F484641

General Info

Members Datasets Scaffolds Average Seq Length
884 337 857 405

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0212890|Ga0496115_0212890_257_1453
Length 398
Sequence MNLHEYQGKEILASHGVRVQRGIVANSPAEAVAAAKQLTAETGTSWHVVKAQIHAGGRGKGGGVKLAKNLQQVEEIAGQIIGMDLITPQTPPTGKRVHKILVAEDVYYPGESETSEFYMSVLLNRGKGRNMIMYSTEGGMDIEEVAEHTPHLIFTEEIDPAVGLQGFQVRRIAFNLGLSGNAFKEMTAFVAALYKAYIDSDASMFEINPVLKTSDNKILAVDAKVALDDNALYRQKKYADMRDIREENPIEVEAKEVGLNYVDLDGTVGCMVNGAGLAMATMDLIKYAGFEPANFLDVGGTADAKRVETAFRIILKDENVKAILINIFGGIVRCDRVAQGVVDAYKNMGDSIKVPIIVRLQGTNAEIAKELIDNSGMPILSATLFQEAADQVKAALSK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
5 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
6 2818991444 Filimonas endophytica 3197 Isolate Unclassified
7 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
8 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
9 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
10 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
11 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
12 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
13 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
14 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
15 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
16 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
17 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
18 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
19 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
20 2914759650 Rhizosphaericola mali Isolate Rhizosphere
21 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
22 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
23 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
24 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
25 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
26 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
27 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
28 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
29 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
30 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
31 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
38 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
45 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
146 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
209 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
210 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
213 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
214 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
241 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
242 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
243 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
244 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
245 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
246 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
247 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
293 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
294 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
295 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
296 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
297 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
298 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
299 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
300 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
301 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
304 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
315 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
316 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
317 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
318 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
319 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
320 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
321 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
322 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
323 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
324 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
325 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
326 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
327 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
328 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
331 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
332 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
333 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
336 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
337 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0.23
Isolates 3.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.35
Nodule 0
Rhizoplane 0.68
Rhizosphere 85.75
Stem 0
Stem Tuber 0
Unclassified 6.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 JGI24751J29686_10000335 3300002459 Bacteria 17022
3 JGI25154J39366_1000293 3300002738 Bacteria 29883
4 JGI25406J46586_10012667 3300003203 Bacteria 3646
5 JGI25153J46596_10001122 3300003215 Bacteria 16227
6 rootH1_10026195 3300003316 Bacteria 28231
7 rootH2_10008034 3300003320 Bacteria 73088
8 rootH2_10009544 3300003320 Bacteria 42409
9 rootL2_10007707 3300003322 Bacteria 12551
10 rootH1_10000938 3300003323 Bacteria 9989
11 rootH1_10000939 3300003323 Bacteria 3587
12 rootH1_10000940 3300003323 Bacteria 88997
13 rootH1_10007034 3300003323 Bacteria 6079
14 rootH1_10009521 3300003316 Bacteria 3977
15 rootH1_10009521 3300003323 Bacteria 38733
16 rootH1_10204701 3300003323 Bacteria 3352
17 JGI25160J50197_1003310 3300003354 Bacteria 7253
18 JGI25160J50197_1005348 3300003354 Bacteria 5361
19 Ga0055535_1001325 3300003761 Bacteria 13183
20 Ga0055542_1003062 3300003762 Bacteria 4823
21 Ga0055528_1001409 3300003790 Bacteria 14726
22 Ga0055528_1003892 3300003790 Bacteria 7340
23 Ga0055531_10000237 3300003794 Bacteria 60479
24 Ga0065165_1000190 3300005262 Bacteria 107377
25 Ga0065165_1009020 3300005262 Bacteria 4550
26 Ga0065165_1014165 3300005262 Bacteria 3113
27 Ga0065714_10003401 3300005288 Bacteria 9196
28 Ga0065714_10106522 3300005288 Bacteria 1534
29 Ga0065704_10070140 3300005289 Bacteria 482257
30 Ga0065704_10071188 3300005289 Bacteria 12593
31 Ga0065704_10155100 3300005289 Bacteria 1397
32 Ga0065712_10071492 3300005290 Bacteria 5221
33 Ga0065715_10120220 3300005293 Bacteria 2264
34 Ga0070658_10021911 3300005327 Bacteria 5124
35 Ga0070658_10074306 3300005327 Bacteria 2788
36 Ga0070658_10096594 3300005327 Bacteria 2439
37 Ga0070658_10180295 3300005327 Bacteria 1777
38 Ga0070658_10256511 3300005327 Bacteria 1484
39 Ga0070676_10003818 3300005328 Bacteria 7904
40 Ga0070676_10012539 3300005328 Bacteria 4632
41 Ga0070683_100001758 3300005329 Bacteria 16869
42 Ga0070683_100002901 3300005329 Bacteria 13732
43 Ga0070683_100004709 3300005329 Bacteria 11275
44 Ga0070683_100018792 3300005329 Bacteria 6129
45 Ga0070690_100112179 3300005330 Bacteria 1821
46 Ga0070690_100134853 3300005330 Bacteria 1671
47 Ga0070670_100042195 3300005331 Bacteria 3921
48 Ga0070670_100067020 3300005331 Bacteria 3081
49 Ga0070670_100073046 3300005331 Bacteria 2947
50 Ga0070670_100085279 3300005331 Bacteria 2713
51 Ga0070670_100087106 3300005331 Bacteria 2684
52 Ga0070670_100098114 3300005331 Bacteria 2521
53 Ga0070677_10004868 3300005333 Bacteria 4407
54 Ga0068869_100009712 3300005334 Bacteria 6249
55 Ga0068869_100027952 3300005334 Bacteria 3936
56 Ga0068869_100060172 3300005334 Bacteria 2783
57 Ga0070666_10000411 3300005335 Bacteria 26651
58 Ga0070666_10002153 3300005335 Bacteria 11964
59 Ga0070666_10008024 3300005335 Bacteria 6532
60 Ga0070666_10069839 3300005335 Bacteria 2389
61 Ga0070680_100001025 3300005336 Bacteria 19985
62 Ga0070680_100011225 3300005336 Bacteria 6929
63 Ga0070680_100029784 3300005336 Bacteria 4382
64 Ga0070680_100055254 3300005336 Bacteria 3244
65 Ga0070680_100105493 3300005336 Bacteria 2342
66 Ga0070680_100235342 3300005336 Bacteria 1547
67 Ga0070682_100000054 3300005337 Bacteria 112635
68 Ga0070682_100011589 3300005337 Bacteria 5041
69 Ga0070682_100129528 3300005337 Bacteria 1706
70 Ga0070682_100192754 3300005337 Bacteria 1432
71 Ga0068868_100003047 3300005338 Bacteria 11665
72 Ga0068868_100052291 3300005338 Bacteria 3216
73 Ga0068868_100079913 3300005338 Bacteria 2620
74 Ga0068868_100083582 3300005338 Bacteria 2563
75 Ga0070660_100010316 3300005339 Bacteria 6597
76 Ga0070660_100062309 3300005339 Bacteria 2897
77 Ga0070660_100113317 3300005339 Bacteria 2159
78 Ga0070660_100118624 3300005339 Bacteria 2110
79 Ga0070689_100027955 3300005340 Bacteria 4258
80 Ga0070691_10015872 3300005341 Bacteria 3462
81 Ga0070661_100118315 3300005344 Bacteria 1983
82 Ga0070661_100145757 3300005344 Bacteria 1787
83 Ga0070661_100187800 3300005344 Bacteria 1575
84 Ga0070661_100286141 3300005344 Bacteria 1280
85 Ga0070668_100000043 3300005347 Bacteria 78564
86 Ga0070668_100046860 3300005347 Bacteria 3322
87 Ga0070668_100158914 3300005347 Bacteria 1833
88 Ga0070669_100000660 3300005353 Bacteria 25474
89 Ga0070675_100002780 3300005354 Bacteria 13170
90 Ga0070675_100004944 3300005354 Bacteria 10167
91 Ga0070675_100021178 3300005354 Bacteria 5193
92 Ga0070675_100032415 3300005354 Bacteria 4228
93 Ga0070675_100063619 3300005354 Bacteria 3050
94 Ga0070675_100091822 3300005354 Bacteria 2544
95 Ga0070671_100035166 3300005355 Bacteria 4150
96 Ga0070671_100123875 3300005355 Bacteria 2176
97 Ga0070674_100022606 3300005356 Bacteria 4058
98 Ga0070674_100099630 3300005356 Bacteria 2114
99 Ga0070674_100234128 3300005356 Bacteria 1435
100 Ga0070673_100002573 3300005364 Bacteria 11081
101 Ga0070673_100095840 3300005364 Bacteria 2434
102 Ga0070673_100179440 3300005364 Bacteria 1812
103 Ga0070673_100193161 3300005364 Bacteria 1750
104 Ga0070688_100003168 3300005365 Bacteria 8426
105 Ga0070688_100011188 3300005365 Bacteria 4982
106 Ga0070688_100213944 3300005365 Bacteria 1355
107 Ga0070659_100003702 3300005366 Bacteria 10907
108 Ga0070659_100024213 3300005366 Bacteria 4652
109 Ga0070659_100180256 3300005366 Bacteria 1733
110 Ga0070667_100000254 3300005367 Bacteria 60664
111 Ga0070667_100019703 3300005367 Bacteria 5596
112 Ga0070667_100027762 3300005367 Bacteria 4710
113 Ga0070667_100053091 3300005367 Bacteria 3421
114 Ga0070701_10019903 3300005438 Bacteria 3176
115 Ga0070700_100040931 3300005441 Bacteria 2839
116 Ga0070700_100097610 3300005441 Bacteria 1930
117 Ga0070663_100067568 3300005455 Bacteria 2593
118 Ga0070678_100025990 3300005456 Bacteria 3951
119 Ga0070678_100039245 3300005456 Bacteria 3339
120 Ga0070678_100048931 3300005456 Bacteria 3048
121 Ga0070678_100153804 3300005456 Bacteria 1856
122 Ga0070662_100002089 3300005457 Bacteria 12246
123 Ga0070662_100015197 3300005457 Bacteria 5153
124 Ga0070662_100027246 3300005457 Bacteria 3964
125 Ga0070662_100031364 3300005457 Bacteria 3729
126 Ga0070662_100091725 3300005457 Bacteria 2282
127 Ga0070662_100179959 3300005457 Bacteria 1666
128 Ga0070681_10038592 3300005458 Bacteria 4788
129 Ga0070681_10051262 3300005458 Bacteria 4116
130 Ga0070681_10052163 3300005458 Bacteria 4079
131 Ga0070681_10095837 3300005458 Bacteria 2916
132 Ga0070681_10112277 3300005458 Bacteria 2665
133 Ga0068867_100007630 3300005459 Bacteria 7653
134 Ga0068867_100027897 3300005459 Bacteria 4062
135 Ga0068867_100226863 3300005459 Bacteria 1508
136 Ga0070685_10004944 3300005466 Bacteria 6746
137 Ga0070685_10085830 3300005466 Bacteria 1896
138 Ga0070698_100000392 3300005471 Bacteria 46091
139 Ga0070698_100010460 3300005471 Bacteria 9905
140 Ga0070679_100000174 3300005530 Bacteria 51897
141 Ga0070679_100001499 3300005530 Bacteria 20743
142 Ga0070679_100003920 3300005530 Bacteria 13685
143 Ga0070679_100019897 3300005530 Bacteria 6536
144 Ga0070679_100046468 3300005530 Bacteria 4327
145 Ga0070684_100000662 3300005535 Bacteria 23780
146 Ga0070684_100003150 3300005535 Bacteria 12313
147 Ga0070684_100064944 3300005535 Bacteria 3203
148 Ga0070684_100107297 3300005535 Bacteria 2501
149 Ga0070684_100249157 3300005535 Bacteria 1623
150 Ga0068853_100000381 3300005539 Bacteria 30507
151 Ga0068853_100004978 3300005539 Bacteria 10355
152 Ga0068853_100023196 3300005539 Bacteria 5193
153 Ga0068853_100270227 3300005539 Bacteria 1565
154 Ga0070672_100000109 3300005543 Bacteria 41435
155 Ga0070672_100026702 3300005543 Bacteria 4301
156 Ga0070672_100036233 3300005543 Bacteria 3757
157 Ga0070672_100050208 3300005543 Bacteria 3248
158 Ga0070672_100167373 3300005543 Bacteria 1826
159 Ga0070686_100034487 3300005544 Bacteria 3119
160 Ga0070693_100002584 3300005547 Bacteria 8335
161 Ga0070665_100000041 3300005548 Bacteria 297849
162 Ga0070665_100002085 3300005548 Bacteria 22449
163 Ga0070665_100020471 3300005548 Bacteria 6643
164 Ga0070665_100027777 3300005548 Bacteria 5697
165 Ga0070704_100152519 3300005549 Bacteria 1818
166 Ga0068855_100000995 3300005563 Bacteria 35281
167 Ga0068855_100003373 3300005563 Bacteria 19563
168 Ga0068855_100015722 3300005563 Bacteria 9103
169 Ga0068855_100023944 3300005563 Bacteria 7310
170 Ga0068855_100030990 3300005563 Bacteria 6391
171 Ga0068855_100042337 3300005563 Bacteria 5396
172 Ga0068855_100042453 3300005563 Bacteria 5388
173 Ga0068855_100091126 3300005563 Bacteria 3517
174 Ga0068855_100107692 3300005563 Bacteria 3202
175 Ga0068855_100143388 3300005563 Bacteria 2720
176 Ga0070664_100003411 3300005564 Bacteria 12829
177 Ga0070664_100012446 3300005564 Bacteria 6916
178 Ga0070664_100042787 3300005564 Bacteria 3823
179 Ga0070664_100140373 3300005564 Bacteria 2127
180 Ga0070664_100144610 3300005564 Bacteria 2096
181 Ga0068857_100019259 3300005577 Bacteria 5992
182 Ga0068857_100081185 3300005577 Bacteria 2895
183 Ga0068857_100084584 3300005577 Bacteria 2835
184 Ga0068857_100250133 3300005577 Bacteria 1625
185 Ga0068854_100141734 3300005578 Bacteria 1845
186 Ga0068854_100308004 3300005578 Bacteria 1284
187 Ga0068856_100020074 3300005614 Bacteria 6488
188 Ga0068856_100049922 3300005614 Bacteria 4124
189 Ga0068856_100123417 3300005614 Bacteria 2592
190 Ga0068856_100133394 3300005614 Bacteria 2489
191 Ga0068856_100273586 3300005614 Bacteria 1705
192 Ga0068852_100004748 3300005616 Bacteria 9648
193 Ga0068852_100024540 3300005616 Bacteria 4875
194 Ga0068852_100032963 3300005616 Bacteria 4296
195 Ga0068852_100034775 3300005616 Bacteria 4196
196 Ga0068852_100039686 3300005616 Bacteria 3965
197 Ga0068852_100061644 3300005616 Bacteria 3260
198 Ga0068852_100159348 3300005616 Bacteria 2106
199 Ga0068852_100174403 3300005616 Bacteria 2018
200 Ga0068859_100000037 3300005617 Bacteria 165480
201 Ga0068859_100024350 3300005617 Bacteria 6073
202 Ga0068859_100048491 3300005617 Bacteria 4266
203 Ga0068859_100065792 3300005617 Unclassified 3658
204 Ga0068859_100173645 3300005617 Bacteria 2237
205 Ga0068859_100386686 3300005617 Bacteria 1495
206 Ga0068864_100001192 3300005618 Bacteria 21573
207 Ga0068864_100029740 3300005618 Bacteria 4629
208 Ga0068864_100032450 3300005618 Bacteria 4438
209 Ga0068864_100039621 3300005618 Bacteria 4027
210 Ga0068864_100040012 3300005618 Bacteria 4009
211 Ga0068864_100061670 3300005618 Bacteria 3248
212 Ga0068861_100003469 3300005719 Bacteria 10464
213 Ga0068851_10001233 3300005834 Bacteria 11109
214 Ga0068851_10030515 3300005834 Bacteria 2673
215 Ga0068851_10057539 3300005834 Bacteria 1985
216 Ga0068870_10037735 3300005840 Bacteria 2491
217 Ga0068870_10048484 3300005840 Bacteria 2237
218 Ga0068863_100002618 3300005841 Bacteria 17840
219 Ga0068863_100002856 3300005841 Bacteria 17115
220 Ga0068863_100074923 3300005841 Bacteria 3202
221 Ga0068863_100154699 3300005841 Bacteria 2195
222 Ga0068858_100000199 3300005842 Bacteria 64607
223 Ga0068858_100018293 3300005842 Bacteria 6561
224 Ga0068860_100000383 3300005843 Bacteria 57999
225 Ga0068860_100000700 3300005843 Bacteria 38538
226 Ga0068860_100013203 3300005843 Bacteria 8103
227 Ga0068860_100152109 3300005843 Bacteria 2229
228 Ga0068860_100217921 3300005843 Bacteria 1853
229 Ga0068862_100007282 3300005844 Bacteria 9184
230 Ga0068862_100010232 3300005844 Bacteria 7740
231 Ga0081540_1018059 3300005983 Bacteria 4341
232 Ga0081539_10003031 3300005985 Bacteria 21772
233 Ga0081539_10004761 3300005985 Bacteria 14651
234 Ga0075366_10056967 3300006195 Bacteria 2322
235 Ga0097621_100001591 3300006237 Bacteria 15526
236 Ga0097621_100003742 3300006237 Bacteria 10539
237 Ga0097621_100004103 3300006237 Bacteria 10103
238 Ga0097621_100024053 3300006237 Bacteria 4751
239 Ga0075370_10062204 3300006353 Bacteria 2127
240 Ga0068871_100000737 3300006358 Bacteria 22233
241 Ga0068871_100002768 3300006358 Bacteria 11972
242 Ga0068871_100008698 3300006358 Bacteria 7304
243 Ga0068871_100018879 3300006358 Bacteria 5254
244 Ga0068871_100024986 3300006358 Bacteria 4641
245 Ga0068871_100088023 3300006358 Bacteria 2583
246 Ga0068871_100129186 3300006358 Bacteria 2141
247 Ga0068871_100277197 3300006358 Bacteria 1466
248 Ga0075428_100009100 3300006844 Bacteria 11018
249 Ga0075430_100002881 3300006846 Bacteria 14402
250 Ga0075429_100002313 3300006880 Bacteria 15998
251 Ga0075429_100027037 3300006880 Bacteria 4982
252 Ga0068865_100010112 3300006881 Bacteria 5867
253 Ga0097620_100000037 3300006931 Bacteria 165480
254 Ga0097620_100024352 3300006931 Bacteria 6073
255 Ga0097620_100048492 3300006931 Bacteria 4266
256 Ga0097620_100065794 3300006931 Unclassified 3658
257 Ga0097620_100173645 3300006931 Bacteria 2237
258 Ga0097620_100386659 3300006931 Bacteria 1495
259 Ga0105240_10000073 3300009093 Bacteria 201032
260 Ga0105240_10000224 3300009093 Bacteria 113175
261 Ga0105240_10002232 3300009093 Bacteria 31507
262 Ga0105240_10003321 3300009093 Bacteria 25128
263 Ga0105240_10005749 3300009093 Bacteria 18399
264 Ga0105240_10008705 3300009093 Bacteria 14477
265 Ga0105240_10036358 3300009093 Bacteria 6337
266 Ga0105240_10077274 3300009093 Bacteria 4102
267 Ga0105240_10111385 3300009093 Bacteria 3311
268 Ga0105240_10213177 3300009093 Bacteria 2255
269 Ga0111539_10017114 3300009094 Bacteria 8973
270 Ga0111539_10019384 3300009094 Bacteria 8397
271 Ga0111539_10202016 3300009094 Bacteria 2317
272 Ga0105245_10040885 3300009098 Bacteria 4132
273 Ga0105247_10000946 3300009101 Bacteria 21902
274 Ga0105247_10075971 3300009101 Bacteria 2109
275 Ga0114129_10023506 3300009147 Bacteria 8737
276 Ga0114129_10156418 3300009147 Bacteria 3117
277 Ga0105241_10000493 3300009174 Bacteria 29814
278 Ga0105241_10012294 3300009174 Bacteria 6278
279 Ga0105241_10039402 3300009174 Bacteria 3564
280 Ga0105242_10023093 3300009176 Bacteria 4902
281 Ga0105242_10047988 3300009176 Bacteria 3469
282 Ga0105242_10060461 3300009176 Bacteria 3113
283 Ga0105242_10104591 3300009176 Bacteria 2403
284 Ga0105242_10171899 3300009176 Bacteria 1905
285 Ga0105248_10027033 3300009177 Bacteria 6383
286 Ga0105248_10075391 3300009177 Bacteria 3791
287 Ga0105237_10000719 3300009545 Bacteria 45812
288 Ga0105237_10001973 3300009545 Bacteria 26110
289 Ga0105237_10002801 3300009545 Bacteria 21180
290 Ga0105237_10003801 3300009545 Bacteria 17746
291 Ga0105237_10004541 3300009545 Bacteria 16041
292 Ga0105237_10006950 3300009545 Bacteria 12477
293 Ga0105237_10018401 3300009545 Bacteria 7228
294 Ga0105237_10025051 3300009545 Bacteria 6103
295 Ga0105237_10110773 3300009545 Bacteria 2737
296 Ga0105238_10000247 3300009551 Bacteria 60300
297 Ga0105238_10023438 3300009551 Bacteria 6292
298 Ga0105238_10042810 3300009551 Bacteria 4583
299 Ga0105238_10178835 3300009551 Bacteria 2098
300 Ga0105249_10001713 3300009553 Bacteria 19174
301 Ga0105249_10003686 3300009553 Bacteria 13205
302 Ga0105249_10004032 3300009553 Bacteria 12671
303 Ga0105249_10004791 3300009553 Bacteria 11679
304 Ga0105249_10012772 3300009553 Bacteria 7406
305 Ga0105249_10020558 3300009553 Bacteria 5903
306 Ga0105249_10034354 3300009553 Bacteria 4595
307 Ga0105249_10057070 3300009553 Bacteria 3576
308 Ga0105249_10075451 3300009553 Bacteria 3123
309 Ga0105239_10000685 3300010375 Bacteria 48269
310 Ga0105239_10000785 3300010375 Bacteria 45044
311 Ga0105239_10003390 3300010375 Bacteria 19552
312 Ga0105239_10019299 3300010375 Bacteria 7530
313 Ga0105239_10024490 3300010375 Bacteria 6650
314 Ga0105239_10025508 3300010375 Bacteria 6508
315 Ga0105239_10029882 3300010375 Bacteria 5993
316 Ga0105239_10044357 3300010375 Bacteria 4875
317 Ga0105239_10100452 3300010375 Bacteria 3200
318 Ga0105246_10030831 3300011119 Bacteria 3544
319 Ga0157373_10004243 3300013100 Bacteria 10818
320 Ga0157373_10006313 3300013100 Bacteria 8856
321 Ga0157373_10035137 3300013100 Bacteria 3599
322 Ga0157373_10105957 3300013100 Bacteria 1977
323 Ga0157373_10117437 3300013100 Bacteria 1870
324 Ga0157371_10000318 3300013102 Bacteria 62463
325 Ga0157371_10000499 3300013102 Bacteria 47558
326 Ga0157371_10006599 3300013102 Bacteria 9536
327 Ga0157371_10009522 3300013102 Bacteria 7639
328 Ga0157371_10012029 3300013102 Bacteria 6635
329 Ga0157371_10012639 3300013102 Bacteria 6442
330 Ga0157371_10013867 3300013102 Bacteria 6106
331 Ga0157371_10017864 3300013102 Bacteria 5258
332 Ga0157371_10033090 3300013102 Bacteria 3716
333 Ga0157371_10061732 3300013102 Bacteria 2657
334 Ga0157371_10174696 3300013102 Bacteria 1536
335 Ga0157370_10000319 3300013104 Bacteria 60498
336 Ga0157370_10000621 3300013104 Bacteria 44144
337 Ga0157370_10001966 3300013104 Bacteria 25315
338 Ga0157370_10005125 3300013104 Bacteria 14778
339 Ga0157370_10013929 3300013104 Bacteria 8258
340 Ga0157370_10024532 3300013104 Bacteria 5972
341 Ga0157370_10035255 3300013104 Bacteria 4866
342 Ga0157370_10040907 3300013104 Unclassified 4474
343 Ga0157370_10237753 3300013104 Bacteria 1686
344 Ga0157369_10006884 3300013105 Bacteria 13120
345 Ga0157369_10053658 3300013105 Bacteria 4356
346 Ga0157369_10164553 3300013105 Bacteria 2340
347 Ga0157374_10000001 3300013296 Bacteria 1077351
348 Ga0157374_10023176 3300013296 Bacteria 5548
349 Ga0157374_10038227 3300013296 Bacteria 4411
350 Ga0157374_10067964 3300013296 Bacteria 3351
351 Ga0157374_10101461 3300013296 Bacteria 2759
352 Ga0157378_10003535 3300013297 Bacteria 13847
353 Ga0157378_10011371 3300013297 Bacteria 7790
354 Ga0157378_10015702 3300013297 Bacteria 6631
355 Ga0157378_10044560 3300013297 Bacteria 3940
356 Ga0157378_10080891 3300013297 Bacteria 2936
357 Ga0157378_10226075 3300013297 Bacteria 1781
358 Ga0163162_10000524 3300013306 Bacteria 35554
359 Ga0163162_10000840 3300013306 Bacteria 28540
360 Ga0163162_10001778 3300013306 Bacteria 20203
361 Ga0163162_10001883 3300013306 Bacteria 19750
362 Ga0163162_10003204 3300013306 Bacteria 15653
363 Ga0163162_10005597 3300013306 Bacteria 12151
364 Ga0163162_10005731 3300013306 Bacteria 12011
365 Ga0163162_10010470 3300013306 Bacteria 9015
366 Ga0163162_10012063 3300013306 Bacteria 8429
367 Ga0163162_10017061 3300013306 Bacteria 7104
368 Ga0163162_10166527 3300013306 Bacteria 2328
369 Ga0157372_10001226 3300013307 Bacteria 27756
370 Ga0157372_10005928 3300013307 Bacteria 12995
371 Ga0157372_10019675 3300013307 Bacteria 7274
372 Ga0157372_10022141 3300013307 Bacteria 6875
373 Ga0157372_10036250 3300013307 Bacteria 5435
374 Ga0157372_10038003 3300013307 Bacteria 5312
375 Ga0157372_10038401 3300013307 Bacteria 5283
376 Ga0157372_10047139 3300013307 Bacteria 4787
377 Ga0157372_10074087 3300013307 Bacteria 3838
378 Ga0157372_10086437 3300013307 Bacteria 3557
379 Ga0157372_10111404 3300013307 Bacteria 3135
380 Ga0157372_10130669 3300013307 Bacteria 2889
381 Ga0157372_10154925 3300013307 Bacteria 2646
382 Ga0157372_10194077 3300013307 Bacteria 2352
383 Ga0157372_10296251 3300013307 Bacteria 1881
384 Ga0157372_10392658 3300013307 Bacteria 1617
385 Ga0157375_10004232 3300013308 Bacteria 12445
386 Ga0157375_10005528 3300013308 Bacteria 10997
387 Ga0157375_10006502 3300013308 Bacteria 10172
388 Ga0157375_10023857 3300013308 Bacteria 5651
389 Ga0157375_10025764 3300013308 Bacteria 5471
390 Ga0157375_10110693 3300013308 Bacteria 2844
391 Ga0157375_10131982 3300013308 Unclassified 2618
392 Ga0157375_10244304 3300013308 Bacteria 1955
393 Ga0163163_10000332 3300014325 Bacteria 45415
394 Ga0163163_10000407 3300014325 Bacteria 40536
395 Ga0163163_10109811 3300014325 Bacteria 2786
396 Ga0163163_10217980 3300014325 Bacteria 1957
397 Ga0163163_10253065 3300014325 Bacteria 1812
398 Ga0157380_10001567 3300014326 Bacteria 15058
399 Ga0157380_10002076 3300014326 Bacteria 13432
400 Ga0157380_10004048 3300014326 Bacteria 10111
401 Ga0157380_10022571 3300014326 Bacteria 4742
402 Ga0157380_10034929 3300014326 Bacteria 3880
403 Ga0157380_10041792 3300014326 Bacteria 3580
404 Ga0157380_10064388 3300014326 Bacteria 2943
405 Ga0157380_10071237 3300014326 Bacteria 2812
406 Ga0157377_10004234 3300014745 Bacteria 6569
407 Ga0157377_10045316 3300014745 Bacteria 2456
408 Ga0157379_10000340 3300014968 Bacteria 37587
409 Ga0157379_10032196 3300014968 Bacteria 4673
410 Ga0157379_10069083 3300014968 Bacteria 3159
411 Ga0157379_10078430 3300014968 Bacteria 2958
412 Ga0157379_10108069 3300014968 Bacteria 2497
413 Ga0157376_10001605 3300014969 Bacteria 14956
414 Ga0157376_10003155 3300014969 Bacteria 11323
415 Ga0157376_10012276 3300014969 Bacteria 6353
416 Ga0157376_10017890 3300014969 Bacteria 5418
417 Ga0157376_10019002 3300014969 Bacteria 5285
418 Ga0157376_10037870 3300014969 Bacteria 3920
419 Ga0182005_1000023 3300015265 Bacteria 246328
420 Ga0163161_10000823 3300017792 Bacteria 24283
421 Ga0213876_10000584 3300021384 Bacteria 27185
422 Ga0213876_10002362 3300021384 Bacteria 11106
423 Ga0209258_100068 3300025242 Bacteria 286288
424 Ga0209646_1000025 3300025246 Bacteria 406493
425 Ga0209646_1001893 3300025246 Bacteria 5113
426 Ga0209026_1000097 3300025250 Bacteria 163212
427 Ga0209148_1000343 3300025254 Bacteria 61260
428 Ga0209673_1000403 3300025273 Bacteria 76872
429 Ga0209676_1000564 3300025292 Bacteria 55947
430 Ga0209564_1009069 3300025295 Bacteria 4790
431 Ga0209758_1001939 3300025297 Bacteria 22471
432 Ga0209758_1023582 3300025297 Bacteria 2778
433 Ga0209050_1000136 3300025298 Bacteria 179113
434 Ga0207426_1000002 3300025302 Bacteria 1249660
435 Ga0207426_1000164 3300025302 Bacteria 171465
436 Ga0207426_1000220 3300025302 Bacteria 134979
437 Ga0207426_1000543 3300025302 Bacteria 53486
438 Ga0207426_1030313 3300025302 Bacteria 1775
439 Ga0209257_1000025 3300025304 Bacteria 724838
440 Ga0209257_1002647 3300025304 Bacteria 17224
441 Ga0207656_10002336 3300025321 Bacteria 6364
442 Ga0207656_10019561 3300025321 Bacteria 2680
443 Ga0207656_10070388 3300025321 Bacteria 1553
444 Ga0207642_10034382 3300025899 Bacteria 2155
445 Ga0207642_10076630 3300025899 Bacteria 1610
446 Ga0207710_10008776 3300025900 Bacteria 4259
447 Ga0207688_10119833 3300025901 Bacteria 1535
448 Ga0207680_10000619 3300025903 Bacteria 16749
449 Ga0207680_10020374 3300025903 Bacteria 3568
450 Ga0207647_10012039 3300025904 Bacteria 6037
451 Ga0207647_10013257 3300025904 Bacteria 5721
452 Ga0207647_10044871 3300025904 Bacteria 2760
453 Ga0207645_10000378 3300025907 Bacteria 36697
454 Ga0207645_10000763 3300025907 Bacteria 26753
455 Ga0207645_10084313 3300025907 Bacteria 2039
456 Ga0207643_10001933 3300025908 Bacteria 11464
457 Ga0207643_10002437 3300025908 Bacteria 10060
458 Ga0207705_10000717 3300025909 Bacteria 27323
459 Ga0207705_10002776 3300025909 Bacteria 13384
460 Ga0207705_10055536 3300025909 Bacteria 2855
461 Ga0207705_10110743 3300025909 Bacteria 2028
462 Ga0207654_10000775 3300025911 Bacteria 17563
463 Ga0207654_10005854 3300025911 Bacteria 6200
464 Ga0207654_10032775 3300025911 Bacteria 2874
465 Ga0207707_10000323 3300025912 Bacteria 50505
466 Ga0207707_10020931 3300025912 Bacteria 5714
467 Ga0207707_10190794 3300025912 Bacteria 1788
468 Ga0207707_10220986 3300025912 Bacteria 1649
469 Ga0207695_10000023 3300025913 Bacteria 657903
470 Ga0207695_10000031 3300025913 Bacteria 526801
471 Ga0207695_10000110 3300025913 Bacteria 250079
472 Ga0207695_10000151 3300025913 Bacteria 206493
473 Ga0207695_10005271 3300025913 Bacteria 17237
474 Ga0207695_10017407 3300025913 Bacteria 8363
475 Ga0207695_10018132 3300025913 Bacteria 8147
476 Ga0207695_10043735 3300025913 Bacteria 4771
477 Ga0207695_10065212 3300025913 Bacteria 3745
478 Ga0207695_10077325 3300025913 Bacteria 3381
479 Ga0207671_10000149 3300025914 Bacteria 107722
480 Ga0207671_10001536 3300025914 Bacteria 26452
481 Ga0207671_10002088 3300025914 Bacteria 21861
482 Ga0207671_10002513 3300025914 Bacteria 19573
483 Ga0207671_10005116 3300025914 Bacteria 12220
484 Ga0207671_10006479 3300025914 Bacteria 10419
485 Ga0207671_10047911 3300025914 Bacteria 3163
486 Ga0207660_10012104 3300025917 Bacteria 5639
487 Ga0207662_10030759 3300025918 Bacteria 3117
488 Ga0207657_10005727 3300025919 Bacteria 12961
489 Ga0207657_10011956 3300025919 Bacteria 8590
490 Ga0207657_10072488 3300025919 Bacteria 2914
491 Ga0207657_10094429 3300025919 Bacteria 2490
492 Ga0207649_10077560 3300025920 Bacteria 2141
493 Ga0207649_10145606 3300025920 Bacteria 1626
494 Ga0207652_10000132 3300025921 Bacteria 80345
495 Ga0207652_10000713 3300025921 Bacteria 32283
496 Ga0207652_10017662 3300025921 Bacteria 5840
497 Ga0207681_10019898 3300025923 Bacteria 4250
498 Ga0207694_10011872 3300025924 Bacteria 6568
499 Ga0207650_10070537 3300025925 Bacteria 2627
500 Ga0207659_10032682 3300025926 Bacteria 3574
501 Ga0207659_10037741 3300025926 Bacteria 3356
502 Ga0207644_10038614 3300025931 Bacteria 3365
503 Ga0207644_10097004 3300025931 Bacteria 2208
504 Ga0207690_10013324 3300025932 Bacteria 4939
505 Ga0207690_10028354 3300025932 Bacteria 3549
506 Ga0207706_10005229 3300025933 Bacteria 12114
507 Ga0207706_10009726 3300025933 Bacteria 8826
508 Ga0207706_10012289 3300025933 Bacteria 7802
509 Ga0207706_10013804 3300025933 Bacteria 7330
510 Ga0207706_10041013 3300025933 Bacteria 4104
511 Ga0207706_10094724 3300025933 Unclassified 2627
512 Ga0207686_10038744 3300025934 Bacteria 2887
513 Ga0207670_10048750 3300025936 Bacteria 2829
514 Ga0207670_10083764 3300025936 Bacteria 2238
515 Ga0207670_10119845 3300025936 Bacteria 1911
516 Ga0207704_10005264 3300025938 Bacteria 5958
517 Ga0207704_10034464 3300025938 Bacteria 2889
518 Ga0207691_10000227 3300025940 Bacteria 54652
519 Ga0207691_10013965 3300025940 Bacteria 7662
520 Ga0207691_10062119 3300025940 Bacteria 3391
521 Ga0207691_10096532 3300025940 Bacteria 2642
522 Ga0207691_10103237 3300025940 Bacteria 2542
523 Ga0207689_10002045 3300025942 Bacteria 19049
524 Ga0207689_10003446 3300025942 Bacteria 14441
525 Ga0207689_10003531 3300025942 Bacteria 14286
526 Ga0207689_10004234 3300025942 Bacteria 13052
527 Ga0207689_10011373 3300025942 Bacteria 7628
528 Ga0207689_10025901 3300025942 Bacteria 4912
529 Ga0207689_10056715 3300025942 Bacteria 3224
530 Ga0207689_10143286 3300025942 Bacteria 1969
531 Ga0207661_10045478 3300025944 Bacteria 3475
532 Ga0207661_10109524 3300025944 Bacteria 2333
533 Ga0207661_10120246 3300025944 Bacteria 2235
534 Ga0207679_10003970 3300025945 Bacteria 9193
535 Ga0207679_10102601 3300025945 Bacteria 2240
536 Ga0207679_10157092 3300025945 Bacteria 1858
537 Ga0207667_10000144 3300025949 Bacteria 108295
538 Ga0207667_10004138 3300025949 Bacteria 17827
539 Ga0207667_10005340 3300025949 Bacteria 15665
540 Ga0207667_10023124 3300025949 Bacteria 6847
541 Ga0207667_10039915 3300025949 Bacteria 4999
542 Ga0207667_10052787 3300025949 Bacteria 4279
543 Ga0207651_10002380 3300025960 Bacteria 8980
544 Ga0207651_10018126 3300025960 Unclassified 4181
545 Ga0207651_10075712 3300025960 Bacteria 2403
546 Ga0207651_10145571 3300025960 Bacteria 1837
547 Ga0207712_10003315 3300025961 Bacteria 10203
548 Ga0207712_10007921 3300025961 Bacteria 6711
549 Ga0207712_10008082 3300025961 Bacteria 6655
550 Ga0207712_10014895 3300025961 Bacteria 5007
551 Ga0207712_10032658 3300025961 Bacteria 3514
552 Ga0207712_10070570 3300025961 Bacteria 2510
553 Ga0207712_10120156 3300025961 Bacteria 1987
554 Ga0207712_10290390 3300025961 Unclassified 1338
555 Ga0207668_10000679 3300025972 Bacteria 20879
556 Ga0207668_10008809 3300025972 Bacteria 6030
557 Ga0207668_10038350 3300025972 Bacteria 3215
558 Ga0207668_10083481 3300025972 Bacteria 2325
559 Ga0207668_10132718 3300025972 Bacteria 1904
560 Ga0207640_10119688 3300025981 Unclassified 1883
561 Ga0207640_10202917 3300025981 Bacteria 1504
562 Ga0207640_10213358 3300025981 Bacteria 1472
563 Ga0207658_10000176 3300025986 Bacteria 68501
564 Ga0207658_10081045 3300025986 Bacteria 2488
565 Ga0207658_10097445 3300025986 Bacteria 2296
566 Ga0207677_10026360 3300026023 Bacteria 3644
567 Ga0207677_10200572 3300026023 Bacteria 1585
568 Ga0207703_10000433 3300026035 Bacteria 44015
569 Ga0207703_10003126 3300026035 Bacteria 13978
570 Ga0207703_10274415 3300026035 Bacteria 1529
571 Ga0207639_10010289 3300026041 Bacteria 6475
572 Ga0207639_10134275 3300026041 Bacteria 2053
573 Ga0207639_10226161 3300026041 Bacteria 1619
574 Ga0207702_10040374 3300026078 Bacteria 3913
575 Ga0207702_10083529 3300026078 Bacteria 2779
576 Ga0207702_10164195 3300026078 Bacteria 2030
577 Ga0207702_10282799 3300026078 Bacteria 1569
578 Ga0207641_10000226 3300026088 Bacteria 72539
579 Ga0207641_10012826 3300026088 Bacteria 6871
580 Ga0207641_10014131 3300026088 Bacteria 6543
581 Ga0207641_10135852 3300026088 Bacteria 2213
582 Ga0207648_10003768 3300026089 Bacteria 15840
583 Ga0207648_10007506 3300026089 Bacteria 10709
584 Ga0207648_10013131 3300026089 Bacteria 7720
585 Ga0207648_10040889 3300026089 Bacteria 4072
586 Ga0207648_10047172 3300026089 Bacteria 3777
587 Ga0207648_10057857 3300026089 Bacteria 3382
588 Ga0207676_10001240 3300026095 Bacteria 18994
589 Ga0207676_10013461 3300026095 Bacteria 5876
590 Ga0207676_10020222 3300026095 Bacteria 4867
591 Ga0207676_10038784 3300026095 Bacteria 3639
592 Ga0207676_10046530 3300026095 Bacteria 3358
593 Ga0207676_10048482 3300026095 Bacteria 3298
594 Ga0207674_10005115 3300026116 Bacteria 15654
595 Ga0207674_10006654 3300026116 Bacteria 13576
596 Ga0207674_10015073 3300026116 Bacteria 8510
597 Ga0207674_10017055 3300026116 Bacteria 7926
598 Ga0207674_10017645 3300026116 Bacteria 7784
599 Ga0207674_10031117 3300026116 Bacteria 5607
600 Ga0207674_10122929 3300026116 Bacteria 2561
601 Ga0207674_10137166 3300026116 Bacteria 2407
602 Ga0207674_10167353 3300026116 Bacteria 2152
603 Ga0207675_100008068 3300026118 Bacteria 9918
604 Ga0207675_100057429 3300026118 Bacteria 3631
605 Ga0207675_100089718 3300026118 Bacteria 2889
606 Ga0207675_100139676 3300026118 Bacteria 2301
607 Ga0207675_100280555 3300026118 Bacteria 1619
608 Ga0207683_10001455 3300026121 Bacteria 21350
609 Ga0207683_10100585 3300026121 Bacteria 2581
610 Ga0207683_10120369 3300026121 Unclassified 2356
611 Ga0207683_10163987 3300026121 Bacteria 2010
612 Ga0207683_10177500 3300026121 Bacteria 1931
613 Ga0207698_10002228 3300026142 Bacteria 11462
614 Ga0207698_10004129 3300026142 Bacteria 8823
615 Ga0207698_10029722 3300026142 Bacteria 3917
616 Ga0207698_10033022 3300026142 Bacteria 3756
617 Ga0207698_10104374 3300026142 Bacteria 2358
618 Ga0207698_10130927 3300026142 Bacteria 2143
619 Ga0207698_10193103 3300026142 Bacteria 1816
620 Ga0207698_10195203 3300026142 Unclassified 1807
621 Ga0207698_10268755 3300026142 Bacteria 1571
622 Ga0207698_10286375 3300026142 Bacteria 1526
623 Ga0207428_10138124 3300027907 Bacteria 1862
624 Ga0207428_10191013 3300027907 Bacteria 1544
625 Ga0268266_10000049 3300028379 Bacteria 307763
626 Ga0268266_10011164 3300028379 Bacteria 7819
627 Ga0268266_10018579 3300028379 Bacteria 5924
628 Ga0268265_10011975 3300028380 Bacteria 5870
629 Ga0268265_10039803 3300028380 Bacteria 3467
630 Ga0268264_10000041 3300028381 Bacteria 372501
631 Ga0268264_10002959 3300028381 Bacteria 14756
632 Ga0268264_10006197 3300028381 Bacteria 10100
633 Ga0268264_10009695 3300028381 Bacteria 7975
634 Ga0268264_10017026 3300028381 Bacteria 5951
635 Ga0268264_10086619 3300028381 Bacteria 2692
636 Ga0268264_10140300 3300028381 Bacteria 2154
637 Ga0268264_10217134 3300028381 Bacteria 1759
638 Ga0265334_10044384 3300028573 Bacteria 1726
639 Ga0265323_10001043 3300028653 Bacteria 14359
640 Ga0307517_10002168 3300028786 Bacteria 31819
641 Ga0307515_10000001 3300028794 Bacteria 4259510
642 Ga0307515_10000469 3300028794 Bacteria 96345
643 Ga0307515_10001093 3300028794 Bacteria 62142
644 Ga0307515_10130111 3300028794 Bacteria 2780
645 Ga0307511_10000139 3300030521 Bacteria 67385
646 Ga0316179_1031295 3300030734 Bacteria 2938
647 Ga0265327_10000197 3300031251 Bacteria 126837
648 Ga0265327_10000248 3300031251 Bacteria 107284
649 Ga0265327_10000272 3300031251 Bacteria 102100
650 Ga0265327_10000344 3300031251 Bacteria 87965
651 Ga0265327_10007740 3300031251 Bacteria 8208
652 Ga0265316_10000989 3300031344 Bacteria 30846
653 Ga0265316_10011439 3300031344 Bacteria 8002
654 Ga0307509_10025149 3300031507 Bacteria 6653
655 Ga0307509_10231184 3300031507 Bacteria 1652
656 Ga0265313_10032946 3300031595 Bacteria 2639
657 Ga0307508_10067215 3300031616 Bacteria 3153
658 Ga0307508_10122302 3300031616 Bacteria 2206
659 Ga0307514_10015943 3300031649 Bacteria 6189
660 Ga0265342_10043284 3300031712 Bacteria 2718
661 Ga0316576_10098873 3300031727 Bacteria 2179
662 Ga0307516_10001339 3300031730 Bacteria 34211
663 Ga0307516_10048026 3300031730 Bacteria 4202
664 Ga0307405_10058628 3300031731 Bacteria 2424
665 Ga0307412_10058409 3300031911 Bacteria 2580
666 Ga0307409_100219993 3300031995 Bacteria 1714
667 Ga0307416_100096360 3300032002 Bacteria 2558
668 Ga0307416_100221109 3300032002 Bacteria 1816
669 Ga0307414_10000080 3300032004 Bacteria 89531
670 Ga0307414_10014853 3300032004 Bacteria 4684
671 Ga0307414_10228856 3300032004 Bacteria 1531
672 Ga0307411_10002742 3300032005 Bacteria 7915
673 Ga0307415_100036116 3300032126 Bacteria 3235
674 Ga0307510_10048530 3300033180 Bacteria 4528
675 Ga0316588_1023036 3300033528 Bacteria 1426
676 Ga0373933_0120653 3300035724 Bacteria 1642
677 Ga0373937_0132909 3300036401 Bacteria 2325
678 Ga0373937_0278049 3300036401 Bacteria 1581
679 Ga0395899_0006685 3300037312 Bacteria 8935
680 Ga0395899_0011397 3300037312 Bacteria 6808
681 Ga0395899_0057450 3300037312 Bacteria 2872
682 Ga0395900_0007443 3300037418 Bacteria 11310
683 Ga0395900_0040022 3300037418 Bacteria 4830
684 Ga0395900_0064927 3300037418 Unclassified 3749
685 Ga0395900_0145350 3300037418 Bacteria 2425
686 Ga0395898_0002124 3300037466 Bacteria 24470
687 Ga0395898_0002566 3300037466 Bacteria 21273
688 Ga0395905_0000003 3300037471 Bacteria 1347396
689 Ga0395905_0001098 3300037471 Bacteria 34054
690 Ga0395905_0010903 3300037471 Bacteria 8801
691 Ga0395905_0104734 3300037471 Bacteria 2656
692 Ga0395901_0001075 3300038443 Bacteria 29195
693 Ga0395901_0010128 3300038443 Bacteria 9552
694 Ga0395901_0034989 3300038443 Bacteria 5189
695 Ga0395901_0041287 3300038443 Bacteria 4780
696 Ga0395901_0177080 3300038443 Bacteria 2237
697 Ga0395901_0317988 3300038443 Bacteria 1611
698 Ga0436365_0585774 3300039437 Bacteria 54587
699 Ga0436365_0678933 3300039437 Bacteria 1874
700 Ga0436365_1029016 3300039437 Bacteria 11135
701 Ga0436365_1894125 3300039437 Bacteria 1935
702 Ga0451833_1482918 3300041491 Bacteria 1356
703 Ga0439431_0000240 3300041997 Bacteria 11132
704 Ga0439445_0005873 3300042004 Bacteria 2807
705 Ga0439449_0000099 3300042007 Bacteria 27712
706 Ga0439457_000696 3300042014 Bacteria 9932
707 Ga0439462_0000918 3300042015 Bacteria 6239
708 Ga0451577_0000452 3300042876 Bacteria 71587
709 Ga0466969_0000238 3300044656 Bacteria 30098
710 Ga0466972_0000003 3300044658 Bacteria 391452
711 Ga0466972_0000039 3300044658 Bacteria 135618
712 Ga0453683_0065909 3300044673 Bacteria 2264
713 Ga0466966_0000136 3300044684 Bacteria 47038
714 Ga0466964_0012435 3300044706 Bacteria 3220
715 Ga0453684_0033978 3300044712 Bacteria 7092
716 Ga0453684_0092446 3300044712 Bacteria 3730
717 Ga0453684_0257288 3300044712 Bacteria 2002
718 Ga0466970_0000460 3300044765 Bacteria 20110
719 Ga0466970_0015787 3300044765 Bacteria 3888
720 Ga0466970_0056323 3300044765 Bacteria 2101
721 Ga0466957_0001467 3300044842 Bacteria 12361
722 Ga0466957_0096749 3300044842 Bacteria 1856
723 Ga0466959_0000002 3300045049 Bacteria 362671
724 Ga0466959_0044378 3300045049 Bacteria 3276
725 Ga0466959_0229430 3300045049 Bacteria 1285
726 Ga0495627_013728 3300046453 Bacteria 2845
727 Ga0495629_0236814 3300046459 Bacteria 1257
728 Ga0495638_0039053 3300046460 Bacteria 3015
729 Ga0495638_0040748 3300046460 Bacteria 2942
730 Ga0495651_0157060 3300046462 Bacteria 1634
731 Ga0495594_0138503 3300046499 Bacteria 1380
732 Ga0495606_0002871 3300046507 Bacteria 19056
733 Ga0495606_0090956 3300046507 Bacteria 1877
734 Ga0495628_0011990 3300046516 Bacteria 7311
735 Ga0495630_0051189 3300046517 Bacteria 3091
736 Ga0495643_0039118 3300046522 Bacteria 2595
737 Ga0495633_0000774 3300046558 Bacteria 28642
738 Ga0495668_0000310 3300046616 Bacteria 67405
739 Ga0495668_0000751 3300046616 Bacteria 38311
740 Ga0495668_0001166 3300046616 Bacteria 26773
741 Ga0495611_0000316 3300046648 Bacteria 32353
742 Ga0495658_0004160 3300046683 Bacteria 7128
743 Ga0495636_0000138 3300047318 Bacteria 29235
744 Ga0495687_000001 3300047443 Bacteria 1215582
745 Ga0495686_0000004 3300047472 Bacteria 869019
746 Ga0495686_0000595 3300047472 Bacteria 50402
747 Ga0496104_0188665 3300048907 Bacteria 1973
748 Ga0496108_0256381 3300048911 Bacteria 1522
749 Ga0496110_0070127 3300048913 Bacteria 3105
750 Ga0496114_0000439 3300048917 Bacteria 30666
751 Ga0496114_0248159 3300048917 Bacteria 1566
752 Ga0496115_0212890 3300048918 Bacteria 1596
753 Ga0496121_0000010 3300048924 Bacteria 793488
754 Ga0496125_0000443 3300048928 Bacteria 75675
755 Ga0496126_0095277 3300048929 Bacteria 2611
756 Ga0501319_002049 3300049535 Bacteria 1244
757 Ga0501031_0008920 3300049568 Bacteria 6520
758 Ga0501032_0071251 3300049569 Bacteria 2317
759 Ga0501032_0108954 3300049569 Bacteria 1834
760 Ga0501033_0075824 3300049570 Bacteria 2468
761 Ga0501033_0255734 3300049570 Bacteria 1240
762 Ga0501034_0000277 3300049571 Bacteria 92445
763 Ga0501034_0009006 3300049571 Bacteria 10483
764 Ga0501034_0009656 3300049571 Bacteria 10090
765 Ga0501034_0024994 3300049571 Bacteria 6078
766 Ga0501034_0025394 3300049571 Bacteria 6031
767 Ga0501034_0052389 3300049571 Bacteria 4111
768 Ga0501034_0066202 3300049571 Bacteria 3626
769 Ga0501034_0193412 3300049571 Bacteria 1996
770 Ga0501036_0095881 3300049572 Bacteria 2508
771 Ga0501036_0098463 3300049572 Bacteria 2472
772 Ga0501037_0013639 3300049573 Bacteria 5987
773 Ga0501037_0040682 3300049573 Bacteria 3420
774 Ga0501037_0083724 3300049573 Bacteria 2311
775 Ga0501038_0035496 3300049574 Bacteria 4377
776 Ga0501038_0173163 3300049574 Bacteria 1746
777 Ga0501043_0013312 3300049579 Bacteria 6432
778 Ga0501043_0148836 3300049579 Bacteria 1832
779 Ga0501047_0019100 3300049581 Bacteria 6576
780 Ga0501047_0038244 3300049581 Bacteria 4642
781 Ga0501047_0192609 3300049581 Bacteria 1902
782 Ga0501069_0013494 3300049585 Bacteria 4357
783 Ga0501073_0003496 3300049589 Bacteria 11804
784 Ga0501202_002713 3300049652 Bacteria 2990
785 Ga0501207_011727 3300049654 Bacteria 1308
786 Ga0501235_004888 3300049669 Bacteria 2904
787 Ga0501236_000375 3300049670 Bacteria 4955
788 Ga0501242_003333 3300049674 Bacteria 1733
789 Ga0501252_000726 3300049682 Bacteria 2713
790 Ga0501219_001064 3300049703 Bacteria 3153
791 Ga0501221_000433 3300049704 Bacteria 6494
792 Ga0501225_0028234 3300049705 Bacteria 1543
793 Ga0501234_006306 3300049707 Bacteria 1855
794 Ga0501080_0141640 3300049742 Bacteria 2223
795 Ga0501080_0224180 3300049742 Bacteria 1719
796 Ga0501080_0244120 3300049742 Bacteria 1638
797 Ga0501241_000078 3300049758 Bacteria 21770
798 Ga0501241_000560 3300049758 Bacteria 7966
799 Ga0501266_006658 3300049763 Bacteria 1438
800 Ga0501035_0033293 3300049822 Bacteria 4687
801 Ga0501035_0037822 3300049822 Bacteria 4368
802 Ga0501035_0074981 3300049822 Bacteria 2992
803 Ga0501035_0092700 3300049822 Bacteria 2658
804 Ga0501035_0176330 3300049822 Bacteria 1844
805 Ga0501044_0064792 3300049823 Bacteria 3729
806 Ga0501044_0065167 3300049823 Bacteria 3716
807 Ga0501044_0069714 3300049823 Bacteria 3579
808 Ga0501044_0218251 3300049823 Bacteria 1858
809 Ga0501044_0328652 3300049823 Bacteria 1452
810 Ga0501284_00011 3300050005 Bacteria 131008
811 Ga0501284_00565 3300050005 Bacteria 1917
812 nmdc:mga0k408_32148_c1 3300050493 Bacteria 2998
813 nmdc:mga0k408_54335_c1 3300050493 Bacteria 2321
814 nmdc:mga05p37_1503_c1 3300050507 Bacteria 27101
815 nmdc:mga09592_137274_c1 3300050508 Bacteria 2107
816 nmdc:mga09592_8593_c1 3300050508 Bacteria 8308
817 nmdc:mga06r32_98436_c1 3300050510 Bacteria 2867
818 nmdc:mga08y16_24983_c1 3300050511 Bacteria 6303
819 nmdc:mga08y16_95741_c1 3300050511 Bacteria 3092
820 Ga0495619_0020579 3300053085 Bacteria 4205
821 Ga0500578_0000034 3300053086 Bacteria 136582
822 Ga0500644_0000475 3300053088 Bacteria 17705
823 Ga0500644_0007039 3300053088 Bacteria 2912
824 Ga0500646_0010394 3300053090 Bacteria 2388
825 Ga0500583_0002199 3300053092 Bacteria 5793
826 Ga0500583_0047440 3300053092 Bacteria 1979
827 Ga0500641_0000188 3300053096 Bacteria 23249
828 Ga0500641_0012559 3300053096 Bacteria 3094
829 Ga0500562_000077 3300053108 Bacteria 45189
830 Ga0500562_000935 3300053108 Bacteria 7111
831 Ga0500569_000194 3300053109 Bacteria 9667
832 Ga0500642_0067126 3300053130 Bacteria 1625
833 Ga0500652_012467 3300053131 Bacteria 2983
834 Ga0500658_0005885 3300053134 Bacteria 4564
835 Ga0500559_0012611 3300053136 Bacteria 3589
836 Ga0500559_0015288 3300053136 Bacteria 3241
837 Ga0500568_0002131 3300053139 Bacteria 11940
838 Ga0500568_0039990 3300053139 Bacteria 1890
839 Ga0500573_0054826 3300053140 Bacteria 2289
840 Ga0500589_032472 3300053147 Bacteria 2434
841 Ga0500589_037593 3300053147 Bacteria 2260
842 Ga0500604_0000511 3300053151 Bacteria 10771
843 Ga0500604_0006844 3300053151 Bacteria 3017
844 Ga0500616_0002819 3300053153 Bacteria 13977
845 Ga0500616_0006055 3300053153 Bacteria 8026
846 Ga0500622_0000014 3300053156 Bacteria 368189
847 Ga0500622_0000020 3300053156 Bacteria 271239
848 Ga0500622_0000725 3300053156 Bacteria 28810
849 Ga0500622_0001543 3300053156 Bacteria 18252
850 Ga0500622_0020151 3300053156 Bacteria 3541
851 Ga0500634_0031992 3300053161 Bacteria 2870
852 Ga0500636_0020568 3300053177 Bacteria 3908
853 Ga0500636_0026467 3300053177 Bacteria 3427
854 Ga0500611_000031 3300053727 Bacteria 85821
855 Ga0501084_0058451 3300054114 Bacteria 3226
856 Ga0500661_000526 3300055283 Bacteria 7108
857 Ga0466962_0011997 3300061719 Bacteria 4168

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10167353 Ga0207674_101673532 375
2 3300048917 Ga0496114_0000439 Ga0496114_0000439_23546_24760 386
3 3300049707 Ga0501234_006306 Ga0501234_006306_87_1250 387
4 3300005614 Ga0068856_100133394 Ga0068856_1001333942 389
5 3300005616 Ga0068852_100159348 Ga0068852_1001593481 389
6 3300026142 Ga0207698_10104374 Ga0207698_101043743 389
7 3300005327 Ga0070658_10256511 Ga0070658_102565112 390
8 3300005441 Ga0070700_100097610 Ga0070700_1000976102 390
9 3300009094 Ga0111539_10019384 Ga0111539_100193845 390
10 iso_pu_bacteria 2833640130 2833642984 392
11 3300025945 Ga0207679_10157092 Ga0207679_101570922 393
12 3300049570 Ga0501033_0255734 Ga0501033_0255734_43_1224 393
13 iso_pu_bacteria 2919509842 2919510987 393
14 3300013104 Ga0157370_10000319 Ga0157370_1000031947 396
15 3300030734 Ga0316179_1031295 Ga0316179_10312952 396
16 3300031344 Ga0265316_10000989 Ga0265316_1000098914 396
17 3300031712 Ga0265342_10043284 Ga0265342_100432844 396
18 3300032005 Ga0307411_10002742 Ga0307411_100027421 396
19 3300046507 Ga0495606_0090956 Ga0495606_0090956_205_1452 396
20 3300049535 Ga0501319_002049 Ga0501319_002049_12_1205 396
21 3300053096 Ga0500641_0000188 Ga0500641_0000188_21441_22634 396
22 3300053140 Ga0500573_0054826 Ga0500573_0054826_956_2149 396
23 iso_pu_bacteria 2816332280 2817415207 396
24 3300005289 Ga0065704_10071188 Ga0065704_1007118814 397
25 3300005834 Ga0068851_10030515 Ga0068851_100305152 397
26 3300014326 Ga0157380_10002076 Ga0157380_100020768 397
27 3300025321 Ga0207656_10019561 Ga0207656_100195612 397
28 3300033528 Ga0316588_1023036 Ga0316588_10230362 397
29 3300044712 Ga0453684_0033978 Ga0453684_0033978_3565_4758 397
30 3300048918 Ga0496115_0212890 Ga0496115_0212890_257_1453 397
31 3300048928 Ga0496125_0000443 Ga0496125_0000443_29545_30741 397
32 3300048929 Ga0496126_0095277 Ga0496126_0095277_1196_2392 397
33 3300028653 Ga0265323_10001043 Ga0265323_100010437 398
34 3300031344 Ga0265316_10011439 Ga0265316_100114396 398
35 3300037471 Ga0395905_0001098 Ga0395905_0001098_20962_22158 398
36 iso_pu_bacteria 2738541278 2738727080 399
37 iso_pu_bacteria 2818991444 2819590748 399
38 iso_pu_bacteria 2818991460 2819680595 399
39 iso_pu_bacteria 2883068021 2883071100 399
40 iso_pu_bacteria 2884791551 2884797980 399
41 iso_pu_bacteria 2890804823 2890807304 399
42 iso_pu_bacteria 2929177148 2929182886 399
43 iso_pu_bacteria 2945977869 2945978841 399
44 iso_pu_bacteria 2946013367 2946015293 399
45 iso_pu_bacteria 2818991442 2819572431 400
46 iso_pu_bacteria 2821136567 2821140200 400
47 iso_pu_bacteria 2840677318 2840677769 400
48 iso_pu_bacteria 2884634485 2884634894 400
49 iso_pu_bacteria 2896085136 2896085587 400
50 iso_pu_bacteria 2896109856 2896113791 400
51 iso_pu_bacteria 2904467357 2904472323 400
52 iso_pu_bacteria 2919692658 2919693138 400
53 iso_pu_bacteria 2929154850 2929157771 400
54 iso_pu_bacteria 2929239360 2929245018 400
55 iso_pu_bacteria 2929921140 2929927293 400
56 iso_pu_bacteria 8003151029 8003151177 400
57 iso_pu_bacteria 2522125168 2522548210 401
58 iso_pu_bacteria 2911138879 2911143019 401
59 iso_pu_bacteria 2914759650 2914761826 401
60 iso_pu_bacteria 2881955468 2881956394 402
61 3300002459 JGI24751J29686_10000335 JGI24751J29686_100003359 403
62 3300003203 JGI25406J46586_10012667 JGI25406J46586_100126672 403
63 3300003316 rootH1_10026195 rootH1_100261959 403
64 3300003320 rootH2_10008034 rootH2_1000803455 403
65 3300003320 rootH2_10009544 rootH2_100095442 403
66 3300003322 rootL2_10007707 rootL2_100077078 403
67 3300003323 rootH1_10000938 rootH1_100009382 403
68 3300003323 rootH1_10000939 rootH1_100009392 403
69 3300003323 rootH1_10000940 rootH1_1000094018 403
70 3300003323 rootH1_10007034 rootH1_100070345 403
71 3300003323 rootH1_10009521 rootH1_1000952113 403
72 3300003323 rootH1_10204701 rootH1_102047012 403
73 3300003761 Ga0055535_1001325 Ga0055535_10013254 403
74 3300003762 Ga0055542_1003062 Ga0055542_10030621 403
75 3300005262 Ga0065165_1009020 Ga0065165_10090203 403
76 3300005288 Ga0065714_10003401 Ga0065714_100034012 403
77 3300005288 Ga0065714_10106522 Ga0065714_101065222 403
78 3300005290 Ga0065712_10071492 Ga0065712_100714923 403
79 3300005293 Ga0065715_10120220 Ga0065715_101202202 403
80 3300005327 Ga0070658_10021911 Ga0070658_100219114 403
81 3300005327 Ga0070658_10074306 Ga0070658_100743062 403
82 3300005327 Ga0070658_10096594 Ga0070658_100965942 403
83 3300005327 Ga0070658_10180295 Ga0070658_101802952 403
84 3300005328 Ga0070676_10003818 Ga0070676_100038185 403
85 3300005328 Ga0070676_10012539 Ga0070676_100125393 403
86 3300005329 Ga0070683_100001758 Ga0070683_1000017583 403
87 3300005329 Ga0070683_100002901 Ga0070683_1000029019 403
88 3300005329 Ga0070683_100018792 Ga0070683_1000187922 403
89 3300005330 Ga0070690_100112179 Ga0070690_1001121791 403
90 3300005330 Ga0070690_100134853 Ga0070690_1001348532 403
91 3300005331 Ga0070670_100042195 Ga0070670_1000421954 403
92 3300005331 Ga0070670_100067020 Ga0070670_1000670203 403
93 3300005331 Ga0070670_100073046 Ga0070670_1000730463 403
94 3300005331 Ga0070670_100085279 Ga0070670_1000852793 403
95 3300005331 Ga0070670_100087106 Ga0070670_1000871062 403
96 3300005331 Ga0070670_100098114 Ga0070670_1000981141 403
97 3300005333 Ga0070677_10004868 Ga0070677_100048683 403
98 3300005334 Ga0068869_100009712 Ga0068869_1000097123 403
99 3300005334 Ga0068869_100027952 Ga0068869_1000279522 403
100 3300005334 Ga0068869_100060172 Ga0068869_1000601723 403
101 3300005335 Ga0070666_10000411 Ga0070666_100004112 403
102 3300005335 Ga0070666_10002153 Ga0070666_1000215310 403
103 3300005335 Ga0070666_10008024 Ga0070666_100080242 403
104 3300005335 Ga0070666_10069839 Ga0070666_100698392 403
105 3300005336 Ga0070680_100001025 Ga0070680_1000010253 403
106 3300005336 Ga0070680_100011225 Ga0070680_1000112251 403
107 3300005336 Ga0070680_100029784 Ga0070680_1000297842 403
108 3300005336 Ga0070680_100055254 Ga0070680_1000552544 403
109 3300005336 Ga0070680_100105493 Ga0070680_1001054932 403
110 3300005336 Ga0070680_100235342 Ga0070680_1002353422 403
111 3300005337 Ga0070682_100000054 Ga0070682_10000005433 403
112 3300005337 Ga0070682_100011589 Ga0070682_1000115897 403
113 3300005337 Ga0070682_100129528 Ga0070682_1001295281 403
114 3300005337 Ga0070682_100192754 Ga0070682_1001927541 403
115 3300005338 Ga0068868_100003047 Ga0068868_1000030473 403
116 3300005338 Ga0068868_100083582 Ga0068868_1000835822 403
117 3300005339 Ga0070660_100010316 Ga0070660_1000103165 403
118 3300005339 Ga0070660_100062309 Ga0070660_1000623091 403
119 3300005339 Ga0070660_100113317 Ga0070660_1001133172 403
120 3300005340 Ga0070689_100027955 Ga0070689_1000279553 403
121 3300005341 Ga0070691_10015872 Ga0070691_100158723 403
122 3300005344 Ga0070661_100118315 Ga0070661_1001183151 403
123 3300005344 Ga0070661_100286141 Ga0070661_1002861411 403
124 3300005347 Ga0070668_100000043 Ga0070668_10000004330 403
125 3300005347 Ga0070668_100046860 Ga0070668_1000468603 403
126 3300005347 Ga0070668_100158914 Ga0070668_1001589141 403
127 3300005353 Ga0070669_100000660 Ga0070669_10000066023 403
128 3300005354 Ga0070675_100002780 Ga0070675_1000027805 403
129 3300005354 Ga0070675_100004944 Ga0070675_10000494410 403
130 3300005354 Ga0070675_100063619 Ga0070675_1000636192 403
131 3300005354 Ga0070675_100091822 Ga0070675_1000918223 403
132 3300005355 Ga0070671_100035166 Ga0070671_1000351663 403
133 3300005355 Ga0070671_100123875 Ga0070671_1001238751 403
134 3300005356 Ga0070674_100099630 Ga0070674_1000996302 403
135 3300005356 Ga0070674_100234128 Ga0070674_1002341281 403
136 3300005364 Ga0070673_100002573 Ga0070673_1000025734 403
137 3300005364 Ga0070673_100179440 Ga0070673_1001794401 403
138 3300005364 Ga0070673_100193161 Ga0070673_1001931611 403
139 3300005365 Ga0070688_100003168 Ga0070688_1000031687 403
140 3300005365 Ga0070688_100011188 Ga0070688_1000111886 403
141 3300005365 Ga0070688_100213944 Ga0070688_1002139441 403
142 3300005366 Ga0070659_100003702 Ga0070659_1000037029 403
143 3300005366 Ga0070659_100180256 Ga0070659_1001802562 403
144 3300005367 Ga0070667_100000254 Ga0070667_10000025423 403
145 3300005367 Ga0070667_100019703 Ga0070667_1000197035 403
146 3300005367 Ga0070667_100027762 Ga0070667_1000277622 403
147 3300005367 Ga0070667_100053091 Ga0070667_1000530911 403
148 3300005438 Ga0070701_10019903 Ga0070701_100199031 403
149 3300005441 Ga0070700_100040931 Ga0070700_1000409313 403
150 3300005455 Ga0070663_100067568 Ga0070663_1000675683 403
151 3300005456 Ga0070678_100025990 Ga0070678_1000259903 403
152 3300005456 Ga0070678_100039245 Ga0070678_1000392452 403
153 3300005457 Ga0070662_100002089 Ga0070662_1000020896 403
154 3300005457 Ga0070662_100015197 Ga0070662_1000151974 403
155 3300005457 Ga0070662_100027246 Ga0070662_1000272464 403
156 3300005457 Ga0070662_100031364 Ga0070662_1000313643 403
157 3300005457 Ga0070662_100091725 Ga0070662_1000917251 403
158 3300005457 Ga0070662_100179959 Ga0070662_1001799593 403
159 3300005458 Ga0070681_10038592 Ga0070681_100385923 403
160 3300005458 Ga0070681_10051262 Ga0070681_100512622 403
161 3300005458 Ga0070681_10052163 Ga0070681_100521636 403
162 3300005458 Ga0070681_10095837 Ga0070681_100958373 403
163 3300005458 Ga0070681_10112277 Ga0070681_101122772 403
164 3300005459 Ga0068867_100007630 Ga0068867_1000076306 403
165 3300005459 Ga0068867_100027897 Ga0068867_1000278972 403
166 3300005459 Ga0068867_100226863 Ga0068867_1002268631 403
167 3300005466 Ga0070685_10004944 Ga0070685_100049442 403
168 3300005466 Ga0070685_10085830 Ga0070685_100858302 403
169 3300005471 Ga0070698_100000392 Ga0070698_10000039229 403
170 3300005471 Ga0070698_100010460 Ga0070698_1000104605 403
171 3300005530 Ga0070679_100000174 Ga0070679_10000017414 403
172 3300005530 Ga0070679_100001499 Ga0070679_1000014998 403
173 3300005530 Ga0070679_100003920 Ga0070679_1000039207 403
174 3300005530 Ga0070679_100019897 Ga0070679_1000198973 403
175 3300005530 Ga0070679_100046468 Ga0070679_1000464682 403
176 3300005535 Ga0070684_100000662 Ga0070684_1000006626 403
177 3300005535 Ga0070684_100064944 Ga0070684_1000649442 403
178 3300005535 Ga0070684_100107297 Ga0070684_1001072972 403
179 3300005535 Ga0070684_100249157 Ga0070684_1002491572 403
180 3300005539 Ga0068853_100000381 Ga0068853_10000038116 403
181 3300005539 Ga0068853_100004978 Ga0068853_1000049789 403
182 3300005539 Ga0068853_100023196 Ga0068853_1000231965 403
183 3300005539 Ga0068853_100270227 Ga0068853_1002702271 403
184 3300005543 Ga0070672_100000109 Ga0070672_1000001094 403
185 3300005543 Ga0070672_100026702 Ga0070672_1000267023 403
186 3300005543 Ga0070672_100050208 Ga0070672_1000502082 403
187 3300005543 Ga0070672_100167373 Ga0070672_1001673731 403
188 3300005547 Ga0070693_100002584 Ga0070693_1000025845 403
189 3300005548 Ga0070665_100002085 Ga0070665_10000208517 403
190 3300005548 Ga0070665_100027777 Ga0070665_1000277775 403
191 3300005549 Ga0070704_100152519 Ga0070704_1001525192 403
192 3300005563 Ga0068855_100000995 Ga0068855_10000099517 403
193 3300005563 Ga0068855_100003373 Ga0068855_1000033736 403
194 3300005563 Ga0068855_100015722 Ga0068855_1000157223 403
195 3300005563 Ga0068855_100023944 Ga0068855_1000239442 403
196 3300005563 Ga0068855_100030990 Ga0068855_1000309907 403
197 3300005563 Ga0068855_100042337 Ga0068855_1000423374 403
198 3300005563 Ga0068855_100042453 Ga0068855_1000424533 403
199 3300005563 Ga0068855_100091126 Ga0068855_1000911262 403
200 3300005563 Ga0068855_100143388 Ga0068855_1001433882 403
201 3300005564 Ga0070664_100003411 Ga0070664_10000341116 403
202 3300005564 Ga0070664_100012446 Ga0070664_1000124463 403
203 3300005564 Ga0070664_100140373 Ga0070664_1001403732 403
204 3300005564 Ga0070664_100144610 Ga0070664_1001446101 403
205 3300005577 Ga0068857_100019259 Ga0068857_1000192595 403
206 3300005577 Ga0068857_100084584 Ga0068857_1000845843 403
207 3300005577 Ga0068857_100250133 Ga0068857_1002501332 403
208 3300005578 Ga0068854_100141734 Ga0068854_1001417341 403
209 3300005578 Ga0068854_100308004 Ga0068854_1003080041 403
210 3300005614 Ga0068856_100020074 Ga0068856_1000200744 403
211 3300005614 Ga0068856_100123417 Ga0068856_1001234172 403
212 3300005616 Ga0068852_100032963 Ga0068852_1000329632 403
213 3300005616 Ga0068852_100039686 Ga0068852_1000396862 403
214 3300005616 Ga0068852_100061644 Ga0068852_1000616442 403
215 3300005617 Ga0068859_100000037 Ga0068859_10000003743 403
216 3300005617 Ga0068859_100024350 Ga0068859_1000243504 403
217 3300005617 Ga0068859_100048491 Ga0068859_1000484914 403
218 3300005617 Ga0068859_100065792 Ga0068859_1000657922 403
219 3300005617 Ga0068859_100173645 Ga0068859_1001736452 403
220 3300005617 Ga0068859_100386686 Ga0068859_1003866861 403
221 3300005618 Ga0068864_100001192 Ga0068864_10000119210 403
222 3300005618 Ga0068864_100029740 Ga0068864_1000297403 403
223 3300005618 Ga0068864_100039621 Ga0068864_1000396212 403
224 3300005618 Ga0068864_100040012 Ga0068864_1000400122 403
225 3300005618 Ga0068864_100061670 Ga0068864_1000616703 403
226 3300005719 Ga0068861_100003469 Ga0068861_1000034696 403
227 3300005834 Ga0068851_10001233 Ga0068851_100012334 403
228 3300005834 Ga0068851_10057539 Ga0068851_100575392 403
229 3300005840 Ga0068870_10037735 Ga0068870_100377352 403
230 3300005840 Ga0068870_10048484 Ga0068870_100484843 403
231 3300005841 Ga0068863_100002618 Ga0068863_10000261812 403
232 3300005841 Ga0068863_100002856 Ga0068863_10000285614 403
233 3300005841 Ga0068863_100074923 Ga0068863_1000749233 403
234 3300005841 Ga0068863_100154699 Ga0068863_1001546993 403
235 3300005842 Ga0068858_100000199 Ga0068858_10000019934 403
236 3300005842 Ga0068858_100018293 Ga0068858_1000182936 403
237 3300005843 Ga0068860_100000700 Ga0068860_10000070033 403
238 3300005843 Ga0068860_100013203 Ga0068860_1000132034 403
239 3300005843 Ga0068860_100152109 Ga0068860_1001521092 403
240 3300005843 Ga0068860_100217921 Ga0068860_1002179212 403
241 3300005844 Ga0068862_100007282 Ga0068862_1000072827 403
242 3300005844 Ga0068862_100010232 Ga0068862_1000102325 403
243 3300005983 Ga0081540_1018059 Ga0081540_10180591 403
244 3300005985 Ga0081539_10003031 Ga0081539_1000303119 403
245 3300005985 Ga0081539_10004761 Ga0081539_1000476116 403
246 3300006237 Ga0097621_100001591 Ga0097621_10000159111 403
247 3300006237 Ga0097621_100003742 Ga0097621_1000037427 403
248 3300006237 Ga0097621_100004103 Ga0097621_10000410310 403
249 3300006237 Ga0097621_100024053 Ga0097621_1000240535 403
250 3300006358 Ga0068871_100000737 Ga0068871_10000073710 403
251 3300006358 Ga0068871_100002768 Ga0068871_1000027684 403
252 3300006358 Ga0068871_100008698 Ga0068871_1000086986 403
253 3300006358 Ga0068871_100018879 Ga0068871_1000188792 403
254 3300006358 Ga0068871_100024986 Ga0068871_1000249861 403
255 3300006358 Ga0068871_100088023 Ga0068871_1000880233 403
256 3300006358 Ga0068871_100129186 Ga0068871_1001291862 403
257 3300006358 Ga0068871_100277197 Ga0068871_1002771971 403
258 3300006844 Ga0075428_100009100 Ga0075428_1000091005 403
259 3300006846 Ga0075430_100002881 Ga0075430_10000288111 403
260 3300006880 Ga0075429_100002313 Ga0075429_1000023139 403
261 3300006880 Ga0075429_100027037 Ga0075429_1000270376 403
262 3300006881 Ga0068865_100010112 Ga0068865_1000101123 403
263 3300006931 Ga0097620_100000037 Ga0097620_10000003743 403
264 3300006931 Ga0097620_100024352 Ga0097620_1000243524 403
265 3300006931 Ga0097620_100048492 Ga0097620_1000484924 403
266 3300006931 Ga0097620_100065794 Ga0097620_1000657942 403
267 3300006931 Ga0097620_100173645 Ga0097620_1001736452 403
268 3300006931 Ga0097620_100386659 Ga0097620_1003866591 403
269 3300009093 Ga0105240_10002232 Ga0105240_1000223223 403
270 3300009093 Ga0105240_10003321 Ga0105240_100033219 403
271 3300009093 Ga0105240_10005749 Ga0105240_100057495 403
272 3300009093 Ga0105240_10077274 Ga0105240_100772742 403
273 3300009093 Ga0105240_10111385 Ga0105240_101113852 403
274 3300009093 Ga0105240_10213177 Ga0105240_102131772 403
275 3300009094 Ga0111539_10202016 Ga0111539_102020162 403
276 3300009098 Ga0105245_10040885 Ga0105245_100408853 403
277 3300009101 Ga0105247_10000946 Ga0105247_100009464 403
278 3300009101 Ga0105247_10075971 Ga0105247_100759712 403
279 3300009147 Ga0114129_10156418 Ga0114129_101564183 403
280 3300009174 Ga0105241_10012294 Ga0105241_100122945 403
281 3300009174 Ga0105241_10039402 Ga0105241_100394022 403
282 3300009176 Ga0105242_10023093 Ga0105242_100230934 403
283 3300009176 Ga0105242_10047988 Ga0105242_100479882 403
284 3300009176 Ga0105242_10060461 Ga0105242_100604612 403
285 3300009176 Ga0105242_10104591 Ga0105242_101045912 403
286 3300009176 Ga0105242_10171899 Ga0105242_101718992 403
287 3300009177 Ga0105248_10027033 Ga0105248_100270334 403
288 3300009177 Ga0105248_10075391 Ga0105248_100753912 403
289 3300009545 Ga0105237_10000719 Ga0105237_1000071918 403
290 3300009545 Ga0105237_10001973 Ga0105237_1000197311 403
291 3300009545 Ga0105237_10002801 Ga0105237_1000280117 403
292 3300009545 Ga0105237_10025051 Ga0105237_100250515 403
293 3300009551 Ga0105238_10178835 Ga0105238_101788351 403
294 3300009553 Ga0105249_10001713 Ga0105249_100017138 403
295 3300009553 Ga0105249_10003686 Ga0105249_1000368613 403
296 3300009553 Ga0105249_10004032 Ga0105249_100040325 403
297 3300009553 Ga0105249_10004791 Ga0105249_100047919 403
298 3300009553 Ga0105249_10012772 Ga0105249_100127723 403
299 3300009553 Ga0105249_10020558 Ga0105249_100205584 403
300 3300009553 Ga0105249_10034354 Ga0105249_100343544 403
301 3300009553 Ga0105249_10057070 Ga0105249_100570705 403
302 3300009553 Ga0105249_10075451 Ga0105249_100754513 403
303 3300010375 Ga0105239_10000685 Ga0105239_1000068524 403
304 3300010375 Ga0105239_10000785 Ga0105239_1000078511 403
305 3300010375 Ga0105239_10019299 Ga0105239_100192993 403
306 3300010375 Ga0105239_10024490 Ga0105239_100244904 403
307 3300010375 Ga0105239_10044357 Ga0105239_100443574 403
308 3300010375 Ga0105239_10100452 Ga0105239_101004522 403
309 3300011119 Ga0105246_10030831 Ga0105246_100308313 403
310 3300013100 Ga0157373_10004243 Ga0157373_100042433 403
311 3300013100 Ga0157373_10006313 Ga0157373_100063132 403
312 3300013100 Ga0157373_10035137 Ga0157373_100351375 403
313 3300013100 Ga0157373_10105957 Ga0157373_101059572 403
314 3300013100 Ga0157373_10117437 Ga0157373_101174373 403
315 3300013102 Ga0157371_10000318 Ga0157371_100003187 403
316 3300013102 Ga0157371_10000499 Ga0157371_100004998 403
317 3300013102 Ga0157371_10006599 Ga0157371_100065993 403
318 3300013102 Ga0157371_10009522 Ga0157371_100095222 403
319 3300013102 Ga0157371_10012029 Ga0157371_100120294 403
320 3300013102 Ga0157371_10012639 Ga0157371_100126392 403
321 3300013102 Ga0157371_10013867 Ga0157371_100138676 403
322 3300013102 Ga0157371_10017864 Ga0157371_100178644 403
323 3300013102 Ga0157371_10033090 Ga0157371_100330902 403
324 3300013102 Ga0157371_10174696 Ga0157371_101746961 403
325 3300013104 Ga0157370_10000621 Ga0157370_1000062120 403
326 3300013104 Ga0157370_10001966 Ga0157370_1000196612 403
327 3300013104 Ga0157370_10005125 Ga0157370_100051257 403
328 3300013104 Ga0157370_10013929 Ga0157370_100139296 403
329 3300013104 Ga0157370_10024532 Ga0157370_100245322 403
330 3300013104 Ga0157370_10040907 Ga0157370_100409077 403
331 3300013104 Ga0157370_10237753 Ga0157370_102377532 403
332 3300013105 Ga0157369_10006884 Ga0157369_100068848 403
333 3300013105 Ga0157369_10053658 Ga0157369_100536581 403
334 3300013296 Ga0157374_10000001 Ga0157374_1000000153 403
335 3300013296 Ga0157374_10023176 Ga0157374_100231765 403
336 3300013296 Ga0157374_10038227 Ga0157374_100382273 403
337 3300013296 Ga0157374_10067964 Ga0157374_100679643 403
338 3300013296 Ga0157374_10101461 Ga0157374_101014611 403
339 3300013297 Ga0157378_10003535 Ga0157378_100035355 403
340 3300013297 Ga0157378_10011371 Ga0157378_100113715 403
341 3300013297 Ga0157378_10080891 Ga0157378_100808912 403
342 3300013297 Ga0157378_10226075 Ga0157378_102260753 403
343 3300013306 Ga0163162_10000524 Ga0163162_1000052410 403
344 3300013306 Ga0163162_10000840 Ga0163162_100008406 403
345 3300013306 Ga0163162_10001778 Ga0163162_100017783 403
346 3300013306 Ga0163162_10001883 Ga0163162_100018839 403
347 3300013306 Ga0163162_10003204 Ga0163162_100032043 403
348 3300013306 Ga0163162_10005597 Ga0163162_100055978 403
349 3300013306 Ga0163162_10005731 Ga0163162_100057315 403
350 3300013306 Ga0163162_10010470 Ga0163162_100104703 403
351 3300013306 Ga0163162_10012063 Ga0163162_100120632 403
352 3300013306 Ga0163162_10017061 Ga0163162_100170614 403
353 3300013306 Ga0163162_10166527 Ga0163162_101665272 403
354 3300013307 Ga0157372_10001226 Ga0157372_1000122622 403
355 3300013307 Ga0157372_10005928 Ga0157372_100059281 403
356 3300013307 Ga0157372_10019675 Ga0157372_100196755 403
357 3300013307 Ga0157372_10022141 Ga0157372_100221418 403
358 3300013307 Ga0157372_10036250 Ga0157372_100362502 403
359 3300013307 Ga0157372_10038003 Ga0157372_100380032 403
360 3300013307 Ga0157372_10038401 Ga0157372_100384016 403
361 3300013307 Ga0157372_10086437 Ga0157372_100864373 403
362 3300013307 Ga0157372_10130669 Ga0157372_101306692 403
363 3300013307 Ga0157372_10154925 Ga0157372_101549252 403
364 3300013307 Ga0157372_10194077 Ga0157372_101940771 403
365 3300013307 Ga0157372_10392658 Ga0157372_103926581 403
366 3300013308 Ga0157375_10004232 Ga0157375_100042328 403
367 3300013308 Ga0157375_10005528 Ga0157375_100055284 403
368 3300013308 Ga0157375_10006502 Ga0157375_100065026 403
369 3300013308 Ga0157375_10023857 Ga0157375_100238575 403
370 3300013308 Ga0157375_10025764 Ga0157375_100257643 403
371 3300013308 Ga0157375_10131982 Ga0157375_101319822 403
372 3300013308 Ga0157375_10244304 Ga0157375_102443042 403
373 3300014325 Ga0163163_10000332 Ga0163163_1000033228 403
374 3300014325 Ga0163163_10000407 Ga0163163_1000040725 403
375 3300014325 Ga0163163_10109811 Ga0163163_101098112 403
376 3300014325 Ga0163163_10217980 Ga0163163_102179801 403
377 3300014325 Ga0163163_10253065 Ga0163163_102530652 403
378 3300014326 Ga0157380_10001567 Ga0157380_100015675 403
379 3300014326 Ga0157380_10004048 Ga0157380_1000404811 403
380 3300014326 Ga0157380_10022571 Ga0157380_100225713 403
381 3300014326 Ga0157380_10034929 Ga0157380_100349292 403
382 3300014326 Ga0157380_10041792 Ga0157380_100417921 403
383 3300014326 Ga0157380_10064388 Ga0157380_100643884 403
384 3300014326 Ga0157380_10071237 Ga0157380_100712372 403
385 3300014745 Ga0157377_10004234 Ga0157377_100042342 403
386 3300014745 Ga0157377_10045316 Ga0157377_100453162 403
387 3300014968 Ga0157379_10000340 Ga0157379_100003404 403
388 3300014968 Ga0157379_10032196 Ga0157379_100321963 403
389 3300014968 Ga0157379_10069083 Ga0157379_100690832 403
390 3300014968 Ga0157379_10078430 Ga0157379_100784301 403
391 3300014968 Ga0157379_10108069 Ga0157379_101080692 403
392 3300014969 Ga0157376_10001605 Ga0157376_1000160510 403
393 3300014969 Ga0157376_10003155 Ga0157376_100031553 403
394 3300014969 Ga0157376_10012276 Ga0157376_100122762 403
395 3300014969 Ga0157376_10017890 Ga0157376_100178901 403
396 3300014969 Ga0157376_10019002 Ga0157376_100190025 403
397 3300014969 Ga0157376_10037870 Ga0157376_100378706 403
398 3300017792 Ga0163161_10000823 Ga0163161_100008232 403
399 3300021384 Ga0213876_10000584 Ga0213876_100005846 403
400 3300021384 Ga0213876_10002362 Ga0213876_100023625 403
401 3300025242 Ga0209258_100068 Ga0209258_10006881 403
402 3300025246 Ga0209646_1001893 Ga0209646_10018933 403
403 3300025254 Ga0209148_1000343 Ga0209148_100034317 403
404 3300025302 Ga0207426_1000002 Ga0207426_1000002997 403
405 3300025302 Ga0207426_1000164 Ga0207426_100016438 403
406 3300025321 Ga0207656_10002336 Ga0207656_100023363 403
407 3300025321 Ga0207656_10070388 Ga0207656_100703882 403
408 3300025899 Ga0207642_10034382 Ga0207642_100343821 403
409 3300025899 Ga0207642_10076630 Ga0207642_100766301 403
410 3300025900 Ga0207710_10008776 Ga0207710_100087765 403
411 3300025903 Ga0207680_10000619 Ga0207680_100006192 403
412 3300025903 Ga0207680_10020374 Ga0207680_100203743 403
413 3300025904 Ga0207647_10044871 Ga0207647_100448712 403
414 3300025907 Ga0207645_10000378 Ga0207645_1000037830 403
415 3300025907 Ga0207645_10000763 Ga0207645_1000076322 403
416 3300025908 Ga0207643_10001933 Ga0207643_100019333 403
417 3300025908 Ga0207643_10002437 Ga0207643_100024379 403
418 3300025909 Ga0207705_10000717 Ga0207705_1000071720 403
419 3300025909 Ga0207705_10002776 Ga0207705_100027764 403
420 3300025909 Ga0207705_10055536 Ga0207705_100555362 403
421 3300025909 Ga0207705_10110743 Ga0207705_101107432 403
422 3300025911 Ga0207654_10005854 Ga0207654_100058542 403
423 3300025911 Ga0207654_10032775 Ga0207654_100327751 403
424 3300025912 Ga0207707_10000323 Ga0207707_100003235 403
425 3300025912 Ga0207707_10020931 Ga0207707_100209313 403
426 3300025912 Ga0207707_10190794 Ga0207707_101907942 403
427 3300025912 Ga0207707_10220986 Ga0207707_102209862 403
428 3300025913 Ga0207695_10000023 Ga0207695_10000023198 403
429 3300025913 Ga0207695_10000031 Ga0207695_10000031372 403
430 3300025913 Ga0207695_10000110 Ga0207695_1000011099 403
431 3300025913 Ga0207695_10017407 Ga0207695_100174072 403
432 3300025913 Ga0207695_10018132 Ga0207695_100181323 403
433 3300025913 Ga0207695_10077325 Ga0207695_100773253 403
434 3300025914 Ga0207671_10001536 Ga0207671_1000153615 403
435 3300025914 Ga0207671_10002513 Ga0207671_100025138 403
436 3300025914 Ga0207671_10047911 Ga0207671_100479112 403
437 3300025917 Ga0207660_10012104 Ga0207660_100121042 403
438 3300025919 Ga0207657_10005727 Ga0207657_100057279 403
439 3300025919 Ga0207657_10011956 Ga0207657_100119567 403
440 3300025919 Ga0207657_10072488 Ga0207657_100724881 403
441 3300025919 Ga0207657_10094429 Ga0207657_100944292 403
442 3300025920 Ga0207649_10077560 Ga0207649_100775602 403
443 3300025921 Ga0207652_10000132 Ga0207652_1000013239 403
444 3300025921 Ga0207652_10000713 Ga0207652_100007133 403
445 3300025921 Ga0207652_10017662 Ga0207652_100176622 403
446 3300025923 Ga0207681_10019898 Ga0207681_100198982 403
447 3300025925 Ga0207650_10070537 Ga0207650_100705371 403
448 3300025926 Ga0207659_10032682 Ga0207659_100326822 403
449 3300025926 Ga0207659_10037741 Ga0207659_100377413 403
450 3300025931 Ga0207644_10038614 Ga0207644_100386143 403
451 3300025931 Ga0207644_10097004 Ga0207644_100970041 403
452 3300025932 Ga0207690_10013324 Ga0207690_100133246 403
453 3300025932 Ga0207690_10028354 Ga0207690_100283543 403
454 3300025933 Ga0207706_10005229 Ga0207706_100052293 403
455 3300025933 Ga0207706_10009726 Ga0207706_100097265 403
456 3300025933 Ga0207706_10012289 Ga0207706_100122893 403
457 3300025933 Ga0207706_10013804 Ga0207706_100138042 403
458 3300025933 Ga0207706_10041013 Ga0207706_100410137 403
459 3300025933 Ga0207706_10094724 Ga0207706_100947242 403
460 3300025934 Ga0207686_10038744 Ga0207686_100387443 403
461 3300025936 Ga0207670_10048750 Ga0207670_100487503 403
462 3300025936 Ga0207670_10083764 Ga0207670_100837642 403
463 3300025936 Ga0207670_10119845 Ga0207670_101198452 403
464 3300025938 Ga0207704_10005264 Ga0207704_100052643 403
465 3300025938 Ga0207704_10034464 Ga0207704_100344642 403
466 3300025940 Ga0207691_10000227 Ga0207691_1000022723 403
467 3300025940 Ga0207691_10013965 Ga0207691_100139656 403
468 3300025940 Ga0207691_10062119 Ga0207691_100621192 403
469 3300025940 Ga0207691_10096532 Ga0207691_100965323 403
470 3300025940 Ga0207691_10103237 Ga0207691_101032371 403
471 3300025942 Ga0207689_10002045 Ga0207689_1000204519 403
472 3300025942 Ga0207689_10003446 Ga0207689_1000344611 403
473 3300025942 Ga0207689_10003531 Ga0207689_100035313 403
474 3300025942 Ga0207689_10004234 Ga0207689_100042344 403
475 3300025942 Ga0207689_10011373 Ga0207689_1001137310 403
476 3300025942 Ga0207689_10025901 Ga0207689_100259014 403
477 3300025942 Ga0207689_10056715 Ga0207689_100567151 403
478 3300025942 Ga0207689_10143286 Ga0207689_101432861 403
479 3300025944 Ga0207661_10045478 Ga0207661_100454782 403
480 3300025944 Ga0207661_10109524 Ga0207661_101095241 403
481 3300025944 Ga0207661_10120246 Ga0207661_101202463 403
482 3300025945 Ga0207679_10102601 Ga0207679_101026012 403
483 3300025949 Ga0207667_10000144 Ga0207667_1000014431 403
484 3300025949 Ga0207667_10005340 Ga0207667_1000534011 403
485 3300025949 Ga0207667_10023124 Ga0207667_100231248 403
486 3300025949 Ga0207667_10039915 Ga0207667_100399152 403
487 3300025949 Ga0207667_10052787 Ga0207667_100527874 403
488 3300025960 Ga0207651_10002380 Ga0207651_100023807 403
489 3300025960 Ga0207651_10018126 Ga0207651_100181262 403
490 3300025960 Ga0207651_10075712 Ga0207651_100757121 403
491 3300025960 Ga0207651_10145571 Ga0207651_101455712 403
492 3300025961 Ga0207712_10003315 Ga0207712_100033154 403
493 3300025961 Ga0207712_10007921 Ga0207712_100079214 403
494 3300025961 Ga0207712_10008082 Ga0207712_100080823 403
495 3300025961 Ga0207712_10014895 Ga0207712_100148954 403
496 3300025961 Ga0207712_10032658 Ga0207712_100326585 403
497 3300025961 Ga0207712_10070570 Ga0207712_100705701 403
498 3300025961 Ga0207712_10120156 Ga0207712_101201561 403
499 3300025961 Ga0207712_10290390 Ga0207712_102903901 403
500 3300025972 Ga0207668_10000679 Ga0207668_1000067914 403
501 3300025972 Ga0207668_10008809 Ga0207668_100088094 403
502 3300025972 Ga0207668_10038350 Ga0207668_100383503 403
503 3300025972 Ga0207668_10083481 Ga0207668_100834812 403
504 3300025972 Ga0207668_10132718 Ga0207668_101327183 403
505 3300025981 Ga0207640_10119688 Ga0207640_101196881 403
506 3300025981 Ga0207640_10202917 Ga0207640_102029171 403
507 3300025981 Ga0207640_10213358 Ga0207640_102133581 403
508 3300025986 Ga0207658_10000176 Ga0207658_1000017630 403
509 3300025986 Ga0207658_10081045 Ga0207658_100810452 403
510 3300025986 Ga0207658_10097445 Ga0207658_100974452 403
511 3300026023 Ga0207677_10200572 Ga0207677_102005722 403
512 3300026035 Ga0207703_10000433 Ga0207703_1000043333 403
513 3300026035 Ga0207703_10003126 Ga0207703_1000312611 403
514 3300026041 Ga0207639_10010289 Ga0207639_100102896 403
515 3300026041 Ga0207639_10226161 Ga0207639_102261612 403
516 3300026078 Ga0207702_10040374 Ga0207702_100403742 403
517 3300026078 Ga0207702_10083529 Ga0207702_100835292 403
518 3300026078 Ga0207702_10164195 Ga0207702_101641951 403
519 3300026088 Ga0207641_10000226 Ga0207641_100002269 403
520 3300026088 Ga0207641_10012826 Ga0207641_100128263 403
521 3300026088 Ga0207641_10014131 Ga0207641_100141316 403
522 3300026088 Ga0207641_10135852 Ga0207641_101358522 403
523 3300026089 Ga0207648_10003768 Ga0207648_1000376811 403
524 3300026089 Ga0207648_10007506 Ga0207648_100075063 403
525 3300026089 Ga0207648_10013131 Ga0207648_100131314 403
526 3300026089 Ga0207648_10040889 Ga0207648_100408894 403
527 3300026089 Ga0207648_10047172 Ga0207648_100471723 403
528 3300026089 Ga0207648_10057857 Ga0207648_100578572 403
529 3300026095 Ga0207676_10001240 Ga0207676_1000124012 403
530 3300026095 Ga0207676_10013461 Ga0207676_100134615 403
531 3300026095 Ga0207676_10020222 Ga0207676_100202223 403
532 3300026095 Ga0207676_10046530 Ga0207676_100465302 403
533 3300026095 Ga0207676_10048482 Ga0207676_100484822 403
534 3300026116 Ga0207674_10006654 Ga0207674_100066545 403
535 3300026116 Ga0207674_10015073 Ga0207674_100150736 403
536 3300026116 Ga0207674_10017055 Ga0207674_100170559 403
537 3300026116 Ga0207674_10017645 Ga0207674_100176456 403
538 3300026116 Ga0207674_10031117 Ga0207674_100311173 403
539 3300026116 Ga0207674_10122929 Ga0207674_101229291 403
540 3300026116 Ga0207674_10137166 Ga0207674_101371663 403
541 3300026118 Ga0207675_100008068 Ga0207675_10000806811 403
542 3300026118 Ga0207675_100057429 Ga0207675_1000574292 403
543 3300026118 Ga0207675_100089718 Ga0207675_1000897181 403
544 3300026118 Ga0207675_100139676 Ga0207675_1001396762 403
545 3300026118 Ga0207675_100280555 Ga0207675_1002805552 403
546 3300026121 Ga0207683_10001455 Ga0207683_100014552 403
547 3300026121 Ga0207683_10120369 Ga0207683_101203693 403
548 3300026121 Ga0207683_10177500 Ga0207683_101775002 403
549 3300026142 Ga0207698_10002228 Ga0207698_100022286 403
550 3300026142 Ga0207698_10029722 Ga0207698_100297223 403
551 3300026142 Ga0207698_10130927 Ga0207698_101309271 403
552 3300026142 Ga0207698_10193103 Ga0207698_101931031 403
553 3300026142 Ga0207698_10268755 Ga0207698_102687551 403
554 3300026142 Ga0207698_10286375 Ga0207698_102863752 403
555 3300027907 Ga0207428_10138124 Ga0207428_101381242 403
556 3300028379 Ga0268266_10011164 Ga0268266_100111644 403
557 3300028379 Ga0268266_10018579 Ga0268266_100185797 403
558 3300028380 Ga0268265_10011975 Ga0268265_100119753 403
559 3300028380 Ga0268265_10039803 Ga0268265_100398033 403
560 3300028381 Ga0268264_10002959 Ga0268264_1000295913 403
561 3300028381 Ga0268264_10009695 Ga0268264_100096954 403
562 3300028381 Ga0268264_10017026 Ga0268264_100170261 403
563 3300028381 Ga0268264_10086619 Ga0268264_100866192 403
564 3300028381 Ga0268264_10140300 Ga0268264_101403002 403
565 3300028381 Ga0268264_10217134 Ga0268264_102171342 403
566 3300028573 Ga0265334_10044384 Ga0265334_100443842 403
567 3300028786 Ga0307517_10002168 Ga0307517_1000216816 403
568 3300028794 Ga0307515_10000001 Ga0307515_100000011023 403
569 3300028794 Ga0307515_10000469 Ga0307515_100004695 403
570 3300028794 Ga0307515_10001093 Ga0307515_100010934 403
571 3300028794 Ga0307515_10130111 Ga0307515_101301112 403
572 3300030521 Ga0307511_10000139 Ga0307511_1000013939 403
573 3300031251 Ga0265327_10000248 Ga0265327_1000024888 403
574 3300031251 Ga0265327_10000344 Ga0265327_1000034440 403
575 3300031507 Ga0307509_10025149 Ga0307509_100251492 403
576 3300031507 Ga0307509_10231184 Ga0307509_102311842 403
577 3300031595 Ga0265313_10032946 Ga0265313_100329462 403
578 3300031616 Ga0307508_10067215 Ga0307508_100672151 403
579 3300031616 Ga0307508_10122302 Ga0307508_101223022 403
580 3300031649 Ga0307514_10015943 Ga0307514_100159435 403
581 3300031727 Ga0316576_10098873 Ga0316576_100988732 403
582 3300031730 Ga0307516_10001339 Ga0307516_100013399 403
583 3300031730 Ga0307516_10048026 Ga0307516_100480263 403
584 3300031731 Ga0307405_10058628 Ga0307405_100586282 403
585 3300032002 Ga0307416_100096360 Ga0307416_1000963602 403
586 3300032126 Ga0307415_100036116 Ga0307415_1000361161 403
587 3300033180 Ga0307510_10048530 Ga0307510_100485302 403
588 3300035724 Ga0373933_0120653 Ga0373933_0120653_232_1443 403
589 3300036401 Ga0373937_0132909 Ga0373937_0132909_467_1678 403
590 3300037312 Ga0395899_0006685 Ga0395899_0006685_6492_7703 403
591 3300037312 Ga0395899_0011397 Ga0395899_0011397_5259_6539 403
592 3300037312 Ga0395899_0057450 Ga0395899_0057450_191_1402 403
593 3300037418 Ga0395900_0007443 Ga0395900_0007443_6069_7349 403
594 3300037418 Ga0395900_0040022 Ga0395900_0040022_3538_4749 403
595 3300037418 Ga0395900_0064927 Ga0395900_0064927_2367_3578 403
596 3300037466 Ga0395898_0002124 Ga0395898_0002124_3052_4332 403
597 3300037466 Ga0395898_0002566 Ga0395898_0002566_13849_15060 403
598 3300037471 Ga0395905_0000003 Ga0395905_0000003_377299_378510 403
599 3300037471 Ga0395905_0010903 Ga0395905_0010903_4578_5789 403
600 3300037471 Ga0395905_0104734 Ga0395905_0104734_823_2034 403
601 3300038443 Ga0395901_0001075 Ga0395901_0001075_15174_16385 403
602 3300038443 Ga0395901_0010128 Ga0395901_0010128_726_2006 403
603 3300038443 Ga0395901_0034989 Ga0395901_0034989_1351_2562 403
604 3300038443 Ga0395901_0041287 Ga0395901_0041287_2308_3594 403
605 3300038443 Ga0395901_0317988 Ga0395901_0317988_304_1590 403
606 3300039437 Ga0436365_0585774 Ga0436365_0585774_50957_52168 403
607 3300039437 Ga0436365_0678933 Ga0436365_0678933_144_1355 403
608 3300039437 Ga0436365_1029016 Ga0436365_1029016_7266_8477 403
609 3300039437 Ga0436365_1894125 Ga0436365_1894125_366_1577 403
610 3300041491 Ga0451833_1482918 Ga0451833_1482918_69_1280 403
611 3300042007 Ga0439449_0000099 Ga0439449_0000099_19525_20736 403
612 3300042014 Ga0439457_000696 Ga0439457_000696_8013_9254 403
613 3300042015 Ga0439462_0000918 Ga0439462_0000918_828_2258 403
614 3300044656 Ga0466969_0000238 Ga0466969_0000238_14062_15273 403
615 3300044658 Ga0466972_0000003 Ga0466972_0000003_152128_153339 403
616 3300044658 Ga0466972_0000039 Ga0466972_0000039_5545_6756 403
617 3300044684 Ga0466966_0000136 Ga0466966_0000136_21052_22263 403
618 3300044706 Ga0466964_0012435 Ga0466964_0012435_683_1894 403
619 3300044712 Ga0453684_0092446 Ga0453684_0092446_2011_3222 403
620 3300044712 Ga0453684_0257288 Ga0453684_0257288_476_1687 403
621 3300044765 Ga0466970_0000460 Ga0466970_0000460_9516_10727 403
622 3300044765 Ga0466970_0015787 Ga0466970_0015787_796_2007 403
623 3300044765 Ga0466970_0056323 Ga0466970_0056323_880_2091 403
624 3300044842 Ga0466957_0001467 Ga0466957_0001467_9652_10935 403
625 3300044842 Ga0466957_0096749 Ga0466957_0096749_427_1638 403
626 3300045049 Ga0466959_0000002 Ga0466959_0000002_270850_272061 403
627 3300045049 Ga0466959_0044378 Ga0466959_0044378_1481_2692 403
628 3300045049 Ga0466959_0229430 Ga0466959_0229430_17_1228 403
629 3300046459 Ga0495629_0236814 Ga0495629_0236814_36_1247 403
630 3300046460 Ga0495638_0040748 Ga0495638_0040748_279_1490 403
631 3300046462 Ga0495651_0157060 Ga0495651_0157060_245_1456 403
632 3300046499 Ga0495594_0138503 Ga0495594_0138503_125_1336 403
633 3300046507 Ga0495606_0002871 Ga0495606_0002871_6074_7285 403
634 3300046516 Ga0495628_0011990 Ga0495628_0011990_1865_3076 403
635 3300046517 Ga0495630_0051189 Ga0495630_0051189_1759_2970 403
636 3300046522 Ga0495643_0039118 Ga0495643_0039118_580_1791 403
637 3300046616 Ga0495668_0000310 Ga0495668_0000310_35895_37106 403
638 3300046616 Ga0495668_0000751 Ga0495668_0000751_3220_4431 403
639 3300046648 Ga0495611_0000316 Ga0495611_0000316_27140_28351 403
640 3300046683 Ga0495658_0004160 Ga0495658_0004160_1003_2214 403
641 3300047472 Ga0495686_0000004 Ga0495686_0000004_572433_573644 403
642 3300048907 Ga0496104_0188665 Ga0496104_0188665_161_1372 403
643 3300048911 Ga0496108_0256381 Ga0496108_0256381_53_1342 403
644 3300048913 Ga0496110_0070127 Ga0496110_0070127_259_1470 403
645 3300048917 Ga0496114_0248159 Ga0496114_0248159_227_1438 403
646 3300049568 Ga0501031_0008920 Ga0501031_0008920_4786_5997 403
647 3300049569 Ga0501032_0108954 Ga0501032_0108954_471_1682 403
648 3300049571 Ga0501034_0000277 Ga0501034_0000277_33899_35110 403
649 3300049571 Ga0501034_0009006 Ga0501034_0009006_6092_7303 403
650 3300049571 Ga0501034_0009656 Ga0501034_0009656_3641_4852 403
651 3300049571 Ga0501034_0024994 Ga0501034_0024994_256_1467 403
652 3300049571 Ga0501034_0066202 Ga0501034_0066202_22_1233 403
653 3300049571 Ga0501034_0193412 Ga0501034_0193412_151_1362 403
654 3300049572 Ga0501036_0095881 Ga0501036_0095881_812_2023 403
655 3300049573 Ga0501037_0040682 Ga0501037_0040682_39_1250 403
656 3300049574 Ga0501038_0173163 Ga0501038_0173163_372_1583 403
657 3300049579 Ga0501043_0013312 Ga0501043_0013312_5205_6416 403
658 3300049579 Ga0501043_0148836 Ga0501043_0148836_130_1341 403
659 3300049581 Ga0501047_0019100 Ga0501047_0019100_52_1263 403
660 3300049581 Ga0501047_0192609 Ga0501047_0192609_233_1444 403
661 3300049585 Ga0501069_0013494 Ga0501069_0013494_26_1237 403
662 3300049589 Ga0501073_0003496 Ga0501073_0003496_2425_3636 403
663 3300049652 Ga0501202_002713 Ga0501202_002713_103_1314 403
664 3300049654 Ga0501207_011727 Ga0501207_011727_26_1237 403
665 3300049669 Ga0501235_004888 Ga0501235_004888_1086_2297 403
666 3300049670 Ga0501236_000375 Ga0501236_000375_1483_2694 403
667 3300049674 Ga0501242_003333 Ga0501242_003333_473_1684 403
668 3300049682 Ga0501252_000726 Ga0501252_000726_1271_2482 403
669 3300049703 Ga0501219_001064 Ga0501219_001064_899_2110 403
670 3300049704 Ga0501221_000433 Ga0501221_000433_5037_6248 403
671 3300049705 Ga0501225_0028234 Ga0501225_0028234_82_1293 403
672 3300049742 Ga0501080_0141640 Ga0501080_0141640_802_2013 403
673 3300049742 Ga0501080_0224180 Ga0501080_0224180_17_1228 403
674 3300049742 Ga0501080_0244120 Ga0501080_0244120_367_1578 403
675 3300049758 Ga0501241_000560 Ga0501241_000560_4436_5647 403
676 3300049822 Ga0501035_0037822 Ga0501035_0037822_77_1288 403
677 3300049822 Ga0501035_0074981 Ga0501035_0074981_1554_2765 403
678 3300049822 Ga0501035_0092700 Ga0501035_0092700_1344_2555 403
679 3300049822 Ga0501035_0176330 Ga0501035_0176330_37_1293 403
680 3300049823 Ga0501044_0065167 Ga0501044_0065167_271_1482 403
681 3300049823 Ga0501044_0069714 Ga0501044_0069714_1518_2729 403
682 3300049823 Ga0501044_0218251 Ga0501044_0218251_256_1467 403
683 3300050005 Ga0501284_00011 Ga0501284_00011_25581_26792 403
684 3300050493 nmdc:mga0k408_32148_c1 nmdc:mga0k408_32148_c1_13_1224 403
685 3300050493 nmdc:mga0k408_54335_c1 nmdc:mga0k408_54335_c1_809_2020 403
686 3300050507 nmdc:mga05p37_1503_c1 nmdc:mga05p37_1503_c1_8660_9871 403
687 3300050508 nmdc:mga09592_137274_c1 nmdc:mga09592_137274_c1_666_1877 403
688 3300050508 nmdc:mga09592_8593_c1 nmdc:mga09592_8593_c1_5470_6681 403
689 3300050510 nmdc:mga06r32_98436_c1 nmdc:mga06r32_98436_c1_284_1495 403
690 3300050511 nmdc:mga08y16_24983_c1 nmdc:mga08y16_24983_c1_4262_5473 403
691 3300053085 Ga0495619_0020579 Ga0495619_0020579_654_1865 403
692 3300053086 Ga0500578_0000034 Ga0500578_0000034_21041_22252 403
693 3300053088 Ga0500644_0007039 Ga0500644_0007039_160_1371 403
694 3300053092 Ga0500583_0002199 Ga0500583_0002199_569_1780 403
695 3300053096 Ga0500641_0012559 Ga0500641_0012559_863_2074 403
696 3300053108 Ga0500562_000077 Ga0500562_000077_42963_44174 403
697 3300053108 Ga0500562_000935 Ga0500562_000935_778_1989 403
698 3300053139 Ga0500568_0002131 Ga0500568_0002131_3160_4371 403
699 3300053147 Ga0500589_032472 Ga0500589_032472_343_1554 403
700 3300053151 Ga0500604_0000511 Ga0500604_0000511_146_1357 403
701 3300053151 Ga0500604_0006844 Ga0500604_0006844_1534_2745 403
702 3300053153 Ga0500616_0006055 Ga0500616_0006055_4701_5912 403
703 3300053156 Ga0500622_0000014 Ga0500622_0000014_95764_96975 403
704 3300053156 Ga0500622_0000020 Ga0500622_0000020_98548_99759 403
705 3300053156 Ga0500622_0001543 Ga0500622_0001543_266_1477 403
706 3300053177 Ga0500636_0026467 Ga0500636_0026467_2103_3314 403
707 3300053727 Ga0500611_000031 Ga0500611_000031_82162_83373 403
708 3300054114 Ga0501084_0058451 Ga0501084_0058451_715_1926 403
709 3300061719 Ga0466962_0011997 Ga0466962_0011997_446_1657 403
710 3300002738 JGI25154J39366_1000293 JGI25154J39366_100029318 404
711 3300003215 JGI25153J46596_10001122 JGI25153J46596_100011228 404
712 3300003354 JGI25160J50197_1003310 JGI25160J50197_10033106 404
713 3300003354 JGI25160J50197_1005348 JGI25160J50197_10053482 404
714 3300003790 Ga0055528_1001409 Ga0055528_10014093 404
715 3300003790 Ga0055528_1003892 Ga0055528_10038921 404
716 3300003794 Ga0055531_10000237 Ga0055531_1000023748 404
717 3300005262 Ga0065165_1000190 Ga0065165_100019033 404
718 3300005262 Ga0065165_1014165 Ga0065165_10141652 404
719 3300005289 Ga0065704_10155100 Ga0065704_101551001 404
720 3300005338 Ga0068868_100052291 Ga0068868_1000522912 404
721 3300005354 Ga0070675_100032415 Ga0070675_1000324151 404
722 3300005548 Ga0070665_100000041 Ga0070665_100000041205 404
723 3300005563 Ga0068855_100107692 Ga0068855_1001076922 404
724 3300005577 Ga0068857_100081185 Ga0068857_1000811852 404
725 3300005614 Ga0068856_100049922 Ga0068856_1000499223 404
726 3300005614 Ga0068856_100273586 Ga0068856_1002735862 404
727 3300005616 Ga0068852_100004748 Ga0068852_1000047486 404
728 3300005618 Ga0068864_100032450 Ga0068864_1000324503 404
729 3300005843 Ga0068860_100000383 Ga0068860_1000003838 404
730 3300006195 Ga0075366_10056967 Ga0075366_100569672 404
731 3300009093 Ga0105240_10000224 Ga0105240_1000022473 404
732 3300009093 Ga0105240_10036358 Ga0105240_100363585 404
733 3300009174 Ga0105241_10000493 Ga0105241_1000049319 404
734 3300009545 Ga0105237_10003801 Ga0105237_100038019 404
735 3300009545 Ga0105237_10004541 Ga0105237_100045414 404
736 3300009545 Ga0105237_10006950 Ga0105237_1000695010 404
737 3300009551 Ga0105238_10000247 Ga0105238_1000024736 404
738 3300009551 Ga0105238_10023438 Ga0105238_100234383 404
739 3300009551 Ga0105238_10042810 Ga0105238_100428103 404
740 3300010375 Ga0105239_10025508 Ga0105239_100255082 404
741 3300010375 Ga0105239_10029882 Ga0105239_100298824 404
742 3300013104 Ga0157370_10035255 Ga0157370_100352552 404
743 3300013297 Ga0157378_10044560 Ga0157378_100445603 404
744 3300013307 Ga0157372_10047139 Ga0157372_100471392 404
745 3300013307 Ga0157372_10074087 Ga0157372_100740873 404
746 3300015265 Ga0182005_1000023 Ga0182005_1000023144 404
747 3300025246 Ga0209646_1000025 Ga0209646_100002542 404
748 3300025250 Ga0209026_1000097 Ga0209026_1000097124 404
749 3300025273 Ga0209673_1000403 Ga0209673_100040341 404
750 3300025295 Ga0209564_1009069 Ga0209564_10090694 404
751 3300025297 Ga0209758_1001939 Ga0209758_100193915 404
752 3300025297 Ga0209758_1023582 Ga0209758_10235823 404
753 3300025298 Ga0209050_1000136 Ga0209050_100013688 404
754 3300025302 Ga0207426_1000220 Ga0207426_100022089 404
755 3300025302 Ga0207426_1000543 Ga0207426_10005436 404
756 3300025302 Ga0207426_1030313 Ga0207426_10303132 404
757 3300025304 Ga0209257_1000025 Ga0209257_1000025538 404
758 3300025304 Ga0209257_1002647 Ga0209257_100264712 404
759 3300025904 Ga0207647_10012039 Ga0207647_100120395 404
760 3300025911 Ga0207654_10000775 Ga0207654_100007757 404
761 3300025913 Ga0207695_10043735 Ga0207695_100437352 404
762 3300025913 Ga0207695_10065212 Ga0207695_100652123 404
763 3300025914 Ga0207671_10002088 Ga0207671_100020887 404
764 3300025914 Ga0207671_10005116 Ga0207671_100051162 404
765 3300025914 Ga0207671_10006479 Ga0207671_100064792 404
766 3300025924 Ga0207694_10011872 Ga0207694_100118725 404
767 3300025949 Ga0207667_10004138 Ga0207667_100041382 404
768 3300026023 Ga0207677_10026360 Ga0207677_100263603 404
769 3300026035 Ga0207703_10274415 Ga0207703_102744152 404
770 3300026041 Ga0207639_10134275 Ga0207639_101342752 404
771 3300026078 Ga0207702_10282799 Ga0207702_102827992 404
772 3300026095 Ga0207676_10038784 Ga0207676_100387842 404
773 3300026116 Ga0207674_10005115 Ga0207674_1000511510 404
774 3300026142 Ga0207698_10004129 Ga0207698_100041292 404
775 3300028379 Ga0268266_10000049 Ga0268266_10000049253 404
776 3300028381 Ga0268264_10000041 Ga0268264_1000004191 404
777 3300028381 Ga0268264_10006197 Ga0268264_100061976 404
778 3300032004 Ga0307414_10000080 Ga0307414_1000008069 404
779 3300032004 Ga0307414_10228856 Ga0307414_102288563 404
780 3300041997 Ga0439431_0000240 Ga0439431_0000240_4849_6063 404
781 3300042004 Ga0439445_0005873 Ga0439445_0005873_41_1255 404
782 3300046453 Ga0495627_013728 Ga0495627_013728_868_2082 404
783 3300046460 Ga0495638_0039053 Ga0495638_0039053_1565_2848 404
784 3300046558 Ga0495633_0000774 Ga0495633_0000774_872_2086 404
785 3300047443 Ga0495687_000001 Ga0495687_000001_104993_106207 404
786 3300047472 Ga0495686_0000595 Ga0495686_0000595_9400_10614 404
787 3300048924 Ga0496121_0000010 Ga0496121_0000010_732963_734207 404
788 3300049569 Ga0501032_0071251 Ga0501032_0071251_147_1361 404
789 3300049571 Ga0501034_0052389 Ga0501034_0052389_1505_2719 404
790 3300049573 Ga0501037_0083724 Ga0501037_0083724_885_2099 404
791 3300049758 Ga0501241_000078 Ga0501241_000078_539_1753 404
792 3300049823 Ga0501044_0064792 Ga0501044_0064792_657_1871 404
793 3300049823 Ga0501044_0328652 Ga0501044_0328652_105_1319 404
794 3300050005 Ga0501284_00565 Ga0501284_00565_220_1434 404
795 3300053088 Ga0500644_0000475 Ga0500644_0000475_10767_12011 404
796 3300053090 Ga0500646_0010394 Ga0500646_0010394_311_1555 404
797 3300053092 Ga0500583_0047440 Ga0500583_0047440_262_1545 404
798 3300053109 Ga0500569_000194 Ga0500569_000194_2592_3836 404
799 3300053130 Ga0500642_0067126 Ga0500642_0067126_279_1562 404
800 3300053131 Ga0500652_012467 Ga0500652_012467_560_1774 404
801 3300053134 Ga0500658_0005885 Ga0500658_0005885_2276_3520 404
802 3300053136 Ga0500559_0012611 Ga0500559_0012611_2017_3261 404
803 3300053139 Ga0500568_0039990 Ga0500568_0039990_16_1230 404
804 3300053147 Ga0500589_037593 Ga0500589_037593_715_1959 404
805 3300053153 Ga0500616_0002819 Ga0500616_0002819_3266_4510 404
806 3300053156 Ga0500622_0000725 Ga0500622_0000725_22242_23456 404
807 3300053156 Ga0500622_0020151 Ga0500622_0020151_1882_3165 404
808 3300053161 Ga0500634_0031992 Ga0500634_0031992_186_1430 404
809 3300053177 Ga0500636_0020568 Ga0500636_0020568_630_1874 404
810 3300055283 Ga0500661_000526 Ga0500661_000526_1961_3205 404
811 3300005329 Ga0070683_100004709 Ga0070683_1000047095 405
812 3300005338 Ga0068868_100079913 Ga0068868_1000799133 405
813 3300005339 Ga0070660_100118624 Ga0070660_1001186242 405
814 3300005344 Ga0070661_100145757 Ga0070661_1001457571 405
815 3300005344 Ga0070661_100187800 Ga0070661_1001878001 405
816 3300005354 Ga0070675_100021178 Ga0070675_1000211781 405
817 3300005356 Ga0070674_100022606 Ga0070674_1000226061 405
818 3300005364 Ga0070673_100095840 Ga0070673_1000958402 405
819 3300005366 Ga0070659_100024213 Ga0070659_1000242133 405
820 3300005456 Ga0070678_100048931 Ga0070678_1000489312 405
821 3300005456 Ga0070678_100153804 Ga0070678_1001538041 405
822 3300005535 Ga0070684_100003150 Ga0070684_1000031505 405
823 3300005543 Ga0070672_100036233 Ga0070672_1000362331 405
824 3300005544 Ga0070686_100034487 Ga0070686_1000344873 405
825 3300005564 Ga0070664_100042787 Ga0070664_1000427875 405
826 3300005616 Ga0068852_100024540 Ga0068852_1000245404 405
827 3300005616 Ga0068852_100034775 Ga0068852_1000347752 405
828 3300005616 Ga0068852_100174403 Ga0068852_1001744033 405
829 3300006353 Ga0075370_10062204 Ga0075370_100622042 405
830 3300009094 Ga0111539_10017114 Ga0111539_100171143 405
831 3300009147 Ga0114129_10023506 Ga0114129_100235067 405
832 3300013102 Ga0157371_10061732 Ga0157371_100617322 405
833 3300013105 Ga0157369_10164553 Ga0157369_101645531 405
834 3300013297 Ga0157378_10015702 Ga0157378_100157024 405
835 3300013307 Ga0157372_10111404 Ga0157372_101114041 405
836 3300013307 Ga0157372_10296251 Ga0157372_102962512 405
837 3300013308 Ga0157375_10110693 Ga0157375_101106932 405
838 3300025292 Ga0209676_1000564 Ga0209676_100056428 405
839 3300025901 Ga0207688_10119833 Ga0207688_101198331 405
840 3300025907 Ga0207645_10084313 Ga0207645_100843132 405
841 3300025918 Ga0207662_10030759 Ga0207662_100307592 405
842 3300025920 Ga0207649_10145606 Ga0207649_101456062 405
843 3300025945 Ga0207679_10003970 Ga0207679_100039705 405
844 3300026121 Ga0207683_10100585 Ga0207683_101005852 405
845 3300026121 Ga0207683_10163987 Ga0207683_101639872 405
846 3300026142 Ga0207698_10033022 Ga0207698_100330223 405
847 3300026142 Ga0207698_10195203 Ga0207698_101952032 405
848 3300027907 Ga0207428_10191013 Ga0207428_101910131 405
849 3300031251 Ga0265327_10000197 Ga0265327_1000019745 405
850 3300031251 Ga0265327_10000272 Ga0265327_1000027244 405
851 3300031251 Ga0265327_10007740 Ga0265327_100077401 405
852 3300031911 Ga0307412_10058409 Ga0307412_100584091 405
853 3300031995 Ga0307409_100219993 Ga0307409_1002199931 405
854 3300032002 Ga0307416_100221109 Ga0307416_1002211091 405
855 3300032004 Ga0307414_10014853 Ga0307414_100148534 405
856 3300036401 Ga0373937_0278049 Ga0373937_0278049_235_1452 405
857 3300037418 Ga0395900_0145350 Ga0395900_0145350_398_1615 405
858 3300038443 Ga0395901_0177080 Ga0395901_0177080_189_1409 405
859 3300042876 Ga0451577_0000452 Ga0451577_0000452_65281_66501 405
860 3300044673 Ga0453683_0065909 Ga0453683_0065909_384_1610 405
861 3300046616 Ga0495668_0001166 Ga0495668_0001166_9601_10818 405
862 3300049570 Ga0501033_0075824 Ga0501033_0075824_672_1889 405
863 3300049571 Ga0501034_0025394 Ga0501034_0025394_3324_4541 405
864 3300049572 Ga0501036_0098463 Ga0501036_0098463_288_1505 405
865 3300049573 Ga0501037_0013639 Ga0501037_0013639_4724_5941 405
866 3300049574 Ga0501038_0035496 Ga0501038_0035496_3010_4227 405
867 3300049581 Ga0501047_0038244 Ga0501047_0038244_1096_2313 405
868 3300049763 Ga0501266_006658 Ga0501266_006658_57_1274 405
869 3300049822 Ga0501035_0033293 Ga0501035_0033293_3405_4622 405
870 3300050511 nmdc:mga08y16_95741_c1 nmdc:mga08y16_95741_c1_895_2112 405
871 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00007950 406
872 3300005289 Ga0065704_10070140 Ga0065704_10070140138 406
873 3300005548 Ga0070665_100020471 Ga0070665_1000204717 406
874 3300009093 Ga0105240_10000073 Ga0105240_1000007382 406
875 3300009093 Ga0105240_10008705 Ga0105240_100087055 406
876 3300009545 Ga0105237_10018401 Ga0105237_1001840111 406
877 3300009545 Ga0105237_10110773 Ga0105237_101107732 406
878 3300010375 Ga0105239_10003390 Ga0105239_100033908 406
879 3300025904 Ga0207647_10013257 Ga0207647_100132572 406
880 3300025913 Ga0207695_10000151 Ga0207695_1000015188 406
881 3300025913 Ga0207695_10005271 Ga0207695_1000527119 406
882 3300025914 Ga0207671_10000149 Ga0207671_1000014987 406
883 3300047318 Ga0495636_0000138 Ga0495636_0000138_546_1766 406
884 3300053136 Ga0500559_0015288 Ga0500559_0015288_1320_2540 406

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00549

Ligase_CoA

CoA-ligase

271

393

0.96

PF08442

ATP-grasp_2

ATP-grasp domain

2

212

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mel-assembly1.cif.gz_B succinyl-coa synthase from campylobacter jejuni 0.9387 1 403
6mel-assembly1.cif.gz_B succinyl-coa synthase from campylobacter jejuni 0.9364 1 403
6no6-assembly1.cif.gz_B k46be&k114bd mutant atp-grasp fold of blastocystis hominis succinyl-coa synthetase 0.9346 1 236
6no3-assembly1.cif.gz_B adp bound to v113bl mutant atp-grasp fold of blastocystis hominis succinyl-coa synthetase 0.9324 1 236
6no0-assembly1.cif.gz_B adp bound to atp-grasp fold of blastocystis hominis succinyl-coa synthetase 0.9319 1 236
ID Description Score Start End Superfamily
4xx0B01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9703 123 256 3.30.470.20
af_Q2FZ37_21_104_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9573 21 113 3.30.470.20
3ufxE01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9449 1 250 3.30.470.20
1jkjB01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9437 119 256 3.30.470.20
af_P53312_51_141_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9341 21 116 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A520AIY0-F1-model_v4 Succinate--CoA ligase subunit beta (EC 6.2.1.5) 0.982 1 267 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
AF-A0A520AIY0-F1-model_v4 Succinate--CoA ligase subunit beta (EC 6.2.1.5) 0.9783 1 267 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
AF-A0A382W310-F1-model_v4 ATP-grasp domain-containing protein 0.9763 1 256 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
GO:0046872
AF-A0A7V3AH90-F1-model_v4 Succinate--CoA ligase subunit beta (EC 6.2.1.5) 0.9728 148 257 GO:0004775
GO:0005829
GO:0006099
GO:0006104
GO:0042709
AF-A0A382W310-F1-model_v4 ATP-grasp domain-containing protein 0.9723 1 256 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.63 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map