F484640
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 884 | 299 | 1768 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300046462|Ga0495651_0213375|Ga0495651_0213375_862_1284 |
| Length | 140 |
| Sequence | MVEEGKPAPDFELKSDSGETVKLSDLRGKQVVLYFYPKDDTPGCTTQACGIRDAYGEFEDERSHVEFKQKYELPFALLADVDHSVAEDYGVWVEKSYAGKKYLGVARSTFVIAEDGTIKRAIHDVKPDSHADDVLETLRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 118 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 120 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 129 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 130 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 134 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 136 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 145 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 148 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 160 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 170 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 171 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 172 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 173 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 174 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 175 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 176 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 177 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 178 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 179 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 180 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 184 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 185 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 186 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 187 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 188 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 189 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 190 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 295 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 296 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 297 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 299 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.93 |
| Metatranscriptomes | 4.07 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 9.39 |
| Rhizosphere | 89.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495651_0213375 | 3300046462 | Bacteria | 1341 |
| 2 | Ga0058863_11910037 | 3300004799 | Bacteria | 736 |
| 3 | Ga0058862_12807872 | 3300004803 | Bacteria | 1202 |
| 4 | Ga0070658_10044965 | 3300005327 | Bacteria | 3569 |
| 5 | Ga0070658_10049400 | 3300005327 | Bacteria | 3407 |
| 6 | Ga0070658_10257830 | 3300005327 | Bacteria | 1480 |
| 7 | Ga0070658_10267597 | 3300005327 | Bacteria | 1453 |
| 8 | Ga0070676_11549710 | 3300005328 | Bacteria | 511 |
| 9 | Ga0070683_100006172 | 3300005329 | Bacteria | 10050 |
| 10 | Ga0070683_100032081 | 3300005329 | Bacteria | 4781 |
| 11 | Ga0070683_100044248 | 3300005329 | Bacteria | 4105 |
| 12 | Ga0070683_100062290 | 3300005329 | Bacteria | 3468 |
| 13 | Ga0070683_100103720 | 3300005329 | Bacteria | 2680 |
| 14 | Ga0070683_100108882 | 3300005329 | Bacteria | 2613 |
| 15 | Ga0070683_100285283 | 3300005329 | Bacteria | 1571 |
| 16 | Ga0070683_100296222 | 3300005329 | Bacteria | 1539 |
| 17 | Ga0070683_101203931 | 3300005329 | Bacteria | 728 |
| 18 | Ga0070680_100014485 | 3300005336 | Bacteria | 6168 |
| 19 | Ga0070680_100250951 | 3300005336 | Bacteria | 1496 |
| 20 | Ga0070680_100261994 | 3300005336 | Bacteria | 1462 |
| 21 | Ga0070680_101643982 | 3300005336 | Bacteria | 557 |
| 22 | Ga0070682_100047037 | 3300005337 | Bacteria | 2680 |
| 23 | Ga0070682_100577351 | 3300005337 | Bacteria | 884 |
| 24 | Ga0070682_100991390 | 3300005337 | Bacteria | 697 |
| 25 | Ga0070660_100003458 | 3300005339 | Bacteria | 10871 |
| 26 | Ga0070660_100004868 | 3300005339 | Bacteria | 9276 |
| 27 | Ga0070660_100016665 | 3300005339 | Bacteria | 5340 |
| 28 | Ga0070660_100024280 | 3300005339 | Bacteria | 4498 |
| 29 | Ga0070660_100024290 | 3300005339 | Bacteria | 4497 |
| 30 | Ga0070660_100024497 | 3300005339 | Bacteria | 4477 |
| 31 | Ga0070660_100040297 | 3300005339 | Bacteria | 3554 |
| 32 | Ga0070660_100127570 | 3300005339 | Bacteria | 2034 |
| 33 | Ga0070661_100034760 | 3300005344 | Bacteria | 3657 |
| 34 | Ga0070661_100161475 | 3300005344 | Bacteria | 1697 |
| 35 | Ga0070661_100236906 | 3300005344 | Bacteria | 1404 |
| 36 | Ga0070661_100320473 | 3300005344 | Bacteria | 1211 |
| 37 | Ga0070661_100690736 | 3300005344 | Bacteria | 831 |
| 38 | Ga0070661_100973999 | 3300005344 | Bacteria | 703 |
| 39 | Ga0070692_10101787 | 3300005345 | Bacteria | 1576 |
| 40 | Ga0070675_100877311 | 3300005354 | Bacteria | 822 |
| 41 | Ga0070671_100423705 | 3300005355 | Bacteria | 1140 |
| 42 | Ga0070659_100039235 | 3300005366 | Bacteria | 3696 |
| 43 | Ga0070659_100580276 | 3300005366 | Bacteria | 962 |
| 44 | Ga0070709_10009338 | 3300005434 | Bacteria | 5406 |
| 45 | Ga0070709_10074488 | 3300005434 | Bacteria | 2200 |
| 46 | Ga0070709_10253706 | 3300005434 | Bacteria | 1268 |
| 47 | Ga0070714_100117081 | 3300005435 | Bacteria | 2366 |
| 48 | Ga0070714_100305542 | 3300005435 | Bacteria | 1484 |
| 49 | Ga0070714_100352029 | 3300005435 | Bacteria | 1383 |
| 50 | Ga0070714_100415621 | 3300005435 | Bacteria | 1273 |
| 51 | Ga0070714_101325693 | 3300005435 | Bacteria | 703 |
| 52 | Ga0070714_101741154 | 3300005435 | Bacteria | 609 |
| 53 | Ga0070713_100005892 | 3300005436 | Bacteria | 8425 |
| 54 | Ga0070710_10030936 | 3300005437 | Bacteria | 2884 |
| 55 | Ga0070710_10225923 | 3300005437 | Bacteria | 1193 |
| 56 | Ga0070710_10958211 | 3300005437 | Bacteria | 621 |
| 57 | Ga0070711_100067249 | 3300005439 | Bacteria | 2513 |
| 58 | Ga0070700_100478974 | 3300005441 | Bacteria | 953 |
| 59 | Ga0070708_100006727 | 3300005445 | Bacteria | 9154 |
| 60 | Ga0070708_101705434 | 3300005445 | Bacteria | 585 |
| 61 | Ga0070681_10019025 | 3300005458 | Bacteria | 6874 |
| 62 | Ga0070681_10024922 | 3300005458 | Bacteria | 6019 |
| 63 | Ga0070681_10129972 | 3300005458 | Bacteria | 2450 |
| 64 | Ga0070681_10213474 | 3300005458 | Bacteria | 1846 |
| 65 | Ga0070681_10322083 | 3300005458 | Bacteria | 1455 |
| 66 | Ga0070681_10354634 | 3300005458 | Bacteria | 1377 |
| 67 | Ga0070681_10661414 | 3300005458 | Bacteria | 960 |
| 68 | Ga0070681_10829816 | 3300005458 | Bacteria | 842 |
| 69 | Ga0068867_100949343 | 3300005459 | Bacteria | 777 |
| 70 | Ga0070706_101241462 | 3300005467 | Bacteria | 684 |
| 71 | Ga0070706_101351608 | 3300005467 | Bacteria | 653 |
| 72 | Ga0070707_100000328 | 3300005468 | Bacteria | 46683 |
| 73 | Ga0070707_100116347 | 3300005468 | Bacteria | 2595 |
| 74 | Ga0070707_100665549 | 3300005468 | Bacteria | 1004 |
| 75 | Ga0070698_100099113 | 3300005471 | Bacteria | 2887 |
| 76 | Ga0070698_100215543 | 3300005471 | Archaea | 1854 |
| 77 | Ga0070698_100279610 | 3300005471 | Unclassified | 1600 |
| 78 | Ga0070698_100284890 | 3300005471 | Bacteria | 1583 |
| 79 | Ga0070699_100122865 | 3300005518 | Bacteria | 2284 |
| 80 | Ga0070699_100292820 | 3300005518 | Bacteria | 1460 |
| 81 | Ga0070699_100542705 | 3300005518 | Unclassified | 1058 |
| 82 | Ga0070679_100025308 | 3300005530 | Bacteria | 5822 |
| 83 | Ga0070679_100029750 | 3300005530 | Bacteria | 5388 |
| 84 | Ga0070679_100054350 | 3300005530 | Bacteria | 3986 |
| 85 | Ga0070679_100056642 | 3300005530 | Bacteria | 3905 |
| 86 | Ga0070679_100065935 | 3300005530 | Bacteria | 3609 |
| 87 | Ga0070679_100130752 | 3300005530 | Bacteria | 2492 |
| 88 | Ga0070679_100194174 | 3300005530 | Bacteria | 1998 |
| 89 | Ga0070679_100292201 | 3300005530 | Bacteria | 1581 |
| 90 | Ga0070679_100355960 | 3300005530 | Bacteria | 1411 |
| 91 | Ga0070679_100369841 | 3300005530 | Bacteria | 1381 |
| 92 | Ga0070679_100780161 | 3300005530 | Bacteria | 899 |
| 93 | Ga0070679_100949128 | 3300005530 | Bacteria | 804 |
| 94 | Ga0070684_100001095 | 3300005535 | Bacteria | 19436 |
| 95 | Ga0070684_100007102 | 3300005535 | Bacteria | 8703 |
| 96 | Ga0070684_100008765 | 3300005535 | Bacteria | 7930 |
| 97 | Ga0070684_100024219 | 3300005535 | Bacteria | 5089 |
| 98 | Ga0070684_100172679 | 3300005535 | Bacteria | 1963 |
| 99 | Ga0070684_100372351 | 3300005535 | Bacteria | 1315 |
| 100 | Ga0068853_100218022 | 3300005539 | Bacteria | 1741 |
| 101 | Ga0070695_100765516 | 3300005545 | Bacteria | 771 |
| 102 | Ga0070696_100013480 | 3300005546 | Bacteria | 5485 |
| 103 | Ga0070693_100261354 | 3300005547 | Bacteria | 1151 |
| 104 | Ga0070693_100291319 | 3300005547 | Bacteria | 1097 |
| 105 | Ga0070693_101085586 | 3300005547 | Bacteria | 610 |
| 106 | Ga0070665_100015545 | 3300005548 | Bacteria | 7646 |
| 107 | Ga0070704_100234855 | 3300005549 | Bacteria | 1498 |
| 108 | Ga0068855_100002523 | 3300005563 | Bacteria | 22549 |
| 109 | Ga0068855_100036661 | 3300005563 | Bacteria | 5834 |
| 110 | Ga0068855_100043181 | 3300005563 | Bacteria | 5341 |
| 111 | Ga0068855_100069488 | 3300005563 | Bacteria | 4099 |
| 112 | Ga0068855_100106284 | 3300005563 | Bacteria | 3226 |
| 113 | Ga0068855_100253446 | 3300005563 | Bacteria | 1963 |
| 114 | Ga0068855_100258802 | 3300005563 | Bacteria | 1939 |
| 115 | Ga0068855_100513656 | 3300005563 | Bacteria | 1301 |
| 116 | Ga0070664_101136944 | 3300005564 | Bacteria | 736 |
| 117 | Ga0068857_100148013 | 3300005577 | Bacteria | 2125 |
| 118 | Ga0068854_100407166 | 3300005578 | Bacteria | 1127 |
| 119 | Ga0068856_100049855 | 3300005614 | Bacteria | 4127 |
| 120 | Ga0068856_100059390 | 3300005614 | Bacteria | 3778 |
| 121 | Ga0068856_100067539 | 3300005614 | Bacteria | 3533 |
| 122 | Ga0068856_100084897 | 3300005614 | Bacteria | 3145 |
| 123 | Ga0068856_100178594 | 3300005614 | Bacteria | 2135 |
| 124 | Ga0068856_100393716 | 3300005614 | Bacteria | 1405 |
| 125 | Ga0068856_100495341 | 3300005614 | Bacteria | 1243 |
| 126 | Ga0068856_100533228 | 3300005614 | Bacteria | 1195 |
| 127 | Ga0068856_102660802 | 3300005614 | Bacteria | 506 |
| 128 | Ga0070702_100062886 | 3300005615 | Bacteria | 2166 |
| 129 | Ga0068852_100040177 | 3300005616 | Bacteria | 3945 |
| 130 | Ga0068852_100135685 | 3300005616 | Bacteria | 2272 |
| 131 | Ga0068852_100144161 | 3300005616 | Bacteria | 2207 |
| 132 | Ga0068852_101161862 | 3300005616 | Bacteria | 793 |
| 133 | Ga0068852_101228121 | 3300005616 | Bacteria | 771 |
| 134 | Ga0068852_101564188 | 3300005616 | Bacteria | 682 |
| 135 | Ga0070717_10010696 | 3300006028 | Bacteria | 6940 |
| 136 | Ga0070717_10079145 | 3300006028 | Bacteria | 2756 |
| 137 | Ga0070717_10093185 | 3300006028 | Bacteria | 2546 |
| 138 | Ga0070717_10709825 | 3300006028 | Bacteria | 914 |
| 139 | Ga0070715_10000913 | 3300006163 | Bacteria | 8202 |
| 140 | Ga0070716_100009358 | 3300006173 | Bacteria | 4881 |
| 141 | Ga0070712_100079806 | 3300006175 | Bacteria | 2366 |
| 142 | Ga0097621_100698329 | 3300006237 | Bacteria | 934 |
| 143 | Ga0075433_10204649 | 3300006852 | Bacteria | 1754 |
| 144 | Ga0075434_100228629 | 3300006871 | Bacteria | 1880 |
| 145 | Ga0075434_100656827 | 3300006871 | Bacteria | 1067 |
| 146 | Ga0075434_101518093 | 3300006871 | Bacteria | 679 |
| 147 | Ga0068865_100387794 | 3300006881 | Bacteria | 1141 |
| 148 | Ga0075435_100232637 | 3300007076 | Bacteria | 1566 |
| 149 | Ga0075435_100654786 | 3300007076 | Bacteria | 912 |
| 150 | Ga0105240_10044922 | 3300009093 | Bacteria | 5608 |
| 151 | Ga0105240_10141561 | 3300009093 | Bacteria | 2875 |
| 152 | Ga0105240_10142362 | 3300009093 | Bacteria | 2866 |
| 153 | Ga0105240_10272459 | 3300009093 | Bacteria | 1948 |
| 154 | Ga0105240_10408980 | 3300009093 | Bacteria | 1527 |
| 155 | Ga0105240_10513146 | 3300009093 | Bacteria | 1331 |
| 156 | Ga0105240_11062221 | 3300009093 | Bacteria | 863 |
| 157 | Ga0105240_11835238 | 3300009093 | Bacteria | 631 |
| 158 | Ga0105240_12125815 | 3300009093 | Bacteria | 583 |
| 159 | Ga0111539_10189352 | 3300009094 | Bacteria | 2401 |
| 160 | Ga0111539_10836222 | 3300009094 | Bacteria | 1071 |
| 161 | Ga0105245_10072323 | 3300009098 | Bacteria | 3132 |
| 162 | Ga0105245_10728912 | 3300009098 | Bacteria | 1026 |
| 163 | Ga0105245_10798624 | 3300009098 | Bacteria | 982 |
| 164 | Ga0105243_10686974 | 3300009148 | Bacteria | 996 |
| 165 | Ga0105241_10350360 | 3300009174 | Bacteria | 1282 |
| 166 | Ga0105241_12199504 | 3300009174 | Bacteria | 547 |
| 167 | Ga0105242_10052199 | 3300009176 | Bacteria | 3335 |
| 168 | Ga0105237_10021997 | 3300009545 | Bacteria | 6546 |
| 169 | Ga0105237_10053974 | 3300009545 | Bacteria | 4028 |
| 170 | Ga0105237_11700849 | 3300009545 | Bacteria | 638 |
| 171 | Ga0105237_11820802 | 3300009545 | Bacteria | 616 |
| 172 | Ga0105238_10042846 | 3300009551 | Bacteria | 4582 |
| 173 | Ga0105238_10134415 | 3300009551 | Bacteria | 2451 |
| 174 | Ga0105238_10696070 | 3300009551 | Bacteria | 1028 |
| 175 | Ga0105238_11815757 | 3300009551 | Bacteria | 642 |
| 176 | Ga0105239_10095199 | 3300010375 | Bacteria | 3290 |
| 177 | Ga0105239_10228079 | 3300010375 | Bacteria | 2090 |
| 178 | Ga0105246_10240014 | 3300011119 | Bacteria | 1432 |
| 179 | Ga0105246_10681044 | 3300011119 | Bacteria | 899 |
| 180 | Ga0157373_10198661 | 3300013100 | Bacteria | 1414 |
| 181 | Ga0157373_10311830 | 3300013100 | Bacteria | 1118 |
| 182 | Ga0157373_10448121 | 3300013100 | Bacteria | 929 |
| 183 | Ga0157370_10012542 | 3300013104 | Bacteria | 8787 |
| 184 | Ga0157370_10016007 | 3300013104 | Bacteria | 7607 |
| 185 | Ga0157370_10030932 | 3300013104 | Bacteria | 5242 |
| 186 | Ga0157370_10075505 | 3300013104 | Bacteria | 3177 |
| 187 | Ga0157370_10353586 | 3300013104 | Bacteria | 1354 |
| 188 | Ga0157369_10005342 | 3300013105 | Bacteria | 14966 |
| 189 | Ga0157369_10129010 | 3300013105 | Bacteria | 2680 |
| 190 | Ga0157369_10176788 | 3300013105 | Bacteria | 2247 |
| 191 | Ga0157369_10184569 | 3300013105 | Bacteria | 2194 |
| 192 | Ga0157369_10194671 | 3300013105 | Bacteria | 2129 |
| 193 | Ga0157369_10710497 | 3300013105 | Bacteria | 1035 |
| 194 | Ga0157369_11370811 | 3300013105 | Bacteria | 720 |
| 195 | Ga0157374_10029179 | 3300013296 | Bacteria | 4992 |
| 196 | Ga0157374_10069343 | 3300013296 | Bacteria | 3320 |
| 197 | Ga0157374_10097387 | 3300013296 | Bacteria | 2815 |
| 198 | Ga0157374_10426933 | 3300013296 | Bacteria | 1325 |
| 199 | Ga0157372_10022568 | 3300013307 | Bacteria | 6811 |
| 200 | Ga0157372_10113951 | 3300013307 | Bacteria | 3099 |
| 201 | Ga0157372_10475734 | 3300013307 | Bacteria | 1456 |
| 202 | Ga0157372_10506450 | 3300013307 | Bacteria | 1408 |
| 203 | Ga0157372_10580893 | 3300013307 | Bacteria | 1306 |
| 204 | Ga0157372_10629771 | 3300013307 | Bacteria | 1250 |
| 205 | Ga0157372_12404605 | 3300013307 | Bacteria | 605 |
| 206 | Ga0157375_10265161 | 3300013308 | Bacteria | 1879 |
| 207 | Ga0182008_10026158 | 3300014497 | Bacteria | 2959 |
| 208 | Ga0182008_10555448 | 3300014497 | Bacteria | 639 |
| 209 | Ga0157377_10478835 | 3300014745 | Bacteria | 865 |
| 210 | Ga0157376_10043644 | 3300014969 | Bacteria | 3681 |
| 211 | Ga0182007_10146001 | 3300015262 | Bacteria | 802 |
| 212 | Ga0197907_10009387 | 3300020069 | Bacteria | 710 |
| 213 | Ga0197907_10041855 | 3300020069 | Bacteria | 952 |
| 214 | Ga0197907_10515615 | 3300020069 | Bacteria | 2003 |
| 215 | Ga0197907_11062133 | 3300020069 | Bacteria | 944 |
| 216 | Ga0197907_11071902 | 3300020069 | Bacteria | 918 |
| 217 | Ga0206356_10187915 | 3300020070 | Bacteria | 8163 |
| 218 | Ga0206356_10258522 | 3300020070 | Bacteria | 1418 |
| 219 | Ga0206356_10281124 | 3300020070 | Bacteria | 1145 |
| 220 | Ga0206356_11112730 | 3300020070 | Bacteria | 1666 |
| 221 | Ga0206356_11608284 | 3300020070 | Bacteria | 1220 |
| 222 | Ga0206356_11868100 | 3300020070 | Bacteria | 3912 |
| 223 | Ga0206356_11892701 | 3300020070 | Bacteria | 1681 |
| 224 | Ga0206349_1136107 | 3300020075 | Bacteria | 1336 |
| 225 | Ga0206351_10651009 | 3300020077 | Bacteria | 569 |
| 226 | Ga0206352_10674157 | 3300020078 | Bacteria | 720 |
| 227 | Ga0206350_10519715 | 3300020080 | Bacteria | 1711 |
| 228 | Ga0206350_10557578 | 3300020080 | Bacteria | 759 |
| 229 | Ga0206350_11657286 | 3300020080 | Bacteria | 1351 |
| 230 | Ga0206354_10183692 | 3300020081 | Bacteria | 941 |
| 231 | Ga0206354_10237964 | 3300020081 | Bacteria | 2860 |
| 232 | Ga0206354_10488364 | 3300020081 | Bacteria | 1837 |
| 233 | Ga0206354_10830731 | 3300020081 | Bacteria | 2935 |
| 234 | Ga0206354_11689399 | 3300020081 | Bacteria | 764 |
| 235 | Ga0206353_10888591 | 3300020082 | Bacteria | 1044 |
| 236 | Ga0206353_11019404 | 3300020082 | Bacteria | 1245 |
| 237 | Ga0206353_11100058 | 3300020082 | Bacteria | 4994 |
| 238 | Ga0206353_11705978 | 3300020082 | Bacteria | 4600 |
| 239 | Ga0206353_11757538 | 3300020082 | Bacteria | 2186 |
| 240 | Ga0206353_11821296 | 3300020082 | Bacteria | 1701 |
| 241 | Ga0206353_11914856 | 3300020082 | Bacteria | 1756 |
| 242 | Ga0154015_1030712 | 3300020610 | Bacteria | 661 |
| 243 | Ga0224712_10060128 | 3300022467 | Bacteria | 1511 |
| 244 | Ga0224712_10344249 | 3300022467 | Bacteria | 703 |
| 245 | Ga0207692_10217726 | 3300025898 | Bacteria | 1130 |
| 246 | Ga0207710_10678221 | 3300025900 | Bacteria | 540 |
| 247 | Ga0207685_10060306 | 3300025905 | Bacteria | 1500 |
| 248 | Ga0207699_10084519 | 3300025906 | Bacteria | 1977 |
| 249 | Ga0207699_10254141 | 3300025906 | Bacteria | 1212 |
| 250 | Ga0207643_10252636 | 3300025908 | Bacteria | 1086 |
| 251 | Ga0207705_10039578 | 3300025909 | Bacteria | 3379 |
| 252 | Ga0207705_10105627 | 3300025909 | Bacteria | 2076 |
| 253 | Ga0207705_10171817 | 3300025909 | Bacteria | 1632 |
| 254 | Ga0207705_10452921 | 3300025909 | Bacteria | 995 |
| 255 | Ga0207684_10369515 | 3300025910 | Bacteria | 1234 |
| 256 | Ga0207707_10033222 | 3300025912 | Bacteria | 4516 |
| 257 | Ga0207707_10065998 | 3300025912 | Bacteria | 3151 |
| 258 | Ga0207707_10136123 | 3300025912 | Bacteria | 2148 |
| 259 | Ga0207707_10209062 | 3300025912 | Bacteria | 1700 |
| 260 | Ga0207707_10233985 | 3300025912 | Bacteria | 1598 |
| 261 | Ga0207707_10423307 | 3300025912 | Bacteria | 1141 |
| 262 | Ga0207695_10174628 | 3300025913 | Bacteria | 2072 |
| 263 | Ga0207695_10210584 | 3300025913 | Bacteria | 1855 |
| 264 | Ga0207695_10224332 | 3300025913 | Bacteria | 1786 |
| 265 | Ga0207695_10476269 | 3300025913 | Bacteria | 1131 |
| 266 | Ga0207695_11083594 | 3300025913 | Bacteria | 681 |
| 267 | Ga0207671_11230119 | 3300025914 | Bacteria | 585 |
| 268 | Ga0207693_10002991 | 3300025915 | Bacteria | 14628 |
| 269 | Ga0207693_10199885 | 3300025915 | Bacteria | 1572 |
| 270 | Ga0207693_10523851 | 3300025915 | Unclassified | 925 |
| 271 | Ga0207663_10010865 | 3300025916 | Bacteria | 4863 |
| 272 | Ga0207660_10005003 | 3300025917 | Bacteria | 8639 |
| 273 | Ga0207660_10086052 | 3300025917 | Bacteria | 2320 |
| 274 | Ga0207660_10207281 | 3300025917 | Bacteria | 1534 |
| 275 | Ga0207660_10326356 | 3300025917 | Bacteria | 1226 |
| 276 | Ga0207660_10340579 | 3300025917 | Bacteria | 1200 |
| 277 | Ga0207660_10641559 | 3300025917 | Bacteria | 866 |
| 278 | Ga0207657_10002763 | 3300025919 | Bacteria | 18897 |
| 279 | Ga0207657_10003362 | 3300025919 | Bacteria | 17097 |
| 280 | Ga0207657_10003801 | 3300025919 | Bacteria | 16051 |
| 281 | Ga0207657_10004114 | 3300025919 | Bacteria | 15445 |
| 282 | Ga0207657_10007860 | 3300025919 | Bacteria | 10887 |
| 283 | Ga0207657_10008349 | 3300025919 | Bacteria | 10518 |
| 284 | Ga0207657_10063332 | 3300025919 | Bacteria | 3162 |
| 285 | Ga0207657_10147158 | 3300025919 | Bacteria | 1921 |
| 286 | Ga0207649_10031406 | 3300025920 | Bacteria | 3156 |
| 287 | Ga0207649_10178078 | 3300025920 | Bacteria | 1486 |
| 288 | Ga0207649_10336006 | 3300025920 | Bacteria | 1114 |
| 289 | Ga0207649_11196526 | 3300025920 | Bacteria | 600 |
| 290 | Ga0207652_10053734 | 3300025921 | Bacteria | 3460 |
| 291 | Ga0207652_10068716 | 3300025921 | Bacteria | 3075 |
| 292 | Ga0207652_10075250 | 3300025921 | Bacteria | 2942 |
| 293 | Ga0207652_10163860 | 3300025921 | Bacteria | 1993 |
| 294 | Ga0207652_10176663 | 3300025921 | Bacteria | 1918 |
| 295 | Ga0207652_10292513 | 3300025921 | Bacteria | 1470 |
| 296 | Ga0207652_10349085 | 3300025921 | Bacteria | 1335 |
| 297 | Ga0207652_10360486 | 3300025921 | Bacteria | 1312 |
| 298 | Ga0207652_10381876 | 3300025921 | Bacteria | 1271 |
| 299 | Ga0207652_10482469 | 3300025921 | Bacteria | 1116 |
| 300 | Ga0207652_10590479 | 3300025921 | Bacteria | 996 |
| 301 | Ga0207652_11086102 | 3300025921 | Bacteria | 700 |
| 302 | Ga0207652_11173158 | 3300025921 | Bacteria | 669 |
| 303 | Ga0207646_10000835 | 3300025922 | Bacteria | 40092 |
| 304 | Ga0207646_10086919 | 3300025922 | Bacteria | 2798 |
| 305 | Ga0207646_10829419 | 3300025922 | Bacteria | 823 |
| 306 | Ga0207694_10148986 | 3300025924 | Bacteria | 1884 |
| 307 | Ga0207694_10402406 | 3300025924 | Bacteria | 1138 |
| 308 | Ga0207694_11009869 | 3300025924 | Bacteria | 704 |
| 309 | Ga0207687_10556110 | 3300025927 | Bacteria | 963 |
| 310 | Ga0207700_10612943 | 3300025928 | Bacteria | 969 |
| 311 | Ga0207700_11345898 | 3300025928 | Bacteria | 636 |
| 312 | Ga0207664_10006174 | 3300025929 | Bacteria | 8220 |
| 313 | Ga0207664_10032905 | 3300025929 | Bacteria | 3978 |
| 314 | Ga0207664_10120046 | 3300025929 | Bacteria | 2199 |
| 315 | Ga0207664_10360431 | 3300025929 | Bacteria | 1288 |
| 316 | Ga0207664_10702488 | 3300025929 | Bacteria | 909 |
| 317 | Ga0207664_11011090 | 3300025929 | Bacteria | 745 |
| 318 | Ga0207690_10110817 | 3300025932 | Bacteria | 1977 |
| 319 | Ga0207690_10163561 | 3300025932 | Bacteria | 1661 |
| 320 | Ga0207704_10251053 | 3300025938 | Bacteria | 1328 |
| 321 | Ga0207665_10000336 | 3300025939 | Bacteria | 32436 |
| 322 | Ga0207665_10200240 | 3300025939 | Bacteria | 1455 |
| 323 | Ga0207691_10736099 | 3300025940 | Bacteria | 831 |
| 324 | Ga0207661_10008269 | 3300025944 | Bacteria | 7433 |
| 325 | Ga0207661_10057448 | 3300025944 | Bacteria | 3128 |
| 326 | Ga0207661_10075517 | 3300025944 | Bacteria | 2766 |
| 327 | Ga0207661_10082548 | 3300025944 | Bacteria | 2657 |
| 328 | Ga0207661_10171821 | 3300025944 | Bacteria | 1887 |
| 329 | Ga0207661_10244185 | 3300025944 | Bacteria | 1594 |
| 330 | Ga0207661_10245921 | 3300025944 | Bacteria | 1588 |
| 331 | Ga0207661_10401511 | 3300025944 | Bacteria | 1243 |
| 332 | Ga0207661_10452771 | 3300025944 | Bacteria | 1169 |
| 333 | Ga0207679_11091235 | 3300025945 | Bacteria | 732 |
| 334 | Ga0207667_10038453 | 3300025949 | Bacteria | 5110 |
| 335 | Ga0207667_10292628 | 3300025949 | Bacteria | 1664 |
| 336 | Ga0207667_10312245 | 3300025949 | Bacteria | 1606 |
| 337 | Ga0207667_10442537 | 3300025949 | Bacteria | 1321 |
| 338 | Ga0207667_10552813 | 3300025949 | Bacteria | 1164 |
| 339 | Ga0207667_11166048 | 3300025949 | Bacteria | 751 |
| 340 | Ga0207640_10467711 | 3300025981 | Bacteria | 1043 |
| 341 | Ga0207708_10998272 | 3300026075 | Bacteria | 727 |
| 342 | Ga0207702_10019232 | 3300026078 | Bacteria | 5650 |
| 343 | Ga0207702_10147056 | 3300026078 | Bacteria | 2139 |
| 344 | Ga0207702_10169434 | 3300026078 | Bacteria | 2001 |
| 345 | Ga0207702_11729690 | 3300026078 | Bacteria | 618 |
| 346 | Ga0207702_12439155 | 3300026078 | Bacteria | 510 |
| 347 | Ga0207648_10340201 | 3300026089 | Bacteria | 1351 |
| 348 | Ga0207648_10934923 | 3300026089 | Bacteria | 811 |
| 349 | Ga0207674_10250614 | 3300026116 | Bacteria | 1718 |
| 350 | Ga0207674_10428898 | 3300026116 | Bacteria | 1278 |
| 351 | Ga0207698_10142799 | 3300026142 | Bacteria | 2065 |
| 352 | Ga0207698_10186349 | 3300026142 | Bacteria | 1844 |
| 353 | Ga0207698_10257913 | 3300026142 | Bacteria | 1600 |
| 354 | Ga0207698_10669165 | 3300026142 | Bacteria | 1030 |
| 355 | Ga0268266_10164982 | 3300028379 | Bacteria | 2006 |
| 356 | Ga0265319_1001384 | 3300028563 | Bacteria | 14568 |
| 357 | Ga0265319_1013771 | 3300028563 | Bacteria | 3198 |
| 358 | Ga0265319_1151353 | 3300028563 | Bacteria | 718 |
| 359 | Ga0265334_10016813 | 3300028573 | Bacteria | 3024 |
| 360 | Ga0265334_10021458 | 3300028573 | Bacteria | 2637 |
| 361 | Ga0265318_10000657 | 3300028577 | Bacteria | 23614 |
| 362 | Ga0265318_10001537 | 3300028577 | Bacteria | 13437 |
| 363 | Ga0265318_10050008 | 3300028577 | Bacteria | 1572 |
| 364 | Ga0265318_10064817 | 3300028577 | Bacteria | 1359 |
| 365 | Ga0265322_10034042 | 3300028654 | Bacteria | 1452 |
| 366 | Ga0265322_10076010 | 3300028654 | Bacteria | 953 |
| 367 | Ga0265336_10013279 | 3300028666 | Bacteria | 2748 |
| 368 | Ga0265336_10056286 | 3300028666 | Bacteria | 1182 |
| 369 | Ga0265338_10003688 | 3300028800 | Bacteria | 21332 |
| 370 | Ga0265338_10005979 | 3300028800 | Bacteria | 15653 |
| 371 | Ga0265338_10038481 | 3300028800 | Bacteria | 4531 |
| 372 | Ga0265338_10111325 | 3300028800 | Bacteria | 2204 |
| 373 | Ga0265338_10160831 | 3300028800 | Bacteria | 1734 |
| 374 | Ga0265338_10194067 | 3300028800 | Bacteria | 1537 |
| 375 | Ga0265338_10574786 | 3300028800 | Bacteria | 787 |
| 376 | Ga0265338_10741062 | 3300028800 | Bacteria | 676 |
| 377 | Ga0265324_10037517 | 3300029957 | Bacteria | 1684 |
| 378 | Ga0265330_10000672 | 3300031235 | Bacteria | 21962 |
| 379 | Ga0265330_10038951 | 3300031235 | Bacteria | 2113 |
| 380 | Ga0265332_10003607 | 3300031238 | Bacteria | 7419 |
| 381 | Ga0265328_10001789 | 3300031239 | Bacteria | 9800 |
| 382 | Ga0265328_10069565 | 3300031239 | Bacteria | 1294 |
| 383 | Ga0265320_10009710 | 3300031240 | Bacteria | 5776 |
| 384 | Ga0265320_10020029 | 3300031240 | Bacteria | 3638 |
| 385 | Ga0265320_10122018 | 3300031240 | Bacteria | 1188 |
| 386 | Ga0265325_10001475 | 3300031241 | Bacteria | 16573 |
| 387 | Ga0265329_10014857 | 3300031242 | Bacteria | 2737 |
| 388 | Ga0265340_10001171 | 3300031247 | Bacteria | 15016 |
| 389 | Ga0265340_10046505 | 3300031247 | Bacteria | 2117 |
| 390 | Ga0265340_10076072 | 3300031247 | Bacteria | 1586 |
| 391 | Ga0265339_10007738 | 3300031249 | Bacteria | 6908 |
| 392 | Ga0265339_10261350 | 3300031249 | Bacteria | 835 |
| 393 | Ga0265331_10002439 | 3300031250 | Bacteria | 12593 |
| 394 | Ga0265331_10043661 | 3300031250 | Bacteria | 2170 |
| 395 | Ga0265327_10004284 | 3300031251 | Bacteria | 12759 |
| 396 | Ga0265327_10010298 | 3300031251 | Bacteria | 6592 |
| 397 | Ga0265327_10014563 | 3300031251 | Bacteria | 5134 |
| 398 | Ga0265327_10035657 | 3300031251 | Bacteria | 2746 |
| 399 | Ga0265327_10075211 | 3300031251 | Bacteria | 1680 |
| 400 | Ga0265316_10004219 | 3300031344 | Bacteria | 14355 |
| 401 | Ga0265316_10009220 | 3300031344 | Bacteria | 9089 |
| 402 | Ga0265316_10302089 | 3300031344 | Bacteria | 1166 |
| 403 | Ga0307408_100396580 | 3300031548 | Bacteria | 1184 |
| 404 | Ga0307408_101242320 | 3300031548 | Bacteria | 696 |
| 405 | Ga0265313_10003136 | 3300031595 | Bacteria | 13647 |
| 406 | Ga0265313_10009194 | 3300031595 | Bacteria | 6444 |
| 407 | Ga0265314_10003360 | 3300031711 | Bacteria | 15527 |
| 408 | Ga0265314_10007017 | 3300031711 | Bacteria | 9842 |
| 409 | Ga0265314_10017989 | 3300031711 | Bacteria | 5529 |
| 410 | Ga0265314_10330852 | 3300031711 | Bacteria | 844 |
| 411 | Ga0265342_10002099 | 3300031712 | Bacteria | 17590 |
| 412 | Ga0307409_100266527 | 3300031995 | Bacteria | 1575 |
| 413 | Ga0307416_100038804 | 3300032002 | Bacteria | 3678 |
| 414 | Ga0307416_100074266 | 3300032002 | Bacteria | 2840 |
| 415 | Ga0307416_101130573 | 3300032002 | Bacteria | 888 |
| 416 | Ga0307415_100139056 | 3300032126 | Bacteria | 1852 |
| 417 | Ga0307415_100147699 | 3300032126 | Bacteria | 1805 |
| 418 | Ga0307415_101036624 | 3300032126 | Unclassified | 765 |
| 419 | Ga0307415_101527920 | 3300032126 | Bacteria | 639 |
| 420 | Ga0316593_10346592 | 3300032168 | Bacteria | 568 |
| 421 | Ga0373950_0070141 | 3300034818 | Bacteria | 717 |
| 422 | Ga0373926_0049284 | 3300035083 | Bacteria | 1517 |
| 423 | Ga0373940_0037706 | 3300035088 | Bacteria | 1317 |
| 424 | Ga0373944_0006773 | 3300035089 | Bacteria | 3051 |
| 425 | Ga0373944_0064161 | 3300035089 | Bacteria | 1184 |
| 426 | Ga0373949_0101143 | 3300035090 | Bacteria | 790 |
| 427 | Ga0373936_0056343 | 3300035113 | Bacteria | 1597 |
| 428 | Ga0373945_0017335 | 3300035116 | Bacteria | 2438 |
| 429 | Ga0373953_0070444 | 3300035117 | Bacteria | 1442 |
| 430 | Ga0373954_0206208 | 3300035118 | Bacteria | 966 |
| 431 | Ga0373943_0000829 | 3300035170 | Bacteria | 13619 |
| 432 | Ga0373943_0036518 | 3300035170 | Bacteria | 2353 |
| 433 | Ga0373943_0095875 | 3300035170 | Bacteria | 1543 |
| 434 | Ga0373955_0195257 | 3300035172 | Bacteria | 1204 |
| 435 | Ga0373942_0142849 | 3300035207 | Bacteria | 763 |
| 436 | Ga0373931_0008030 | 3300035691 | Bacteria | 4994 |
| 437 | Ga0373935_0128514 | 3300035692 | Bacteria | 1700 |
| 438 | Ga0373935_0305804 | 3300035692 | Bacteria | 1125 |
| 439 | Ga0373927_0019664 | 3300035695 | Bacteria | 4428 |
| 440 | Ga0373927_0054110 | 3300035695 | Bacteria | 2596 |
| 441 | Ga0373927_0268582 | 3300035695 | Bacteria | 1122 |
| 442 | Ga0373933_0026041 | 3300035724 | Bacteria | 3356 |
| 443 | Ga0373947_0000984 | 3300035725 | Bacteria | 17384 |
| 444 | Ga0373947_0010822 | 3300035725 | Bacteria | 5235 |
| 445 | Ga0373937_0046778 | 3300036401 | Bacteria | 3957 |
| 446 | Ga0373937_0227002 | 3300036401 | Bacteria | 1758 |
| 447 | Ga0373937_0763600 | 3300036401 | Bacteria | 914 |
| 448 | Ga0373925_0009937 | 3300037068 | Bacteria | 6910 |
| 449 | Ga0373925_0024098 | 3300037068 | Bacteria | 4442 |
| 450 | Ga0395899_0021325 | 3300037312 | Bacteria | 4914 |
| 451 | Ga0395899_0031616 | 3300037312 | Bacteria | 3978 |
| 452 | Ga0395899_0052522 | 3300037312 | Bacteria | 3020 |
| 453 | Ga0395899_0123867 | 3300037312 | Bacteria | 1849 |
| 454 | Ga0395899_0180565 | 3300037312 | Bacteria | 1482 |
| 455 | Ga0395900_0003871 | 3300037418 | Bacteria | 15996 |
| 456 | Ga0395900_0047074 | 3300037418 | Bacteria | 4440 |
| 457 | Ga0395900_0100506 | 3300037418 | Bacteria | 2971 |
| 458 | Ga0395900_0148192 | 3300037418 | Bacteria | 2399 |
| 459 | Ga0395900_0155976 | 3300037418 | Bacteria | 2331 |
| 460 | Ga0395900_0160906 | 3300037418 | Bacteria | 2290 |
| 461 | Ga0395900_0247475 | 3300037418 | Bacteria | 1785 |
| 462 | Ga0395900_0316345 | 3300037418 | Bacteria | 1543 |
| 463 | Ga0395900_0399633 | 3300037418 | Bacteria | 1339 |
| 464 | Ga0395900_0400417 | 3300037418 | Bacteria | 1337 |
| 465 | Ga0395900_0454870 | 3300037418 | Bacteria | 1236 |
| 466 | Ga0395900_0890565 | 3300037418 | Bacteria | 814 |
| 467 | Ga0395898_0012460 | 3300037466 | Bacteria | 8790 |
| 468 | Ga0395898_0026181 | 3300037466 | Bacteria | 5871 |
| 469 | Ga0395898_0050440 | 3300037466 | Bacteria | 4072 |
| 470 | Ga0395898_0057630 | 3300037466 | Bacteria | 3785 |
| 471 | Ga0395898_0154285 | 3300037466 | Bacteria | 2197 |
| 472 | Ga0395898_0280150 | 3300037466 | Bacteria | 1590 |
| 473 | Ga0395898_0580842 | 3300037466 | Bacteria | 1063 |
| 474 | Ga0395898_0667204 | 3300037466 | Bacteria | 982 |
| 475 | Ga0395898_0759652 | 3300037466 | Bacteria | 911 |
| 476 | Ga0395905_0023831 | 3300037471 | Bacteria | 5779 |
| 477 | Ga0395905_0078030 | 3300037471 | Bacteria | 3103 |
| 478 | Ga0395905_0152407 | 3300037471 | Bacteria | 2174 |
| 479 | Ga0395905_0271506 | 3300037471 | Bacteria | 1582 |
| 480 | Ga0395905_0412289 | 3300037471 | Bacteria | 1246 |
| 481 | Ga0395905_0502317 | 3300037471 | Bacteria | 1113 |
| 482 | Ga0436364_0876689 | 3300037853 | Bacteria | 1501 |
| 483 | Ga0395901_0008826 | 3300038443 | Bacteria | 10203 |
| 484 | Ga0395901_0016696 | 3300038443 | Bacteria | 7480 |
| 485 | Ga0395901_0035865 | 3300038443 | Bacteria | 5125 |
| 486 | Ga0395901_0168287 | 3300038443 | Bacteria | 2300 |
| 487 | Ga0395901_0430493 | 3300038443 | Bacteria | 1352 |
| 488 | Ga0395901_0751132 | 3300038443 | Bacteria | 968 |
| 489 | Ga0395901_0916062 | 3300038443 | Bacteria | 857 |
| 490 | Ga0395901_0978537 | 3300038443 | Bacteria | 823 |
| 491 | Ga0436365_1128087 | 3300039437 | Bacteria | 590 |
| 492 | Ga0436365_1495102 | 3300039437 | Bacteria | 1390 |
| 493 | Ga0436365_1706016 | 3300039437 | Bacteria | 794 |
| 494 | Ga0436360_0298578 | 3300039438 | Bacteria | 1050 |
| 495 | Ga0436360_0668708 | 3300039438 | Bacteria | 2048 |
| 496 | Ga0436360_0980384 | 3300039438 | Bacteria | 6299 |
| 497 | Ga0436363_1711709 | 3300039450 | Bacteria | 823 |
| 498 | Ga0439461_0012117 | 3300041410 | Bacteria | 1610 |
| 499 | Ga0451835_0412462 | 3300041492 | Bacteria | 851 |
| 500 | Ga0451845_0599224 | 3300041501 | Bacteria | 592 |
| 501 | Ga0439433_0056594 | 3300041999 | Bacteria | 930 |
| 502 | Ga0439448_0147590 | 3300042005 | Bacteria | 815 |
| 503 | Ga0439462_0045384 | 3300042015 | Bacteria | 1177 |
| 504 | Ga0439446_0103117 | 3300042156 | Bacteria | 904 |
| 505 | Ga0439434_0131938 | 3300042435 | Bacteria | 820 |
| 506 | Ga0439434_0287981 | 3300042435 | Bacteria | 566 |
| 507 | Ga0439435_0090733 | 3300042436 | Bacteria | 928 |
| 508 | Ga0450918_041876 | 3300042531 | Bacteria | 823 |
| 509 | Ga0466969_0000388 | 3300044656 | Bacteria | 24129 |
| 510 | Ga0466969_0051427 | 3300044656 | Bacteria | 2028 |
| 511 | Ga0466972_0096198 | 3300044658 | Bacteria | 1403 |
| 512 | Ga0466972_0416872 | 3300044658 | Bacteria | 630 |
| 513 | Ga0466965_0077580 | 3300044683 | Bacteria | 1678 |
| 514 | Ga0466965_0144400 | 3300044683 | Bacteria | 1241 |
| 515 | Ga0466966_0024715 | 3300044684 | Bacteria | 3930 |
| 516 | Ga0466966_0070776 | 3300044684 | Bacteria | 2186 |
| 517 | Ga0466966_0158964 | 3300044684 | Bacteria | 1376 |
| 518 | Ga0466966_0363076 | 3300044684 | Bacteria | 870 |
| 519 | Ga0466966_0424790 | 3300044684 | Bacteria | 799 |
| 520 | Ga0466961_0008115 | 3300044693 | Bacteria | 6684 |
| 521 | Ga0466961_0032291 | 3300044693 | Bacteria | 3363 |
| 522 | Ga0466961_0049430 | 3300044693 | Bacteria | 2688 |
| 523 | Ga0466961_0058747 | 3300044693 | Bacteria | 2447 |
| 524 | Ga0466961_0096972 | 3300044693 | Bacteria | 1859 |
| 525 | Ga0466961_0126748 | 3300044693 | Bacteria | 1601 |
| 526 | Ga0466961_0445125 | 3300044693 | Bacteria | 784 |
| 527 | Ga0466961_0458499 | 3300044693 | Bacteria | 771 |
| 528 | Ga0466963_0000496 | 3300044694 | Bacteria | 18307 |
| 529 | Ga0466963_0004989 | 3300044694 | Bacteria | 7748 |
| 530 | Ga0466963_0007612 | 3300044694 | Bacteria | 6465 |
| 531 | Ga0466963_0012464 | 3300044694 | Bacteria | 5204 |
| 532 | Ga0466963_0016410 | 3300044694 | Bacteria | 4605 |
| 533 | Ga0466963_0027365 | 3300044694 | Bacteria | 3650 |
| 534 | Ga0466963_0029294 | 3300044694 | Bacteria | 3542 |
| 535 | Ga0466963_0046766 | 3300044694 | Bacteria | 2854 |
| 536 | Ga0466963_0052153 | 3300044694 | Bacteria | 2713 |
| 537 | Ga0466963_0086524 | 3300044694 | Bacteria | 2130 |
| 538 | Ga0466963_0161532 | 3300044694 | Bacteria | 1559 |
| 539 | Ga0466963_0336547 | 3300044694 | Bacteria | 1062 |
| 540 | Ga0466963_0515069 | 3300044694 | Bacteria | 845 |
| 541 | Ga0466963_0924771 | 3300044694 | Bacteria | 614 |
| 542 | Ga0466964_0009803 | 3300044706 | Bacteria | 3609 |
| 543 | Ga0466964_0108093 | 3300044706 | Bacteria | 1236 |
| 544 | Ga0466964_0327675 | 3300044706 | Bacteria | 780 |
| 545 | Ga0466971_0000165 | 3300044719 | Bacteria | 24707 |
| 546 | Ga0466971_0006803 | 3300044719 | Bacteria | 4974 |
| 547 | Ga0466971_0018750 | 3300044719 | Bacteria | 3067 |
| 548 | Ga0466971_0034312 | 3300044719 | Bacteria | 2274 |
| 549 | Ga0466971_0137194 | 3300044719 | Bacteria | 1138 |
| 550 | Ga0466971_0172829 | 3300044719 | Bacteria | 1014 |
| 551 | Ga0466971_0219864 | 3300044719 | Bacteria | 900 |
| 552 | Ga0466971_0227269 | 3300044719 | Bacteria | 885 |
| 553 | Ga0466968_0004439 | 3300044735 | Bacteria | 5249 |
| 554 | Ga0466968_0004580 | 3300044735 | Bacteria | 5170 |
| 555 | Ga0466968_0005689 | 3300044735 | Bacteria | 4670 |
| 556 | Ga0466968_0027732 | 3300044735 | Bacteria | 2331 |
| 557 | Ga0466968_0054697 | 3300044735 | Bacteria | 1711 |
| 558 | Ga0466968_0303991 | 3300044735 | Bacteria | 768 |
| 559 | Ga0466968_0475271 | 3300044735 | Bacteria | 620 |
| 560 | Ga0466970_0052831 | 3300044765 | Bacteria | 2169 |
| 561 | Ga0466970_0611066 | 3300044765 | Bacteria | 633 |
| 562 | Ga0466957_0001076 | 3300044842 | Bacteria | 14082 |
| 563 | Ga0466957_0012986 | 3300044842 | Bacteria | 4825 |
| 564 | Ga0466957_0053166 | 3300044842 | Bacteria | 2468 |
| 565 | Ga0466957_0059241 | 3300044842 | Bacteria | 2347 |
| 566 | Ga0466957_0092321 | 3300044842 | Bacteria | 1898 |
| 567 | Ga0466959_0021447 | 3300045049 | Bacteria | 4764 |
| 568 | Ga0466959_0022495 | 3300045049 | Bacteria | 4661 |
| 569 | Ga0466959_0052831 | 3300045049 | Bacteria | 2974 |
| 570 | Ga0466959_0193666 | 3300045049 | Bacteria | 1418 |
| 571 | Ga0466959_0240095 | 3300045049 | Unclassified | 1252 |
| 572 | Ga0466959_0265075 | 3300045049 | Bacteria | 1182 |
| 573 | Ga0466959_0427263 | 3300045049 | Bacteria | 899 |
| 574 | Ga0451576_0131220 | 3300045051 | Bacteria | 2612 |
| 575 | Ga0451576_0558524 | 3300045051 | Bacteria | 1203 |
| 576 | Ga0466958_0000198 | 3300045836 | Bacteria | 22183 |
| 577 | Ga0466958_0010251 | 3300045836 | Bacteria | 5244 |
| 578 | Ga0466958_0013940 | 3300045836 | Bacteria | 4582 |
| 579 | Ga0466958_0017255 | 3300045836 | Bacteria | 4170 |
| 580 | Ga0466958_0017496 | 3300045836 | Bacteria | 4145 |
| 581 | Ga0466958_0021576 | 3300045836 | Bacteria | 3765 |
| 582 | Ga0466958_0057947 | 3300045836 | Bacteria | 2354 |
| 583 | Ga0466958_0069822 | 3300045836 | Bacteria | 2149 |
| 584 | Ga0466958_0207928 | 3300045836 | Bacteria | 1246 |
| 585 | Ga0466958_0313896 | 3300045836 | Bacteria | 1007 |
| 586 | Ga0466958_0796595 | 3300045836 | Bacteria | 616 |
| 587 | Ga0466967_0000179 | 3300045976 | Bacteria | 26199 |
| 588 | Ga0466967_0004681 | 3300045976 | Bacteria | 9291 |
| 589 | Ga0466967_0010812 | 3300045976 | Bacteria | 6869 |
| 590 | Ga0466967_0012007 | 3300045976 | Bacteria | 6600 |
| 591 | Ga0466967_0012286 | 3300045976 | Bacteria | 6541 |
| 592 | Ga0466967_0016889 | 3300045976 | Bacteria | 5771 |
| 593 | Ga0466967_0034468 | 3300045976 | Bacteria | 4297 |
| 594 | Ga0466967_0035396 | 3300045976 | Bacteria | 4250 |
| 595 | Ga0466967_0050261 | 3300045976 | Bacteria | 3650 |
| 596 | Ga0466967_0058719 | 3300045976 | Bacteria | 3401 |
| 597 | Ga0466967_0106170 | 3300045976 | Bacteria | 2574 |
| 598 | Ga0466967_0125599 | 3300045976 | Bacteria | 2376 |
| 599 | Ga0466967_0177980 | 3300045976 | Bacteria | 2004 |
| 600 | Ga0466967_0203593 | 3300045976 | Bacteria | 1875 |
| 601 | Ga0466967_0215260 | 3300045976 | Bacteria | 1823 |
| 602 | Ga0466967_0401429 | 3300045976 | Bacteria | 1334 |
| 603 | Ga0466967_0452035 | 3300045976 | Bacteria | 1256 |
| 604 | Ga0466967_0470092 | 3300045976 | Bacteria | 1231 |
| 605 | Ga0466967_0488172 | 3300045976 | Bacteria | 1207 |
| 606 | Ga0466967_0505462 | 3300045976 | Bacteria | 1186 |
| 607 | Ga0466967_0575358 | 3300045976 | Bacteria | 1110 |
| 608 | Ga0466967_0835861 | 3300045976 | Bacteria | 915 |
| 609 | Ga0466967_0987400 | 3300045976 | Bacteria | 838 |
| 610 | Ga0495627_178389 | 3300046453 | Bacteria | 589 |
| 611 | Ga0495592_0148502 | 3300046454 | Bacteria | 1623 |
| 612 | Ga0495603_0024362 | 3300046455 | Bacteria | 3659 |
| 613 | Ga0495603_0103167 | 3300046455 | Bacteria | 1665 |
| 614 | Ga0495603_0304809 | 3300046455 | Unclassified | 915 |
| 615 | Ga0495629_0007857 | 3300046459 | Bacteria | 7849 |
| 616 | Ga0495629_0010312 | 3300046459 | Bacteria | 6808 |
| 617 | Ga0495641_0004552 | 3300046461 | Bacteria | 9732 |
| 618 | Ga0495641_0005759 | 3300046461 | Bacteria | 8234 |
| 619 | Ga0495641_0312811 | 3300046461 | Bacteria | 708 |
| 620 | Ga0495651_0035126 | 3300046462 | Bacteria | 3905 |
| 621 | Ga0495651_0066163 | 3300046462 | Bacteria | 2759 |
| 622 | Ga0495651_0597939 | 3300046462 | Bacteria | 696 |
| 623 | Ga0495653_0024531 | 3300046463 | Bacteria | 4859 |
| 624 | Ga0495653_0029554 | 3300046463 | Bacteria | 4373 |
| 625 | Ga0495653_0067957 | 3300046463 | Bacteria | 2674 |
| 626 | Ga0495653_0084567 | 3300046463 | Bacteria | 2336 |
| 627 | Ga0495653_0103363 | 3300046463 | Bacteria | 2060 |
| 628 | Ga0495653_0207592 | 3300046463 | Bacteria | 1325 |
| 629 | Ga0495653_0234166 | 3300046463 | Bacteria | 1228 |
| 630 | Ga0495653_0410068 | 3300046463 | Bacteria | 859 |
| 631 | Ga0495580_0023610 | 3300046472 | Bacteria | 4513 |
| 632 | Ga0495582_0005237 | 3300046473 | Bacteria | 7251 |
| 633 | Ga0495582_0033438 | 3300046473 | Bacteria | 2827 |
| 634 | Ga0495639_0012174 | 3300046475 | Bacteria | 3708 |
| 635 | Ga0495662_0002311 | 3300046476 | Bacteria | 9609 |
| 636 | Ga0495664_0028844 | 3300046477 | Bacteria | 3242 |
| 637 | Ga0495664_0443283 | 3300046477 | Bacteria | 778 |
| 638 | Ga0495664_0775003 | 3300046477 | Bacteria | 564 |
| 639 | Ga0495584_0019722 | 3300046491 | Bacteria | 3426 |
| 640 | Ga0495585_0049390 | 3300046492 | Bacteria | 2336 |
| 641 | Ga0495608_0028929 | 3300046511 | Bacteria | 3764 |
| 642 | Ga0495608_0047179 | 3300046511 | Bacteria | 2864 |
| 643 | Ga0495608_0141142 | 3300046511 | Bacteria | 1537 |
| 644 | Ga0495608_0216183 | 3300046511 | Bacteria | 1204 |
| 645 | Ga0495618_0033708 | 3300046514 | Bacteria | 3211 |
| 646 | Ga0495618_0064325 | 3300046514 | Bacteria | 2330 |
| 647 | Ga0495618_0693419 | 3300046514 | Bacteria | 599 |
| 648 | Ga0495628_0141693 | 3300046516 | Bacteria | 1835 |
| 649 | Ga0495630_0014476 | 3300046517 | Bacteria | 5747 |
| 650 | Ga0495630_0024352 | 3300046517 | Bacteria | 4476 |
| 651 | Ga0495630_0026574 | 3300046517 | Bacteria | 4286 |
| 652 | Ga0495630_0078367 | 3300046517 | Bacteria | 2491 |
| 653 | Ga0495630_0487330 | 3300046517 | Bacteria | 945 |
| 654 | Ga0495630_0496231 | 3300046517 | Unclassified | 936 |
| 655 | Ga0495630_0568596 | 3300046517 | Bacteria | 869 |
| 656 | Ga0495637_0078988 | 3300046520 | Bacteria | 1315 |
| 657 | Ga0495644_0003489 | 3300046523 | Bacteria | 6222 |
| 658 | Ga0495644_0184684 | 3300046523 | Bacteria | 802 |
| 659 | Ga0495666_0000649 | 3300046526 | Bacteria | 15639 |
| 660 | Ga0495642_0072159 | 3300046528 | Bacteria | 1445 |
| 661 | Ga0495652_0045044 | 3300046529 | Bacteria | 3796 |
| 662 | Ga0495652_0165994 | 3300046529 | Bacteria | 1709 |
| 663 | Ga0495652_0322946 | 3300046529 | Bacteria | 1114 |
| 664 | Ga0495665_0002189 | 3300046531 | Bacteria | 10576 |
| 665 | Ga0495640_0024397 | 3300046533 | Bacteria | 4399 |
| 666 | Ga0495640_0073224 | 3300046533 | Bacteria | 2294 |
| 667 | Ga0495640_0100577 | 3300046533 | Bacteria | 1898 |
| 668 | Ga0495640_0250586 | 3300046533 | Bacteria | 1109 |
| 669 | Ga0495586_0019241 | 3300046535 | Bacteria | 3631 |
| 670 | Ga0495586_0021041 | 3300046535 | Bacteria | 3476 |
| 671 | Ga0495586_0030331 | 3300046535 | Bacteria | 2893 |
| 672 | Ga0495645_0041106 | 3300046543 | Bacteria | 3371 |
| 673 | Ga0495645_0273687 | 3300046543 | Bacteria | 1113 |
| 674 | Ga0495667_0152910 | 3300046559 | Bacteria | 1485 |
| 675 | Ga0495656_0284329 | 3300046615 | Bacteria | 844 |
| 676 | Ga0495668_0301998 | 3300046616 | Bacteria | 878 |
| 677 | Ga0495634_0027714 | 3300046642 | Bacteria | 3940 |
| 678 | Ga0495634_0041481 | 3300046642 | Bacteria | 3125 |
| 679 | Ga0495634_0098872 | 3300046642 | Bacteria | 1887 |
| 680 | Ga0495634_0099298 | 3300046642 | Bacteria | 1882 |
| 681 | Ga0495634_0153216 | 3300046642 | Bacteria | 1456 |
| 682 | Ga0495634_0200483 | 3300046642 | Bacteria | 1240 |
| 683 | Ga0495634_0787512 | 3300046642 | Bacteria | 543 |
| 684 | Ga0495611_0507350 | 3300046648 | Bacteria | 548 |
| 685 | Ga0495635_0016327 | 3300046663 | Bacteria | 5184 |
| 686 | Ga0495635_0043606 | 3300046663 | Bacteria | 3095 |
| 687 | Ga0495635_0303154 | 3300046663 | Bacteria | 1071 |
| 688 | Ga0495659_0022974 | 3300046664 | Bacteria | 2115 |
| 689 | Ga0495657_0023514 | 3300046675 | Bacteria | 4402 |
| 690 | Ga0495657_0056134 | 3300046675 | Bacteria | 2624 |
| 691 | Ga0495657_0153958 | 3300046675 | Bacteria | 1426 |
| 692 | Ga0495657_0225684 | 3300046675 | Bacteria | 1134 |
| 693 | Ga0495599_0002999 | 3300046678 | Bacteria | 9830 |
| 694 | Ga0495599_0448727 | 3300046678 | Bacteria | 764 |
| 695 | Ga0495646_0053036 | 3300046680 | Bacteria | 2447 |
| 696 | Ga0495647_0000558 | 3300046681 | Bacteria | 10976 |
| 697 | Ga0495647_0034053 | 3300046681 | Bacteria | 1906 |
| 698 | Ga0495647_0057849 | 3300046681 | Bacteria | 1523 |
| 699 | Ga0495658_0004841 | 3300046683 | Bacteria | 6604 |
| 700 | Ga0495658_0032586 | 3300046683 | Bacteria | 2847 |
| 701 | Ga0495658_0210600 | 3300046683 | Bacteria | 1214 |
| 702 | Ga0495669_0357859 | 3300046684 | Bacteria | 706 |
| 703 | Ga0495613_0006480 | 3300046689 | Bacteria | 8748 |
| 704 | Ga0495613_0018612 | 3300046689 | Bacteria | 5178 |
| 705 | Ga0495613_0159840 | 3300046689 | Bacteria | 1603 |
| 706 | Ga0495613_0221746 | 3300046689 | Bacteria | 1327 |
| 707 | Ga0495624_0003577 | 3300046690 | Bacteria | 11505 |
| 708 | Ga0495624_0028867 | 3300046690 | Bacteria | 3621 |
| 709 | Ga0495624_0081689 | 3300046690 | Bacteria | 2001 |
| 710 | Ga0495624_0154900 | 3300046690 | Bacteria | 1401 |
| 711 | Ga0495624_0208184 | 3300046690 | Unclassified | 1187 |
| 712 | Ga0495624_0600804 | 3300046690 | Bacteria | 656 |
| 713 | Ga0495600_0022360 | 3300046809 | Bacteria | 4058 |
| 714 | Ga0495600_0363851 | 3300046809 | Bacteria | 904 |
| 715 | Ga0495600_0396020 | 3300046809 | Bacteria | 860 |
| 716 | Ga0495600_0419670 | 3300046809 | Bacteria | 830 |
| 717 | Ga0495581_0002674 | 3300047315 | Bacteria | 10139 |
| 718 | Ga0495581_0066870 | 3300047315 | Bacteria | 2078 |
| 719 | Ga0495604_0115700 | 3300047317 | Bacteria | 1948 |
| 720 | Ga0495604_0156176 | 3300047317 | Bacteria | 1616 |
| 721 | Ga0495604_0217466 | 3300047317 | Bacteria | 1317 |
| 722 | Ga0495674_0100783 | 3300047319 | Bacteria | 2457 |
| 723 | Ga0495674_0117974 | 3300047319 | Bacteria | 2244 |
| 724 | Ga0495676_0002388 | 3300047321 | Bacteria | 16667 |
| 725 | Ga0495676_0182585 | 3300047321 | Bacteria | 1469 |
| 726 | Ga0495676_0573726 | 3300047321 | Bacteria | 736 |
| 727 | Ga0495680_0002404 | 3300047322 | Bacteria | 19198 |
| 728 | Ga0495680_0035961 | 3300047322 | Bacteria | 3982 |
| 729 | Ga0495680_0151250 | 3300047322 | Bacteria | 1692 |
| 730 | Ga0495680_0225414 | 3300047322 | Bacteria | 1336 |
| 731 | Ga0495680_0313835 | 3300047322 | Bacteria | 1098 |
| 732 | Ga0495680_0734836 | 3300047322 | Bacteria | 649 |
| 733 | Ga0495675_0023867 | 3300047444 | Bacteria | 3897 |
| 734 | Ga0495675_0220301 | 3300047444 | Bacteria | 1149 |
| 735 | Ga0495679_072161 | 3300047446 | Bacteria | 993 |
| 736 | Ga0495685_093090 | 3300047447 | Bacteria | 998 |
| 737 | Ga0495684_0043631 | 3300047471 | Bacteria | 3434 |
| 738 | Ga0495684_0162401 | 3300047471 | Bacteria | 1665 |
| 739 | Ga0495684_0193398 | 3300047471 | Bacteria | 1503 |
| 740 | Ga0495684_0244796 | 3300047471 | Bacteria | 1306 |
| 741 | Ga0495684_0360292 | 3300047471 | Bacteria | 1030 |
| 742 | Ga0495593_0008342 | 3300047673 | Bacteria | 6029 |
| 743 | Ga0495593_0030005 | 3300047673 | Bacteria | 2978 |
| 744 | Ga0495602_0029426 | 3300048088 | Bacteria | 5230 |
| 745 | Ga0495602_0322921 | 3300048088 | Bacteria | 1122 |
| 746 | Ga0495614_0006474 | 3300048089 | Bacteria | 5254 |
| 747 | Ga0495614_0285191 | 3300048089 | Bacteria | 761 |
| 748 | Ga0495615_0277824 | 3300048090 | Bacteria | 537 |
| 749 | Ga0496100_0004732 | 3300048903 | Bacteria | 7257 |
| 750 | Ga0496100_0103592 | 3300048903 | Bacteria | 1965 |
| 751 | Ga0496100_0123805 | 3300048903 | Bacteria | 1812 |
| 752 | Ga0496100_0589973 | 3300048903 | Bacteria | 862 |
| 753 | Ga0496101_0053116 | 3300048904 | Bacteria | 2922 |
| 754 | Ga0496101_0156161 | 3300048904 | Bacteria | 1748 |
| 755 | Ga0496101_0217355 | 3300048904 | Bacteria | 1482 |
| 756 | Ga0496101_0277742 | 3300048904 | Bacteria | 1309 |
| 757 | Ga0496101_0778275 | 3300048904 | Bacteria | 755 |
| 758 | Ga0496101_1135061 | 3300048904 | Bacteria | 613 |
| 759 | Ga0496102_0029581 | 3300048905 | Bacteria | 4902 |
| 760 | Ga0496102_0092424 | 3300048905 | Bacteria | 2802 |
| 761 | Ga0496102_0341605 | 3300048905 | Bacteria | 1410 |
| 762 | Ga0496103_0013174 | 3300048906 | Bacteria | 4902 |
| 763 | Ga0496103_0164925 | 3300048906 | Bacteria | 1422 |
| 764 | Ga0496103_0192473 | 3300048906 | Bacteria | 1311 |
| 765 | Ga0496103_0209671 | 3300048906 | Bacteria | 1253 |
| 766 | Ga0496104_0009204 | 3300048907 | Bacteria | 8780 |
| 767 | Ga0496104_0132100 | 3300048907 | Bacteria | 2398 |
| 768 | Ga0496104_0325131 | 3300048907 | Bacteria | 1451 |
| 769 | Ga0496104_0434813 | 3300048907 | Bacteria | 1224 |
| 770 | Ga0496104_0494286 | 3300048907 | Bacteria | 1134 |
| 771 | Ga0496104_0530922 | 3300048907 | Bacteria | 1088 |
| 772 | Ga0496104_1477150 | 3300048907 | Bacteria | 583 |
| 773 | Ga0496105_0022782 | 3300048908 | Bacteria | 5075 |
| 774 | Ga0496105_0077056 | 3300048908 | Bacteria | 2753 |
| 775 | Ga0496105_0524005 | 3300048908 | Bacteria | 928 |
| 776 | Ga0496105_0861945 | 3300048908 | Bacteria | 685 |
| 777 | Ga0496106_0006958 | 3300048909 | Bacteria | 8362 |
| 778 | Ga0496106_0010051 | 3300048909 | Bacteria | 6990 |
| 779 | Ga0496106_0033698 | 3300048909 | Bacteria | 3822 |
| 780 | Ga0496106_0042412 | 3300048909 | Bacteria | 3412 |
| 781 | Ga0496106_0323039 | 3300048909 | Bacteria | 1239 |
| 782 | Ga0496107_0019319 | 3300048910 | Bacteria | 4808 |
| 783 | Ga0496107_0054955 | 3300048910 | Bacteria | 2875 |
| 784 | Ga0496107_0080978 | 3300048910 | Bacteria | 2368 |
| 785 | Ga0496107_0173684 | 3300048910 | Bacteria | 1599 |
| 786 | Ga0496107_0238174 | 3300048910 | Bacteria | 1354 |
| 787 | Ga0496108_0001322 | 3300048911 | Bacteria | 19476 |
| 788 | Ga0496108_0008941 | 3300048911 | Bacteria | 8119 |
| 789 | Ga0496108_0018951 | 3300048911 | Bacteria | 5643 |
| 790 | Ga0496108_0135626 | 3300048911 | Bacteria | 2117 |
| 791 | Ga0496108_0275493 | 3300048911 | Bacteria | 1465 |
| 792 | Ga0496109_0004720 | 3300048912 | Bacteria | 11381 |
| 793 | Ga0496109_0356659 | 3300048912 | Bacteria | 1381 |
| 794 | Ga0496109_0375810 | 3300048912 | Bacteria | 1342 |
| 795 | Ga0496109_0677365 | 3300048912 | Bacteria | 969 |
| 796 | Ga0496109_0804363 | 3300048912 | Bacteria | 878 |
| 797 | Ga0496109_1043269 | 3300048912 | Bacteria | 755 |
| 798 | Ga0496109_1267216 | 3300048912 | Bacteria | 673 |
| 799 | Ga0496110_0000279 | 3300048913 | Bacteria | 33279 |
| 800 | Ga0496110_0009338 | 3300048913 | Bacteria | 7935 |
| 801 | Ga0496110_0015765 | 3300048913 | Bacteria | 6299 |
| 802 | Ga0496110_0357216 | 3300048913 | Bacteria | 1331 |
| 803 | Ga0496110_0413902 | 3300048913 | Bacteria | 1229 |
| 804 | Ga0496111_0000545 | 3300048914 | Bacteria | 19484 |
| 805 | Ga0496111_0169482 | 3300048914 | Bacteria | 1622 |
| 806 | Ga0496111_0209165 | 3300048914 | Bacteria | 1449 |
| 807 | Ga0496112_0011241 | 3300048915 | Bacteria | 8166 |
| 808 | Ga0496112_0031813 | 3300048915 | Bacteria | 5119 |
| 809 | Ga0496112_0032075 | 3300048915 | Bacteria | 5099 |
| 810 | Ga0496112_0036838 | 3300048915 | Bacteria | 4772 |
| 811 | Ga0496112_0080753 | 3300048915 | Bacteria | 3216 |
| 812 | Ga0496112_0232758 | 3300048915 | Bacteria | 1797 |
| 813 | Ga0496112_0234587 | 3300048915 | Bacteria | 1789 |
| 814 | Ga0496112_0247276 | 3300048915 | Bacteria | 1735 |
| 815 | Ga0496112_0297050 | 3300048915 | Bacteria | 1561 |
| 816 | Ga0496112_0359563 | 3300048915 | Bacteria | 1398 |
| 817 | Ga0496112_0440185 | 3300048915 | Bacteria | 1241 |
| 818 | Ga0496112_0791168 | 3300048915 | Bacteria | 874 |
| 819 | Ga0496112_1035970 | 3300048915 | Bacteria | 740 |
| 820 | Ga0496112_1194797 | 3300048915 | Bacteria | 677 |
| 821 | Ga0496113_0046676 | 3300048916 | Bacteria | 3216 |
| 822 | Ga0496113_0059245 | 3300048916 | Bacteria | 2884 |
| 823 | Ga0496113_0124315 | 3300048916 | Bacteria | 2020 |
| 824 | Ga0496113_0579559 | 3300048916 | Bacteria | 899 |
| 825 | Ga0496113_1053668 | 3300048916 | Bacteria | 639 |
| 826 | Ga0496114_0004356 | 3300048917 | Bacteria | 10956 |
| 827 | Ga0496114_0008653 | 3300048917 | Bacteria | 8068 |
| 828 | Ga0496114_0436270 | 3300048917 | Bacteria | 1160 |
| 829 | Ga0496115_0061455 | 3300048918 | Bacteria | 3028 |
| 830 | Ga0496115_0089319 | 3300048918 | Bacteria | 2516 |
| 831 | Ga0496115_0422524 | 3300048918 | Bacteria | 1080 |
| 832 | Ga0501032_0704498 | 3300049569 | Bacteria | 640 |
| 833 | Ga0501034_0136755 | 3300049571 | Bacteria | 2431 |
| 834 | Ga0501040_0012822 | 3300049576 | Bacteria | 5504 |
| 835 | Ga0501040_0055003 | 3300049576 | Bacteria | 2729 |
| 836 | Ga0501040_0533133 | 3300049576 | Bacteria | 847 |
| 837 | Ga0501041_0571423 | 3300049577 | Bacteria | 721 |
| 838 | Ga0501042_0364931 | 3300049578 | Bacteria | 1045 |
| 839 | Ga0501046_0557824 | 3300049580 | Bacteria | 816 |
| 840 | Ga0501046_0566451 | 3300049580 | Bacteria | 808 |
| 841 | Ga0501047_0192221 | 3300049581 | Bacteria | 1904 |
| 842 | Ga0501047_0802157 | 3300049581 | Bacteria | 756 |
| 843 | Ga0501067_0001025 | 3300049583 | Bacteria | 15041 |
| 844 | Ga0501067_0150337 | 3300049583 | Bacteria | 1297 |
| 845 | Ga0501069_0003321 | 3300049585 | Bacteria | 8255 |
| 846 | Ga0501070_0096886 | 3300049586 | Bacteria | 2440 |
| 847 | Ga0501070_0206256 | 3300049586 | Bacteria | 1614 |
| 848 | Ga0501072_0622635 | 3300049588 | Bacteria | 850 |
| 849 | Ga0501073_0046169 | 3300049589 | Bacteria | 3065 |
| 850 | Ga0501074_0024761 | 3300049590 | Bacteria | 4361 |
| 851 | Ga0501076_0484631 | 3300049592 | Bacteria | 1019 |
| 852 | Ga0501077_0130384 | 3300049593 | Bacteria | 1594 |
| 853 | Ga0501079_0538582 | 3300049741 | Bacteria | 918 |
| 854 | Ga0501080_0026200 | 3300049742 | Bacteria | 5417 |
| 855 | Ga0501045_0345198 | 3300049824 | Bacteria | 1108 |
| 856 | nmdc:mga08y16_956291_c1 | 3300050511 | Bacteria | 839 |
| 857 | nmdc:mga0n895_103855_c1 | 3300050512 | Bacteria | 2854 |
| 858 | nmdc:mga0rr50_156168_c1 | 3300050513 | Bacteria | 1848 |
| 859 | nmdc:mga0a205_170661_c1 | 3300050515 | Bacteria | 2071 |
| 860 | Ga0495601_0006704 | 3300053077 | Bacteria | 6739 |
| 861 | Ga0495601_0196025 | 3300053077 | Bacteria | 1320 |
| 862 | Ga0495612_0001091 | 3300053078 | Bacteria | 11105 |
| 863 | Ga0495612_0180209 | 3300053078 | Bacteria | 928 |
| 864 | Ga0495655_0149229 | 3300053083 | Bacteria | 734 |
| 865 | Ga0495595_0032786 | 3300053084 | Bacteria | 2341 |
| 866 | Ga0495595_0044461 | 3300053084 | Bacteria | 2040 |
| 867 | Ga0495595_0109100 | 3300053084 | Bacteria | 1340 |
| 868 | Ga0495619_0034198 | 3300053085 | Bacteria | 3304 |
| 869 | Ga0495619_0046079 | 3300053085 | Bacteria | 2866 |
| 870 | Ga0495619_0054108 | 3300053085 | Bacteria | 2655 |
| 871 | Ga0495619_0120095 | 3300053085 | Bacteria | 1802 |
| 872 | Ga0495619_0282476 | 3300053085 | Bacteria | 1150 |
| 873 | Ga0500566_0098325 | 3300053094 | Bacteria | 1608 |
| 874 | Ga0590071_140344 | 3300059421 | Bacteria | 623 |
| 875 | Ga0590075_007359 | 3300059424 | Bacteria | 2615 |
| 876 | Ga0501082_0228144 | 3300060353 | Bacteria | 1621 |
| 877 | Ga0466962_0000618 | 3300061719 | Bacteria | 15773 |
| 878 | Ga0466962_0006173 | 3300061719 | Bacteria | 5757 |
| 879 | Ga0466962_0045074 | 3300061719 | Bacteria | 2108 |
| 880 | Ga0466962_0199984 | 3300061719 | Unclassified | 976 |
| 881 | Ga0466962_0339949 | 3300061719 | Bacteria | 746 |
| 882 | Ga0466962_0500409 | 3300061719 | Bacteria | 615 |
| 883 | Ga0466962_0563281 | 3300061719 | Bacteria | 579 |
| 884 | Ga0530510_0009967 | 3300061734 | Bacteria | 6666 |
| 885 | Ga0495651_0213375 | |||
| 886 | Ga0058863_11910037 | |||
| 887 | Ga0058862_12807872 | |||
| 888 | Ga0070658_10044965 | |||
| 889 | Ga0070658_10049400 | |||
| 890 | Ga0070658_10257830 | |||
| 891 | Ga0070658_10267597 | |||
| 892 | Ga0070676_11549710 | |||
| 893 | Ga0070683_100006172 | |||
| 894 | Ga0070683_100032081 | |||
| 895 | Ga0070683_100044248 | |||
| 896 | Ga0070683_100062290 | |||
| 897 | Ga0070683_100103720 | |||
| 898 | Ga0070683_100108882 | |||
| 899 | Ga0070683_100285283 | |||
| 900 | Ga0070683_100296222 | |||
| 901 | Ga0070683_101203931 | |||
| 902 | Ga0070680_100014485 | |||
| 903 | Ga0070680_100250951 | |||
| 904 | Ga0070680_100261994 | |||
| 905 | Ga0070680_101643982 | |||
| 906 | Ga0070682_100047037 | |||
| 907 | Ga0070682_100577351 | |||
| 908 | Ga0070682_100991390 | |||
| 909 | Ga0070660_100003458 | |||
| 910 | Ga0070660_100004868 | |||
| 911 | Ga0070660_100016665 | |||
| 912 | Ga0070660_100024280 | |||
| 913 | Ga0070660_100024290 | |||
| 914 | Ga0070660_100024497 | |||
| 915 | Ga0070660_100040297 | |||
| 916 | Ga0070660_100127570 | |||
| 917 | Ga0070661_100034760 | |||
| 918 | Ga0070661_100161475 | |||
| 919 | Ga0070661_100236906 | |||
| 920 | Ga0070661_100320473 | |||
| 921 | Ga0070661_100690736 | |||
| 922 | Ga0070661_100973999 | |||
| 923 | Ga0070692_10101787 | |||
| 924 | Ga0070675_100877311 | |||
| 925 | Ga0070671_100423705 | |||
| 926 | Ga0070659_100039235 | |||
| 927 | Ga0070659_100580276 | |||
| 928 | Ga0070709_10009338 | |||
| 929 | Ga0070709_10074488 | |||
| 930 | Ga0070709_10253706 | |||
| 931 | Ga0070714_100117081 | |||
| 932 | Ga0070714_100305542 | |||
| 933 | Ga0070714_100352029 | |||
| 934 | Ga0070714_100415621 | |||
| 935 | Ga0070714_101325693 | |||
| 936 | Ga0070714_101741154 | |||
| 937 | Ga0070713_100005892 | |||
| 938 | Ga0070710_10030936 | |||
| 939 | Ga0070710_10225923 | |||
| 940 | Ga0070710_10958211 | |||
| 941 | Ga0070711_100067249 | |||
| 942 | Ga0070700_100478974 | |||
| 943 | Ga0070708_100006727 | |||
| 944 | Ga0070708_101705434 | |||
| 945 | Ga0070681_10019025 | |||
| 946 | Ga0070681_10024922 | |||
| 947 | Ga0070681_10129972 | |||
| 948 | Ga0070681_10213474 | |||
| 949 | Ga0070681_10322083 | |||
| 950 | Ga0070681_10354634 | |||
| 951 | Ga0070681_10661414 | |||
| 952 | Ga0070681_10829816 | |||
| 953 | Ga0068867_100949343 | |||
| 954 | Ga0070706_101241462 | |||
| 955 | Ga0070706_101351608 | |||
| 956 | Ga0070707_100000328 | |||
| 957 | Ga0070707_100116347 | |||
| 958 | Ga0070707_100665549 | |||
| 959 | Ga0070698_100099113 | |||
| 960 | Ga0070698_100215543 | |||
| 961 | Ga0070698_100279610 | |||
| 962 | Ga0070698_100284890 | |||
| 963 | Ga0070699_100122865 | |||
| 964 | Ga0070699_100292820 | |||
| 965 | Ga0070699_100542705 | |||
| 966 | Ga0070679_100025308 | |||
| 967 | Ga0070679_100029750 | |||
| 968 | Ga0070679_100054350 | |||
| 969 | Ga0070679_100056642 | |||
| 970 | Ga0070679_100065935 | |||
| 971 | Ga0070679_100130752 | |||
| 972 | Ga0070679_100194174 | |||
| 973 | Ga0070679_100292201 | |||
| 974 | Ga0070679_100355960 | |||
| 975 | Ga0070679_100369841 | |||
| 976 | Ga0070679_100780161 | |||
| 977 | Ga0070679_100949128 | |||
| 978 | Ga0070684_100001095 | |||
| 979 | Ga0070684_100007102 | |||
| 980 | Ga0070684_100008765 | |||
| 981 | Ga0070684_100024219 | |||
| 982 | Ga0070684_100172679 | |||
| 983 | Ga0070684_100372351 | |||
| 984 | Ga0068853_100218022 | |||
| 985 | Ga0070695_100765516 | |||
| 986 | Ga0070696_100013480 | |||
| 987 | Ga0070693_100261354 | |||
| 988 | Ga0070693_100291319 | |||
| 989 | Ga0070693_101085586 | |||
| 990 | Ga0070665_100015545 | |||
| 991 | Ga0070704_100234855 | |||
| 992 | Ga0068855_100002523 | |||
| 993 | Ga0068855_100036661 | |||
| 994 | Ga0068855_100043181 | |||
| 995 | Ga0068855_100069488 | |||
| 996 | Ga0068855_100106284 | |||
| 997 | Ga0068855_100253446 | |||
| 998 | Ga0068855_100258802 | |||
| 999 | Ga0068855_100513656 | |||
| 1000 | Ga0070664_101136944 | |||
| 1001 | Ga0068857_100148013 | |||
| 1002 | Ga0068854_100407166 | |||
| 1003 | Ga0068856_100049855 | |||
| 1004 | Ga0068856_100059390 | |||
| 1005 | Ga0068856_100067539 | |||
| 1006 | Ga0068856_100084897 | |||
| 1007 | Ga0068856_100178594 | |||
| 1008 | Ga0068856_100393716 | |||
| 1009 | Ga0068856_100495341 | |||
| 1010 | Ga0068856_100533228 | |||
| 1011 | Ga0068856_102660802 | |||
| 1012 | Ga0070702_100062886 | |||
| 1013 | Ga0068852_100040177 | |||
| 1014 | Ga0068852_100135685 | |||
| 1015 | Ga0068852_100144161 | |||
| 1016 | Ga0068852_101161862 | |||
| 1017 | Ga0068852_101228121 | |||
| 1018 | Ga0068852_101564188 | |||
| 1019 | Ga0070717_10010696 | |||
| 1020 | Ga0070717_10079145 | |||
| 1021 | Ga0070717_10093185 | |||
| 1022 | Ga0070717_10709825 | |||
| 1023 | Ga0070715_10000913 | |||
| 1024 | Ga0070716_100009358 | |||
| 1025 | Ga0070712_100079806 | |||
| 1026 | Ga0097621_100698329 | |||
| 1027 | Ga0075433_10204649 | |||
| 1028 | Ga0075434_100228629 | |||
| 1029 | Ga0075434_100656827 | |||
| 1030 | Ga0075434_101518093 | |||
| 1031 | Ga0068865_100387794 | |||
| 1032 | Ga0075435_100232637 | |||
| 1033 | Ga0075435_100654786 | |||
| 1034 | Ga0105240_10044922 | |||
| 1035 | Ga0105240_10141561 | |||
| 1036 | Ga0105240_10142362 | |||
| 1037 | Ga0105240_10272459 | |||
| 1038 | Ga0105240_10408980 | |||
| 1039 | Ga0105240_10513146 | |||
| 1040 | Ga0105240_11062221 | |||
| 1041 | Ga0105240_11835238 | |||
| 1042 | Ga0105240_12125815 | |||
| 1043 | Ga0111539_10189352 | |||
| 1044 | Ga0111539_10836222 | |||
| 1045 | Ga0105245_10072323 | |||
| 1046 | Ga0105245_10728912 | |||
| 1047 | Ga0105245_10798624 | |||
| 1048 | Ga0105243_10686974 | |||
| 1049 | Ga0105241_10350360 | |||
| 1050 | Ga0105241_12199504 | |||
| 1051 | Ga0105242_10052199 | |||
| 1052 | Ga0105237_10021997 | |||
| 1053 | Ga0105237_10053974 | |||
| 1054 | Ga0105237_11700849 | |||
| 1055 | Ga0105237_11820802 | |||
| 1056 | Ga0105238_10042846 | |||
| 1057 | Ga0105238_10134415 | |||
| 1058 | Ga0105238_10696070 | |||
| 1059 | Ga0105238_11815757 | |||
| 1060 | Ga0105239_10095199 | |||
| 1061 | Ga0105239_10228079 | |||
| 1062 | Ga0105246_10240014 | |||
| 1063 | Ga0105246_10681044 | |||
| 1064 | Ga0157373_10198661 | |||
| 1065 | Ga0157373_10311830 | |||
| 1066 | Ga0157373_10448121 | |||
| 1067 | Ga0157370_10012542 | |||
| 1068 | Ga0157370_10016007 | |||
| 1069 | Ga0157370_10030932 | |||
| 1070 | Ga0157370_10075505 | |||
| 1071 | Ga0157370_10353586 | |||
| 1072 | Ga0157369_10005342 | |||
| 1073 | Ga0157369_10129010 | |||
| 1074 | Ga0157369_10176788 | |||
| 1075 | Ga0157369_10184569 | |||
| 1076 | Ga0157369_10194671 | |||
| 1077 | Ga0157369_10710497 | |||
| 1078 | Ga0157369_11370811 | |||
| 1079 | Ga0157374_10029179 | |||
| 1080 | Ga0157374_10069343 | |||
| 1081 | Ga0157374_10097387 | |||
| 1082 | Ga0157374_10426933 | |||
| 1083 | Ga0157372_10022568 | |||
| 1084 | Ga0157372_10113951 | |||
| 1085 | Ga0157372_10475734 | |||
| 1086 | Ga0157372_10506450 | |||
| 1087 | Ga0157372_10580893 | |||
| 1088 | Ga0157372_10629771 | |||
| 1089 | Ga0157372_12404605 | |||
| 1090 | Ga0157375_10265161 | |||
| 1091 | Ga0182008_10026158 | |||
| 1092 | Ga0182008_10555448 | |||
| 1093 | Ga0157377_10478835 | |||
| 1094 | Ga0157376_10043644 | |||
| 1095 | Ga0182007_10146001 | |||
| 1096 | Ga0197907_10009387 | |||
| 1097 | Ga0197907_10041855 | |||
| 1098 | Ga0197907_10515615 | |||
| 1099 | Ga0197907_11062133 | |||
| 1100 | Ga0197907_11071902 | |||
| 1101 | Ga0206356_10187915 | |||
| 1102 | Ga0206356_10258522 | |||
| 1103 | Ga0206356_10281124 | |||
| 1104 | Ga0206356_11112730 | |||
| 1105 | Ga0206356_11608284 | |||
| 1106 | Ga0206356_11868100 | |||
| 1107 | Ga0206356_11892701 | |||
| 1108 | Ga0206349_1136107 | |||
| 1109 | Ga0206351_10651009 | |||
| 1110 | Ga0206352_10674157 | |||
| 1111 | Ga0206350_10519715 | |||
| 1112 | Ga0206350_10557578 | |||
| 1113 | Ga0206350_11657286 | |||
| 1114 | Ga0206354_10183692 | |||
| 1115 | Ga0206354_10237964 | |||
| 1116 | Ga0206354_10488364 | |||
| 1117 | Ga0206354_10830731 | |||
| 1118 | Ga0206354_11689399 | |||
| 1119 | Ga0206353_10888591 | |||
| 1120 | Ga0206353_11019404 | |||
| 1121 | Ga0206353_11100058 | |||
| 1122 | Ga0206353_11705978 | |||
| 1123 | Ga0206353_11757538 | |||
| 1124 | Ga0206353_11821296 | |||
| 1125 | Ga0206353_11914856 | |||
| 1126 | Ga0154015_1030712 | |||
| 1127 | Ga0224712_10060128 | |||
| 1128 | Ga0224712_10344249 | |||
| 1129 | Ga0207692_10217726 | |||
| 1130 | Ga0207710_10678221 | |||
| 1131 | Ga0207685_10060306 | |||
| 1132 | Ga0207699_10084519 | |||
| 1133 | Ga0207699_10254141 | |||
| 1134 | Ga0207643_10252636 | |||
| 1135 | Ga0207705_10039578 | |||
| 1136 | Ga0207705_10105627 | |||
| 1137 | Ga0207705_10171817 | |||
| 1138 | Ga0207705_10452921 | |||
| 1139 | Ga0207684_10369515 | |||
| 1140 | Ga0207707_10033222 | |||
| 1141 | Ga0207707_10065998 | |||
| 1142 | Ga0207707_10136123 | |||
| 1143 | Ga0207707_10209062 | |||
| 1144 | Ga0207707_10233985 | |||
| 1145 | Ga0207707_10423307 | |||
| 1146 | Ga0207695_10174628 | |||
| 1147 | Ga0207695_10210584 | |||
| 1148 | Ga0207695_10224332 | |||
| 1149 | Ga0207695_10476269 | |||
| 1150 | Ga0207695_11083594 | |||
| 1151 | Ga0207671_11230119 | |||
| 1152 | Ga0207693_10002991 | |||
| 1153 | Ga0207693_10199885 | |||
| 1154 | Ga0207693_10523851 | |||
| 1155 | Ga0207663_10010865 | |||
| 1156 | Ga0207660_10005003 | |||
| 1157 | Ga0207660_10086052 | |||
| 1158 | Ga0207660_10207281 | |||
| 1159 | Ga0207660_10326356 | |||
| 1160 | Ga0207660_10340579 | |||
| 1161 | Ga0207660_10641559 | |||
| 1162 | Ga0207657_10002763 | |||
| 1163 | Ga0207657_10003362 | |||
| 1164 | Ga0207657_10003801 | |||
| 1165 | Ga0207657_10004114 | |||
| 1166 | Ga0207657_10007860 | |||
| 1167 | Ga0207657_10008349 | |||
| 1168 | Ga0207657_10063332 | |||
| 1169 | Ga0207657_10147158 | |||
| 1170 | Ga0207649_10031406 | |||
| 1171 | Ga0207649_10178078 | |||
| 1172 | Ga0207649_10336006 | |||
| 1173 | Ga0207649_11196526 | |||
| 1174 | Ga0207652_10053734 | |||
| 1175 | Ga0207652_10068716 | |||
| 1176 | Ga0207652_10075250 | |||
| 1177 | Ga0207652_10163860 | |||
| 1178 | Ga0207652_10176663 | |||
| 1179 | Ga0207652_10292513 | |||
| 1180 | Ga0207652_10349085 | |||
| 1181 | Ga0207652_10360486 | |||
| 1182 | Ga0207652_10381876 | |||
| 1183 | Ga0207652_10482469 | |||
| 1184 | Ga0207652_10590479 | |||
| 1185 | Ga0207652_11086102 | |||
| 1186 | Ga0207652_11173158 | |||
| 1187 | Ga0207646_10000835 | |||
| 1188 | Ga0207646_10086919 | |||
| 1189 | Ga0207646_10829419 | |||
| 1190 | Ga0207694_10148986 | |||
| 1191 | Ga0207694_10402406 | |||
| 1192 | Ga0207694_11009869 | |||
| 1193 | Ga0207687_10556110 | |||
| 1194 | Ga0207700_10612943 | |||
| 1195 | Ga0207700_11345898 | |||
| 1196 | Ga0207664_10006174 | |||
| 1197 | Ga0207664_10032905 | |||
| 1198 | Ga0207664_10120046 | |||
| 1199 | Ga0207664_10360431 | |||
| 1200 | Ga0207664_10702488 | |||
| 1201 | Ga0207664_11011090 | |||
| 1202 | Ga0207690_10110817 | |||
| 1203 | Ga0207690_10163561 | |||
| 1204 | Ga0207704_10251053 | |||
| 1205 | Ga0207665_10000336 | |||
| 1206 | Ga0207665_10200240 | |||
| 1207 | Ga0207691_10736099 | |||
| 1208 | Ga0207661_10008269 | |||
| 1209 | Ga0207661_10057448 | |||
| 1210 | Ga0207661_10075517 | |||
| 1211 | Ga0207661_10082548 | |||
| 1212 | Ga0207661_10171821 | |||
| 1213 | Ga0207661_10244185 | |||
| 1214 | Ga0207661_10245921 | |||
| 1215 | Ga0207661_10401511 | |||
| 1216 | Ga0207661_10452771 | |||
| 1217 | Ga0207679_11091235 | |||
| 1218 | Ga0207667_10038453 | |||
| 1219 | Ga0207667_10292628 | |||
| 1220 | Ga0207667_10312245 | |||
| 1221 | Ga0207667_10442537 | |||
| 1222 | Ga0207667_10552813 | |||
| 1223 | Ga0207667_11166048 | |||
| 1224 | Ga0207640_10467711 | |||
| 1225 | Ga0207708_10998272 | |||
| 1226 | Ga0207702_10019232 | |||
| 1227 | Ga0207702_10147056 | |||
| 1228 | Ga0207702_10169434 | |||
| 1229 | Ga0207702_11729690 | |||
| 1230 | Ga0207702_12439155 | |||
| 1231 | Ga0207648_10340201 | |||
| 1232 | Ga0207648_10934923 | |||
| 1233 | Ga0207674_10250614 | |||
| 1234 | Ga0207674_10428898 | |||
| 1235 | Ga0207698_10142799 | |||
| 1236 | Ga0207698_10186349 | |||
| 1237 | Ga0207698_10257913 | |||
| 1238 | Ga0207698_10669165 | |||
| 1239 | Ga0268266_10164982 | |||
| 1240 | Ga0265319_1001384 | |||
| 1241 | Ga0265319_1013771 | |||
| 1242 | Ga0265319_1151353 | |||
| 1243 | Ga0265334_10016813 | |||
| 1244 | Ga0265334_10021458 | |||
| 1245 | Ga0265318_10000657 | |||
| 1246 | Ga0265318_10001537 | |||
| 1247 | Ga0265318_10050008 | |||
| 1248 | Ga0265318_10064817 | |||
| 1249 | Ga0265322_10034042 | |||
| 1250 | Ga0265322_10076010 | |||
| 1251 | Ga0265336_10013279 | |||
| 1252 | Ga0265336_10056286 | |||
| 1253 | Ga0265338_10003688 | |||
| 1254 | Ga0265338_10005979 | |||
| 1255 | Ga0265338_10038481 | |||
| 1256 | Ga0265338_10111325 | |||
| 1257 | Ga0265338_10160831 | |||
| 1258 | Ga0265338_10194067 | |||
| 1259 | Ga0265338_10574786 | |||
| 1260 | Ga0265338_10741062 | |||
| 1261 | Ga0265324_10037517 | |||
| 1262 | Ga0265330_10000672 | |||
| 1263 | Ga0265330_10038951 | |||
| 1264 | Ga0265332_10003607 | |||
| 1265 | Ga0265328_10001789 | |||
| 1266 | Ga0265328_10069565 | |||
| 1267 | Ga0265320_10009710 | |||
| 1268 | Ga0265320_10020029 | |||
| 1269 | Ga0265320_10122018 | |||
| 1270 | Ga0265325_10001475 | |||
| 1271 | Ga0265329_10014857 | |||
| 1272 | Ga0265340_10001171 | |||
| 1273 | Ga0265340_10046505 | |||
| 1274 | Ga0265340_10076072 | |||
| 1275 | Ga0265339_10007738 | |||
| 1276 | Ga0265339_10261350 | |||
| 1277 | Ga0265331_10002439 | |||
| 1278 | Ga0265331_10043661 | |||
| 1279 | Ga0265327_10004284 | |||
| 1280 | Ga0265327_10010298 | |||
| 1281 | Ga0265327_10014563 | |||
| 1282 | Ga0265327_10035657 | |||
| 1283 | Ga0265327_10075211 | |||
| 1284 | Ga0265316_10004219 | |||
| 1285 | Ga0265316_10009220 | |||
| 1286 | Ga0265316_10302089 | |||
| 1287 | Ga0307408_100396580 | |||
| 1288 | Ga0307408_101242320 | |||
| 1289 | Ga0265313_10003136 | |||
| 1290 | Ga0265313_10009194 | |||
| 1291 | Ga0265314_10003360 | |||
| 1292 | Ga0265314_10007017 | |||
| 1293 | Ga0265314_10017989 | |||
| 1294 | Ga0265314_10330852 | |||
| 1295 | Ga0265342_10002099 | |||
| 1296 | Ga0307409_100266527 | |||
| 1297 | Ga0307416_100038804 | |||
| 1298 | Ga0307416_100074266 | |||
| 1299 | Ga0307416_101130573 | |||
| 1300 | Ga0307415_100139056 | |||
| 1301 | Ga0307415_100147699 | |||
| 1302 | Ga0307415_101036624 | |||
| 1303 | Ga0307415_101527920 | |||
| 1304 | Ga0316593_10346592 | |||
| 1305 | Ga0373950_0070141 | |||
| 1306 | Ga0373926_0049284 | |||
| 1307 | Ga0373940_0037706 | |||
| 1308 | Ga0373944_0006773 | |||
| 1309 | Ga0373944_0064161 | |||
| 1310 | Ga0373949_0101143 | |||
| 1311 | Ga0373936_0056343 | |||
| 1312 | Ga0373945_0017335 | |||
| 1313 | Ga0373953_0070444 | |||
| 1314 | Ga0373954_0206208 | |||
| 1315 | Ga0373943_0000829 | |||
| 1316 | Ga0373943_0036518 | |||
| 1317 | Ga0373943_0095875 | |||
| 1318 | Ga0373955_0195257 | |||
| 1319 | Ga0373942_0142849 | |||
| 1320 | Ga0373931_0008030 | |||
| 1321 | Ga0373935_0128514 | |||
| 1322 | Ga0373935_0305804 | |||
| 1323 | Ga0373927_0019664 | |||
| 1324 | Ga0373927_0054110 | |||
| 1325 | Ga0373927_0268582 | |||
| 1326 | Ga0373933_0026041 | |||
| 1327 | Ga0373947_0000984 | |||
| 1328 | Ga0373947_0010822 | |||
| 1329 | Ga0373937_0046778 | |||
| 1330 | Ga0373937_0227002 | |||
| 1331 | Ga0373937_0763600 | |||
| 1332 | Ga0373925_0009937 | |||
| 1333 | Ga0373925_0024098 | |||
| 1334 | Ga0395899_0021325 | |||
| 1335 | Ga0395899_0031616 | |||
| 1336 | Ga0395899_0052522 | |||
| 1337 | Ga0395899_0123867 | |||
| 1338 | Ga0395899_0180565 | |||
| 1339 | Ga0395900_0003871 | |||
| 1340 | Ga0395900_0047074 | |||
| 1341 | Ga0395900_0100506 | |||
| 1342 | Ga0395900_0148192 | |||
| 1343 | Ga0395900_0155976 | |||
| 1344 | Ga0395900_0160906 | |||
| 1345 | Ga0395900_0247475 | |||
| 1346 | Ga0395900_0316345 | |||
| 1347 | Ga0395900_0399633 | |||
| 1348 | Ga0395900_0400417 | |||
| 1349 | Ga0395900_0454870 | |||
| 1350 | Ga0395900_0890565 | |||
| 1351 | Ga0395898_0012460 | |||
| 1352 | Ga0395898_0026181 | |||
| 1353 | Ga0395898_0050440 | |||
| 1354 | Ga0395898_0057630 | |||
| 1355 | Ga0395898_0154285 | |||
| 1356 | Ga0395898_0280150 | |||
| 1357 | Ga0395898_0580842 | |||
| 1358 | Ga0395898_0667204 | |||
| 1359 | Ga0395898_0759652 | |||
| 1360 | Ga0395905_0023831 | |||
| 1361 | Ga0395905_0078030 | |||
| 1362 | Ga0395905_0152407 | |||
| 1363 | Ga0395905_0271506 | |||
| 1364 | Ga0395905_0412289 | |||
| 1365 | Ga0395905_0502317 | |||
| 1366 | Ga0436364_0876689 | |||
| 1367 | Ga0395901_0008826 | |||
| 1368 | Ga0395901_0016696 | |||
| 1369 | Ga0395901_0035865 | |||
| 1370 | Ga0395901_0168287 | |||
| 1371 | Ga0395901_0430493 | |||
| 1372 | Ga0395901_0751132 | |||
| 1373 | Ga0395901_0916062 | |||
| 1374 | Ga0395901_0978537 | |||
| 1375 | Ga0436365_1128087 | |||
| 1376 | Ga0436365_1495102 | |||
| 1377 | Ga0436365_1706016 | |||
| 1378 | Ga0436360_0298578 | |||
| 1379 | Ga0436360_0668708 | |||
| 1380 | Ga0436360_0980384 | |||
| 1381 | Ga0436363_1711709 | |||
| 1382 | Ga0439461_0012117 | |||
| 1383 | Ga0451835_0412462 | |||
| 1384 | Ga0451845_0599224 | |||
| 1385 | Ga0439433_0056594 | |||
| 1386 | Ga0439448_0147590 | |||
| 1387 | Ga0439462_0045384 | |||
| 1388 | Ga0439446_0103117 | |||
| 1389 | Ga0439434_0131938 | |||
| 1390 | Ga0439434_0287981 | |||
| 1391 | Ga0439435_0090733 | |||
| 1392 | Ga0450918_041876 | |||
| 1393 | Ga0466969_0000388 | |||
| 1394 | Ga0466969_0051427 | |||
| 1395 | Ga0466972_0096198 | |||
| 1396 | Ga0466972_0416872 | |||
| 1397 | Ga0466965_0077580 | |||
| 1398 | Ga0466965_0144400 | |||
| 1399 | Ga0466966_0024715 | |||
| 1400 | Ga0466966_0070776 | |||
| 1401 | Ga0466966_0158964 | |||
| 1402 | Ga0466966_0363076 | |||
| 1403 | Ga0466966_0424790 | |||
| 1404 | Ga0466961_0008115 | |||
| 1405 | Ga0466961_0032291 | |||
| 1406 | Ga0466961_0049430 | |||
| 1407 | Ga0466961_0058747 | |||
| 1408 | Ga0466961_0096972 | |||
| 1409 | Ga0466961_0126748 | |||
| 1410 | Ga0466961_0445125 | |||
| 1411 | Ga0466961_0458499 | |||
| 1412 | Ga0466963_0000496 | |||
| 1413 | Ga0466963_0004989 | |||
| 1414 | Ga0466963_0007612 | |||
| 1415 | Ga0466963_0012464 | |||
| 1416 | Ga0466963_0016410 | |||
| 1417 | Ga0466963_0027365 | |||
| 1418 | Ga0466963_0029294 | |||
| 1419 | Ga0466963_0046766 | |||
| 1420 | Ga0466963_0052153 | |||
| 1421 | Ga0466963_0086524 | |||
| 1422 | Ga0466963_0161532 | |||
| 1423 | Ga0466963_0336547 | |||
| 1424 | Ga0466963_0515069 | |||
| 1425 | Ga0466963_0924771 | |||
| 1426 | Ga0466964_0009803 | |||
| 1427 | Ga0466964_0108093 | |||
| 1428 | Ga0466964_0327675 | |||
| 1429 | Ga0466971_0000165 | |||
| 1430 | Ga0466971_0006803 | |||
| 1431 | Ga0466971_0018750 | |||
| 1432 | Ga0466971_0034312 | |||
| 1433 | Ga0466971_0137194 | |||
| 1434 | Ga0466971_0172829 | |||
| 1435 | Ga0466971_0219864 | |||
| 1436 | Ga0466971_0227269 | |||
| 1437 | Ga0466968_0004439 | |||
| 1438 | Ga0466968_0004580 | |||
| 1439 | Ga0466968_0005689 | |||
| 1440 | Ga0466968_0027732 | |||
| 1441 | Ga0466968_0054697 | |||
| 1442 | Ga0466968_0303991 | |||
| 1443 | Ga0466968_0475271 | |||
| 1444 | Ga0466970_0052831 | |||
| 1445 | Ga0466970_0611066 | |||
| 1446 | Ga0466957_0001076 | |||
| 1447 | Ga0466957_0012986 | |||
| 1448 | Ga0466957_0053166 | |||
| 1449 | Ga0466957_0059241 | |||
| 1450 | Ga0466957_0092321 | |||
| 1451 | Ga0466959_0021447 | |||
| 1452 | Ga0466959_0022495 | |||
| 1453 | Ga0466959_0052831 | |||
| 1454 | Ga0466959_0193666 | |||
| 1455 | Ga0466959_0240095 | |||
| 1456 | Ga0466959_0265075 | |||
| 1457 | Ga0466959_0427263 | |||
| 1458 | Ga0451576_0131220 | |||
| 1459 | Ga0451576_0558524 | |||
| 1460 | Ga0466958_0000198 | |||
| 1461 | Ga0466958_0010251 | |||
| 1462 | Ga0466958_0013940 | |||
| 1463 | Ga0466958_0017255 | |||
| 1464 | Ga0466958_0017496 | |||
| 1465 | Ga0466958_0021576 | |||
| 1466 | Ga0466958_0057947 | |||
| 1467 | Ga0466958_0069822 | |||
| 1468 | Ga0466958_0207928 | |||
| 1469 | Ga0466958_0313896 | |||
| 1470 | Ga0466958_0796595 | |||
| 1471 | Ga0466967_0000179 | |||
| 1472 | Ga0466967_0004681 | |||
| 1473 | Ga0466967_0010812 | |||
| 1474 | Ga0466967_0012007 | |||
| 1475 | Ga0466967_0012286 | |||
| 1476 | Ga0466967_0016889 | |||
| 1477 | Ga0466967_0034468 | |||
| 1478 | Ga0466967_0035396 | |||
| 1479 | Ga0466967_0050261 | |||
| 1480 | Ga0466967_0058719 | |||
| 1481 | Ga0466967_0106170 | |||
| 1482 | Ga0466967_0125599 | |||
| 1483 | Ga0466967_0177980 | |||
| 1484 | Ga0466967_0203593 | |||
| 1485 | Ga0466967_0215260 | |||
| 1486 | Ga0466967_0401429 | |||
| 1487 | Ga0466967_0452035 | |||
| 1488 | Ga0466967_0470092 | |||
| 1489 | Ga0466967_0488172 | |||
| 1490 | Ga0466967_0505462 | |||
| 1491 | Ga0466967_0575358 | |||
| 1492 | Ga0466967_0835861 | |||
| 1493 | Ga0466967_0987400 | |||
| 1494 | Ga0495627_178389 | |||
| 1495 | Ga0495592_0148502 | |||
| 1496 | Ga0495603_0024362 | |||
| 1497 | Ga0495603_0103167 | |||
| 1498 | Ga0495603_0304809 | |||
| 1499 | Ga0495629_0007857 | |||
| 1500 | Ga0495629_0010312 | |||
| 1501 | Ga0495641_0004552 | |||
| 1502 | Ga0495641_0005759 | |||
| 1503 | Ga0495641_0312811 | |||
| 1504 | Ga0495651_0035126 | |||
| 1505 | Ga0495651_0066163 | |||
| 1506 | Ga0495651_0597939 | |||
| 1507 | Ga0495653_0024531 | |||
| 1508 | Ga0495653_0029554 | |||
| 1509 | Ga0495653_0067957 | |||
| 1510 | Ga0495653_0084567 | |||
| 1511 | Ga0495653_0103363 | |||
| 1512 | Ga0495653_0207592 | |||
| 1513 | Ga0495653_0234166 | |||
| 1514 | Ga0495653_0410068 | |||
| 1515 | Ga0495580_0023610 | |||
| 1516 | Ga0495582_0005237 | |||
| 1517 | Ga0495582_0033438 | |||
| 1518 | Ga0495639_0012174 | |||
| 1519 | Ga0495662_0002311 | |||
| 1520 | Ga0495664_0028844 | |||
| 1521 | Ga0495664_0443283 | |||
| 1522 | Ga0495664_0775003 | |||
| 1523 | Ga0495584_0019722 | |||
| 1524 | Ga0495585_0049390 | |||
| 1525 | Ga0495608_0028929 | |||
| 1526 | Ga0495608_0047179 | |||
| 1527 | Ga0495608_0141142 | |||
| 1528 | Ga0495608_0216183 | |||
| 1529 | Ga0495618_0033708 | |||
| 1530 | Ga0495618_0064325 | |||
| 1531 | Ga0495618_0693419 | |||
| 1532 | Ga0495628_0141693 | |||
| 1533 | Ga0495630_0014476 | |||
| 1534 | Ga0495630_0024352 | |||
| 1535 | Ga0495630_0026574 | |||
| 1536 | Ga0495630_0078367 | |||
| 1537 | Ga0495630_0487330 | |||
| 1538 | Ga0495630_0496231 | |||
| 1539 | Ga0495630_0568596 | |||
| 1540 | Ga0495637_0078988 | |||
| 1541 | Ga0495644_0003489 | |||
| 1542 | Ga0495644_0184684 | |||
| 1543 | Ga0495666_0000649 | |||
| 1544 | Ga0495642_0072159 | |||
| 1545 | Ga0495652_0045044 | |||
| 1546 | Ga0495652_0165994 | |||
| 1547 | Ga0495652_0322946 | |||
| 1548 | Ga0495665_0002189 | |||
| 1549 | Ga0495640_0024397 | |||
| 1550 | Ga0495640_0073224 | |||
| 1551 | Ga0495640_0100577 | |||
| 1552 | Ga0495640_0250586 | |||
| 1553 | Ga0495586_0019241 | |||
| 1554 | Ga0495586_0021041 | |||
| 1555 | Ga0495586_0030331 | |||
| 1556 | Ga0495645_0041106 | |||
| 1557 | Ga0495645_0273687 | |||
| 1558 | Ga0495667_0152910 | |||
| 1559 | Ga0495656_0284329 | |||
| 1560 | Ga0495668_0301998 | |||
| 1561 | Ga0495634_0027714 | |||
| 1562 | Ga0495634_0041481 | |||
| 1563 | Ga0495634_0098872 | |||
| 1564 | Ga0495634_0099298 | |||
| 1565 | Ga0495634_0153216 | |||
| 1566 | Ga0495634_0200483 | |||
| 1567 | Ga0495634_0787512 | |||
| 1568 | Ga0495611_0507350 | |||
| 1569 | Ga0495635_0016327 | |||
| 1570 | Ga0495635_0043606 | |||
| 1571 | Ga0495635_0303154 | |||
| 1572 | Ga0495659_0022974 | |||
| 1573 | Ga0495657_0023514 | |||
| 1574 | Ga0495657_0056134 | |||
| 1575 | Ga0495657_0153958 | |||
| 1576 | Ga0495657_0225684 | |||
| 1577 | Ga0495599_0002999 | |||
| 1578 | Ga0495599_0448727 | |||
| 1579 | Ga0495646_0053036 | |||
| 1580 | Ga0495647_0000558 | |||
| 1581 | Ga0495647_0034053 | |||
| 1582 | Ga0495647_0057849 | |||
| 1583 | Ga0495658_0004841 | |||
| 1584 | Ga0495658_0032586 | |||
| 1585 | Ga0495658_0210600 | |||
| 1586 | Ga0495669_0357859 | |||
| 1587 | Ga0495613_0006480 | |||
| 1588 | Ga0495613_0018612 | |||
| 1589 | Ga0495613_0159840 | |||
| 1590 | Ga0495613_0221746 | |||
| 1591 | Ga0495624_0003577 | |||
| 1592 | Ga0495624_0028867 | |||
| 1593 | Ga0495624_0081689 | |||
| 1594 | Ga0495624_0154900 | |||
| 1595 | Ga0495624_0208184 | |||
| 1596 | Ga0495624_0600804 | |||
| 1597 | Ga0495600_0022360 | |||
| 1598 | Ga0495600_0363851 | |||
| 1599 | Ga0495600_0396020 | |||
| 1600 | Ga0495600_0419670 | |||
| 1601 | Ga0495581_0002674 | |||
| 1602 | Ga0495581_0066870 | |||
| 1603 | Ga0495604_0115700 | |||
| 1604 | Ga0495604_0156176 | |||
| 1605 | Ga0495604_0217466 | |||
| 1606 | Ga0495674_0100783 | |||
| 1607 | Ga0495674_0117974 | |||
| 1608 | Ga0495676_0002388 | |||
| 1609 | Ga0495676_0182585 | |||
| 1610 | Ga0495676_0573726 | |||
| 1611 | Ga0495680_0002404 | |||
| 1612 | Ga0495680_0035961 | |||
| 1613 | Ga0495680_0151250 | |||
| 1614 | Ga0495680_0225414 | |||
| 1615 | Ga0495680_0313835 | |||
| 1616 | Ga0495680_0734836 | |||
| 1617 | Ga0495675_0023867 | |||
| 1618 | Ga0495675_0220301 | |||
| 1619 | Ga0495679_072161 | |||
| 1620 | Ga0495685_093090 | |||
| 1621 | Ga0495684_0043631 | |||
| 1622 | Ga0495684_0162401 | |||
| 1623 | Ga0495684_0193398 | |||
| 1624 | Ga0495684_0244796 | |||
| 1625 | Ga0495684_0360292 | |||
| 1626 | Ga0495593_0008342 | |||
| 1627 | Ga0495593_0030005 | |||
| 1628 | Ga0495602_0029426 | |||
| 1629 | Ga0495602_0322921 | |||
| 1630 | Ga0495614_0006474 | |||
| 1631 | Ga0495614_0285191 | |||
| 1632 | Ga0495615_0277824 | |||
| 1633 | Ga0496100_0004732 | |||
| 1634 | Ga0496100_0103592 | |||
| 1635 | Ga0496100_0123805 | |||
| 1636 | Ga0496100_0589973 | |||
| 1637 | Ga0496101_0053116 | |||
| 1638 | Ga0496101_0156161 | |||
| 1639 | Ga0496101_0217355 | |||
| 1640 | Ga0496101_0277742 | |||
| 1641 | Ga0496101_0778275 | |||
| 1642 | Ga0496101_1135061 | |||
| 1643 | Ga0496102_0029581 | |||
| 1644 | Ga0496102_0092424 | |||
| 1645 | Ga0496102_0341605 | |||
| 1646 | Ga0496103_0013174 | |||
| 1647 | Ga0496103_0164925 | |||
| 1648 | Ga0496103_0192473 | |||
| 1649 | Ga0496103_0209671 | |||
| 1650 | Ga0496104_0009204 | |||
| 1651 | Ga0496104_0132100 | |||
| 1652 | Ga0496104_0325131 | |||
| 1653 | Ga0496104_0434813 | |||
| 1654 | Ga0496104_0494286 | |||
| 1655 | Ga0496104_0530922 | |||
| 1656 | Ga0496104_1477150 | |||
| 1657 | Ga0496105_0022782 | |||
| 1658 | Ga0496105_0077056 | |||
| 1659 | Ga0496105_0524005 | |||
| 1660 | Ga0496105_0861945 | |||
| 1661 | Ga0496106_0006958 | |||
| 1662 | Ga0496106_0010051 | |||
| 1663 | Ga0496106_0033698 | |||
| 1664 | Ga0496106_0042412 | |||
| 1665 | Ga0496106_0323039 | |||
| 1666 | Ga0496107_0019319 | |||
| 1667 | Ga0496107_0054955 | |||
| 1668 | Ga0496107_0080978 | |||
| 1669 | Ga0496107_0173684 | |||
| 1670 | Ga0496107_0238174 | |||
| 1671 | Ga0496108_0001322 | |||
| 1672 | Ga0496108_0008941 | |||
| 1673 | Ga0496108_0018951 | |||
| 1674 | Ga0496108_0135626 | |||
| 1675 | Ga0496108_0275493 | |||
| 1676 | Ga0496109_0004720 | |||
| 1677 | Ga0496109_0356659 | |||
| 1678 | Ga0496109_0375810 | |||
| 1679 | Ga0496109_0677365 | |||
| 1680 | Ga0496109_0804363 | |||
| 1681 | Ga0496109_1043269 | |||
| 1682 | Ga0496109_1267216 | |||
| 1683 | Ga0496110_0000279 | |||
| 1684 | Ga0496110_0009338 | |||
| 1685 | Ga0496110_0015765 | |||
| 1686 | Ga0496110_0357216 | |||
| 1687 | Ga0496110_0413902 | |||
| 1688 | Ga0496111_0000545 | |||
| 1689 | Ga0496111_0169482 | |||
| 1690 | Ga0496111_0209165 | |||
| 1691 | Ga0496112_0011241 | |||
| 1692 | Ga0496112_0031813 | |||
| 1693 | Ga0496112_0032075 | |||
| 1694 | Ga0496112_0036838 | |||
| 1695 | Ga0496112_0080753 | |||
| 1696 | Ga0496112_0232758 | |||
| 1697 | Ga0496112_0234587 | |||
| 1698 | Ga0496112_0247276 | |||
| 1699 | Ga0496112_0297050 | |||
| 1700 | Ga0496112_0359563 | |||
| 1701 | Ga0496112_0440185 | |||
| 1702 | Ga0496112_0791168 | |||
| 1703 | Ga0496112_1035970 | |||
| 1704 | Ga0496112_1194797 | |||
| 1705 | Ga0496113_0046676 | |||
| 1706 | Ga0496113_0059245 | |||
| 1707 | Ga0496113_0124315 | |||
| 1708 | Ga0496113_0579559 | |||
| 1709 | Ga0496113_1053668 | |||
| 1710 | Ga0496114_0004356 | |||
| 1711 | Ga0496114_0008653 | |||
| 1712 | Ga0496114_0436270 | |||
| 1713 | Ga0496115_0061455 | |||
| 1714 | Ga0496115_0089319 | |||
| 1715 | Ga0496115_0422524 | |||
| 1716 | Ga0501032_0704498 | |||
| 1717 | Ga0501034_0136755 | |||
| 1718 | Ga0501040_0012822 | |||
| 1719 | Ga0501040_0055003 | |||
| 1720 | Ga0501040_0533133 | |||
| 1721 | Ga0501041_0571423 | |||
| 1722 | Ga0501042_0364931 | |||
| 1723 | Ga0501046_0557824 | |||
| 1724 | Ga0501046_0566451 | |||
| 1725 | Ga0501047_0192221 | |||
| 1726 | Ga0501047_0802157 | |||
| 1727 | Ga0501067_0001025 | |||
| 1728 | Ga0501067_0150337 | |||
| 1729 | Ga0501069_0003321 | |||
| 1730 | Ga0501070_0096886 | |||
| 1731 | Ga0501070_0206256 | |||
| 1732 | Ga0501072_0622635 | |||
| 1733 | Ga0501073_0046169 | |||
| 1734 | Ga0501074_0024761 | |||
| 1735 | Ga0501076_0484631 | |||
| 1736 | Ga0501077_0130384 | |||
| 1737 | Ga0501079_0538582 | |||
| 1738 | Ga0501080_0026200 | |||
| 1739 | Ga0501045_0345198 | |||
| 1740 | nmdc:mga08y16_956291_c1 | |||
| 1741 | nmdc:mga0n895_103855_c1 | |||
| 1742 | nmdc:mga0rr50_156168_c1 | |||
| 1743 | nmdc:mga0a205_170661_c1 | |||
| 1744 | Ga0495601_0006704 | |||
| 1745 | Ga0495601_0196025 | |||
| 1746 | Ga0495612_0001091 | |||
| 1747 | Ga0495612_0180209 | |||
| 1748 | Ga0495655_0149229 | |||
| 1749 | Ga0495595_0032786 | |||
| 1750 | Ga0495595_0044461 | |||
| 1751 | Ga0495595_0109100 | |||
| 1752 | Ga0495619_0034198 | |||
| 1753 | Ga0495619_0046079 | |||
| 1754 | Ga0495619_0054108 | |||
| 1755 | Ga0495619_0120095 | |||
| 1756 | Ga0495619_0282476 | |||
| 1757 | Ga0500566_0098325 | |||
| 1758 | Ga0590071_140344 | |||
| 1759 | Ga0590075_007359 | |||
| 1760 | Ga0501082_0228144 | |||
| 1761 | Ga0466962_0000618 | |||
| 1762 | Ga0466962_0006173 | |||
| 1763 | Ga0466962_0045074 | |||
| 1764 | Ga0466962_0199984 | |||
| 1765 | Ga0466962_0339949 | |||
| 1766 | Ga0466962_0500409 | |||
| 1767 | Ga0466962_0563281 | |||
| 1768 | Ga0530510_0009967 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5iph-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - c84s mutant | 0.9526 | 11 | 151 |
| 5io2-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - c48s mutant | 0.9506 | 11 | 151 |
| 3gkm-assembly1.cif.gz_A | insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures | 0.9492 | 11 | 151 |
| 5enu-assembly2.cif.gz_B | crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria | 0.9467 | 1 | 150 |
| 3ixr-assembly1.cif.gz_A | crystal structure of xylella fastidiosa prxq c47s mutant | 0.9436 | 1 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G280_3_151_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9701 | 3 | 151 | 3.40.30.10 |
| af_P0AE52_4_156_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9696 | 2 | 151 | 3.40.30.10 |
| af_Q2G280_3_151_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9638 | 3 | 151 | 3.40.30.10 |
| af_Q55E48_3_135_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.959 | 1 | 134 | 3.40.30.10 |
| 5iphA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9526 | 11 | 151 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F8SL95-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.991 | 2 | 129 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A432TGI5-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) | 0.9904 | 1 | 91 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A3M1LPF9-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9879 | 2 | 151 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A2E1M849-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9856 | 1 | 86 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A838F4Z2-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9837 | 1 | 151 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |