F484640

General Info

Members Datasets Scaffolds Average Seq Length
884 299 1768 153

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0213375|Ga0495651_0213375_862_1284
Length 140
Sequence MVEEGKPAPDFELKSDSGETVKLSDLRGKQVVLYFYPKDDTPGCTTQACGIRDAYGEFEDERSHVEFKQKYELPFALLADVDHSVAEDYGVWVEKSYAGKKYLGVARSTFVIAEDGTIKRAIHDVKPDSHADDVLETLRS

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
172 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
173 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
174 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
245 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
295 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 4.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 9.39
Rhizosphere 89.71
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0213375 3300046462 Bacteria 1341
2 Ga0058863_11910037 3300004799 Bacteria 736
3 Ga0058862_12807872 3300004803 Bacteria 1202
4 Ga0070658_10044965 3300005327 Bacteria 3569
5 Ga0070658_10049400 3300005327 Bacteria 3407
6 Ga0070658_10257830 3300005327 Bacteria 1480
7 Ga0070658_10267597 3300005327 Bacteria 1453
8 Ga0070676_11549710 3300005328 Bacteria 511
9 Ga0070683_100006172 3300005329 Bacteria 10050
10 Ga0070683_100032081 3300005329 Bacteria 4781
11 Ga0070683_100044248 3300005329 Bacteria 4105
12 Ga0070683_100062290 3300005329 Bacteria 3468
13 Ga0070683_100103720 3300005329 Bacteria 2680
14 Ga0070683_100108882 3300005329 Bacteria 2613
15 Ga0070683_100285283 3300005329 Bacteria 1571
16 Ga0070683_100296222 3300005329 Bacteria 1539
17 Ga0070683_101203931 3300005329 Bacteria 728
18 Ga0070680_100014485 3300005336 Bacteria 6168
19 Ga0070680_100250951 3300005336 Bacteria 1496
20 Ga0070680_100261994 3300005336 Bacteria 1462
21 Ga0070680_101643982 3300005336 Bacteria 557
22 Ga0070682_100047037 3300005337 Bacteria 2680
23 Ga0070682_100577351 3300005337 Bacteria 884
24 Ga0070682_100991390 3300005337 Bacteria 697
25 Ga0070660_100003458 3300005339 Bacteria 10871
26 Ga0070660_100004868 3300005339 Bacteria 9276
27 Ga0070660_100016665 3300005339 Bacteria 5340
28 Ga0070660_100024280 3300005339 Bacteria 4498
29 Ga0070660_100024290 3300005339 Bacteria 4497
30 Ga0070660_100024497 3300005339 Bacteria 4477
31 Ga0070660_100040297 3300005339 Bacteria 3554
32 Ga0070660_100127570 3300005339 Bacteria 2034
33 Ga0070661_100034760 3300005344 Bacteria 3657
34 Ga0070661_100161475 3300005344 Bacteria 1697
35 Ga0070661_100236906 3300005344 Bacteria 1404
36 Ga0070661_100320473 3300005344 Bacteria 1211
37 Ga0070661_100690736 3300005344 Bacteria 831
38 Ga0070661_100973999 3300005344 Bacteria 703
39 Ga0070692_10101787 3300005345 Bacteria 1576
40 Ga0070675_100877311 3300005354 Bacteria 822
41 Ga0070671_100423705 3300005355 Bacteria 1140
42 Ga0070659_100039235 3300005366 Bacteria 3696
43 Ga0070659_100580276 3300005366 Bacteria 962
44 Ga0070709_10009338 3300005434 Bacteria 5406
45 Ga0070709_10074488 3300005434 Bacteria 2200
46 Ga0070709_10253706 3300005434 Bacteria 1268
47 Ga0070714_100117081 3300005435 Bacteria 2366
48 Ga0070714_100305542 3300005435 Bacteria 1484
49 Ga0070714_100352029 3300005435 Bacteria 1383
50 Ga0070714_100415621 3300005435 Bacteria 1273
51 Ga0070714_101325693 3300005435 Bacteria 703
52 Ga0070714_101741154 3300005435 Bacteria 609
53 Ga0070713_100005892 3300005436 Bacteria 8425
54 Ga0070710_10030936 3300005437 Bacteria 2884
55 Ga0070710_10225923 3300005437 Bacteria 1193
56 Ga0070710_10958211 3300005437 Bacteria 621
57 Ga0070711_100067249 3300005439 Bacteria 2513
58 Ga0070700_100478974 3300005441 Bacteria 953
59 Ga0070708_100006727 3300005445 Bacteria 9154
60 Ga0070708_101705434 3300005445 Bacteria 585
61 Ga0070681_10019025 3300005458 Bacteria 6874
62 Ga0070681_10024922 3300005458 Bacteria 6019
63 Ga0070681_10129972 3300005458 Bacteria 2450
64 Ga0070681_10213474 3300005458 Bacteria 1846
65 Ga0070681_10322083 3300005458 Bacteria 1455
66 Ga0070681_10354634 3300005458 Bacteria 1377
67 Ga0070681_10661414 3300005458 Bacteria 960
68 Ga0070681_10829816 3300005458 Bacteria 842
69 Ga0068867_100949343 3300005459 Bacteria 777
70 Ga0070706_101241462 3300005467 Bacteria 684
71 Ga0070706_101351608 3300005467 Bacteria 653
72 Ga0070707_100000328 3300005468 Bacteria 46683
73 Ga0070707_100116347 3300005468 Bacteria 2595
74 Ga0070707_100665549 3300005468 Bacteria 1004
75 Ga0070698_100099113 3300005471 Bacteria 2887
76 Ga0070698_100215543 3300005471 Archaea 1854
77 Ga0070698_100279610 3300005471 Unclassified 1600
78 Ga0070698_100284890 3300005471 Bacteria 1583
79 Ga0070699_100122865 3300005518 Bacteria 2284
80 Ga0070699_100292820 3300005518 Bacteria 1460
81 Ga0070699_100542705 3300005518 Unclassified 1058
82 Ga0070679_100025308 3300005530 Bacteria 5822
83 Ga0070679_100029750 3300005530 Bacteria 5388
84 Ga0070679_100054350 3300005530 Bacteria 3986
85 Ga0070679_100056642 3300005530 Bacteria 3905
86 Ga0070679_100065935 3300005530 Bacteria 3609
87 Ga0070679_100130752 3300005530 Bacteria 2492
88 Ga0070679_100194174 3300005530 Bacteria 1998
89 Ga0070679_100292201 3300005530 Bacteria 1581
90 Ga0070679_100355960 3300005530 Bacteria 1411
91 Ga0070679_100369841 3300005530 Bacteria 1381
92 Ga0070679_100780161 3300005530 Bacteria 899
93 Ga0070679_100949128 3300005530 Bacteria 804
94 Ga0070684_100001095 3300005535 Bacteria 19436
95 Ga0070684_100007102 3300005535 Bacteria 8703
96 Ga0070684_100008765 3300005535 Bacteria 7930
97 Ga0070684_100024219 3300005535 Bacteria 5089
98 Ga0070684_100172679 3300005535 Bacteria 1963
99 Ga0070684_100372351 3300005535 Bacteria 1315
100 Ga0068853_100218022 3300005539 Bacteria 1741
101 Ga0070695_100765516 3300005545 Bacteria 771
102 Ga0070696_100013480 3300005546 Bacteria 5485
103 Ga0070693_100261354 3300005547 Bacteria 1151
104 Ga0070693_100291319 3300005547 Bacteria 1097
105 Ga0070693_101085586 3300005547 Bacteria 610
106 Ga0070665_100015545 3300005548 Bacteria 7646
107 Ga0070704_100234855 3300005549 Bacteria 1498
108 Ga0068855_100002523 3300005563 Bacteria 22549
109 Ga0068855_100036661 3300005563 Bacteria 5834
110 Ga0068855_100043181 3300005563 Bacteria 5341
111 Ga0068855_100069488 3300005563 Bacteria 4099
112 Ga0068855_100106284 3300005563 Bacteria 3226
113 Ga0068855_100253446 3300005563 Bacteria 1963
114 Ga0068855_100258802 3300005563 Bacteria 1939
115 Ga0068855_100513656 3300005563 Bacteria 1301
116 Ga0070664_101136944 3300005564 Bacteria 736
117 Ga0068857_100148013 3300005577 Bacteria 2125
118 Ga0068854_100407166 3300005578 Bacteria 1127
119 Ga0068856_100049855 3300005614 Bacteria 4127
120 Ga0068856_100059390 3300005614 Bacteria 3778
121 Ga0068856_100067539 3300005614 Bacteria 3533
122 Ga0068856_100084897 3300005614 Bacteria 3145
123 Ga0068856_100178594 3300005614 Bacteria 2135
124 Ga0068856_100393716 3300005614 Bacteria 1405
125 Ga0068856_100495341 3300005614 Bacteria 1243
126 Ga0068856_100533228 3300005614 Bacteria 1195
127 Ga0068856_102660802 3300005614 Bacteria 506
128 Ga0070702_100062886 3300005615 Bacteria 2166
129 Ga0068852_100040177 3300005616 Bacteria 3945
130 Ga0068852_100135685 3300005616 Bacteria 2272
131 Ga0068852_100144161 3300005616 Bacteria 2207
132 Ga0068852_101161862 3300005616 Bacteria 793
133 Ga0068852_101228121 3300005616 Bacteria 771
134 Ga0068852_101564188 3300005616 Bacteria 682
135 Ga0070717_10010696 3300006028 Bacteria 6940
136 Ga0070717_10079145 3300006028 Bacteria 2756
137 Ga0070717_10093185 3300006028 Bacteria 2546
138 Ga0070717_10709825 3300006028 Bacteria 914
139 Ga0070715_10000913 3300006163 Bacteria 8202
140 Ga0070716_100009358 3300006173 Bacteria 4881
141 Ga0070712_100079806 3300006175 Bacteria 2366
142 Ga0097621_100698329 3300006237 Bacteria 934
143 Ga0075433_10204649 3300006852 Bacteria 1754
144 Ga0075434_100228629 3300006871 Bacteria 1880
145 Ga0075434_100656827 3300006871 Bacteria 1067
146 Ga0075434_101518093 3300006871 Bacteria 679
147 Ga0068865_100387794 3300006881 Bacteria 1141
148 Ga0075435_100232637 3300007076 Bacteria 1566
149 Ga0075435_100654786 3300007076 Bacteria 912
150 Ga0105240_10044922 3300009093 Bacteria 5608
151 Ga0105240_10141561 3300009093 Bacteria 2875
152 Ga0105240_10142362 3300009093 Bacteria 2866
153 Ga0105240_10272459 3300009093 Bacteria 1948
154 Ga0105240_10408980 3300009093 Bacteria 1527
155 Ga0105240_10513146 3300009093 Bacteria 1331
156 Ga0105240_11062221 3300009093 Bacteria 863
157 Ga0105240_11835238 3300009093 Bacteria 631
158 Ga0105240_12125815 3300009093 Bacteria 583
159 Ga0111539_10189352 3300009094 Bacteria 2401
160 Ga0111539_10836222 3300009094 Bacteria 1071
161 Ga0105245_10072323 3300009098 Bacteria 3132
162 Ga0105245_10728912 3300009098 Bacteria 1026
163 Ga0105245_10798624 3300009098 Bacteria 982
164 Ga0105243_10686974 3300009148 Bacteria 996
165 Ga0105241_10350360 3300009174 Bacteria 1282
166 Ga0105241_12199504 3300009174 Bacteria 547
167 Ga0105242_10052199 3300009176 Bacteria 3335
168 Ga0105237_10021997 3300009545 Bacteria 6546
169 Ga0105237_10053974 3300009545 Bacteria 4028
170 Ga0105237_11700849 3300009545 Bacteria 638
171 Ga0105237_11820802 3300009545 Bacteria 616
172 Ga0105238_10042846 3300009551 Bacteria 4582
173 Ga0105238_10134415 3300009551 Bacteria 2451
174 Ga0105238_10696070 3300009551 Bacteria 1028
175 Ga0105238_11815757 3300009551 Bacteria 642
176 Ga0105239_10095199 3300010375 Bacteria 3290
177 Ga0105239_10228079 3300010375 Bacteria 2090
178 Ga0105246_10240014 3300011119 Bacteria 1432
179 Ga0105246_10681044 3300011119 Bacteria 899
180 Ga0157373_10198661 3300013100 Bacteria 1414
181 Ga0157373_10311830 3300013100 Bacteria 1118
182 Ga0157373_10448121 3300013100 Bacteria 929
183 Ga0157370_10012542 3300013104 Bacteria 8787
184 Ga0157370_10016007 3300013104 Bacteria 7607
185 Ga0157370_10030932 3300013104 Bacteria 5242
186 Ga0157370_10075505 3300013104 Bacteria 3177
187 Ga0157370_10353586 3300013104 Bacteria 1354
188 Ga0157369_10005342 3300013105 Bacteria 14966
189 Ga0157369_10129010 3300013105 Bacteria 2680
190 Ga0157369_10176788 3300013105 Bacteria 2247
191 Ga0157369_10184569 3300013105 Bacteria 2194
192 Ga0157369_10194671 3300013105 Bacteria 2129
193 Ga0157369_10710497 3300013105 Bacteria 1035
194 Ga0157369_11370811 3300013105 Bacteria 720
195 Ga0157374_10029179 3300013296 Bacteria 4992
196 Ga0157374_10069343 3300013296 Bacteria 3320
197 Ga0157374_10097387 3300013296 Bacteria 2815
198 Ga0157374_10426933 3300013296 Bacteria 1325
199 Ga0157372_10022568 3300013307 Bacteria 6811
200 Ga0157372_10113951 3300013307 Bacteria 3099
201 Ga0157372_10475734 3300013307 Bacteria 1456
202 Ga0157372_10506450 3300013307 Bacteria 1408
203 Ga0157372_10580893 3300013307 Bacteria 1306
204 Ga0157372_10629771 3300013307 Bacteria 1250
205 Ga0157372_12404605 3300013307 Bacteria 605
206 Ga0157375_10265161 3300013308 Bacteria 1879
207 Ga0182008_10026158 3300014497 Bacteria 2959
208 Ga0182008_10555448 3300014497 Bacteria 639
209 Ga0157377_10478835 3300014745 Bacteria 865
210 Ga0157376_10043644 3300014969 Bacteria 3681
211 Ga0182007_10146001 3300015262 Bacteria 802
212 Ga0197907_10009387 3300020069 Bacteria 710
213 Ga0197907_10041855 3300020069 Bacteria 952
214 Ga0197907_10515615 3300020069 Bacteria 2003
215 Ga0197907_11062133 3300020069 Bacteria 944
216 Ga0197907_11071902 3300020069 Bacteria 918
217 Ga0206356_10187915 3300020070 Bacteria 8163
218 Ga0206356_10258522 3300020070 Bacteria 1418
219 Ga0206356_10281124 3300020070 Bacteria 1145
220 Ga0206356_11112730 3300020070 Bacteria 1666
221 Ga0206356_11608284 3300020070 Bacteria 1220
222 Ga0206356_11868100 3300020070 Bacteria 3912
223 Ga0206356_11892701 3300020070 Bacteria 1681
224 Ga0206349_1136107 3300020075 Bacteria 1336
225 Ga0206351_10651009 3300020077 Bacteria 569
226 Ga0206352_10674157 3300020078 Bacteria 720
227 Ga0206350_10519715 3300020080 Bacteria 1711
228 Ga0206350_10557578 3300020080 Bacteria 759
229 Ga0206350_11657286 3300020080 Bacteria 1351
230 Ga0206354_10183692 3300020081 Bacteria 941
231 Ga0206354_10237964 3300020081 Bacteria 2860
232 Ga0206354_10488364 3300020081 Bacteria 1837
233 Ga0206354_10830731 3300020081 Bacteria 2935
234 Ga0206354_11689399 3300020081 Bacteria 764
235 Ga0206353_10888591 3300020082 Bacteria 1044
236 Ga0206353_11019404 3300020082 Bacteria 1245
237 Ga0206353_11100058 3300020082 Bacteria 4994
238 Ga0206353_11705978 3300020082 Bacteria 4600
239 Ga0206353_11757538 3300020082 Bacteria 2186
240 Ga0206353_11821296 3300020082 Bacteria 1701
241 Ga0206353_11914856 3300020082 Bacteria 1756
242 Ga0154015_1030712 3300020610 Bacteria 661
243 Ga0224712_10060128 3300022467 Bacteria 1511
244 Ga0224712_10344249 3300022467 Bacteria 703
245 Ga0207692_10217726 3300025898 Bacteria 1130
246 Ga0207710_10678221 3300025900 Bacteria 540
247 Ga0207685_10060306 3300025905 Bacteria 1500
248 Ga0207699_10084519 3300025906 Bacteria 1977
249 Ga0207699_10254141 3300025906 Bacteria 1212
250 Ga0207643_10252636 3300025908 Bacteria 1086
251 Ga0207705_10039578 3300025909 Bacteria 3379
252 Ga0207705_10105627 3300025909 Bacteria 2076
253 Ga0207705_10171817 3300025909 Bacteria 1632
254 Ga0207705_10452921 3300025909 Bacteria 995
255 Ga0207684_10369515 3300025910 Bacteria 1234
256 Ga0207707_10033222 3300025912 Bacteria 4516
257 Ga0207707_10065998 3300025912 Bacteria 3151
258 Ga0207707_10136123 3300025912 Bacteria 2148
259 Ga0207707_10209062 3300025912 Bacteria 1700
260 Ga0207707_10233985 3300025912 Bacteria 1598
261 Ga0207707_10423307 3300025912 Bacteria 1141
262 Ga0207695_10174628 3300025913 Bacteria 2072
263 Ga0207695_10210584 3300025913 Bacteria 1855
264 Ga0207695_10224332 3300025913 Bacteria 1786
265 Ga0207695_10476269 3300025913 Bacteria 1131
266 Ga0207695_11083594 3300025913 Bacteria 681
267 Ga0207671_11230119 3300025914 Bacteria 585
268 Ga0207693_10002991 3300025915 Bacteria 14628
269 Ga0207693_10199885 3300025915 Bacteria 1572
270 Ga0207693_10523851 3300025915 Unclassified 925
271 Ga0207663_10010865 3300025916 Bacteria 4863
272 Ga0207660_10005003 3300025917 Bacteria 8639
273 Ga0207660_10086052 3300025917 Bacteria 2320
274 Ga0207660_10207281 3300025917 Bacteria 1534
275 Ga0207660_10326356 3300025917 Bacteria 1226
276 Ga0207660_10340579 3300025917 Bacteria 1200
277 Ga0207660_10641559 3300025917 Bacteria 866
278 Ga0207657_10002763 3300025919 Bacteria 18897
279 Ga0207657_10003362 3300025919 Bacteria 17097
280 Ga0207657_10003801 3300025919 Bacteria 16051
281 Ga0207657_10004114 3300025919 Bacteria 15445
282 Ga0207657_10007860 3300025919 Bacteria 10887
283 Ga0207657_10008349 3300025919 Bacteria 10518
284 Ga0207657_10063332 3300025919 Bacteria 3162
285 Ga0207657_10147158 3300025919 Bacteria 1921
286 Ga0207649_10031406 3300025920 Bacteria 3156
287 Ga0207649_10178078 3300025920 Bacteria 1486
288 Ga0207649_10336006 3300025920 Bacteria 1114
289 Ga0207649_11196526 3300025920 Bacteria 600
290 Ga0207652_10053734 3300025921 Bacteria 3460
291 Ga0207652_10068716 3300025921 Bacteria 3075
292 Ga0207652_10075250 3300025921 Bacteria 2942
293 Ga0207652_10163860 3300025921 Bacteria 1993
294 Ga0207652_10176663 3300025921 Bacteria 1918
295 Ga0207652_10292513 3300025921 Bacteria 1470
296 Ga0207652_10349085 3300025921 Bacteria 1335
297 Ga0207652_10360486 3300025921 Bacteria 1312
298 Ga0207652_10381876 3300025921 Bacteria 1271
299 Ga0207652_10482469 3300025921 Bacteria 1116
300 Ga0207652_10590479 3300025921 Bacteria 996
301 Ga0207652_11086102 3300025921 Bacteria 700
302 Ga0207652_11173158 3300025921 Bacteria 669
303 Ga0207646_10000835 3300025922 Bacteria 40092
304 Ga0207646_10086919 3300025922 Bacteria 2798
305 Ga0207646_10829419 3300025922 Bacteria 823
306 Ga0207694_10148986 3300025924 Bacteria 1884
307 Ga0207694_10402406 3300025924 Bacteria 1138
308 Ga0207694_11009869 3300025924 Bacteria 704
309 Ga0207687_10556110 3300025927 Bacteria 963
310 Ga0207700_10612943 3300025928 Bacteria 969
311 Ga0207700_11345898 3300025928 Bacteria 636
312 Ga0207664_10006174 3300025929 Bacteria 8220
313 Ga0207664_10032905 3300025929 Bacteria 3978
314 Ga0207664_10120046 3300025929 Bacteria 2199
315 Ga0207664_10360431 3300025929 Bacteria 1288
316 Ga0207664_10702488 3300025929 Bacteria 909
317 Ga0207664_11011090 3300025929 Bacteria 745
318 Ga0207690_10110817 3300025932 Bacteria 1977
319 Ga0207690_10163561 3300025932 Bacteria 1661
320 Ga0207704_10251053 3300025938 Bacteria 1328
321 Ga0207665_10000336 3300025939 Bacteria 32436
322 Ga0207665_10200240 3300025939 Bacteria 1455
323 Ga0207691_10736099 3300025940 Bacteria 831
324 Ga0207661_10008269 3300025944 Bacteria 7433
325 Ga0207661_10057448 3300025944 Bacteria 3128
326 Ga0207661_10075517 3300025944 Bacteria 2766
327 Ga0207661_10082548 3300025944 Bacteria 2657
328 Ga0207661_10171821 3300025944 Bacteria 1887
329 Ga0207661_10244185 3300025944 Bacteria 1594
330 Ga0207661_10245921 3300025944 Bacteria 1588
331 Ga0207661_10401511 3300025944 Bacteria 1243
332 Ga0207661_10452771 3300025944 Bacteria 1169
333 Ga0207679_11091235 3300025945 Bacteria 732
334 Ga0207667_10038453 3300025949 Bacteria 5110
335 Ga0207667_10292628 3300025949 Bacteria 1664
336 Ga0207667_10312245 3300025949 Bacteria 1606
337 Ga0207667_10442537 3300025949 Bacteria 1321
338 Ga0207667_10552813 3300025949 Bacteria 1164
339 Ga0207667_11166048 3300025949 Bacteria 751
340 Ga0207640_10467711 3300025981 Bacteria 1043
341 Ga0207708_10998272 3300026075 Bacteria 727
342 Ga0207702_10019232 3300026078 Bacteria 5650
343 Ga0207702_10147056 3300026078 Bacteria 2139
344 Ga0207702_10169434 3300026078 Bacteria 2001
345 Ga0207702_11729690 3300026078 Bacteria 618
346 Ga0207702_12439155 3300026078 Bacteria 510
347 Ga0207648_10340201 3300026089 Bacteria 1351
348 Ga0207648_10934923 3300026089 Bacteria 811
349 Ga0207674_10250614 3300026116 Bacteria 1718
350 Ga0207674_10428898 3300026116 Bacteria 1278
351 Ga0207698_10142799 3300026142 Bacteria 2065
352 Ga0207698_10186349 3300026142 Bacteria 1844
353 Ga0207698_10257913 3300026142 Bacteria 1600
354 Ga0207698_10669165 3300026142 Bacteria 1030
355 Ga0268266_10164982 3300028379 Bacteria 2006
356 Ga0265319_1001384 3300028563 Bacteria 14568
357 Ga0265319_1013771 3300028563 Bacteria 3198
358 Ga0265319_1151353 3300028563 Bacteria 718
359 Ga0265334_10016813 3300028573 Bacteria 3024
360 Ga0265334_10021458 3300028573 Bacteria 2637
361 Ga0265318_10000657 3300028577 Bacteria 23614
362 Ga0265318_10001537 3300028577 Bacteria 13437
363 Ga0265318_10050008 3300028577 Bacteria 1572
364 Ga0265318_10064817 3300028577 Bacteria 1359
365 Ga0265322_10034042 3300028654 Bacteria 1452
366 Ga0265322_10076010 3300028654 Bacteria 953
367 Ga0265336_10013279 3300028666 Bacteria 2748
368 Ga0265336_10056286 3300028666 Bacteria 1182
369 Ga0265338_10003688 3300028800 Bacteria 21332
370 Ga0265338_10005979 3300028800 Bacteria 15653
371 Ga0265338_10038481 3300028800 Bacteria 4531
372 Ga0265338_10111325 3300028800 Bacteria 2204
373 Ga0265338_10160831 3300028800 Bacteria 1734
374 Ga0265338_10194067 3300028800 Bacteria 1537
375 Ga0265338_10574786 3300028800 Bacteria 787
376 Ga0265338_10741062 3300028800 Bacteria 676
377 Ga0265324_10037517 3300029957 Bacteria 1684
378 Ga0265330_10000672 3300031235 Bacteria 21962
379 Ga0265330_10038951 3300031235 Bacteria 2113
380 Ga0265332_10003607 3300031238 Bacteria 7419
381 Ga0265328_10001789 3300031239 Bacteria 9800
382 Ga0265328_10069565 3300031239 Bacteria 1294
383 Ga0265320_10009710 3300031240 Bacteria 5776
384 Ga0265320_10020029 3300031240 Bacteria 3638
385 Ga0265320_10122018 3300031240 Bacteria 1188
386 Ga0265325_10001475 3300031241 Bacteria 16573
387 Ga0265329_10014857 3300031242 Bacteria 2737
388 Ga0265340_10001171 3300031247 Bacteria 15016
389 Ga0265340_10046505 3300031247 Bacteria 2117
390 Ga0265340_10076072 3300031247 Bacteria 1586
391 Ga0265339_10007738 3300031249 Bacteria 6908
392 Ga0265339_10261350 3300031249 Bacteria 835
393 Ga0265331_10002439 3300031250 Bacteria 12593
394 Ga0265331_10043661 3300031250 Bacteria 2170
395 Ga0265327_10004284 3300031251 Bacteria 12759
396 Ga0265327_10010298 3300031251 Bacteria 6592
397 Ga0265327_10014563 3300031251 Bacteria 5134
398 Ga0265327_10035657 3300031251 Bacteria 2746
399 Ga0265327_10075211 3300031251 Bacteria 1680
400 Ga0265316_10004219 3300031344 Bacteria 14355
401 Ga0265316_10009220 3300031344 Bacteria 9089
402 Ga0265316_10302089 3300031344 Bacteria 1166
403 Ga0307408_100396580 3300031548 Bacteria 1184
404 Ga0307408_101242320 3300031548 Bacteria 696
405 Ga0265313_10003136 3300031595 Bacteria 13647
406 Ga0265313_10009194 3300031595 Bacteria 6444
407 Ga0265314_10003360 3300031711 Bacteria 15527
408 Ga0265314_10007017 3300031711 Bacteria 9842
409 Ga0265314_10017989 3300031711 Bacteria 5529
410 Ga0265314_10330852 3300031711 Bacteria 844
411 Ga0265342_10002099 3300031712 Bacteria 17590
412 Ga0307409_100266527 3300031995 Bacteria 1575
413 Ga0307416_100038804 3300032002 Bacteria 3678
414 Ga0307416_100074266 3300032002 Bacteria 2840
415 Ga0307416_101130573 3300032002 Bacteria 888
416 Ga0307415_100139056 3300032126 Bacteria 1852
417 Ga0307415_100147699 3300032126 Bacteria 1805
418 Ga0307415_101036624 3300032126 Unclassified 765
419 Ga0307415_101527920 3300032126 Bacteria 639
420 Ga0316593_10346592 3300032168 Bacteria 568
421 Ga0373950_0070141 3300034818 Bacteria 717
422 Ga0373926_0049284 3300035083 Bacteria 1517
423 Ga0373940_0037706 3300035088 Bacteria 1317
424 Ga0373944_0006773 3300035089 Bacteria 3051
425 Ga0373944_0064161 3300035089 Bacteria 1184
426 Ga0373949_0101143 3300035090 Bacteria 790
427 Ga0373936_0056343 3300035113 Bacteria 1597
428 Ga0373945_0017335 3300035116 Bacteria 2438
429 Ga0373953_0070444 3300035117 Bacteria 1442
430 Ga0373954_0206208 3300035118 Bacteria 966
431 Ga0373943_0000829 3300035170 Bacteria 13619
432 Ga0373943_0036518 3300035170 Bacteria 2353
433 Ga0373943_0095875 3300035170 Bacteria 1543
434 Ga0373955_0195257 3300035172 Bacteria 1204
435 Ga0373942_0142849 3300035207 Bacteria 763
436 Ga0373931_0008030 3300035691 Bacteria 4994
437 Ga0373935_0128514 3300035692 Bacteria 1700
438 Ga0373935_0305804 3300035692 Bacteria 1125
439 Ga0373927_0019664 3300035695 Bacteria 4428
440 Ga0373927_0054110 3300035695 Bacteria 2596
441 Ga0373927_0268582 3300035695 Bacteria 1122
442 Ga0373933_0026041 3300035724 Bacteria 3356
443 Ga0373947_0000984 3300035725 Bacteria 17384
444 Ga0373947_0010822 3300035725 Bacteria 5235
445 Ga0373937_0046778 3300036401 Bacteria 3957
446 Ga0373937_0227002 3300036401 Bacteria 1758
447 Ga0373937_0763600 3300036401 Bacteria 914
448 Ga0373925_0009937 3300037068 Bacteria 6910
449 Ga0373925_0024098 3300037068 Bacteria 4442
450 Ga0395899_0021325 3300037312 Bacteria 4914
451 Ga0395899_0031616 3300037312 Bacteria 3978
452 Ga0395899_0052522 3300037312 Bacteria 3020
453 Ga0395899_0123867 3300037312 Bacteria 1849
454 Ga0395899_0180565 3300037312 Bacteria 1482
455 Ga0395900_0003871 3300037418 Bacteria 15996
456 Ga0395900_0047074 3300037418 Bacteria 4440
457 Ga0395900_0100506 3300037418 Bacteria 2971
458 Ga0395900_0148192 3300037418 Bacteria 2399
459 Ga0395900_0155976 3300037418 Bacteria 2331
460 Ga0395900_0160906 3300037418 Bacteria 2290
461 Ga0395900_0247475 3300037418 Bacteria 1785
462 Ga0395900_0316345 3300037418 Bacteria 1543
463 Ga0395900_0399633 3300037418 Bacteria 1339
464 Ga0395900_0400417 3300037418 Bacteria 1337
465 Ga0395900_0454870 3300037418 Bacteria 1236
466 Ga0395900_0890565 3300037418 Bacteria 814
467 Ga0395898_0012460 3300037466 Bacteria 8790
468 Ga0395898_0026181 3300037466 Bacteria 5871
469 Ga0395898_0050440 3300037466 Bacteria 4072
470 Ga0395898_0057630 3300037466 Bacteria 3785
471 Ga0395898_0154285 3300037466 Bacteria 2197
472 Ga0395898_0280150 3300037466 Bacteria 1590
473 Ga0395898_0580842 3300037466 Bacteria 1063
474 Ga0395898_0667204 3300037466 Bacteria 982
475 Ga0395898_0759652 3300037466 Bacteria 911
476 Ga0395905_0023831 3300037471 Bacteria 5779
477 Ga0395905_0078030 3300037471 Bacteria 3103
478 Ga0395905_0152407 3300037471 Bacteria 2174
479 Ga0395905_0271506 3300037471 Bacteria 1582
480 Ga0395905_0412289 3300037471 Bacteria 1246
481 Ga0395905_0502317 3300037471 Bacteria 1113
482 Ga0436364_0876689 3300037853 Bacteria 1501
483 Ga0395901_0008826 3300038443 Bacteria 10203
484 Ga0395901_0016696 3300038443 Bacteria 7480
485 Ga0395901_0035865 3300038443 Bacteria 5125
486 Ga0395901_0168287 3300038443 Bacteria 2300
487 Ga0395901_0430493 3300038443 Bacteria 1352
488 Ga0395901_0751132 3300038443 Bacteria 968
489 Ga0395901_0916062 3300038443 Bacteria 857
490 Ga0395901_0978537 3300038443 Bacteria 823
491 Ga0436365_1128087 3300039437 Bacteria 590
492 Ga0436365_1495102 3300039437 Bacteria 1390
493 Ga0436365_1706016 3300039437 Bacteria 794
494 Ga0436360_0298578 3300039438 Bacteria 1050
495 Ga0436360_0668708 3300039438 Bacteria 2048
496 Ga0436360_0980384 3300039438 Bacteria 6299
497 Ga0436363_1711709 3300039450 Bacteria 823
498 Ga0439461_0012117 3300041410 Bacteria 1610
499 Ga0451835_0412462 3300041492 Bacteria 851
500 Ga0451845_0599224 3300041501 Bacteria 592
501 Ga0439433_0056594 3300041999 Bacteria 930
502 Ga0439448_0147590 3300042005 Bacteria 815
503 Ga0439462_0045384 3300042015 Bacteria 1177
504 Ga0439446_0103117 3300042156 Bacteria 904
505 Ga0439434_0131938 3300042435 Bacteria 820
506 Ga0439434_0287981 3300042435 Bacteria 566
507 Ga0439435_0090733 3300042436 Bacteria 928
508 Ga0450918_041876 3300042531 Bacteria 823
509 Ga0466969_0000388 3300044656 Bacteria 24129
510 Ga0466969_0051427 3300044656 Bacteria 2028
511 Ga0466972_0096198 3300044658 Bacteria 1403
512 Ga0466972_0416872 3300044658 Bacteria 630
513 Ga0466965_0077580 3300044683 Bacteria 1678
514 Ga0466965_0144400 3300044683 Bacteria 1241
515 Ga0466966_0024715 3300044684 Bacteria 3930
516 Ga0466966_0070776 3300044684 Bacteria 2186
517 Ga0466966_0158964 3300044684 Bacteria 1376
518 Ga0466966_0363076 3300044684 Bacteria 870
519 Ga0466966_0424790 3300044684 Bacteria 799
520 Ga0466961_0008115 3300044693 Bacteria 6684
521 Ga0466961_0032291 3300044693 Bacteria 3363
522 Ga0466961_0049430 3300044693 Bacteria 2688
523 Ga0466961_0058747 3300044693 Bacteria 2447
524 Ga0466961_0096972 3300044693 Bacteria 1859
525 Ga0466961_0126748 3300044693 Bacteria 1601
526 Ga0466961_0445125 3300044693 Bacteria 784
527 Ga0466961_0458499 3300044693 Bacteria 771
528 Ga0466963_0000496 3300044694 Bacteria 18307
529 Ga0466963_0004989 3300044694 Bacteria 7748
530 Ga0466963_0007612 3300044694 Bacteria 6465
531 Ga0466963_0012464 3300044694 Bacteria 5204
532 Ga0466963_0016410 3300044694 Bacteria 4605
533 Ga0466963_0027365 3300044694 Bacteria 3650
534 Ga0466963_0029294 3300044694 Bacteria 3542
535 Ga0466963_0046766 3300044694 Bacteria 2854
536 Ga0466963_0052153 3300044694 Bacteria 2713
537 Ga0466963_0086524 3300044694 Bacteria 2130
538 Ga0466963_0161532 3300044694 Bacteria 1559
539 Ga0466963_0336547 3300044694 Bacteria 1062
540 Ga0466963_0515069 3300044694 Bacteria 845
541 Ga0466963_0924771 3300044694 Bacteria 614
542 Ga0466964_0009803 3300044706 Bacteria 3609
543 Ga0466964_0108093 3300044706 Bacteria 1236
544 Ga0466964_0327675 3300044706 Bacteria 780
545 Ga0466971_0000165 3300044719 Bacteria 24707
546 Ga0466971_0006803 3300044719 Bacteria 4974
547 Ga0466971_0018750 3300044719 Bacteria 3067
548 Ga0466971_0034312 3300044719 Bacteria 2274
549 Ga0466971_0137194 3300044719 Bacteria 1138
550 Ga0466971_0172829 3300044719 Bacteria 1014
551 Ga0466971_0219864 3300044719 Bacteria 900
552 Ga0466971_0227269 3300044719 Bacteria 885
553 Ga0466968_0004439 3300044735 Bacteria 5249
554 Ga0466968_0004580 3300044735 Bacteria 5170
555 Ga0466968_0005689 3300044735 Bacteria 4670
556 Ga0466968_0027732 3300044735 Bacteria 2331
557 Ga0466968_0054697 3300044735 Bacteria 1711
558 Ga0466968_0303991 3300044735 Bacteria 768
559 Ga0466968_0475271 3300044735 Bacteria 620
560 Ga0466970_0052831 3300044765 Bacteria 2169
561 Ga0466970_0611066 3300044765 Bacteria 633
562 Ga0466957_0001076 3300044842 Bacteria 14082
563 Ga0466957_0012986 3300044842 Bacteria 4825
564 Ga0466957_0053166 3300044842 Bacteria 2468
565 Ga0466957_0059241 3300044842 Bacteria 2347
566 Ga0466957_0092321 3300044842 Bacteria 1898
567 Ga0466959_0021447 3300045049 Bacteria 4764
568 Ga0466959_0022495 3300045049 Bacteria 4661
569 Ga0466959_0052831 3300045049 Bacteria 2974
570 Ga0466959_0193666 3300045049 Bacteria 1418
571 Ga0466959_0240095 3300045049 Unclassified 1252
572 Ga0466959_0265075 3300045049 Bacteria 1182
573 Ga0466959_0427263 3300045049 Bacteria 899
574 Ga0451576_0131220 3300045051 Bacteria 2612
575 Ga0451576_0558524 3300045051 Bacteria 1203
576 Ga0466958_0000198 3300045836 Bacteria 22183
577 Ga0466958_0010251 3300045836 Bacteria 5244
578 Ga0466958_0013940 3300045836 Bacteria 4582
579 Ga0466958_0017255 3300045836 Bacteria 4170
580 Ga0466958_0017496 3300045836 Bacteria 4145
581 Ga0466958_0021576 3300045836 Bacteria 3765
582 Ga0466958_0057947 3300045836 Bacteria 2354
583 Ga0466958_0069822 3300045836 Bacteria 2149
584 Ga0466958_0207928 3300045836 Bacteria 1246
585 Ga0466958_0313896 3300045836 Bacteria 1007
586 Ga0466958_0796595 3300045836 Bacteria 616
587 Ga0466967_0000179 3300045976 Bacteria 26199
588 Ga0466967_0004681 3300045976 Bacteria 9291
589 Ga0466967_0010812 3300045976 Bacteria 6869
590 Ga0466967_0012007 3300045976 Bacteria 6600
591 Ga0466967_0012286 3300045976 Bacteria 6541
592 Ga0466967_0016889 3300045976 Bacteria 5771
593 Ga0466967_0034468 3300045976 Bacteria 4297
594 Ga0466967_0035396 3300045976 Bacteria 4250
595 Ga0466967_0050261 3300045976 Bacteria 3650
596 Ga0466967_0058719 3300045976 Bacteria 3401
597 Ga0466967_0106170 3300045976 Bacteria 2574
598 Ga0466967_0125599 3300045976 Bacteria 2376
599 Ga0466967_0177980 3300045976 Bacteria 2004
600 Ga0466967_0203593 3300045976 Bacteria 1875
601 Ga0466967_0215260 3300045976 Bacteria 1823
602 Ga0466967_0401429 3300045976 Bacteria 1334
603 Ga0466967_0452035 3300045976 Bacteria 1256
604 Ga0466967_0470092 3300045976 Bacteria 1231
605 Ga0466967_0488172 3300045976 Bacteria 1207
606 Ga0466967_0505462 3300045976 Bacteria 1186
607 Ga0466967_0575358 3300045976 Bacteria 1110
608 Ga0466967_0835861 3300045976 Bacteria 915
609 Ga0466967_0987400 3300045976 Bacteria 838
610 Ga0495627_178389 3300046453 Bacteria 589
611 Ga0495592_0148502 3300046454 Bacteria 1623
612 Ga0495603_0024362 3300046455 Bacteria 3659
613 Ga0495603_0103167 3300046455 Bacteria 1665
614 Ga0495603_0304809 3300046455 Unclassified 915
615 Ga0495629_0007857 3300046459 Bacteria 7849
616 Ga0495629_0010312 3300046459 Bacteria 6808
617 Ga0495641_0004552 3300046461 Bacteria 9732
618 Ga0495641_0005759 3300046461 Bacteria 8234
619 Ga0495641_0312811 3300046461 Bacteria 708
620 Ga0495651_0035126 3300046462 Bacteria 3905
621 Ga0495651_0066163 3300046462 Bacteria 2759
622 Ga0495651_0597939 3300046462 Bacteria 696
623 Ga0495653_0024531 3300046463 Bacteria 4859
624 Ga0495653_0029554 3300046463 Bacteria 4373
625 Ga0495653_0067957 3300046463 Bacteria 2674
626 Ga0495653_0084567 3300046463 Bacteria 2336
627 Ga0495653_0103363 3300046463 Bacteria 2060
628 Ga0495653_0207592 3300046463 Bacteria 1325
629 Ga0495653_0234166 3300046463 Bacteria 1228
630 Ga0495653_0410068 3300046463 Bacteria 859
631 Ga0495580_0023610 3300046472 Bacteria 4513
632 Ga0495582_0005237 3300046473 Bacteria 7251
633 Ga0495582_0033438 3300046473 Bacteria 2827
634 Ga0495639_0012174 3300046475 Bacteria 3708
635 Ga0495662_0002311 3300046476 Bacteria 9609
636 Ga0495664_0028844 3300046477 Bacteria 3242
637 Ga0495664_0443283 3300046477 Bacteria 778
638 Ga0495664_0775003 3300046477 Bacteria 564
639 Ga0495584_0019722 3300046491 Bacteria 3426
640 Ga0495585_0049390 3300046492 Bacteria 2336
641 Ga0495608_0028929 3300046511 Bacteria 3764
642 Ga0495608_0047179 3300046511 Bacteria 2864
643 Ga0495608_0141142 3300046511 Bacteria 1537
644 Ga0495608_0216183 3300046511 Bacteria 1204
645 Ga0495618_0033708 3300046514 Bacteria 3211
646 Ga0495618_0064325 3300046514 Bacteria 2330
647 Ga0495618_0693419 3300046514 Bacteria 599
648 Ga0495628_0141693 3300046516 Bacteria 1835
649 Ga0495630_0014476 3300046517 Bacteria 5747
650 Ga0495630_0024352 3300046517 Bacteria 4476
651 Ga0495630_0026574 3300046517 Bacteria 4286
652 Ga0495630_0078367 3300046517 Bacteria 2491
653 Ga0495630_0487330 3300046517 Bacteria 945
654 Ga0495630_0496231 3300046517 Unclassified 936
655 Ga0495630_0568596 3300046517 Bacteria 869
656 Ga0495637_0078988 3300046520 Bacteria 1315
657 Ga0495644_0003489 3300046523 Bacteria 6222
658 Ga0495644_0184684 3300046523 Bacteria 802
659 Ga0495666_0000649 3300046526 Bacteria 15639
660 Ga0495642_0072159 3300046528 Bacteria 1445
661 Ga0495652_0045044 3300046529 Bacteria 3796
662 Ga0495652_0165994 3300046529 Bacteria 1709
663 Ga0495652_0322946 3300046529 Bacteria 1114
664 Ga0495665_0002189 3300046531 Bacteria 10576
665 Ga0495640_0024397 3300046533 Bacteria 4399
666 Ga0495640_0073224 3300046533 Bacteria 2294
667 Ga0495640_0100577 3300046533 Bacteria 1898
668 Ga0495640_0250586 3300046533 Bacteria 1109
669 Ga0495586_0019241 3300046535 Bacteria 3631
670 Ga0495586_0021041 3300046535 Bacteria 3476
671 Ga0495586_0030331 3300046535 Bacteria 2893
672 Ga0495645_0041106 3300046543 Bacteria 3371
673 Ga0495645_0273687 3300046543 Bacteria 1113
674 Ga0495667_0152910 3300046559 Bacteria 1485
675 Ga0495656_0284329 3300046615 Bacteria 844
676 Ga0495668_0301998 3300046616 Bacteria 878
677 Ga0495634_0027714 3300046642 Bacteria 3940
678 Ga0495634_0041481 3300046642 Bacteria 3125
679 Ga0495634_0098872 3300046642 Bacteria 1887
680 Ga0495634_0099298 3300046642 Bacteria 1882
681 Ga0495634_0153216 3300046642 Bacteria 1456
682 Ga0495634_0200483 3300046642 Bacteria 1240
683 Ga0495634_0787512 3300046642 Bacteria 543
684 Ga0495611_0507350 3300046648 Bacteria 548
685 Ga0495635_0016327 3300046663 Bacteria 5184
686 Ga0495635_0043606 3300046663 Bacteria 3095
687 Ga0495635_0303154 3300046663 Bacteria 1071
688 Ga0495659_0022974 3300046664 Bacteria 2115
689 Ga0495657_0023514 3300046675 Bacteria 4402
690 Ga0495657_0056134 3300046675 Bacteria 2624
691 Ga0495657_0153958 3300046675 Bacteria 1426
692 Ga0495657_0225684 3300046675 Bacteria 1134
693 Ga0495599_0002999 3300046678 Bacteria 9830
694 Ga0495599_0448727 3300046678 Bacteria 764
695 Ga0495646_0053036 3300046680 Bacteria 2447
696 Ga0495647_0000558 3300046681 Bacteria 10976
697 Ga0495647_0034053 3300046681 Bacteria 1906
698 Ga0495647_0057849 3300046681 Bacteria 1523
699 Ga0495658_0004841 3300046683 Bacteria 6604
700 Ga0495658_0032586 3300046683 Bacteria 2847
701 Ga0495658_0210600 3300046683 Bacteria 1214
702 Ga0495669_0357859 3300046684 Bacteria 706
703 Ga0495613_0006480 3300046689 Bacteria 8748
704 Ga0495613_0018612 3300046689 Bacteria 5178
705 Ga0495613_0159840 3300046689 Bacteria 1603
706 Ga0495613_0221746 3300046689 Bacteria 1327
707 Ga0495624_0003577 3300046690 Bacteria 11505
708 Ga0495624_0028867 3300046690 Bacteria 3621
709 Ga0495624_0081689 3300046690 Bacteria 2001
710 Ga0495624_0154900 3300046690 Bacteria 1401
711 Ga0495624_0208184 3300046690 Unclassified 1187
712 Ga0495624_0600804 3300046690 Bacteria 656
713 Ga0495600_0022360 3300046809 Bacteria 4058
714 Ga0495600_0363851 3300046809 Bacteria 904
715 Ga0495600_0396020 3300046809 Bacteria 860
716 Ga0495600_0419670 3300046809 Bacteria 830
717 Ga0495581_0002674 3300047315 Bacteria 10139
718 Ga0495581_0066870 3300047315 Bacteria 2078
719 Ga0495604_0115700 3300047317 Bacteria 1948
720 Ga0495604_0156176 3300047317 Bacteria 1616
721 Ga0495604_0217466 3300047317 Bacteria 1317
722 Ga0495674_0100783 3300047319 Bacteria 2457
723 Ga0495674_0117974 3300047319 Bacteria 2244
724 Ga0495676_0002388 3300047321 Bacteria 16667
725 Ga0495676_0182585 3300047321 Bacteria 1469
726 Ga0495676_0573726 3300047321 Bacteria 736
727 Ga0495680_0002404 3300047322 Bacteria 19198
728 Ga0495680_0035961 3300047322 Bacteria 3982
729 Ga0495680_0151250 3300047322 Bacteria 1692
730 Ga0495680_0225414 3300047322 Bacteria 1336
731 Ga0495680_0313835 3300047322 Bacteria 1098
732 Ga0495680_0734836 3300047322 Bacteria 649
733 Ga0495675_0023867 3300047444 Bacteria 3897
734 Ga0495675_0220301 3300047444 Bacteria 1149
735 Ga0495679_072161 3300047446 Bacteria 993
736 Ga0495685_093090 3300047447 Bacteria 998
737 Ga0495684_0043631 3300047471 Bacteria 3434
738 Ga0495684_0162401 3300047471 Bacteria 1665
739 Ga0495684_0193398 3300047471 Bacteria 1503
740 Ga0495684_0244796 3300047471 Bacteria 1306
741 Ga0495684_0360292 3300047471 Bacteria 1030
742 Ga0495593_0008342 3300047673 Bacteria 6029
743 Ga0495593_0030005 3300047673 Bacteria 2978
744 Ga0495602_0029426 3300048088 Bacteria 5230
745 Ga0495602_0322921 3300048088 Bacteria 1122
746 Ga0495614_0006474 3300048089 Bacteria 5254
747 Ga0495614_0285191 3300048089 Bacteria 761
748 Ga0495615_0277824 3300048090 Bacteria 537
749 Ga0496100_0004732 3300048903 Bacteria 7257
750 Ga0496100_0103592 3300048903 Bacteria 1965
751 Ga0496100_0123805 3300048903 Bacteria 1812
752 Ga0496100_0589973 3300048903 Bacteria 862
753 Ga0496101_0053116 3300048904 Bacteria 2922
754 Ga0496101_0156161 3300048904 Bacteria 1748
755 Ga0496101_0217355 3300048904 Bacteria 1482
756 Ga0496101_0277742 3300048904 Bacteria 1309
757 Ga0496101_0778275 3300048904 Bacteria 755
758 Ga0496101_1135061 3300048904 Bacteria 613
759 Ga0496102_0029581 3300048905 Bacteria 4902
760 Ga0496102_0092424 3300048905 Bacteria 2802
761 Ga0496102_0341605 3300048905 Bacteria 1410
762 Ga0496103_0013174 3300048906 Bacteria 4902
763 Ga0496103_0164925 3300048906 Bacteria 1422
764 Ga0496103_0192473 3300048906 Bacteria 1311
765 Ga0496103_0209671 3300048906 Bacteria 1253
766 Ga0496104_0009204 3300048907 Bacteria 8780
767 Ga0496104_0132100 3300048907 Bacteria 2398
768 Ga0496104_0325131 3300048907 Bacteria 1451
769 Ga0496104_0434813 3300048907 Bacteria 1224
770 Ga0496104_0494286 3300048907 Bacteria 1134
771 Ga0496104_0530922 3300048907 Bacteria 1088
772 Ga0496104_1477150 3300048907 Bacteria 583
773 Ga0496105_0022782 3300048908 Bacteria 5075
774 Ga0496105_0077056 3300048908 Bacteria 2753
775 Ga0496105_0524005 3300048908 Bacteria 928
776 Ga0496105_0861945 3300048908 Bacteria 685
777 Ga0496106_0006958 3300048909 Bacteria 8362
778 Ga0496106_0010051 3300048909 Bacteria 6990
779 Ga0496106_0033698 3300048909 Bacteria 3822
780 Ga0496106_0042412 3300048909 Bacteria 3412
781 Ga0496106_0323039 3300048909 Bacteria 1239
782 Ga0496107_0019319 3300048910 Bacteria 4808
783 Ga0496107_0054955 3300048910 Bacteria 2875
784 Ga0496107_0080978 3300048910 Bacteria 2368
785 Ga0496107_0173684 3300048910 Bacteria 1599
786 Ga0496107_0238174 3300048910 Bacteria 1354
787 Ga0496108_0001322 3300048911 Bacteria 19476
788 Ga0496108_0008941 3300048911 Bacteria 8119
789 Ga0496108_0018951 3300048911 Bacteria 5643
790 Ga0496108_0135626 3300048911 Bacteria 2117
791 Ga0496108_0275493 3300048911 Bacteria 1465
792 Ga0496109_0004720 3300048912 Bacteria 11381
793 Ga0496109_0356659 3300048912 Bacteria 1381
794 Ga0496109_0375810 3300048912 Bacteria 1342
795 Ga0496109_0677365 3300048912 Bacteria 969
796 Ga0496109_0804363 3300048912 Bacteria 878
797 Ga0496109_1043269 3300048912 Bacteria 755
798 Ga0496109_1267216 3300048912 Bacteria 673
799 Ga0496110_0000279 3300048913 Bacteria 33279
800 Ga0496110_0009338 3300048913 Bacteria 7935
801 Ga0496110_0015765 3300048913 Bacteria 6299
802 Ga0496110_0357216 3300048913 Bacteria 1331
803 Ga0496110_0413902 3300048913 Bacteria 1229
804 Ga0496111_0000545 3300048914 Bacteria 19484
805 Ga0496111_0169482 3300048914 Bacteria 1622
806 Ga0496111_0209165 3300048914 Bacteria 1449
807 Ga0496112_0011241 3300048915 Bacteria 8166
808 Ga0496112_0031813 3300048915 Bacteria 5119
809 Ga0496112_0032075 3300048915 Bacteria 5099
810 Ga0496112_0036838 3300048915 Bacteria 4772
811 Ga0496112_0080753 3300048915 Bacteria 3216
812 Ga0496112_0232758 3300048915 Bacteria 1797
813 Ga0496112_0234587 3300048915 Bacteria 1789
814 Ga0496112_0247276 3300048915 Bacteria 1735
815 Ga0496112_0297050 3300048915 Bacteria 1561
816 Ga0496112_0359563 3300048915 Bacteria 1398
817 Ga0496112_0440185 3300048915 Bacteria 1241
818 Ga0496112_0791168 3300048915 Bacteria 874
819 Ga0496112_1035970 3300048915 Bacteria 740
820 Ga0496112_1194797 3300048915 Bacteria 677
821 Ga0496113_0046676 3300048916 Bacteria 3216
822 Ga0496113_0059245 3300048916 Bacteria 2884
823 Ga0496113_0124315 3300048916 Bacteria 2020
824 Ga0496113_0579559 3300048916 Bacteria 899
825 Ga0496113_1053668 3300048916 Bacteria 639
826 Ga0496114_0004356 3300048917 Bacteria 10956
827 Ga0496114_0008653 3300048917 Bacteria 8068
828 Ga0496114_0436270 3300048917 Bacteria 1160
829 Ga0496115_0061455 3300048918 Bacteria 3028
830 Ga0496115_0089319 3300048918 Bacteria 2516
831 Ga0496115_0422524 3300048918 Bacteria 1080
832 Ga0501032_0704498 3300049569 Bacteria 640
833 Ga0501034_0136755 3300049571 Bacteria 2431
834 Ga0501040_0012822 3300049576 Bacteria 5504
835 Ga0501040_0055003 3300049576 Bacteria 2729
836 Ga0501040_0533133 3300049576 Bacteria 847
837 Ga0501041_0571423 3300049577 Bacteria 721
838 Ga0501042_0364931 3300049578 Bacteria 1045
839 Ga0501046_0557824 3300049580 Bacteria 816
840 Ga0501046_0566451 3300049580 Bacteria 808
841 Ga0501047_0192221 3300049581 Bacteria 1904
842 Ga0501047_0802157 3300049581 Bacteria 756
843 Ga0501067_0001025 3300049583 Bacteria 15041
844 Ga0501067_0150337 3300049583 Bacteria 1297
845 Ga0501069_0003321 3300049585 Bacteria 8255
846 Ga0501070_0096886 3300049586 Bacteria 2440
847 Ga0501070_0206256 3300049586 Bacteria 1614
848 Ga0501072_0622635 3300049588 Bacteria 850
849 Ga0501073_0046169 3300049589 Bacteria 3065
850 Ga0501074_0024761 3300049590 Bacteria 4361
851 Ga0501076_0484631 3300049592 Bacteria 1019
852 Ga0501077_0130384 3300049593 Bacteria 1594
853 Ga0501079_0538582 3300049741 Bacteria 918
854 Ga0501080_0026200 3300049742 Bacteria 5417
855 Ga0501045_0345198 3300049824 Bacteria 1108
856 nmdc:mga08y16_956291_c1 3300050511 Bacteria 839
857 nmdc:mga0n895_103855_c1 3300050512 Bacteria 2854
858 nmdc:mga0rr50_156168_c1 3300050513 Bacteria 1848
859 nmdc:mga0a205_170661_c1 3300050515 Bacteria 2071
860 Ga0495601_0006704 3300053077 Bacteria 6739
861 Ga0495601_0196025 3300053077 Bacteria 1320
862 Ga0495612_0001091 3300053078 Bacteria 11105
863 Ga0495612_0180209 3300053078 Bacteria 928
864 Ga0495655_0149229 3300053083 Bacteria 734
865 Ga0495595_0032786 3300053084 Bacteria 2341
866 Ga0495595_0044461 3300053084 Bacteria 2040
867 Ga0495595_0109100 3300053084 Bacteria 1340
868 Ga0495619_0034198 3300053085 Bacteria 3304
869 Ga0495619_0046079 3300053085 Bacteria 2866
870 Ga0495619_0054108 3300053085 Bacteria 2655
871 Ga0495619_0120095 3300053085 Bacteria 1802
872 Ga0495619_0282476 3300053085 Bacteria 1150
873 Ga0500566_0098325 3300053094 Bacteria 1608
874 Ga0590071_140344 3300059421 Bacteria 623
875 Ga0590075_007359 3300059424 Bacteria 2615
876 Ga0501082_0228144 3300060353 Bacteria 1621
877 Ga0466962_0000618 3300061719 Bacteria 15773
878 Ga0466962_0006173 3300061719 Bacteria 5757
879 Ga0466962_0045074 3300061719 Bacteria 2108
880 Ga0466962_0199984 3300061719 Unclassified 976
881 Ga0466962_0339949 3300061719 Bacteria 746
882 Ga0466962_0500409 3300061719 Bacteria 615
883 Ga0466962_0563281 3300061719 Bacteria 579
884 Ga0530510_0009967 3300061734 Bacteria 6666
885 Ga0495651_0213375
886 Ga0058863_11910037
887 Ga0058862_12807872
888 Ga0070658_10044965
889 Ga0070658_10049400
890 Ga0070658_10257830
891 Ga0070658_10267597
892 Ga0070676_11549710
893 Ga0070683_100006172
894 Ga0070683_100032081
895 Ga0070683_100044248
896 Ga0070683_100062290
897 Ga0070683_100103720
898 Ga0070683_100108882
899 Ga0070683_100285283
900 Ga0070683_100296222
901 Ga0070683_101203931
902 Ga0070680_100014485
903 Ga0070680_100250951
904 Ga0070680_100261994
905 Ga0070680_101643982
906 Ga0070682_100047037
907 Ga0070682_100577351
908 Ga0070682_100991390
909 Ga0070660_100003458
910 Ga0070660_100004868
911 Ga0070660_100016665
912 Ga0070660_100024280
913 Ga0070660_100024290
914 Ga0070660_100024497
915 Ga0070660_100040297
916 Ga0070660_100127570
917 Ga0070661_100034760
918 Ga0070661_100161475
919 Ga0070661_100236906
920 Ga0070661_100320473
921 Ga0070661_100690736
922 Ga0070661_100973999
923 Ga0070692_10101787
924 Ga0070675_100877311
925 Ga0070671_100423705
926 Ga0070659_100039235
927 Ga0070659_100580276
928 Ga0070709_10009338
929 Ga0070709_10074488
930 Ga0070709_10253706
931 Ga0070714_100117081
932 Ga0070714_100305542
933 Ga0070714_100352029
934 Ga0070714_100415621
935 Ga0070714_101325693
936 Ga0070714_101741154
937 Ga0070713_100005892
938 Ga0070710_10030936
939 Ga0070710_10225923
940 Ga0070710_10958211
941 Ga0070711_100067249
942 Ga0070700_100478974
943 Ga0070708_100006727
944 Ga0070708_101705434
945 Ga0070681_10019025
946 Ga0070681_10024922
947 Ga0070681_10129972
948 Ga0070681_10213474
949 Ga0070681_10322083
950 Ga0070681_10354634
951 Ga0070681_10661414
952 Ga0070681_10829816
953 Ga0068867_100949343
954 Ga0070706_101241462
955 Ga0070706_101351608
956 Ga0070707_100000328
957 Ga0070707_100116347
958 Ga0070707_100665549
959 Ga0070698_100099113
960 Ga0070698_100215543
961 Ga0070698_100279610
962 Ga0070698_100284890
963 Ga0070699_100122865
964 Ga0070699_100292820
965 Ga0070699_100542705
966 Ga0070679_100025308
967 Ga0070679_100029750
968 Ga0070679_100054350
969 Ga0070679_100056642
970 Ga0070679_100065935
971 Ga0070679_100130752
972 Ga0070679_100194174
973 Ga0070679_100292201
974 Ga0070679_100355960
975 Ga0070679_100369841
976 Ga0070679_100780161
977 Ga0070679_100949128
978 Ga0070684_100001095
979 Ga0070684_100007102
980 Ga0070684_100008765
981 Ga0070684_100024219
982 Ga0070684_100172679
983 Ga0070684_100372351
984 Ga0068853_100218022
985 Ga0070695_100765516
986 Ga0070696_100013480
987 Ga0070693_100261354
988 Ga0070693_100291319
989 Ga0070693_101085586
990 Ga0070665_100015545
991 Ga0070704_100234855
992 Ga0068855_100002523
993 Ga0068855_100036661
994 Ga0068855_100043181
995 Ga0068855_100069488
996 Ga0068855_100106284
997 Ga0068855_100253446
998 Ga0068855_100258802
999 Ga0068855_100513656
1000 Ga0070664_101136944
1001 Ga0068857_100148013
1002 Ga0068854_100407166
1003 Ga0068856_100049855
1004 Ga0068856_100059390
1005 Ga0068856_100067539
1006 Ga0068856_100084897
1007 Ga0068856_100178594
1008 Ga0068856_100393716
1009 Ga0068856_100495341
1010 Ga0068856_100533228
1011 Ga0068856_102660802
1012 Ga0070702_100062886
1013 Ga0068852_100040177
1014 Ga0068852_100135685
1015 Ga0068852_100144161
1016 Ga0068852_101161862
1017 Ga0068852_101228121
1018 Ga0068852_101564188
1019 Ga0070717_10010696
1020 Ga0070717_10079145
1021 Ga0070717_10093185
1022 Ga0070717_10709825
1023 Ga0070715_10000913
1024 Ga0070716_100009358
1025 Ga0070712_100079806
1026 Ga0097621_100698329
1027 Ga0075433_10204649
1028 Ga0075434_100228629
1029 Ga0075434_100656827
1030 Ga0075434_101518093
1031 Ga0068865_100387794
1032 Ga0075435_100232637
1033 Ga0075435_100654786
1034 Ga0105240_10044922
1035 Ga0105240_10141561
1036 Ga0105240_10142362
1037 Ga0105240_10272459
1038 Ga0105240_10408980
1039 Ga0105240_10513146
1040 Ga0105240_11062221
1041 Ga0105240_11835238
1042 Ga0105240_12125815
1043 Ga0111539_10189352
1044 Ga0111539_10836222
1045 Ga0105245_10072323
1046 Ga0105245_10728912
1047 Ga0105245_10798624
1048 Ga0105243_10686974
1049 Ga0105241_10350360
1050 Ga0105241_12199504
1051 Ga0105242_10052199
1052 Ga0105237_10021997
1053 Ga0105237_10053974
1054 Ga0105237_11700849
1055 Ga0105237_11820802
1056 Ga0105238_10042846
1057 Ga0105238_10134415
1058 Ga0105238_10696070
1059 Ga0105238_11815757
1060 Ga0105239_10095199
1061 Ga0105239_10228079
1062 Ga0105246_10240014
1063 Ga0105246_10681044
1064 Ga0157373_10198661
1065 Ga0157373_10311830
1066 Ga0157373_10448121
1067 Ga0157370_10012542
1068 Ga0157370_10016007
1069 Ga0157370_10030932
1070 Ga0157370_10075505
1071 Ga0157370_10353586
1072 Ga0157369_10005342
1073 Ga0157369_10129010
1074 Ga0157369_10176788
1075 Ga0157369_10184569
1076 Ga0157369_10194671
1077 Ga0157369_10710497
1078 Ga0157369_11370811
1079 Ga0157374_10029179
1080 Ga0157374_10069343
1081 Ga0157374_10097387
1082 Ga0157374_10426933
1083 Ga0157372_10022568
1084 Ga0157372_10113951
1085 Ga0157372_10475734
1086 Ga0157372_10506450
1087 Ga0157372_10580893
1088 Ga0157372_10629771
1089 Ga0157372_12404605
1090 Ga0157375_10265161
1091 Ga0182008_10026158
1092 Ga0182008_10555448
1093 Ga0157377_10478835
1094 Ga0157376_10043644
1095 Ga0182007_10146001
1096 Ga0197907_10009387
1097 Ga0197907_10041855
1098 Ga0197907_10515615
1099 Ga0197907_11062133
1100 Ga0197907_11071902
1101 Ga0206356_10187915
1102 Ga0206356_10258522
1103 Ga0206356_10281124
1104 Ga0206356_11112730
1105 Ga0206356_11608284
1106 Ga0206356_11868100
1107 Ga0206356_11892701
1108 Ga0206349_1136107
1109 Ga0206351_10651009
1110 Ga0206352_10674157
1111 Ga0206350_10519715
1112 Ga0206350_10557578
1113 Ga0206350_11657286
1114 Ga0206354_10183692
1115 Ga0206354_10237964
1116 Ga0206354_10488364
1117 Ga0206354_10830731
1118 Ga0206354_11689399
1119 Ga0206353_10888591
1120 Ga0206353_11019404
1121 Ga0206353_11100058
1122 Ga0206353_11705978
1123 Ga0206353_11757538
1124 Ga0206353_11821296
1125 Ga0206353_11914856
1126 Ga0154015_1030712
1127 Ga0224712_10060128
1128 Ga0224712_10344249
1129 Ga0207692_10217726
1130 Ga0207710_10678221
1131 Ga0207685_10060306
1132 Ga0207699_10084519
1133 Ga0207699_10254141
1134 Ga0207643_10252636
1135 Ga0207705_10039578
1136 Ga0207705_10105627
1137 Ga0207705_10171817
1138 Ga0207705_10452921
1139 Ga0207684_10369515
1140 Ga0207707_10033222
1141 Ga0207707_10065998
1142 Ga0207707_10136123
1143 Ga0207707_10209062
1144 Ga0207707_10233985
1145 Ga0207707_10423307
1146 Ga0207695_10174628
1147 Ga0207695_10210584
1148 Ga0207695_10224332
1149 Ga0207695_10476269
1150 Ga0207695_11083594
1151 Ga0207671_11230119
1152 Ga0207693_10002991
1153 Ga0207693_10199885
1154 Ga0207693_10523851
1155 Ga0207663_10010865
1156 Ga0207660_10005003
1157 Ga0207660_10086052
1158 Ga0207660_10207281
1159 Ga0207660_10326356
1160 Ga0207660_10340579
1161 Ga0207660_10641559
1162 Ga0207657_10002763
1163 Ga0207657_10003362
1164 Ga0207657_10003801
1165 Ga0207657_10004114
1166 Ga0207657_10007860
1167 Ga0207657_10008349
1168 Ga0207657_10063332
1169 Ga0207657_10147158
1170 Ga0207649_10031406
1171 Ga0207649_10178078
1172 Ga0207649_10336006
1173 Ga0207649_11196526
1174 Ga0207652_10053734
1175 Ga0207652_10068716
1176 Ga0207652_10075250
1177 Ga0207652_10163860
1178 Ga0207652_10176663
1179 Ga0207652_10292513
1180 Ga0207652_10349085
1181 Ga0207652_10360486
1182 Ga0207652_10381876
1183 Ga0207652_10482469
1184 Ga0207652_10590479
1185 Ga0207652_11086102
1186 Ga0207652_11173158
1187 Ga0207646_10000835
1188 Ga0207646_10086919
1189 Ga0207646_10829419
1190 Ga0207694_10148986
1191 Ga0207694_10402406
1192 Ga0207694_11009869
1193 Ga0207687_10556110
1194 Ga0207700_10612943
1195 Ga0207700_11345898
1196 Ga0207664_10006174
1197 Ga0207664_10032905
1198 Ga0207664_10120046
1199 Ga0207664_10360431
1200 Ga0207664_10702488
1201 Ga0207664_11011090
1202 Ga0207690_10110817
1203 Ga0207690_10163561
1204 Ga0207704_10251053
1205 Ga0207665_10000336
1206 Ga0207665_10200240
1207 Ga0207691_10736099
1208 Ga0207661_10008269
1209 Ga0207661_10057448
1210 Ga0207661_10075517
1211 Ga0207661_10082548
1212 Ga0207661_10171821
1213 Ga0207661_10244185
1214 Ga0207661_10245921
1215 Ga0207661_10401511
1216 Ga0207661_10452771
1217 Ga0207679_11091235
1218 Ga0207667_10038453
1219 Ga0207667_10292628
1220 Ga0207667_10312245
1221 Ga0207667_10442537
1222 Ga0207667_10552813
1223 Ga0207667_11166048
1224 Ga0207640_10467711
1225 Ga0207708_10998272
1226 Ga0207702_10019232
1227 Ga0207702_10147056
1228 Ga0207702_10169434
1229 Ga0207702_11729690
1230 Ga0207702_12439155
1231 Ga0207648_10340201
1232 Ga0207648_10934923
1233 Ga0207674_10250614
1234 Ga0207674_10428898
1235 Ga0207698_10142799
1236 Ga0207698_10186349
1237 Ga0207698_10257913
1238 Ga0207698_10669165
1239 Ga0268266_10164982
1240 Ga0265319_1001384
1241 Ga0265319_1013771
1242 Ga0265319_1151353
1243 Ga0265334_10016813
1244 Ga0265334_10021458
1245 Ga0265318_10000657
1246 Ga0265318_10001537
1247 Ga0265318_10050008
1248 Ga0265318_10064817
1249 Ga0265322_10034042
1250 Ga0265322_10076010
1251 Ga0265336_10013279
1252 Ga0265336_10056286
1253 Ga0265338_10003688
1254 Ga0265338_10005979
1255 Ga0265338_10038481
1256 Ga0265338_10111325
1257 Ga0265338_10160831
1258 Ga0265338_10194067
1259 Ga0265338_10574786
1260 Ga0265338_10741062
1261 Ga0265324_10037517
1262 Ga0265330_10000672
1263 Ga0265330_10038951
1264 Ga0265332_10003607
1265 Ga0265328_10001789
1266 Ga0265328_10069565
1267 Ga0265320_10009710
1268 Ga0265320_10020029
1269 Ga0265320_10122018
1270 Ga0265325_10001475
1271 Ga0265329_10014857
1272 Ga0265340_10001171
1273 Ga0265340_10046505
1274 Ga0265340_10076072
1275 Ga0265339_10007738
1276 Ga0265339_10261350
1277 Ga0265331_10002439
1278 Ga0265331_10043661
1279 Ga0265327_10004284
1280 Ga0265327_10010298
1281 Ga0265327_10014563
1282 Ga0265327_10035657
1283 Ga0265327_10075211
1284 Ga0265316_10004219
1285 Ga0265316_10009220
1286 Ga0265316_10302089
1287 Ga0307408_100396580
1288 Ga0307408_101242320
1289 Ga0265313_10003136
1290 Ga0265313_10009194
1291 Ga0265314_10003360
1292 Ga0265314_10007017
1293 Ga0265314_10017989
1294 Ga0265314_10330852
1295 Ga0265342_10002099
1296 Ga0307409_100266527
1297 Ga0307416_100038804
1298 Ga0307416_100074266
1299 Ga0307416_101130573
1300 Ga0307415_100139056
1301 Ga0307415_100147699
1302 Ga0307415_101036624
1303 Ga0307415_101527920
1304 Ga0316593_10346592
1305 Ga0373950_0070141
1306 Ga0373926_0049284
1307 Ga0373940_0037706
1308 Ga0373944_0006773
1309 Ga0373944_0064161
1310 Ga0373949_0101143
1311 Ga0373936_0056343
1312 Ga0373945_0017335
1313 Ga0373953_0070444
1314 Ga0373954_0206208
1315 Ga0373943_0000829
1316 Ga0373943_0036518
1317 Ga0373943_0095875
1318 Ga0373955_0195257
1319 Ga0373942_0142849
1320 Ga0373931_0008030
1321 Ga0373935_0128514
1322 Ga0373935_0305804
1323 Ga0373927_0019664
1324 Ga0373927_0054110
1325 Ga0373927_0268582
1326 Ga0373933_0026041
1327 Ga0373947_0000984
1328 Ga0373947_0010822
1329 Ga0373937_0046778
1330 Ga0373937_0227002
1331 Ga0373937_0763600
1332 Ga0373925_0009937
1333 Ga0373925_0024098
1334 Ga0395899_0021325
1335 Ga0395899_0031616
1336 Ga0395899_0052522
1337 Ga0395899_0123867
1338 Ga0395899_0180565
1339 Ga0395900_0003871
1340 Ga0395900_0047074
1341 Ga0395900_0100506
1342 Ga0395900_0148192
1343 Ga0395900_0155976
1344 Ga0395900_0160906
1345 Ga0395900_0247475
1346 Ga0395900_0316345
1347 Ga0395900_0399633
1348 Ga0395900_0400417
1349 Ga0395900_0454870
1350 Ga0395900_0890565
1351 Ga0395898_0012460
1352 Ga0395898_0026181
1353 Ga0395898_0050440
1354 Ga0395898_0057630
1355 Ga0395898_0154285
1356 Ga0395898_0280150
1357 Ga0395898_0580842
1358 Ga0395898_0667204
1359 Ga0395898_0759652
1360 Ga0395905_0023831
1361 Ga0395905_0078030
1362 Ga0395905_0152407
1363 Ga0395905_0271506
1364 Ga0395905_0412289
1365 Ga0395905_0502317
1366 Ga0436364_0876689
1367 Ga0395901_0008826
1368 Ga0395901_0016696
1369 Ga0395901_0035865
1370 Ga0395901_0168287
1371 Ga0395901_0430493
1372 Ga0395901_0751132
1373 Ga0395901_0916062
1374 Ga0395901_0978537
1375 Ga0436365_1128087
1376 Ga0436365_1495102
1377 Ga0436365_1706016
1378 Ga0436360_0298578
1379 Ga0436360_0668708
1380 Ga0436360_0980384
1381 Ga0436363_1711709
1382 Ga0439461_0012117
1383 Ga0451835_0412462
1384 Ga0451845_0599224
1385 Ga0439433_0056594
1386 Ga0439448_0147590
1387 Ga0439462_0045384
1388 Ga0439446_0103117
1389 Ga0439434_0131938
1390 Ga0439434_0287981
1391 Ga0439435_0090733
1392 Ga0450918_041876
1393 Ga0466969_0000388
1394 Ga0466969_0051427
1395 Ga0466972_0096198
1396 Ga0466972_0416872
1397 Ga0466965_0077580
1398 Ga0466965_0144400
1399 Ga0466966_0024715
1400 Ga0466966_0070776
1401 Ga0466966_0158964
1402 Ga0466966_0363076
1403 Ga0466966_0424790
1404 Ga0466961_0008115
1405 Ga0466961_0032291
1406 Ga0466961_0049430
1407 Ga0466961_0058747
1408 Ga0466961_0096972
1409 Ga0466961_0126748
1410 Ga0466961_0445125
1411 Ga0466961_0458499
1412 Ga0466963_0000496
1413 Ga0466963_0004989
1414 Ga0466963_0007612
1415 Ga0466963_0012464
1416 Ga0466963_0016410
1417 Ga0466963_0027365
1418 Ga0466963_0029294
1419 Ga0466963_0046766
1420 Ga0466963_0052153
1421 Ga0466963_0086524
1422 Ga0466963_0161532
1423 Ga0466963_0336547
1424 Ga0466963_0515069
1425 Ga0466963_0924771
1426 Ga0466964_0009803
1427 Ga0466964_0108093
1428 Ga0466964_0327675
1429 Ga0466971_0000165
1430 Ga0466971_0006803
1431 Ga0466971_0018750
1432 Ga0466971_0034312
1433 Ga0466971_0137194
1434 Ga0466971_0172829
1435 Ga0466971_0219864
1436 Ga0466971_0227269
1437 Ga0466968_0004439
1438 Ga0466968_0004580
1439 Ga0466968_0005689
1440 Ga0466968_0027732
1441 Ga0466968_0054697
1442 Ga0466968_0303991
1443 Ga0466968_0475271
1444 Ga0466970_0052831
1445 Ga0466970_0611066
1446 Ga0466957_0001076
1447 Ga0466957_0012986
1448 Ga0466957_0053166
1449 Ga0466957_0059241
1450 Ga0466957_0092321
1451 Ga0466959_0021447
1452 Ga0466959_0022495
1453 Ga0466959_0052831
1454 Ga0466959_0193666
1455 Ga0466959_0240095
1456 Ga0466959_0265075
1457 Ga0466959_0427263
1458 Ga0451576_0131220
1459 Ga0451576_0558524
1460 Ga0466958_0000198
1461 Ga0466958_0010251
1462 Ga0466958_0013940
1463 Ga0466958_0017255
1464 Ga0466958_0017496
1465 Ga0466958_0021576
1466 Ga0466958_0057947
1467 Ga0466958_0069822
1468 Ga0466958_0207928
1469 Ga0466958_0313896
1470 Ga0466958_0796595
1471 Ga0466967_0000179
1472 Ga0466967_0004681
1473 Ga0466967_0010812
1474 Ga0466967_0012007
1475 Ga0466967_0012286
1476 Ga0466967_0016889
1477 Ga0466967_0034468
1478 Ga0466967_0035396
1479 Ga0466967_0050261
1480 Ga0466967_0058719
1481 Ga0466967_0106170
1482 Ga0466967_0125599
1483 Ga0466967_0177980
1484 Ga0466967_0203593
1485 Ga0466967_0215260
1486 Ga0466967_0401429
1487 Ga0466967_0452035
1488 Ga0466967_0470092
1489 Ga0466967_0488172
1490 Ga0466967_0505462
1491 Ga0466967_0575358
1492 Ga0466967_0835861
1493 Ga0466967_0987400
1494 Ga0495627_178389
1495 Ga0495592_0148502
1496 Ga0495603_0024362
1497 Ga0495603_0103167
1498 Ga0495603_0304809
1499 Ga0495629_0007857
1500 Ga0495629_0010312
1501 Ga0495641_0004552
1502 Ga0495641_0005759
1503 Ga0495641_0312811
1504 Ga0495651_0035126
1505 Ga0495651_0066163
1506 Ga0495651_0597939
1507 Ga0495653_0024531
1508 Ga0495653_0029554
1509 Ga0495653_0067957
1510 Ga0495653_0084567
1511 Ga0495653_0103363
1512 Ga0495653_0207592
1513 Ga0495653_0234166
1514 Ga0495653_0410068
1515 Ga0495580_0023610
1516 Ga0495582_0005237
1517 Ga0495582_0033438
1518 Ga0495639_0012174
1519 Ga0495662_0002311
1520 Ga0495664_0028844
1521 Ga0495664_0443283
1522 Ga0495664_0775003
1523 Ga0495584_0019722
1524 Ga0495585_0049390
1525 Ga0495608_0028929
1526 Ga0495608_0047179
1527 Ga0495608_0141142
1528 Ga0495608_0216183
1529 Ga0495618_0033708
1530 Ga0495618_0064325
1531 Ga0495618_0693419
1532 Ga0495628_0141693
1533 Ga0495630_0014476
1534 Ga0495630_0024352
1535 Ga0495630_0026574
1536 Ga0495630_0078367
1537 Ga0495630_0487330
1538 Ga0495630_0496231
1539 Ga0495630_0568596
1540 Ga0495637_0078988
1541 Ga0495644_0003489
1542 Ga0495644_0184684
1543 Ga0495666_0000649
1544 Ga0495642_0072159
1545 Ga0495652_0045044
1546 Ga0495652_0165994
1547 Ga0495652_0322946
1548 Ga0495665_0002189
1549 Ga0495640_0024397
1550 Ga0495640_0073224
1551 Ga0495640_0100577
1552 Ga0495640_0250586
1553 Ga0495586_0019241
1554 Ga0495586_0021041
1555 Ga0495586_0030331
1556 Ga0495645_0041106
1557 Ga0495645_0273687
1558 Ga0495667_0152910
1559 Ga0495656_0284329
1560 Ga0495668_0301998
1561 Ga0495634_0027714
1562 Ga0495634_0041481
1563 Ga0495634_0098872
1564 Ga0495634_0099298
1565 Ga0495634_0153216
1566 Ga0495634_0200483
1567 Ga0495634_0787512
1568 Ga0495611_0507350
1569 Ga0495635_0016327
1570 Ga0495635_0043606
1571 Ga0495635_0303154
1572 Ga0495659_0022974
1573 Ga0495657_0023514
1574 Ga0495657_0056134
1575 Ga0495657_0153958
1576 Ga0495657_0225684
1577 Ga0495599_0002999
1578 Ga0495599_0448727
1579 Ga0495646_0053036
1580 Ga0495647_0000558
1581 Ga0495647_0034053
1582 Ga0495647_0057849
1583 Ga0495658_0004841
1584 Ga0495658_0032586
1585 Ga0495658_0210600
1586 Ga0495669_0357859
1587 Ga0495613_0006480
1588 Ga0495613_0018612
1589 Ga0495613_0159840
1590 Ga0495613_0221746
1591 Ga0495624_0003577
1592 Ga0495624_0028867
1593 Ga0495624_0081689
1594 Ga0495624_0154900
1595 Ga0495624_0208184
1596 Ga0495624_0600804
1597 Ga0495600_0022360
1598 Ga0495600_0363851
1599 Ga0495600_0396020
1600 Ga0495600_0419670
1601 Ga0495581_0002674
1602 Ga0495581_0066870
1603 Ga0495604_0115700
1604 Ga0495604_0156176
1605 Ga0495604_0217466
1606 Ga0495674_0100783
1607 Ga0495674_0117974
1608 Ga0495676_0002388
1609 Ga0495676_0182585
1610 Ga0495676_0573726
1611 Ga0495680_0002404
1612 Ga0495680_0035961
1613 Ga0495680_0151250
1614 Ga0495680_0225414
1615 Ga0495680_0313835
1616 Ga0495680_0734836
1617 Ga0495675_0023867
1618 Ga0495675_0220301
1619 Ga0495679_072161
1620 Ga0495685_093090
1621 Ga0495684_0043631
1622 Ga0495684_0162401
1623 Ga0495684_0193398
1624 Ga0495684_0244796
1625 Ga0495684_0360292
1626 Ga0495593_0008342
1627 Ga0495593_0030005
1628 Ga0495602_0029426
1629 Ga0495602_0322921
1630 Ga0495614_0006474
1631 Ga0495614_0285191
1632 Ga0495615_0277824
1633 Ga0496100_0004732
1634 Ga0496100_0103592
1635 Ga0496100_0123805
1636 Ga0496100_0589973
1637 Ga0496101_0053116
1638 Ga0496101_0156161
1639 Ga0496101_0217355
1640 Ga0496101_0277742
1641 Ga0496101_0778275
1642 Ga0496101_1135061
1643 Ga0496102_0029581
1644 Ga0496102_0092424
1645 Ga0496102_0341605
1646 Ga0496103_0013174
1647 Ga0496103_0164925
1648 Ga0496103_0192473
1649 Ga0496103_0209671
1650 Ga0496104_0009204
1651 Ga0496104_0132100
1652 Ga0496104_0325131
1653 Ga0496104_0434813
1654 Ga0496104_0494286
1655 Ga0496104_0530922
1656 Ga0496104_1477150
1657 Ga0496105_0022782
1658 Ga0496105_0077056
1659 Ga0496105_0524005
1660 Ga0496105_0861945
1661 Ga0496106_0006958
1662 Ga0496106_0010051
1663 Ga0496106_0033698
1664 Ga0496106_0042412
1665 Ga0496106_0323039
1666 Ga0496107_0019319
1667 Ga0496107_0054955
1668 Ga0496107_0080978
1669 Ga0496107_0173684
1670 Ga0496107_0238174
1671 Ga0496108_0001322
1672 Ga0496108_0008941
1673 Ga0496108_0018951
1674 Ga0496108_0135626
1675 Ga0496108_0275493
1676 Ga0496109_0004720
1677 Ga0496109_0356659
1678 Ga0496109_0375810
1679 Ga0496109_0677365
1680 Ga0496109_0804363
1681 Ga0496109_1043269
1682 Ga0496109_1267216
1683 Ga0496110_0000279
1684 Ga0496110_0009338
1685 Ga0496110_0015765
1686 Ga0496110_0357216
1687 Ga0496110_0413902
1688 Ga0496111_0000545
1689 Ga0496111_0169482
1690 Ga0496111_0209165
1691 Ga0496112_0011241
1692 Ga0496112_0031813
1693 Ga0496112_0032075
1694 Ga0496112_0036838
1695 Ga0496112_0080753
1696 Ga0496112_0232758
1697 Ga0496112_0234587
1698 Ga0496112_0247276
1699 Ga0496112_0297050
1700 Ga0496112_0359563
1701 Ga0496112_0440185
1702 Ga0496112_0791168
1703 Ga0496112_1035970
1704 Ga0496112_1194797
1705 Ga0496113_0046676
1706 Ga0496113_0059245
1707 Ga0496113_0124315
1708 Ga0496113_0579559
1709 Ga0496113_1053668
1710 Ga0496114_0004356
1711 Ga0496114_0008653
1712 Ga0496114_0436270
1713 Ga0496115_0061455
1714 Ga0496115_0089319
1715 Ga0496115_0422524
1716 Ga0501032_0704498
1717 Ga0501034_0136755
1718 Ga0501040_0012822
1719 Ga0501040_0055003
1720 Ga0501040_0533133
1721 Ga0501041_0571423
1722 Ga0501042_0364931
1723 Ga0501046_0557824
1724 Ga0501046_0566451
1725 Ga0501047_0192221
1726 Ga0501047_0802157
1727 Ga0501067_0001025
1728 Ga0501067_0150337
1729 Ga0501069_0003321
1730 Ga0501070_0096886
1731 Ga0501070_0206256
1732 Ga0501072_0622635
1733 Ga0501073_0046169
1734 Ga0501074_0024761
1735 Ga0501076_0484631
1736 Ga0501077_0130384
1737 Ga0501079_0538582
1738 Ga0501080_0026200
1739 Ga0501045_0345198
1740 nmdc:mga08y16_956291_c1
1741 nmdc:mga0n895_103855_c1
1742 nmdc:mga0rr50_156168_c1
1743 nmdc:mga0a205_170661_c1
1744 Ga0495601_0006704
1745 Ga0495601_0196025
1746 Ga0495612_0001091
1747 Ga0495612_0180209
1748 Ga0495655_0149229
1749 Ga0495595_0032786
1750 Ga0495595_0044461
1751 Ga0495595_0109100
1752 Ga0495619_0034198
1753 Ga0495619_0046079
1754 Ga0495619_0054108
1755 Ga0495619_0120095
1756 Ga0495619_0282476
1757 Ga0500566_0098325
1758 Ga0590071_140344
1759 Ga0590075_007359
1760 Ga0501082_0228144
1761 Ga0466962_0000618
1762 Ga0466962_0006173
1763 Ga0466962_0045074
1764 Ga0466962_0199984
1765 Ga0466962_0339949
1766 Ga0466962_0500409
1767 Ga0466962_0563281
1768 Ga0530510_0009967

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

4

121

0.98

PF08534

Redoxin

Redoxin

3

135

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9526 11 151
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9506 11 151
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9492 11 151
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9467 1 150
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9436 1 151
ID Description Score Start End Superfamily
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9701 3 151 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9696 2 151 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9638 3 151 3.40.30.10
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.959 1 134 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9526 11 151 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1F8SL95-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.991 2 129 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A432TGI5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9904 1 91 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A3M1LPF9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9879 2 151 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2E1M849-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9856 1 86 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A838F4Z2-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9837 1 151 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map