | Ga0466960_0132182 | 3300044901 | Bacteria | 1318 |
| 575 | Ga0466960_0394034 | 3300044901 | Bacteria | 797 |
| 576 | Ga0466959_0006797 | 3300045049 | Bacteria | 7970 |
| 577 | Ga0466959_0018649 | 3300045049 | Bacteria | 5095 |
| 578 | Ga0466959_0060966 | 3300045049 | Bacteria | 2744 |
| 579 | Ga0466959_0080902 | 3300045049 | Bacteria | 2341 |
| 580 | Ga0466959_0346746 | 3300045049 | Bacteria | 1013 |
| 581 | Ga0451576_0038025 | 3300045051 | Bacteria | 5095 |
| 582 | Ga0451576_0666637 | 3300045051 | Bacteria | 1093 |
| 583 | Ga0466958_0008945 | 3300045836 | Bacteria | 5565 |
| 584 | Ga0466958_0009049 | 3300045836 | Bacteria | 5531 |
| 585 | Ga0466958_0016619 | 3300045836 | Bacteria | 4240 |
| 586 | Ga0466958_0062518 | 3300045836 | Bacteria | 2269 |
| 587 | Ga0466958_0079202 | 3300045836 | Bacteria | 2020 |
| 588 | Ga0466958_0101134 | 3300045836 | Bacteria | 1792 |
| 589 | Ga0466958_0102677 | 3300045836 | Bacteria | 1779 |
| 590 | Ga0466958_0242179 | 3300045836 | Bacteria | 1152 |
| 591 | Ga0466958_0279987 | 3300045836 | Bacteria | 1069 |
| 592 | Ga0466958_0571334 | 3300045836 | Bacteria | 735 |
| 593 | Ga0466958_0644566 | 3300045836 | Bacteria | 689 |
| 594 | Ga0466958_0841803 | 3300045836 | Bacteria | 598 |
| 595 | Ga0466967_0004099 | 3300045976 | Bacteria | 9735 |
| 596 | Ga0466967_0004107 | 3300045976 | Bacteria | 9726 |
| 597 | Ga0466967_0005413 | 3300045976 | Bacteria | 8843 |
| 598 | Ga0466967_0012096 | 3300045976 | Bacteria | 6581 |
| 599 | Ga0466967_0014265 | 3300045976 | Bacteria | 6181 |
| 600 | Ga0466967_0017302 | 3300045976 | Bacteria | 5718 |
| 601 | Ga0466967_0020252 | 3300045976 | Bacteria | 5371 |
| 602 | Ga0466967_0022553 | 3300045976 | Bacteria | 5141 |
| 603 | Ga0466967_0029598 | 3300045976 | Bacteria | 4585 |
| 604 | Ga0466967_0035194 | 3300045976 | Bacteria | 4259 |
| 605 | Ga0466967_0074064 | 3300045976 | Bacteria | 3057 |
| 606 | Ga0466967_0079712 | 3300045976 | Bacteria | 2952 |
| 607 | Ga0466967_0086218 | 3300045976 | Bacteria | 2844 |
| 608 | Ga0466967_0099691 | 3300045976 | Bacteria | 2653 |
| 609 | Ga0466967_0116230 | 3300045976 | Bacteria | 2464 |
| 610 | Ga0466967_0125915 | 3300045976 | Bacteria | 2373 |
| 611 | Ga0466967_0323418 | 3300045976 | Bacteria | 1488 |
| 612 | Ga0466967_0360417 | 3300045976 | Bacteria | 1409 |
| 613 | Ga0466967_0364602 | 3300045976 | Bacteria | 1400 |
| 614 | Ga0466967_0378473 | 3300045976 | Bacteria | 1374 |
| 615 | Ga0466967_0453245 | 3300045976 | Unclassified | 1254 |
| 616 | Ga0466967_0469006 | 3300045976 | Bacteria | 1232 |
| 617 | Ga0466967_0482680 | 3300045976 | Bacteria | 1214 |
| 618 | Ga0466967_0936154 | 3300045976 | Bacteria | 862 |
| 619 | Ga0466967_1463707 | 3300045976 | Bacteria | 680 |
| 620 | Ga0466967_1542779 | 3300045976 | Bacteria | 661 |
| 621 | Ga0495592_0114079 | 3300046454 | Bacteria | 1909 |
| 622 | Ga0495592_0256156 | 3300046454 | Bacteria | 1154 |
| 623 | Ga0495592_0345395 | 3300046454 | Bacteria | 955 |
| 624 | Ga0495603_0001930 | 3300046455 | Bacteria | 12224 |
| 625 | Ga0495603_0124722 | 3300046455 | Bacteria | 1501 |
| 626 | Ga0495629_0237331 | 3300046459 | Bacteria | 1256 |
| 627 | Ga0495629_0278455 | 3300046459 | Bacteria | 1148 |
| 628 | Ga0495641_0000786 | 3300046461 | Bacteria | 26874 |
| 629 | Ga0495641_0100366 | 3300046461 | Bacteria | 1291 |
| 630 | Ga0495641_0131141 | 3300046461 | Bacteria | 1119 |
| 631 | Ga0495651_0644355 | 3300046462 | Bacteria | 665 |
| 632 | Ga0495653_0096938 | 3300046463 | Bacteria | 2143 |
| 633 | Ga0495653_0409014 | 3300046463 | Bacteria | 861 |
| 634 | Ga0495653_0606428 | 3300046463 | Bacteria | 672 |
| 635 | Ga0495580_0055313 | 3300046472 | Bacteria | 2797 |
| 636 | Ga0495582_0010387 | 3300046473 | Bacteria | 5123 |
| 637 | Ga0495582_0067084 | 3300046473 | Bacteria | 1982 |
| 638 | Ga0495582_0595524 | 3300046473 | Unclassified | 640 |
| 639 | Ga0495605_0227158 | 3300046474 | Bacteria | 805 |
| 640 | Ga0495664_0051708 | 3300046477 | Bacteria | 2440 |
| 641 | Ga0495664_0108708 | 3300046477 | Bacteria | 1673 |
| 642 | Ga0495664_0169292 | 3300046477 | Bacteria | 1325 |
| 643 | Ga0495584_0256072 | 3300046491 | Bacteria | 890 |
| 644 | Ga0495584_0577490 | 3300046491 | Bacteria | 573 |
| 645 | Ga0495585_0369235 | 3300046492 | Bacteria | 695 |
| 646 | Ga0495594_0000915 | 3300046499 | Bacteria | 15329 |
| 647 | Ga0495596_0188540 | 3300046500 | Bacteria | 802 |
| 648 | Ga0495596_0226109 | 3300046500 | Bacteria | 727 |
| 649 | Ga0495607_0151633 | 3300046501 | Bacteria | 1186 |
| 650 | Ga0495608_0092973 | 3300046511 | Bacteria | 1949 |
| 651 | Ga0495608_0123724 | 3300046511 | Bacteria | 1657 |
| 652 | Ga0495608_0279230 | 3300046511 | Unclassified | 1037 |
| 653 | Ga0495618_0071215 | 3300046514 | Bacteria | 2212 |
| 654 | Ga0495628_0085846 | 3300046516 | Bacteria | 2441 |
| 655 | Ga0495628_0647580 | 3300046516 | Bacteria | 750 |
| 656 | Ga0495630_0123181 | 3300046517 | Bacteria | 1967 |
| 657 | Ga0495630_0210989 | 3300046517 | Bacteria | 1482 |
| 658 | Ga0495630_0234103 | 3300046517 | Bacteria | 1403 |
| 659 | Ga0495630_0314789 | 3300046517 | Bacteria | 1196 |
| 660 | Ga0495644_0280587 | 3300046523 | Bacteria | 650 |
| 661 | Ga0495663_0081448 | 3300046525 | Bacteria | 1043 |
| 662 | Ga0495663_0094968 | 3300046525 | Bacteria | 976 |
| 663 | Ga0495666_0219681 | 3300046526 | Bacteria | 871 |
| 664 | Ga0495652_0081495 | 3300046529 | Bacteria | 2669 |
| 665 | Ga0495652_0116214 | 3300046529 | Bacteria | 2142 |
| 666 | Ga0495665_0227013 | 3300046531 | Bacteria | 965 |
| 667 | Ga0495640_0180087 | 3300046533 | Bacteria | 1347 |
| 668 | Ga0495586_0043514 | 3300046535 | Bacteria | 2419 |
| 669 | Ga0495587_0044347 | 3300046536 | Bacteria | 2645 |
| 670 | Ga0495587_0143362 | 3300046536 | Bacteria | 1362 |
| 671 | Ga0495598_0117107 | 3300046537 | Bacteria | 899 |
| 672 | Ga0495609_0140515 | 3300046538 | Bacteria | 1031 |
| 673 | Ga0495645_0103084 | 3300046543 | Bacteria | 2027 |
| 674 | Ga0495645_0132161 | 3300046543 | Bacteria | 1748 |
| 675 | Ga0495645_0193256 | 3300046543 | Bacteria | 1385 |
| 676 | Ga0495633_0403859 | 3300046558 | Bacteria | 618 |
| 677 | Ga0495667_0092464 | 3300046559 | Bacteria | 1958 |
| 678 | Ga0495667_0155978 | 3300046559 | Bacteria | 1469 |
| 679 | Ga0495667_0220125 | 3300046559 | Bacteria | 1212 |
| 680 | Ga0495656_0146080 | 3300046615 | Bacteria | 1138 |
| 681 | Ga0495668_0840823 | 3300046616 | Bacteria | 509 |
| 682 | Ga0495634_0243979 | 3300046642 | Bacteria | 1101 |
| 683 | Ga0495634_0281943 | 3300046642 | Bacteria | 1009 |
| 684 | Ga0495634_0389748 | 3300046642 | Bacteria | 829 |
| 685 | Ga0495635_0062124 | 3300046663 | Bacteria | 2565 |
| 686 | Ga0495635_0492222 | 3300046663 | Bacteria | 808 |
| 687 | Ga0495588_0000409 | 3300046674 | Bacteria | 23658 |
| 688 | Ga0495588_0337224 | 3300046674 | Bacteria | 793 |
| 689 | Ga0495657_0037606 | 3300046675 | Bacteria | 3335 |
| 690 | Ga0495657_0041833 | 3300046675 | Bacteria | 3133 |
| 691 | Ga0495657_0111758 | 3300046675 | Bacteria | 1730 |
| 692 | Ga0495599_0197172 | 3300046678 | Bacteria | 1237 |
| 693 | Ga0495599_0262786 | 3300046678 | Bacteria | 1048 |
| 694 | Ga0495623_0145720 | 3300046679 | Bacteria | 1404 |
| 695 | Ga0495623_0315708 | 3300046679 | Bacteria | 859 |
| 696 | Ga0495646_0069904 | 3300046680 | Bacteria | 2070 |
| 697 | Ga0495646_0184746 | 3300046680 | Archaea | 1142 |
| 698 | Ga0495646_0243112 | 3300046680 | Bacteria | 966 |
| 699 | Ga0495647_0342795 | 3300046681 | Bacteria | 679 |
| 700 | Ga0495658_0259714 | 3300046683 | Bacteria | 1093 |
| 701 | Ga0495658_0427233 | 3300046683 | Bacteria | 845 |
| 702 | Ga0495658_0463872 | 3300046683 | Bacteria | 810 |
| 703 | Ga0495658_0657365 | 3300046683 | Bacteria | 671 |
| 704 | Ga0495669_0332549 | 3300046684 | Bacteria | 734 |
| 705 | Ga0495613_0127540 | 3300046689 | Bacteria | 1824 |
| 706 | Ga0495613_0514952 | 3300046689 | Bacteria | 804 |
| 707 | Ga0495624_0073114 | 3300046690 | Bacteria | 2132 |
| 708 | Ga0495624_0534026 | 3300046690 | Bacteria | 701 |
| 709 | Ga0495671_0237456 | 3300046692 | Bacteria | 881 |
| 710 | Ga0495589_0171618 | 3300046794 | Bacteria | 1031 |
| 711 | Ga0495589_0301721 | 3300046794 | Bacteria | 742 |
| 712 | Ga0495600_0113701 | 3300046809 | Bacteria | 1762 |
| 713 | Ga0495581_0283797 | 3300047315 | Bacteria | 968 |
| 714 | Ga0495604_0134778 | 3300047317 | Bacteria | 1771 |
| 715 | Ga0495604_0189034 | 3300047317 | Bacteria | 1436 |
| 716 | Ga0495604_0439752 | 3300047317 | Bacteria | 853 |
| 717 | Ga0495636_0280623 | 3300047318 | Bacteria | 776 |
| 718 | Ga0495674_0009149 | 3300047319 | Bacteria | 9414 |
| 719 | Ga0495674_0366446 | 3300047319 | Bacteria | 1167 |
| 720 | Ga0495676_0002605 | 3300047321 | Bacteria | 16101 |
| 721 | Ga0495676_0343465 | 3300047321 | Bacteria | 999 |
| 722 | Ga0495676_0776768 | 3300047321 | Bacteria | 617 |
| 723 | Ga0495680_0035962 | 3300047322 | Bacteria | 3982 |
| 724 | Ga0495680_0090783 | 3300047322 | Bacteria | 2291 |
| 725 | Ga0495680_0300605 | 3300047322 | Bacteria | 1127 |
| 726 | Ga0495675_0109435 | 3300047444 | Bacteria | 1725 |
| 727 | Ga0495675_0152363 | 3300047444 | Bacteria | 1428 |
| 728 | Ga0495675_0383214 | 3300047444 | Bacteria | 822 |
| 729 | Ga0495677_0101844 | 3300047445 | Bacteria | 1088 |
| 730 | Ga0495679_140961 | 3300047446 | Bacteria | 651 |
| 731 | Ga0495685_130002 | 3300047447 | Bacteria | 824 |
| 732 | Ga0495684_0139049 | 3300047471 | Bacteria | 1821 |
| 733 | Ga0495684_0231196 | 3300047471 | Bacteria | 1352 |
| 734 | Ga0495684_0761143 | 3300047471 | Bacteria | 636 |
| 735 | Ga0495593_0391779 | 3300047673 | Bacteria | 695 |
| 736 | Ga0495602_0107144 | 3300048088 | Bacteria | 2279 |
| 737 | Ga0495602_0273527 | 3300048088 | Bacteria | 1247 |
| 738 | Ga0495602_0441664 | 3300048088 | Bacteria | 920 |
| 739 | Ga0495602_0676779 | 3300048088 | Unclassified | 702 |
| 740 | Ga0495614_0400067 | 3300048089 | Bacteria | 645 |
| 741 | Ga0495615_0133843 | 3300048090 | Bacteria | 727 |
| 742 | Ga0495626_0276658 | 3300048091 | Bacteria | 668 |
| 743 | Ga0496100_0105848 | 3300048903 | Bacteria | 1946 |
| 744 | Ga0496100_0148417 | 3300048903 | Bacteria | 1669 |
| 745 | Ga0496100_0474573 | 3300048903 | Bacteria | 961 |
| 746 | Ga0496100_0544531 | 3300048903 | Bacteria | 897 |
| 747 | Ga0496100_0553661 | 3300048903 | Bacteria | 890 |
| 748 | Ga0496101_0002385 | 3300048904 | Bacteria | 11528 |
| 749 | Ga0496101_0031469 | 3300048904 | Bacteria | 3730 |
| 750 | Ga0496101_0069766 | 3300048904 | Bacteria | 2572 |
| 751 | Ga0496101_0136326 | 3300048904 | Bacteria | 1868 |
| 752 | Ga0496101_0161836 | 3300048904 | Bacteria | 1717 |
| 753 | Ga0496101_0319198 | 3300048904 | Bacteria | 1219 |
| 754 | Ga0496101_0592054 | 3300048904 | Bacteria | 877 |
| 755 | Ga0496102_0027799 | 3300048905 | Bacteria | 5051 |
| 756 | Ga0496102_0047206 | 3300048905 | Bacteria | 3912 |
| 757 | Ga0496102_0225608 | 3300048905 | Bacteria | 1766 |
| 758 | Ga0496102_0434203 | 3300048905 | Bacteria | 1233 |
| 759 | Ga0496102_0484384 | 3300048905 | Bacteria | 1158 |
| 760 | Ga0496102_0490579 | 3300048905 | Bacteria | 1150 |
| 761 | Ga0496102_0656975 | 3300048905 | Bacteria | 972 |
| 762 | Ga0496102_0722089 | 3300048905 | Bacteria | 919 |
| 763 | Ga0496103_0004252 | 3300048906 | Bacteria | 8701 |
| 764 | Ga0496103_0064727 | 3300048906 | Bacteria | 2279 |
| 765 | Ga0496103_0105344 | 3300048906 | Bacteria | 1788 |
| 766 | Ga0496103_0178071 | 3300048906 | Bacteria | 1366 |
| 767 | Ga0496103_0207904 | 3300048906 | Bacteria | 1259 |
| 768 | Ga0496103_0969970 | 3300048906 | Bacteria | 530 |
| 769 | Ga0496104_0003324 | 3300048907 | Bacteria | 13881 |
| 770 | Ga0496104_0051079 | 3300048907 | Bacteria | 3901 |
| 771 | Ga0496104_0225497 | 3300048907 | Bacteria | 1786 |
| 772 | Ga0496104_0420465 | 3300048907 | Bacteria | 1248 |
| 773 | Ga0496104_0949496 | 3300048907 | Bacteria | 764 |
| 774 | Ga0496105_0002977 | 3300048908 | Bacteria | 12447 |
| 775 | Ga0496105_0008104 | 3300048908 | Bacteria | 8169 |
| 776 | Ga0496105_0026004 | 3300048908 | Bacteria | 4770 |
| 777 | Ga0496105_0066590 | 3300048908 | Bacteria | 2974 |
| 778 | Ga0496105_0540614 | 3300048908 | Bacteria | 910 |
| 779 | Ga0496105_0575369 | 3300048908 | Bacteria | 877 |
| 780 | Ga0496105_1075531 | 3300048908 | Bacteria | 598 |
| 781 | Ga0496106_0012098 | 3300048909 | Bacteria | 6368 |
| 782 | Ga0496106_0127162 | 3300048909 | Bacteria | 1996 |
| 783 | Ga0496106_0265348 | 3300048909 | Bacteria | 1374 |
| 784 | Ga0496106_0612959 | 3300048909 | Bacteria | 871 |
| 785 | Ga0496106_0709396 | 3300048909 | Bacteria | 801 |
| 786 | Ga0496106_0776200 | 3300048909 | Bacteria | 761 |
| 787 | Ga0496106_1063525 | 3300048909 | Unclassified | 635 |
| 788 | Ga0496107_0006099 | 3300048910 | Bacteria | 8281 |
| 789 | Ga0496107_0021698 | 3300048910 | Bacteria | 4537 |
| 790 | Ga0496107_0086348 | 3300048910 | Bacteria | 2290 |
| 791 | Ga0496107_0123295 | 3300048910 | Bacteria | 1909 |
| 792 | Ga0496107_0247076 | 3300048910 | Unclassified | 1328 |
| 793 | Ga0496107_0551706 | 3300048910 | Bacteria | 853 |
| 794 | Ga0496107_0648666 | 3300048910 | Bacteria | 778 |
| 795 | Ga0496108_0019950 | 3300048911 | Bacteria | 5505 |
| 796 | Ga0496108_0063050 | 3300048911 | Bacteria | 3121 |
| 797 | Ga0496108_0563048 | 3300048911 | Bacteria | 994 |
| 798 | Ga0496108_1004203 | 3300048911 | Bacteria | 712 |
| 799 | Ga0496109_0008605 | 3300048912 | Bacteria | 8687 |
| 800 | Ga0496109_0027881 | 3300048912 | Bacteria | 5047 |
| 801 | Ga0496109_0428340 | 3300048912 | Bacteria | 1250 |
| 802 | Ga0496109_0813664 | 3300048912 | Bacteria | 872 |
| 803 | Ga0496109_1333195 | 3300048912 | Bacteria | 653 |
| 804 | Ga0496110_0002261 | 3300048913 | Bacteria | 14390 |
| 805 | Ga0496110_0003921 | 3300048913 | Bacteria | 11446 |
| 806 | Ga0496110_0126092 | 3300048913 | Bacteria | 2310 |
| 807 | Ga0496110_1047074 | 3300048913 | Bacteria | 724 |
| 808 | Ga0496110_1213158 | 3300048913 | Unclassified | 663 |
| 809 | Ga0496111_0004014 | 3300048914 | Bacteria | 9239 |
| 810 | Ga0496111_0004077 | 3300048914 | Bacteria | 9174 |
| 811 | Ga0496111_0089764 | 3300048914 | Bacteria | 2251 |
| 812 | Ga0496111_0502209 | 3300048914 | Bacteria | 893 |
| 813 | Ga0496112_0036941 | 3300048915 | Bacteria | 4767 |
| 814 | Ga0496112_0046394 | 3300048915 | Bacteria | 4261 |
| 815 | Ga0496112_0375293 | 3300048915 | Bacteria | 1363 |
| 816 | Ga0496112_0484273 | 3300048915 | Bacteria | 1173 |
| 817 | Ga0496112_0713205 | 3300048915 | Bacteria | 931 |
| 818 | Ga0496112_1356435 | 3300048915 | Bacteria | 626 |
| 819 | Ga0496113_0000346 | 3300048916 | Bacteria | 22110 |
| 820 | Ga0496113_0006351 | 3300048916 | Bacteria | 7478 |
| 821 | Ga0496113_0050632 | 3300048916 | Bacteria | 3097 |
| 822 | Ga0496113_0103365 | 3300048916 | Bacteria | 2210 |
| 823 | Ga0496113_0126973 | 3300048916 | Bacteria | 1998 |
| 824 | Ga0496113_0773037 | 3300048916 | Bacteria | 764 |
| 825 | Ga0496114_0072608 | 3300048917 | Bacteria | 2894 |
| 826 | Ga0496114_0102828 | 3300048917 | Bacteria | 2441 |
| 827 | Ga0496114_0123532 | 3300048917 | Bacteria | 2229 |
| 828 | Ga0496114_0347187 | 3300048917 | Bacteria | 1312 |
| 829 | Ga0496114_0378997 | 3300048917 | Bacteria | 1252 |
| 830 | Ga0496114_0605939 | 3300048917 | Unclassified | 965 |
| 831 | Ga0496114_1069565 | 3300048917 | Bacteria | 691 |
| 832 | Ga0496115_0008562 | 3300048918 | Bacteria | 7574 |
| 833 | Ga0496115_0076075 | 3300048918 | Bacteria | 2728 |
| 834 | Ga0496115_0178383 | 3300048918 | Bacteria | 1756 |
| 835 | Ga0496115_0235598 | 3300048918 | Bacteria | 1509 |
| 836 | Ga0496115_0606708 | 3300048918 | Bacteria | 870 |
| 837 | Ga0496115_0649385 | 3300048918 | Bacteria | 834 |
| 838 | Ga0501034_0141036 | 3300049571 | Bacteria | 2389 |
| 839 | Ga0501034_0203796 | 3300049571 | Bacteria | 1935 |
| 840 | Ga0501046_0410639 | 3300049580 | Bacteria | 977 |
| 841 | Ga0501047_0038554 | 3300049581 | Bacteria | 4623 |
| 842 | Ga0501047_0245662 | 3300049581 | Bacteria | 1639 |
| 843 | Ga0501047_0547734 | 3300049581 | Bacteria | 981 |
| 844 | Ga0501067_0003180 | 3300049583 | Bacteria | 9064 |
| 845 | Ga0501067_0084376 | 3300049583 | Bacteria | 1762 |
| 846 | Ga0501067_0546618 | 3300049583 | Bacteria | 648 |
| 847 | Ga0501067_0657488 | 3300049583 | Unclassified | 588 |
| 848 | Ga0501068_0075511 | 3300049584 | Bacteria | 2062 |
| 849 | Ga0501069_0008869 | 3300049585 | Bacteria | 5301 |
| 850 | Ga0501069_0306865 | 3300049585 | Bacteria | 931 |
| 851 | Ga0501069_0323748 | 3300049585 | Bacteria | 906 |
| 852 | Ga0501070_0017966 | 3300049586 | Bacteria | 5936 |
| 853 | Ga0501070_0259444 | 3300049586 | Bacteria | 1421 |
| 854 | Ga0501070_0402268 | 3300049586 | Bacteria | 1107 |
| 855 | Ga0501072_0007341 | 3300049588 | Bacteria | 8360 |
| 856 | Ga0501073_0097117 | 3300049589 | Bacteria | 2046 |
| 857 | Ga0501074_0299801 | 3300049590 | Bacteria | 1141 |
| 858 | Ga0501079_0177313 | 3300049741 | Bacteria | 1662 |
| 859 | Ga0501080_0005292 | 3300049742 | Bacteria | 11491 |
| 860 | Ga0501080_0147180 | 3300049742 | Bacteria | 2177 |
| 861 | Ga0501080_0208549 | 3300049742 | Bacteria | 1791 |
| 862 | Ga0501080_1149996 | 3300049742 | Bacteria | 669 |
| 863 | Ga0501083_0000319 | 3300049744 | Bacteria | 30507 |
| 864 | Ga0501044_0171108 | 3300049823 | Bacteria | 2144 |
| 865 | Ga0501044_1062408 | 3300049823 | Bacteria | 680 |
| 866 | nmdc:mga05p37_761467_c1 | 3300050507 | Bacteria | 1066 |
| 867 | nmdc:mga05p37_98452_c1 | 3300050507 | Bacteria | 3602 |
| 868 | nmdc:mga09592_158300_c1 | 3300050508 | Bacteria | 1955 |
| 869 | nmdc:mga06r32_480382_c1 | 3300050510 | Bacteria | 1221 |
| 870 | nmdc:mga08y16_311019_c1 | 3300050511 | Bacteria | 1623 |
| 871 | nmdc:mga0n895_508543_c1 | 3300050512 | Unclassified | 1213 |
| 872 | nmdc:mga0n895_82527_c1 | 3300050512 | Bacteria | 3205 |
| 873 | nmdc:mga0rr50_52393_c1 | 3300050513 | Bacteria | 3033 |
| 874 | nmdc:mga08x19_21068_c1 | 3300050514 | Bacteria | 4021 |
| 875 | nmdc:mga08x19_276428_c1 | 3300050514 | Bacteria | 1163 |
| 876 | nmdc:mga0a205_1282466_c1 | 3300050515 | Bacteria | 580 |
| 877 | nmdc:mga0a205_156435_c1 | 3300050515 | Bacteria | 2178 |
| 878 | nmdc:mga0a205_189614_c1 | 3300050515 | Bacteria | 1949 |
| 879 | Ga0495601_0132143 | 3300053077 | Bacteria | 1626 |
| 880 | Ga0495601_0230638 | 3300053077 | Bacteria | 1209 |
| 881 | Ga0495601_0448397 | 3300053077 | Unclassified | 835 |
| 882 | Ga0495595_0090235 | 3300053084 | Bacteria | 1469 |
| 883 | Ga0495619_1085232 | 3300053085 | Unclassified | 533 |
| 884 | Ga0501084_0624802 | 3300054114 | Unclassified | 910 |
| 885 | Ga0587079_219935 | 3300059647 | Bacteria | 527 |
| 886 | Ga0466962_0000661 | 3300061719 | Bacteria | 15283 |
| 887 | Ga0466962_0007279 | 3300061719 | Bacteria | 5305 |
| 888 | Ga0530510_0105987 | 3300061734 | Bacteria | 2057 |
| 889 | Ga0207705_10310361 | |||
| 890 | JGI24747J21853_1006910 | |||
| 891 | Ga0070658_10214997 | |||
| 892 | Ga0070658_11505640 | |||
| 893 | Ga0070676_10064194 | |||
| 894 | Ga0070683_100096654 | |||
| 895 | Ga0070683_100245581 | |||
| 896 | Ga0070683_100868727 | |||
| 897 | Ga0070690_100087734 | |||
| 898 | Ga0070690_100244039 | |||
| 899 | Ga0070690_100727309 | |||
| 900 | Ga0070677_10237783 | |||
| 901 | Ga0068869_101448719 | |||
| 902 | Ga0068869_102011293 | |||
| 903 | Ga0070680_100158864 | |||
| 904 | Ga0070680_100437331 | |||
| 905 | Ga0070680_100492302 | |||
| 906 | Ga0070680_100553461 | |||
| 907 | Ga0070682_100079003 | |||
| 908 | Ga0070682_100674747 | |||
| 909 | Ga0070682_100685957 | |||
| 910 | Ga0068868_100115192 | |||
| 911 | Ga0070660_100034617 | |||
| 912 | Ga0070660_101331948 | |||
| 913 | Ga0070689_100800757 | |||
| 914 | Ga0070691_10029015 | |||
| 915 | Ga0070691_10045164 | |||
| 916 | Ga0070687_100328147 | |||
| 917 | Ga0070661_100237313 | |||
| 918 | Ga0070661_100481706 | |||
| 919 | Ga0070661_100604296 | |||
| 920 | Ga0070692_10262680 | |||
| 921 | Ga0070668_100008900 | |||
| 922 | Ga0070669_100708097 | |||
| 923 | Ga0070671_100036444 | |||
| 924 | Ga0070671_100270080 | |||
| 925 | Ga0070674_100054194 | |||
| 926 | Ga0070673_100890805 | |||
| 927 | Ga0070673_101466109 | |||
| 928 | Ga0070688_100208855 | |||
| 929 | Ga0070659_100167627 | |||
| 930 | Ga0070659_100227894 | |||
| 931 | Ga0070659_100495673 | |||
| 932 | Ga0070709_10108314 | |||
| 933 | Ga0070709_10119745 | |||
| 934 | Ga0070709_10340368 | |||
| 935 | Ga0070709_10496036 | |||
| 936 | Ga0070714_100019301 | |||
| 937 | Ga0070714_100330749 | |||
| 938 | Ga0070714_100787181 | |||
| 939 | Ga0070714_101242233 | |||
| 940 | Ga0070714_101441249 | |||
| 941 | Ga0070713_100097441 | |||
| 942 | Ga0070713_100202706 | |||
| 943 | Ga0070713_100285468 | |||
| 944 | Ga0070713_100423921 | |||
| 945 | Ga0070713_101411837 | |||
| 946 | Ga0070713_102437997 | |||
| 947 | Ga0070710_10024705 | |||
| 948 | Ga0070710_10414210 | |||
| 949 | Ga0070701_10158099 | |||
| 950 | Ga0070711_100089862 | |||
| 951 | Ga0070711_100228315 | |||
| 952 | Ga0070711_100319098 | |||
| 953 | Ga0070711_100669251 | |||
| 954 | Ga0070711_101269094 | |||
| 955 | Ga0070705_100156183 | |||
| 956 | Ga0070705_100875318 | |||
| 957 | Ga0070705_100974375 | |||
| 958 | Ga0070700_100196922 | |||
| 959 | Ga0070694_100059196 | |||
| 960 | Ga0070694_100328708 | |||
| 961 | Ga0070708_100754521 | |||
| 962 | Ga0070708_102140812 | |||
| 963 | Ga0070663_100635999 | |||
| 964 | Ga0070678_100239721 | |||
| 965 | Ga0070678_100325492 | |||
| 966 | Ga0070678_100781822 | |||
| 967 | Ga0070678_102390172 | |||
| 968 | Ga0070662_100008721 | |||
| 969 | Ga0070662_100237158 | |||
| 970 | Ga0070681_10027461 | |||
| 971 | Ga0070681_10077887 | |||
| 972 | Ga0070681_10229331 | |||
| 973 | Ga0068867_100054467 | |||
| 974 | Ga0068867_100189901 | |||
| 975 | Ga0070707_100000967 | |||
| 976 | Ga0070707_100134608 | |||
| 977 | Ga0070707_100403499 | |||
| 978 | Ga0070698_100610216 | |||
| 979 | Ga0070698_100694159 | |||
| 980 | Ga0070698_101981704 | |||
| 981 | Ga0070699_101739811 | |||
| 982 | Ga0070679_100006446 | |||
| 983 | Ga0070679_101091185 | |||
| 984 | Ga0070684_100040658 | |||
| 985 | Ga0070684_100458323 | |||
| 986 | Ga0070684_101196991 | |||
| 987 | Ga0070684_101340286 | |||
| 988 | Ga0070684_101565328 | |||
| 989 | Ga0068853_100422032 | |||
| 990 | Ga0070686_100112133 | |||
| 991 | Ga0070686_100142743 | |||
| 992 | Ga0070686_100297652 | |||
| 993 | Ga0070695_100000009 | |||
| 994 | Ga0070695_100141563 | |||
| 995 | Ga0070695_100543623 | |||
| 996 | Ga0070695_100584542 | |||
| 997 | Ga0070696_100212780 | |||
| 998 | Ga0070693_100003302 | |||
| 999 | Ga0070693_100069549 | |||
| 1000 | Ga0070693_100413061 | |||
| 1001 | Ga0070693_100528831 | |||
| 1002 | Ga0070704_100012668 | |||
| 1003 | Ga0070704_100283519 | |||
| 1004 | Ga0070704_101454039 | |||
| 1005 | Ga0070704_101946505 | |||
| 1006 | Ga0068855_100032708 | |||
| 1007 | Ga0068855_100082269 | |||
| 1008 | Ga0068855_100303528 | |||
| 1009 | Ga0070664_100996173 | |||
| 1010 | Ga0070664_101154495 | |||
| 1011 | Ga0068857_100257582 | |||
| 1012 | Ga0068854_100341191 | |||
| 1013 | Ga0068854_100824455 | |||
| 1014 | Ga0068854_100850445 | |||
| 1015 | Ga0068856_100097876 | |||
| 1016 | Ga0068856_100437262 | |||
| 1017 | Ga0068856_100532957 | |||
| 1018 | Ga0068856_100723351 | |||
| 1019 | Ga0070702_100301540 | |||
| 1020 | Ga0070702_100566861 | |||
| 1021 | Ga0070702_100766208 | |||
| 1022 | Ga0068852_101310903 | |||
| 1023 | Ga0068852_102590928 | |||
| 1024 | Ga0068859_101824474 | |||
| 1025 | Ga0068864_102292695 | |||
| 1026 | Ga0068866_10100190 | |||
| 1027 | Ga0068866_10290382 | |||
| 1028 | Ga0068861_100029766 | |||
| 1029 | Ga0068870_10333177 | |||
| 1030 | Ga0068870_10393666 | |||
| 1031 | Ga0068870_10616755 | |||
| 1032 | Ga0068858_101441321 | |||
| 1033 | Ga0068860_100203149 | |||
| 1034 | Ga0068860_101336447 | |||
| 1035 | Ga0081455_10049608 | |||
| 1036 | Ga0081455_10226310 | |||
| 1037 | Ga0081540_1002206 | |||
| 1038 | Ga0081540_1004965 | |||
| 1039 | Ga0081540_1019109 | |||
| 1040 | Ga0070717_10049690 | |||
| 1041 | Ga0070717_10349183 | |||
| 1042 | Ga0070717_10881246 | |||
| 1043 | Ga0070717_11267049 | |||
| 1044 | Ga0070717_11639233 | |||
| 1045 | Ga0075432_10020216 | |||
| 1046 | Ga0070715_10035033 | |||
| 1047 | Ga0070715_10077106 | |||
| 1048 | Ga0070716_100006144 | |||
| 1049 | Ga0070712_100004553 | |||
| 1050 | Ga0070712_100076280 | |||
| 1051 | Ga0070712_100280096 | |||
| 1052 | Ga0070712_100398231 | |||
| 1053 | Ga0070712_100780616 | |||
| 1054 | Ga0070712_100951634 | |||
| 1055 | Ga0097621_100006460 | |||
| 1056 | Ga0097621_100383618 | |||
| 1057 | Ga0068871_100050403 | |||
| 1058 | Ga0068871_100207648 | |||
| 1059 | Ga0068871_101423430 | |||
| 1060 | Ga0075428_100083136 | |||
| 1061 | Ga0075431_100387039 | |||
| 1062 | Ga0075431_101578009 | |||
| 1063 | Ga0075433_10293640 | |||
| 1064 | Ga0075433_11185935 | |||
| 1065 | Ga0075434_100732293 | |||
| 1066 | Ga0075434_101700409 | |||
| 1067 | Ga0068865_100100953 | |||
| 1068 | Ga0068865_100685292 | |||
| 1069 | Ga0075436_100013277 | |||
| 1070 | Ga0097620_101824343 | |||
| 1071 | Ga0075435_101179798 | |||
| 1072 | Ga0105240_10355411 | |||
| 1073 | Ga0105240_10476997 | |||
| 1074 | Ga0105240_10610132 | |||
| 1075 | Ga0105240_11242895 | |||
| 1076 | Ga0105240_12240362 | |||
| 1077 | Ga0111539_10410005 | |||
| 1078 | Ga0105245_10013780 | |||
| 1079 | Ga0105245_10026118 | |||
| 1080 | Ga0105245_10518679 | |||
| 1081 | Ga0105245_10693134 | |||
| 1082 | Ga0105245_11495577 | |||
| 1083 | Ga0105247_11185946 | |||
| 1084 | Ga0114129_10127217 | |||
| 1085 | Ga0114129_10646867 | |||
| 1086 | Ga0105243_10073149 | |||
| 1087 | Ga0105243_10919750 | |||
| 1088 | Ga0105241_10115929 | |||
| 1089 | Ga0105241_10123497 | |||
| 1090 | Ga0105242_10034248 | |||
| 1091 | Ga0105242_11025086 | |||
| 1092 | Ga0105248_11455954 | |||
| 1093 | Ga0105248_11902870 | |||
| 1094 | Ga0105238_11929748 | |||
| 1095 | Ga0105249_10036463 | |||
| 1096 | Ga0105249_11263099 | |||
| 1097 | Ga0105249_11401905 | |||
| 1098 | Ga0105239_10288743 | |||
| 1099 | Ga0105239_11502672 | |||
| 1100 | Ga0105239_13186436 | |||
| 1101 | Ga0105239_13336546 | |||
| 1102 | Ga0105246_11325773 | |||
| 1103 | Ga0157320_1005704 | |||
| 1104 | Ga0157335_1017402 | |||
| 1105 | Ga0157326_1010442 | |||
| 1106 | Ga0157338_1014109 | |||
| 1107 | Ga0157370_10824133 | |||
| 1108 | Ga0157370_11536358 | |||
| 1109 | Ga0157370_11661908 | |||
| 1110 | Ga0157369_10133899 | |||
| 1111 | Ga0157369_10420997 | |||
| 1112 | Ga0157369_10739500 | |||
| 1113 | Ga0157369_11602354 | |||
| 1114 | Ga0157374_11599158 | |||
| 1115 | Ga0157378_10372589 | |||
| 1116 | Ga0157378_10591455 | |||
| 1117 | Ga0157378_11047068 | |||
| 1118 | Ga0163162_10148770 | |||
| 1119 | Ga0163162_10418116 | |||
| 1120 | Ga0157372_10598071 | |||
| 1121 | Ga0157372_10930138 | |||
| 1122 | Ga0157372_11066462 | |||
| 1123 | Ga0157372_11666247 | |||
| 1124 | Ga0157372_12677178 | |||
| 1125 | Ga0157372_12830914 | |||
| 1126 | Ga0157375_12933610 | |||
| 1127 | Ga0163163_10566358 | |||
| 1128 | Ga0157380_10858141 | |||
| 1129 | Ga0157380_10874668 | |||
| 1130 | Ga0157380_12056882 | |||
| 1131 | Ga0182008_10001169 | |||
| 1132 | Ga0182008_10119715 | |||
| 1133 | Ga0182008_10168623 | |||
| 1134 | Ga0182008_10341121 | |||
| 1135 | Ga0182008_10712614 | |||
| 1136 | Ga0157377_10197782 | |||
| 1137 | Ga0157379_11262358 | |||
| 1138 | Ga0157376_10569500 | |||
| 1139 | Ga0157376_10590546 | |||
| 1140 | Ga0182006_1022982 | |||
| 1141 | Ga0182007_10001522 | |||
| 1142 | Ga0163161_10063249 | |||
| 1143 | Ga0163161_10770946 | |||
| 1144 | Ga0163161_11330915 | |||
| 1145 | Ga0206356_10046714 | |||
| 1146 | Ga0206356_10965810 | |||
| 1147 | Ga0206356_11478238 | |||
| 1148 | Ga0206353_11369135 | |||
| 1149 | Ga0206353_12063587 | |||
| 1150 | Ga0213874_10276159 | |||
| 1151 | Ga0213876_10005302 | |||
| 1152 | Ga0213876_10028074 | |||
| 1153 | Ga0213875_10038452 | |||
| 1154 | Ga0224712_10313497 | |||
| 1155 | Ga0207682_10293859 | |||
| 1156 | Ga0207682_10320831 | |||
| 1157 | Ga0207692_10065988 | |||
| 1158 | Ga0207692_11054955 | |||
| 1159 | Ga0207642_10186144 | |||
| 1160 | Ga0207688_10063170 | |||
| 1161 | Ga0207647_10332625 | |||
| 1162 | Ga0207685_10020349 | |||
| 1163 | Ga0207699_10984660 | |||
| 1164 | Ga0207645_10066177 | |||
| 1165 | Ga0207705_10637834 | |||
| 1166 | Ga0207705_11195903 | |||
| 1167 | Ga0207654_10609118 | |||
| 1168 | Ga0207707_10049188 | |||
| 1169 | Ga0207707_10181967 | |||
| 1170 | Ga0207707_10527304 | |||
| 1171 | Ga0207707_10653453 | |||
| 1172 | Ga0207695_10074697 | |||
| 1173 | Ga0207695_10128005 | |||
| 1174 | Ga0207695_10417182 | |||
| 1175 | Ga0207695_11277298 | |||
| 1176 | Ga0207693_10002091 | |||
| 1177 | Ga0207693_10007849 | |||
| 1178 | Ga0207693_10183540 | |||
| 1179 | Ga0207693_10507060 | |||
| 1180 | Ga0207693_10788172 | |||
| 1181 | Ga0207663_10116855 | |||
| 1182 | Ga0207663_10245785 | |||
| 1183 | Ga0207660_10170917 | |||
| 1184 | Ga0207660_10356550 | |||
| 1185 | Ga0207660_10606465 | |||
| 1186 | Ga0207660_10955576 | |||
| 1187 | Ga0207662_10130970 | |||
| 1188 | Ga0207657_10359135 | |||
| 1189 | Ga0207657_10449252 | |||
| 1190 | Ga0207657_11141354 | |||
| 1191 | Ga0207649_10759244 | |||
| 1192 | Ga0207652_10219888 | |||
| 1193 | Ga0207652_10367007 | |||
| 1194 | Ga0207652_11612064 | |||
| 1195 | Ga0207646_10000523 | |||
| 1196 | Ga0207646_10318001 | |||
| 1197 | Ga0207646_11231577 | |||
| 1198 | Ga0207681_10018104 | |||
| 1199 | Ga0207687_10101930 | |||
| 1200 | Ga0207687_10743455 | |||
| 1201 | Ga0207687_10854308 | |||
| 1202 | Ga0207700_10128074 | |||
| 1203 | Ga0207700_10184237 | |||
| 1204 | Ga0207700_10282486 | |||
| 1205 | Ga0207700_10885651 | |||
| 1206 | Ga0207664_10142470 | |||
| 1207 | Ga0207664_10461442 | |||
| 1208 | Ga0207664_10548951 | |||
| 1209 | Ga0207664_11219602 | |||
| 1210 | Ga0207644_10142480 | |||
| 1211 | Ga0207644_10179265 | |||
| 1212 | Ga0207644_10649900 | |||
| 1213 | Ga0207690_10748113 | |||
| 1214 | Ga0207706_10010184 | |||
| 1215 | Ga0207706_10022429 | |||
| 1216 | Ga0207686_11106383 | |||
| 1217 | Ga0207686_11341484 | |||
| 1218 | Ga0207709_10076211 | |||
| 1219 | Ga0207709_10299165 | |||
| 1220 | Ga0207709_10691095 | |||
| 1221 | Ga0207670_11689852 | |||
| 1222 | Ga0207669_10443420 | |||
| 1223 | Ga0207669_11170438 | |||
| 1224 | Ga0207704_10697646 | |||
| 1225 | Ga0207665_10070562 | |||
| 1226 | Ga0207665_10270465 | |||
| 1227 | Ga0207665_10485910 | |||
| 1228 | Ga0207665_11353103 | |||
| 1229 | Ga0207691_10483206 | |||
| 1230 | Ga0207691_10981706 | |||
| 1231 | Ga0207711_11269610 | |||
| 1232 | Ga0207689_10352300 | |||
| 1233 | Ga0207689_10979129 | |||
| 1234 | Ga0207661_10401928 | |||
| 1235 | Ga0207661_12075005 | |||
| 1236 | Ga0207667_10081446 | |||
| 1237 | Ga0207667_10133805 | |||
| 1238 | Ga0207667_11080268 | |||
| 1239 | Ga0207651_10909356 | |||
| 1240 | Ga0207712_10036215 | |||
| 1241 | Ga0207712_10059963 | |||
| 1242 | Ga0207668_10006182 | |||
| 1243 | Ga0207668_10156377 | |||
| 1244 | Ga0207640_10332213 | |||
| 1245 | Ga0207640_12091273 | |||
| 1246 | Ga0207640_12150726 | |||
| 1247 | Ga0207658_10232325 | |||
| 1248 | Ga0207677_10200562 | |||
| 1249 | Ga0207639_10859284 | |||
| 1250 | Ga0207639_11614805 | |||
| 1251 | Ga0207678_10286798 | |||
| 1252 | Ga0207678_10734082 | |||
| 1253 | Ga0207678_10819604 | |||
| 1254 | Ga0207708_10116305 | |||
| 1255 | Ga0207702_10089121 | |||
| 1256 | Ga0207702_11833783 | |||
| 1257 | Ga0207648_10021873 | |||
| 1258 | Ga0207648_10271840 | |||
| 1259 | Ga0207676_12218869 | |||
| 1260 | Ga0207674_10815924 | |||
| 1261 | Ga0207675_100002763 | |||
| 1262 | Ga0207675_100043272 | |||
| 1263 | Ga0207683_10003820 | |||
| 1264 | Ga0207683_10126854 | |||
| 1265 | Ga0207683_10261572 | |||
| 1266 | Ga0207698_10639715 | |||
| 1267 | Ga0207428_10001749 | |||
| 1268 | Ga0268265_12330138 | |||
| 1269 | Ga0268264_10301904 | |||
| 1270 | Ga0268264_11082515 | |||
| 1271 | Ga0265319_1253164 | |||
| 1272 | Ga0265334_10057519 | |||
| 1273 | Ga0265318_10312988 | |||
| 1274 | Ga0265322_10004957 | |||
| 1275 | Ga0265338_10016797 | |||
| 1276 | Ga0265338_10333043 | |||
| 1277 | Ga0265332_10075196 | |||
| 1278 | Ga0265320_10069464 | |||
| 1279 | Ga0265325_10009897 | |||
| 1280 | Ga0265340_10048790 | |||
| 1281 | Ga0265340_10298514 | |||
| 1282 | Ga0265339_10043531 | |||
| 1283 | Ga0265331_10101001 | |||
| 1284 | Ga0265327_10003899 | |||
| 1285 | Ga0265316_10004010 | |||
| 1286 | Ga0265313_10004245 | |||
| 1287 | Ga0265314_10010034 | |||
| 1288 | Ga0265342_10302641 | |||
| 1289 | Ga0307412_10926851 | |||
| 1290 | Ga0307409_102874281 | |||
| 1291 | Ga0307416_100161639 | |||
| 1292 | Ga0307416_100222961 | |||
| 1293 | Ga0307411_10957721 | |||
| 1294 | Ga0307415_100210936 | |||
| 1295 | Ga0373950_0075882 | |||
| 1296 | Ga0373959_0135283 | |||
| 1297 | Ga0373929_0037565 | |||
| 1298 | Ga0373940_0017271 | |||
| 1299 | Ga0373944_0025477 | |||
| 1300 | Ga0373944_0085325 | |||
| 1301 | Ga0373932_0150808 | |||
| 1302 | Ga0373936_0122021 | |||
| 1303 | Ga0373941_0286350 | |||
| 1304 | Ga0373945_0015131 | |||
| 1305 | Ga0373953_0377228 | |||
| 1306 | Ga0373956_0063617 | |||
| 1307 | Ga0373956_0319531 | |||
| 1308 | Ga0373956_0496352 | |||
| 1309 | Ga0373957_0091442 | |||
| 1310 | Ga0373960_0020482 | |||
| 1311 | Ga0373960_0104494 | |||
| 1312 | Ga0373943_0012237 | |||
| 1313 | Ga0373943_0244534 | |||
| 1314 | Ga0373943_0410276 | |||
| 1315 | Ga0373946_0162870 | |||
| 1316 | Ga0373946_0613394 | |||
| 1317 | Ga0373946_0681011 | |||
| 1318 | Ga0373955_0354823 | |||
| 1319 | Ga0373942_0022656 | |||
| 1320 | Ga0373942_0116200 | |||
| 1321 | Ga0373961_0011219 | |||
| 1322 | Ga0373961_0136555 | |||
| 1323 | Ga0373962_0078265 | |||
| 1324 | Ga0373924_0040038 | |||
| 1325 | Ga0373924_0132210 | |||
| 1326 | Ga0373924_0302778 | |||
| 1327 | Ga0373931_0119213 | |||
| 1328 | Ga0373931_0275425 | |||
| 1329 | Ga0373935_0012688 | |||
| 1330 | Ga0373935_0487032 | |||
| 1331 | Ga0373933_0189374 | |||
| 1332 | Ga0373947_0000770 | |||
| 1333 | Ga0373947_0117301 | |||
| 1334 | Ga0373947_0644671 | |||
| 1335 | Ga0373947_0776078 | |||
| 1336 | Ga0373937_0246279 | |||
| 1337 | Ga0373937_1321019 | |||
| 1338 | Ga0373925_0010352 | |||
| 1339 | Ga0373925_1507147 | |||
| 1340 | Ga0395899_0058245 | |||
| 1341 | Ga0395899_0153479 | |||
| 1342 | Ga0395899_0201751 | |||
| 1343 | Ga0395900_0002122 | |||
| 1344 | Ga0395900_0116281 | |||
| 1345 | Ga0395900_0117438 | |||
| 1346 | Ga0395900_0231295 | |||
| 1347 | Ga0395900_1037516 | |||
| 1348 | Ga0395900_1907004 | |||
| 1349 | Ga0395898_0002136 | |||
| 1350 | Ga0395898_0002238 | |||
| 1351 | Ga0395898_0002255 | |||
| 1352 | Ga0395898_0555735 | |||
| 1353 | Ga0395898_0580892 | |||
| 1354 | Ga0395898_0643479 | |||
| 1355 | Ga0395905_0001065 | |||
| 1356 | Ga0395905_0037126 | |||
| 1357 | Ga0395905_0160047 | |||
| 1358 | Ga0395905_0279215 | |||
| 1359 | Ga0395905_0342275 | |||
| 1360 | Ga0395905_1870246 | |||
| 1361 | Ga0436364_1051529 | |||
| 1362 | Ga0436364_1273932 | |||
| 1363 | Ga0395901_0001460 | |||
| 1364 | Ga0395901_0035317 | |||
| 1365 | Ga0395901_0046527 | |||
| 1366 | Ga0395901_0227484 | |||
| 1367 | Ga0395901_0249917 | |||
| 1368 | Ga0395901_0518386 | |||
| 1369 | Ga0395901_0625265 | |||
| 1370 | Ga0395901_0736963 | |||
| 1371 | Ga0395901_1826107 | |||
| 1372 | Ga0242420_008053 | |||
| 1373 | Ga0436365_0121270 | |||
| 1374 | Ga0436365_0273214 | |||
| 1375 | Ga0436363_0200906 | |||
| 1376 | Ga0436363_1222508 | |||
| 1377 | Ga0436363_1712560 | |||
| 1378 | Ga0436362_0095914 | |||
| 1379 | Ga0439461_0001353 | |||
| 1380 | Ga0439466_0041059 | |||
| 1381 | Ga0451793_1370022 | |||
| 1382 | Ga0451798_0027903 | |||
| 1383 | Ga0451800_0747455 | |||
| 1384 | Ga0451800_1532795 | |||
| 1385 | Ga0451835_0166831 | |||
| 1386 | Ga0451835_0846564 | |||
| 1387 | Ga0451835_0929677 | |||
| 1388 | Ga0451847_0010074 | |||
| 1389 | Ga0451853_0301340 | |||
| 1390 | Ga0451853_0680311 | |||
| 1391 | Ga0451853_1808990 | |||
| 1392 | Ga0451853_3331639 | |||
| 1393 | Ga0439431_0052794 | |||
| 1394 | Ga0439448_0007089 | |||
| 1395 | Ga0439448_0106857 | |||
| 1396 | Ga0439463_109490 | |||
| 1397 | Ga0450907_055649 | |||
| 1398 | Ga0439446_0018685 | |||
| 1399 | Ga0439458_0052133 | |||
| 1400 | Ga0439464_0063108 | |||
| 1401 | Ga0466969_0027273 | |||
| 1402 | Ga0466972_0161594 | |||
| 1403 | Ga0466972_0327463 | |||
| 1404 | Ga0466965_0013055 | |||
| 1405 | Ga0466965_0049575 | |||
| 1406 | Ga0466965_0225456 | |||
| 1407 | Ga0466966_0044313 | |||
| 1408 | Ga0466966_0431375 | |||
| 1409 | Ga0466961_0005586 | |||
| 1410 | Ga0466961_0024499 | |||
| 1411 | Ga0466961_0143729 | |||
| 1412 | Ga0466961_0150883 | |||
| 1413 | Ga0466961_0932536 | |||
| 1414 | Ga0466963_0000482 | |||
| 1415 | Ga0466963_0001696 | |||
| 1416 | Ga0466963_0002627 | |||
| 1417 | Ga0466963_0005909 | |||
| 1418 | Ga0466963_0010624 | |||
| 1419 | Ga0466963_0019739 | |||
| 1420 | Ga0466963_0021423 | |||
| 1421 | Ga0466963_0031970 | |||
| 1422 | Ga0466963_0032835 | |||
| 1423 | Ga0466963_0063913 | |||
| 1424 | Ga0466963_0064531 | |||
| 1425 | Ga0466963_0102989 | |||
| 1426 | Ga0466963_0109960 | |||
| 1427 | Ga0466963_0145955 | |||
| 1428 | Ga0466963_0241941 | |||
| 1429 | Ga0466963_0748485 | |||
| 1430 | Ga0466963_1043130 | |||
| 1431 | Ga0466963_1293195 | |||
| 1432 | Ga0466964_0003414 | |||
| 1433 | Ga0466964_0020297 | |||
| 1434 | Ga0466964_0028446 | |||
| 1435 | Ga0466964_0054369 | |||
| 1436 | Ga0466964_0059776 | |||
| 1437 | Ga0466964_0095620 | |||
| 1438 | Ga0466964_0846665 | |||
| 1439 | Ga0466971_0001805 | |||
| 1440 | Ga0466971_0004784 | |||
| 1441 | Ga0466971_0032012 | |||
| 1442 | Ga0466971_0250426 | |||
| 1443 | Ga0466968_0008584 | |||
| 1444 | Ga0466968_0042076 | |||
| 1445 | Ga0466968_0060638 | |||
| 1446 | Ga0466970_0065140 | |||
| 1447 | Ga0466970_0127942 | |||
| 1448 | Ga0466970_0661671 | |||
| 1449 | Ga0466957_0005137 | |||
| 1450 | Ga0466957_0011744 | |||
| 1451 | Ga0466957_0012546 | |||
| 1452 | Ga0466957_0013491 | |||
| 1453 | Ga0466957_0077694 | |||
| 1454 | Ga0466957_0081326 | |||
| 1455 | Ga0466957_0110669 | |||
| 1456 | Ga0466957_0174778 | |||
| 1457 | Ga0466957_0318325 | |||
| 1458 | Ga0466957_0831405 | |||
| 1459 | Ga0466957_0991743 | |||
| 1460 | Ga0466957_1014522 | |||
| 1461 | Ga0466960_0002382 | |||
| 1462 | Ga0466960_0132182 | |||
| 1463 | Ga0466960_0394034 | |||
| 1464 | Ga0466959_0006797 | |||
| 1465 | Ga0466959_0018649 | |||
| 1466 | Ga0466959_0060966 | |||
| 1467 | Ga0466959_0080902 | |||
| 1468 | Ga0466959_0346746 | |||
| 1469 | Ga0451576_0038025 | |||
| 1470 | Ga0451576_0666637 | |||
| 1471 | Ga0466958_0008945 | |||
| 1472 | Ga0466958_0009049 | |||
| 1473 | Ga0466958_0016619 | |||
| 1474 | Ga0466958_0062518 | |||
| 1475 | Ga0466958_0079202 | |||
| 1476 | Ga0466958_0101134 | |||
| 1477 | Ga0466958_0102677 | |||
| 1478 | Ga0466958_0242179 | |||
| 1479 | Ga0466958_0279987 | |||
| 1480 | Ga0466958_0571334 | |||
| 1481 | Ga0466958_0644566 | |||
| 1482 | Ga0466958_0841803 | |||
| 1483 | Ga0466967_0004099 | |||
| 1484 | Ga0466967_0004107 | |||
| 1485 | Ga0466967_0005413 | |||
| 1486 | Ga0466967_0012096 | |||
| 1487 | Ga0466967_0014265 | |||
| 1488 | Ga0466967_0017302 | |||
| 1489 | Ga0466967_0020252 | |||
| 1490 | Ga0466967_0022553 | |||
| 1491 | Ga0466967_0029598 | |||
| 1492 | Ga0466967_0035194 | |||
| 1493 | Ga0466967_0074064 | |||
| 1494 | Ga0466967_0079712 | |||
| 1495 | Ga0466967_0086218 | |||
| 1496 | Ga0466967_0099691 | |||
| 1497 | Ga0466967_0116230 | |||
| 1498 | Ga0466967_0125915 | |||
| 1499 | Ga0466967_0323418 | |||
| 1500 | Ga0466967_0360417 | |||
| 1501 | Ga0466967_0364602 | |||
| 1502 | Ga0466967_0378473 | |||
| 1503 | Ga0466967_0453245 | |||
| 1504 | Ga0466967_0469006 | |||
| 1505 | Ga0466967_0482680 | |||
| 1506 | Ga0466967_0936154 | |||
| 1507 | Ga0466967_1463707 | |||
| 1508 | Ga0466967_1542779 | |||
| 1509 | Ga0495592_0114079 | |||
| 1510 | Ga0495592_0256156 | |||
| 1511 | Ga0495592_0345395 | |||
| 1512 | Ga0495603_0001930 | |||
| 1513 | Ga0495603_0124722 | |||
| 1514 | Ga0495629_0237331 | |||
| 1515 | Ga0495629_0278455 | |||
| 1516 | Ga0495641_0000786 | |||
| 1517 | Ga0495641_0100366 | |||
| 1518 | Ga0495641_0131141 | |||
| 1519 | Ga0495651_0644355 | |||
| 1520 | Ga0495653_0096938 | |||
| 1521 | Ga0495653_0409014 | |||
| 1522 | Ga0495653_0606428 | |||
| 1523 | Ga0495580_0055313 | |||
| 1524 | Ga0495582_0010387 | |||
| 1525 | Ga0495582_0067084 | |||
| 1526 | Ga0495582_0595524 | |||
| 1527 | Ga0495605_0227158 | |||
| 1528 | Ga0495664_0051708 | |||
| 1529 | Ga0495664_0108708 | |||
| 1530 | Ga0495664_0169292 | |||
| 1531 | Ga0495584_0256072 | |||
| 1532 | Ga0495584_0577490 | |||
| 1533 | Ga0495585_0369235 | |||
| 1534 | Ga0495594_0000915 | |||
| 1535 | Ga0495596_0188540 | |||
| 1536 | Ga0495596_0226109 | |||
| 1537 | Ga0495607_0151633 | |||
| 1538 | Ga0495608_0092973 | |||
| 1539 | Ga0495608_0123724 | |||
| 1540 | Ga0495608_0279230 | |||
| 1541 | Ga0495618_0071215 | |||
| 1542 | Ga0495628_0085846 | |||
| 1543 | Ga0495628_0647580 | |||
| 1544 | Ga0495630_0123181 | |||
| 1545 | Ga0495630_0210989 | |||
| 1546 | Ga0495630_0234103 | |||
| 1547 | Ga0495630_0314789 | |||
| 1548 | Ga0495644_0280587 | |||
| 1549 | Ga0495663_0081448 | |||
| 1550 | Ga0495663_0094968 | |||
| 1551 | Ga0495666_0219681 | |||
| 1552 | Ga0495652_0081495 | |||
| 1553 | Ga0495652_0116214 | |||
| 1554 | Ga0495665_0227013 | |||
| 1555 | Ga0495640_0180087 | |||
| 1556 | Ga0495586_0043514 | |||
| 1557 | Ga0495587_0044347 | |||
| 1558 | Ga0495587_0143362 | |||
| 1559 | Ga0495598_0117107 | |||
| 1560 | Ga0495609_0140515 | |||
| 1561 | Ga0495645_0103084 | |||
| 1562 | Ga0495645_0132161 | |||
| 1563 | Ga0495645_0193256 | |||
| 1564 | Ga0495633_0403859 | |||
| 1565 | Ga0495667_0092464 | |||
| 1566 | Ga0495667_0155978 | |||
| 1567 | Ga0495667_0220125 | |||
| 1568 | Ga0495656_0146080 | |||
| 1569 | Ga0495668_0840823 | |||
| 1570 | Ga0495634_0243979 | |||
| 1571 | Ga0495634_0281943 | |||
| 1572 | Ga0495634_0389748 | |||
| 1573 | Ga0495635_0062124 | |||
| 1574 | Ga0495635_0492222 | |||
| 1575 | Ga0495588_0000409 | |||
| 1576 | Ga0495588_0337224 | |||
| 1577 | Ga0495657_0037606 | |||
| 1578 | Ga0495657_0041833 | |||
| 1579 | Ga0495657_0111758 | |||
| 1580 | Ga0495599_0197172 | |||
| 1581 | Ga0495599_0262786 | |||
| 1582 | Ga0495623_0145720 | |||
| 1583 | Ga0495623_0315708 | |||
| 1584 | Ga0495646_0069904 | |||
| 1585 | Ga0495646_0184746 | |||
| 1586 | Ga0495646_0243112 | |||
| 1587 | Ga0495647_0342795 | |||
| 1588 | Ga0495658_0259714 | |||
| 1589 | Ga0495658_0427233 | |||
| 1590 | Ga0495658_0463872 | |||
| 1591 | Ga0495658_0657365 | |||
| 1592 | Ga0495669_0332549 | |||
| 1593 | Ga0495613_0127540 | |||
| 1594 | Ga0495613_0514952 | |||
| 1595 | Ga0495624_0073114 | |||
| 1596 | Ga0495624_0534026 | |||
| 1597 | Ga0495671_0237456 | |||
| 1598 | Ga0495589_0171618 | |||
| 1599 | Ga0495589_0301721 | |||
| 1600 | Ga0495600_0113701 | |||
| 1601 | Ga0495581_0283797 | |||
| 1602 | Ga0495604_0134778 | |||
| 1603 | Ga0495604_0189034 | |||
| 1604 | Ga0495604_0439752 | |||
| 1605 | Ga0495636_0280623 | |||
| 1606 | Ga0495674_0009149 | |||
| 1607 | Ga0495674_0366446 | |||
| 1608 | Ga0495676_0002605 | |||
| 1609 | Ga0495676_0343465 | |||
| 1610 | Ga0495676_0776768 | |||
| 1611 | Ga0495680_0035962 | |||
| 1612 | Ga0495680_0090783 | |||
| 1613 | Ga0495680_0300605 | |||
| 1614 | Ga0495675_0109435 | |||
| 1615 | Ga0495675_0152363 | |||
| 1616 | Ga0495675_0383214 | |||
| 1617 | Ga0495677_0101844 | |||
| 1618 | Ga0495679_140961 | |||
| 1619 | Ga0495685_130002 | |||
| 1620 | Ga0495684_0139049 | |||
| 1621 | Ga0495684_0231196 | |||
| 1622 | Ga0495684_0761143 | |||
| 1623 | Ga0495593_0391779 | |||
| 1624 | Ga0495602_0107144 | |||
| 1625 | Ga0495602_0273527 | |||
| 1626 | Ga0495602_0441664 | |||
| 1627 | Ga0495602_0676779 | |||
| 1628 | Ga0495614_0400067 | |||
| 1629 | Ga0495615_0133843 | |||
| 1630 | Ga0495626_0276658 | |||
| 1631 | Ga0496100_0105848 | |||
| 1632 | Ga0496100_0148417 | |||
| 1633 | Ga0496100_0474573 | |||
| 1634 | Ga0496100_0544531 | |||
| 1635 | Ga0496100_0553661 | |||
| 1636 | Ga0496101_0002385 | |||
| 1637 | Ga0496101_0031469 | |||
| 1638 | Ga0496101_0069766 | |||
| 1639 | Ga0496101_0136326 | |||
| 1640 | Ga0496101_0161836 | |||
| 1641 | Ga0496101_0319198 | |||
| 1642 | Ga0496101_0592054 | |||
| 1643 | Ga0496102_0027799 | |||
| 1644 | Ga0496102_0047206 | |||
| 1645 | Ga0496102_0225608 | |||
| 1646 | Ga0496102_0434203 | |||
| 1647 | Ga0496102_0484384 | |||
| 1648 | Ga0496102_0490579 | |||
| 1649 | Ga0496102_0656975 | |||
| 1650 | Ga0496102_0722089 | |||
| 1651 | Ga0496103_0004252 | |||
| 1652 | Ga0496103_0064727 | |||
| 1653 | Ga0496103_0105344 | |||
| 1654 | Ga0496103_0178071 | |||
| 1655 | Ga0496103_0207904 | |||
| 1656 | Ga0496103_0969970 | |||
| 1657 | Ga0496104_0003324 | |||
| 1658 | Ga0496104_0051079 | |||
| 1659 | Ga0496104_0225497 | |||
| 1660 | Ga0496104_0420465 | |||
| 1661 | Ga0496104_0949496 | |||
| 1662 | Ga0496105_0002977 | |||
| 1663 | Ga0496105_0008104 | |||
| 1664 | Ga0496105_0026004 | |||
| 1665 | Ga0496105_0066590 | |||
| 1666 | Ga0496105_0540614 | |||
| 1667 | Ga0496105_0575369 | |||
| 1668 | Ga0496105_1075531 | |||
| 1669 | Ga0496106_0012098 | |||
| 1670 | Ga0496106_0127162 | |||
| 1671 | Ga0496106_0265348 | |||
| 1672 | Ga0496106_0612959 | |||
| 1673 | Ga0496106_0709396 | |||
| 1674 | Ga0496106_0776200 | |||
| 1675 | Ga0496106_1063525 | |||
| 1676 | Ga0496107_0006099 | |||
| 1677 | Ga0496107_0021698 | |||
| 1678 | Ga0496107_0086348 | |||
| 1679 | Ga0496107_0123295 | |||
| 1680 | Ga0496107_0247076 | |||
| 1681 | Ga0496107_0551706 | |||
| 1682 | Ga0496107_0648666 | |||
| 1683 | Ga0496108_0019950 | |||
| 1684 | Ga0496108_0063050 | |||
| 1685 | Ga0496108_0563048 | |||
| 1686 | Ga0496108_1004203 | |||
| 1687 | Ga0496109_0008605 | |||
| 1688 | Ga0496109_0027881 | |||
| 1689 | Ga0496109_0428340 | |||
| 1690 | Ga0496109_0813664 | |||
| 1691 | Ga0496109_1333195 | |||
| 1692 | Ga0496110_0002261 | |||
| 1693 | Ga0496110_0003921 | |||
| 1694 | Ga0496110_0126092 | |||
| 1695 | Ga0496110_1047074 | |||
| 1696 | Ga0496110_1213158 | |||
| 1697 | Ga0496111_0004014 | |||
| 1698 | Ga0496111_0004077 | |||
| 1699 | Ga0496111_0089764 | |||
| 1700 | Ga0496111_0502209 | |||
| 1701 | Ga0496112_0036941 | |||
| 1702 | Ga0496112_0046394 | |||
| 1703 | Ga0496112_0375293 | |||
| 1704 | Ga0496112_0484273 | |||
| 1705 | Ga0496112_0713205 | |||
| 1706 | Ga0496112_1356435 | |||
| 1707 | Ga0496113_0000346 | |||
| 1708 | Ga0496113_0006351 | |||
| 1709 | Ga0496113_0050632 | |||
| 1710 | Ga0496113_0103365 | |||
| 1711 | Ga0496113_0126973 | |||
| 1712 | Ga0496113_0773037 | |||
| 1713 | Ga0496114_0072608 | |||
| 1714 | Ga0496114_0102828 | |||
| 1715 | Ga0496114_0123532 | |||
| 1716 | Ga0496114_0347187 | |||
| 1717 | Ga0496114_0378997 | |||
| 1718 | Ga0496114_0605939 | |||
| 1719 | Ga0496114_1069565 | |||
| 1720 | Ga0496115_0008562 | |||
| 1721 | Ga0496115_0076075 | |||
| 1722 | Ga0496115_0178383 | |||
| 1723 | Ga0496115_0235598 | |||
| 1724 | Ga0496115_0606708 | |||
| 1725 | Ga0496115_0649385 | |||
| 1726 | Ga0501034_0141036 | |||
| 1727 | Ga0501034_0203796 | |||
| 1728 | Ga0501046_0410639 | |||
| 1729 | Ga0501047_0038554 | |||
| 1730 | Ga0501047_0245662 | |||
| 1731 | Ga0501047_0547734 | |||
| 1732 | Ga0501067_0003180 | |||
| 1733 | Ga0501067_0084376 | |||
| 1734 | Ga0501067_0546618 | |||
| 1735 | Ga0501067_0657488 | |||
| 1736 | Ga0501068_0075511 | |||
| 1737 | Ga0501069_0008869 | |||
| 1738 | Ga0501069_0306865 | |||
| 1739 | Ga0501069_0323748 | |||
| 1740 | Ga0501070_0017966 | |||
| 1741 | Ga0501070_0259444 | |||
| 1742 | Ga0501070_0402268 | |||
| 1743 | Ga0501072_0007341 | |||
| 1744 | Ga0501073_0097117 | |||
| 1745 | Ga0501074_0299801 | |||
| 1746 | Ga0501079_0177313 | |||
| 1747 | Ga0501080_0005292 | |||
| 1748 | Ga0501080_0147180 | |||
| 1749 | Ga0501080_0208549 | |||
| 1750 | Ga0501080_1149996 | |||
| 1751 | Ga0501083_0000319 | |||
| 1752 | Ga0501044_0171108 | |||
| 1753 | Ga0501044_1062408 | |||
| 1754 | nmdc:mga05p37_761467_c1 | |||
| 1755 | nmdc:mga05p37_98452_c1 | |||
| 1756 | nmdc:mga09592_158300_c1 | |||
| 1757 | nmdc:mga06r32_480382_c1 | |||
| 1758 | nmdc:mga08y16_311019_c1 | |||
| 1759 | nmdc:mga0n895_508543_c1 | |||
| 1760 | nmdc:mga0n895_82527_c1 | |||
| 1761 | nmdc:mga0rr50_52393_c1 | |||
| 1762 | nmdc:mga08x19_21068_c1 | |||
| 1763 | nmdc:mga08x19_276428_c1 | |||
| 1764 | nmdc:mga0a205_1282466_c1 | |||
| 1765 | nmdc:mga0a205_156435_c1 | |||
| 1766 | nmdc:mga0a205_189614_c1 | |||
| 1767 | Ga0495601_0132143 | |||
| 1768 | Ga0495601_0230638 | |||
| 1769 | Ga0495601_0448397 | |||
| 1770 | Ga0495595_0090235 | |||
| 1771 | Ga0495619_1085232 | |||
| 1772 | Ga0501084_0624802 | |||
| 1773 | Ga0587079_219935 | |||
| 1774 | Ga0466962_0000661 | |||
| 1775 | Ga0466962_0007279 | |||
| 1776 | Ga0530510_0105987 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nst-assembly1.cif.gz_A | crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans | 0.9234 | 31 | 106 |
| 4e2g-assembly2.cif.gz_C | crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus | 0.9078 | 29 | 106 |
| 6o2d-assembly1.cif.gz_A | schizosaccharomyces pombe cnp3 cupin domain | 0.894 | 31 | 108 |
| 5fpz-assembly1.cif.gz_A-2 | the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. | 0.8936 | 20 | 109 |
| 3bu7-assembly1.cif.gz_B | crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi | 0.891 | 31 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PPZ7_421_512_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9173 | 32 | 109 | 2.60.120.10 |
| 2h0vB02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9139 | 32 | 106 | 2.60.120.10 |
| 3cewA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9066 | 19 | 115 | 2.60.120.10 |
| 5wxuB02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9 | 31 | 108 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8999 | 29 | 108 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538MVR0-F1-model_v4 | Cupin domain-containing protein | 0.9943 | 1 | 118 |
|
| AF-A0A538CV03-F1-model_v4 | Cupin domain-containing protein | 0.9884 | 1 | 98 |
|
| AF-A0A538MVR0-F1-model_v4 | Cupin domain-containing protein | 0.986 | 1 | 118 |
|
| AF-A0A538KJQ7-F1-model_v4 | Cupin domain-containing protein | 0.9853 | 1 | 118 |
|
| AF-A0A538CV03-F1-model_v4 | Cupin domain-containing protein | 0.9785 | 1 | 98 |
|