F484624
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 884 | 368 | 884 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100189242|Ga0068863_1001892422 |
| Length | 184 |
| Sequence | MTTGGHAPALPRPGTAALGWALVANFRIWAPWRLAYVTDASKDIEEECIFCAKPRGDDDEANLIVHRGESCFVILNLFPYTNGHLMVAPYEHVGDLREISAETLAEMMALAQRAMGRLEEIYSPHGYNVGFNQGRVAGAGVEHHIHMHVVPRWAGDNNFMPVIADTKVMPQSIEQSYEALKGAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 180 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 185 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 206 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 209 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 219 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 220 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 221 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 307 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 310 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 362 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 364 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.41 |
| Nodule | 0 |
| Rhizoplane | 10.86 |
| Rhizosphere | 82.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1006049 | 3300000546 | Bacteria | 1314 |
| 2 | JGI24746J21847_1000760 | 3300001977 | Bacteria | 4956 |
| 3 | JGI24746J21847_1025538 | 3300001977 | Unclassified | 818 |
| 4 | JGI24740J21852_10010068 | 3300001979 | Bacteria | 3662 |
| 5 | JGI24740J21852_10111435 | 3300001979 | Bacteria | 690 |
| 6 | JGI24743J22301_10021951 | 3300001991 | Bacteria | 1222 |
| 7 | JGI24748J21848_1000727 | 3300002074 | Bacteria | 3562 |
| 8 | JGI24738J21930_10065889 | 3300002075 | Unclassified | 746 |
| 9 | JGI24034J26672_10001507 | 3300002239 | Bacteria | 3096 |
| 10 | JGI24034J26672_10037482 | 3300002239 | Bacteria | 806 |
| 11 | JGI24742J22300_10001453 | 3300002244 | Bacteria | 3736 |
| 12 | JGI25404J52841_10000319 | 3300003659 | Bacteria | 6358 |
| 13 | Ga0070658_10120843 | 3300005327 | Bacteria | 2176 |
| 14 | Ga0070683_100000404 | 3300005329 | Bacteria | 29752 |
| 15 | Ga0070683_100006627 | 3300005329 | Bacteria | 9723 |
| 16 | Ga0070683_100060798 | 3300005329 | Bacteria | 3512 |
| 17 | Ga0070683_100323177 | 3300005329 | Bacteria | 1469 |
| 18 | Ga0070683_100343962 | 3300005329 | Bacteria | 1420 |
| 19 | Ga0070683_100453508 | 3300005329 | Bacteria | 1224 |
| 20 | Ga0070670_100073330 | 3300005331 | Bacteria | 2940 |
| 21 | Ga0070666_10231693 | 3300005335 | Bacteria | 1304 |
| 22 | Ga0070680_100394914 | 3300005336 | Bacteria | 1178 |
| 23 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 24 | Ga0070682_100000052 | 3300005337 | Bacteria | 118879 |
| 25 | Ga0070682_100008571 | 3300005337 | Bacteria | 5771 |
| 26 | Ga0068868_100000141 | 3300005338 | Bacteria | 46406 |
| 27 | Ga0068868_100002016 | 3300005338 | Bacteria | 13976 |
| 28 | Ga0068868_100268553 | 3300005338 | Bacteria | 1440 |
| 29 | Ga0070660_100104391 | 3300005339 | Bacteria | 2248 |
| 30 | Ga0070660_100810199 | 3300005339 | Bacteria | 788 |
| 31 | Ga0070691_10000044 | 3300005341 | Bacteria | 36029 |
| 32 | Ga0070691_10000524 | 3300005341 | Bacteria | 14453 |
| 33 | Ga0070691_10482053 | 3300005341 | Bacteria | 714 |
| 34 | Ga0070687_100119153 | 3300005343 | Bacteria | 1507 |
| 35 | Ga0070661_100000099 | 3300005344 | Bacteria | 71115 |
| 36 | Ga0070661_100499160 | 3300005344 | Bacteria | 974 |
| 37 | Ga0070692_10007789 | 3300005345 | Bacteria | 4745 |
| 38 | Ga0070692_10088523 | 3300005345 | Bacteria | 1680 |
| 39 | Ga0070668_100012531 | 3300005347 | Bacteria | 6315 |
| 40 | Ga0070668_100149155 | 3300005347 | Bacteria | 1890 |
| 41 | Ga0070668_100215454 | 3300005347 | Bacteria | 1581 |
| 42 | Ga0070669_100177175 | 3300005353 | Bacteria | 1666 |
| 43 | Ga0070669_100264872 | 3300005353 | Bacteria | 1372 |
| 44 | Ga0070675_100000036 | 3300005354 | Bacteria | 85959 |
| 45 | Ga0070675_100248923 | 3300005354 | Bacteria | 1555 |
| 46 | Ga0070671_100055512 | 3300005355 | Bacteria | 3295 |
| 47 | Ga0070674_100000012 | 3300005356 | Bacteria | 130773 |
| 48 | Ga0070674_100011888 | 3300005356 | Bacteria | 5320 |
| 49 | Ga0070674_100012173 | 3300005356 | Bacteria | 5276 |
| 50 | Ga0070674_100141733 | 3300005356 | Bacteria | 1804 |
| 51 | Ga0070673_100006402 | 3300005364 | Bacteria | 7653 |
| 52 | Ga0070673_100064289 | 3300005364 | Bacteria | 2923 |
| 53 | Ga0070688_100000071 | 3300005365 | Bacteria | 50564 |
| 54 | Ga0070688_100000206 | 3300005365 | Bacteria | 31457 |
| 55 | Ga0070688_100095406 | 3300005365 | Bacteria | 1952 |
| 56 | Ga0070659_100004223 | 3300005366 | Bacteria | 10260 |
| 57 | Ga0070659_100007424 | 3300005366 | Bacteria | 7963 |
| 58 | Ga0070659_100060959 | 3300005366 | Bacteria | 2981 |
| 59 | Ga0070659_100395467 | 3300005366 | Bacteria | 1166 |
| 60 | Ga0070667_100000603 | 3300005367 | Bacteria | 35115 |
| 61 | Ga0070667_100099083 | 3300005367 | Bacteria | 2516 |
| 62 | Ga0070667_100299101 | 3300005367 | Bacteria | 1449 |
| 63 | Ga0070667_100885391 | 3300005367 | Bacteria | 831 |
| 64 | Ga0070714_100041184 | 3300005435 | Bacteria | 3897 |
| 65 | Ga0070714_100430087 | 3300005435 | Bacteria | 1251 |
| 66 | Ga0070713_100000047 | 3300005436 | Bacteria | 76760 |
| 67 | Ga0070713_101616208 | 3300005436 | Unclassified | 629 |
| 68 | Ga0070701_10310198 | 3300005438 | Bacteria | 973 |
| 69 | Ga0070711_100008252 | 3300005439 | Bacteria | 6371 |
| 70 | Ga0070711_100171837 | 3300005439 | Bacteria | 1652 |
| 71 | Ga0070700_100116416 | 3300005441 | Bacteria | 1785 |
| 72 | Ga0070700_100195005 | 3300005441 | Bacteria | 1419 |
| 73 | Ga0070694_100098482 | 3300005444 | Bacteria | 2065 |
| 74 | Ga0070694_100145983 | 3300005444 | Bacteria | 1723 |
| 75 | Ga0070694_100150163 | 3300005444 | Bacteria | 1701 |
| 76 | Ga0070694_100213897 | 3300005444 | Bacteria | 1443 |
| 77 | Ga0070663_100001716 | 3300005455 | Bacteria | 12160 |
| 78 | Ga0070663_100007633 | 3300005455 | Bacteria | 6597 |
| 79 | Ga0070678_100064983 | 3300005456 | Bacteria | 2707 |
| 80 | Ga0070678_100118620 | 3300005456 | Bacteria | 2083 |
| 81 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 82 | Ga0070662_100014992 | 3300005457 | Bacteria | 5185 |
| 83 | Ga0070681_10071340 | 3300005458 | Bacteria | 3438 |
| 84 | Ga0070681_10919100 | 3300005458 | Bacteria | 794 |
| 85 | Ga0068867_100143823 | 3300005459 | Bacteria | 1867 |
| 86 | Ga0070685_10000020 | 3300005466 | Bacteria | 104332 |
| 87 | Ga0070685_10000674 | 3300005466 | Bacteria | 18541 |
| 88 | Ga0070685_10063791 | 3300005466 | Bacteria | 2164 |
| 89 | Ga0070685_10778056 | 3300005466 | Bacteria | 704 |
| 90 | Ga0070679_100005826 | 3300005530 | Bacteria | 11429 |
| 91 | Ga0070679_100025853 | 3300005530 | Bacteria | 5761 |
| 92 | Ga0070684_100178634 | 3300005535 | Bacteria | 1929 |
| 93 | Ga0070684_100200471 | 3300005535 | Bacteria | 1817 |
| 94 | Ga0070684_100712970 | 3300005535 | Bacteria | 936 |
| 95 | Ga0068853_100083524 | 3300005539 | Bacteria | 2798 |
| 96 | Ga0068853_100189350 | 3300005539 | Bacteria | 1869 |
| 97 | Ga0068853_100527751 | 3300005539 | Bacteria | 1116 |
| 98 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 99 | Ga0070672_100004196 | 3300005543 | Bacteria | 9414 |
| 100 | Ga0070686_100097960 | 3300005544 | Bacteria | 1975 |
| 101 | Ga0070686_100167235 | 3300005544 | Bacteria | 1553 |
| 102 | Ga0070696_100772833 | 3300005546 | Bacteria | 789 |
| 103 | Ga0070696_100812601 | 3300005546 | Bacteria | 770 |
| 104 | Ga0070693_100003731 | 3300005547 | Bacteria | 7127 |
| 105 | Ga0070693_100085963 | 3300005547 | Bacteria | 1886 |
| 106 | Ga0070665_100000135 | 3300005548 | Bacteria | 138925 |
| 107 | Ga0070665_100019237 | 3300005548 | Bacteria | 6851 |
| 108 | Ga0070665_100020661 | 3300005548 | Bacteria | 6615 |
| 109 | Ga0070665_100375688 | 3300005548 | Bacteria | 1428 |
| 110 | Ga0070665_100410741 | 3300005548 | Bacteria | 1362 |
| 111 | Ga0070704_100053014 | 3300005549 | Bacteria | 2865 |
| 112 | Ga0070704_100208484 | 3300005549 | Bacteria | 1582 |
| 113 | Ga0070704_100451029 | 3300005549 | Bacteria | 1107 |
| 114 | Ga0068855_100549030 | 3300005563 | Bacteria | 1251 |
| 115 | Ga0070664_100118845 | 3300005564 | Bacteria | 2313 |
| 116 | Ga0068857_100065380 | 3300005577 | Bacteria | 3234 |
| 117 | Ga0068854_100001203 | 3300005578 | Bacteria | 15515 |
| 118 | Ga0068854_100056337 | 3300005578 | Bacteria | 2833 |
| 119 | Ga0068854_100170113 | 3300005578 | Bacteria | 1695 |
| 120 | Ga0068856_100772303 | 3300005614 | Bacteria | 981 |
| 121 | Ga0070702_100080455 | 3300005615 | Bacteria | 1950 |
| 122 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 123 | Ga0068852_100014610 | 3300005616 | Bacteria | 6053 |
| 124 | Ga0068859_100275896 | 3300005617 | Bacteria | 1774 |
| 125 | Ga0068859_100759111 | 3300005617 | Bacteria | 1059 |
| 126 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 127 | Ga0068864_100291873 | 3300005618 | Bacteria | 1524 |
| 128 | Ga0068866_10000008 | 3300005718 | Bacteria | 117658 |
| 129 | Ga0068866_10006530 | 3300005718 | Bacteria | 4860 |
| 130 | Ga0068866_10111683 | 3300005718 | Bacteria | 1526 |
| 131 | Ga0068866_10499494 | 3300005718 | Unclassified | 805 |
| 132 | Ga0068861_100312043 | 3300005719 | Bacteria | 1367 |
| 133 | Ga0068861_101117957 | 3300005719 | Bacteria | 758 |
| 134 | Ga0068851_10013817 | 3300005834 | Bacteria | 3823 |
| 135 | Ga0068863_100000022 | 3300005841 | Bacteria | 188278 |
| 136 | Ga0068863_100006236 | 3300005841 | Bacteria | 11710 |
| 137 | Ga0068863_100189242 | 3300005841 | Bacteria | 1978 |
| 138 | Ga0068863_100467130 | 3300005841 | Bacteria | 1240 |
| 139 | Ga0068858_100018138 | 3300005842 | Bacteria | 6593 |
| 140 | Ga0068858_100154568 | 3300005842 | Bacteria | 2158 |
| 141 | Ga0068858_100257921 | 3300005842 | Bacteria | 1657 |
| 142 | Ga0068860_100011591 | 3300005843 | Bacteria | 8694 |
| 143 | Ga0068860_100085754 | 3300005843 | Bacteria | 2996 |
| 144 | Ga0068860_101205744 | 3300005843 | Bacteria | 777 |
| 145 | Ga0068862_100002782 | 3300005844 | Bacteria | 15329 |
| 146 | Ga0068862_100124618 | 3300005844 | Bacteria | 2274 |
| 147 | Ga0081455_10010756 | 3300005937 | Bacteria | 9252 |
| 148 | Ga0081455_10041071 | 3300005937 | Bacteria | 4073 |
| 149 | Ga0081455_10049005 | 3300005937 | Bacteria | 3644 |
| 150 | Ga0081455_10067266 | 3300005937 | Bacteria | 2986 |
| 151 | Ga0081455_10072555 | 3300005937 | Bacteria | 2849 |
| 152 | Ga0081455_10239729 | 3300005937 | Bacteria | 1333 |
| 153 | Ga0081538_10000812 | 3300005981 | Bacteria | 33866 |
| 154 | Ga0081538_10048156 | 3300005981 | Bacteria | 2604 |
| 155 | Ga0081538_10156378 | 3300005981 | Bacteria | 1022 |
| 156 | Ga0081538_10224873 | 3300005981 | Unclassified | 740 |
| 157 | Ga0081540_1000100 | 3300005983 | Bacteria | 91640 |
| 158 | Ga0081540_1000366 | 3300005983 | Bacteria | 45428 |
| 159 | Ga0081540_1083410 | 3300005983 | Bacteria | 1430 |
| 160 | Ga0081539_10000878 | 3300005985 | Bacteria | 57633 |
| 161 | Ga0081539_10024074 | 3300005985 | Bacteria | 3963 |
| 162 | Ga0070717_10296430 | 3300006028 | Bacteria | 1437 |
| 163 | Ga0075365_10002366 | 3300006038 | Bacteria | 9203 |
| 164 | Ga0075365_10018720 | 3300006038 | Bacteria | 4264 |
| 165 | Ga0075365_10156417 | 3300006038 | Bacteria | 1587 |
| 166 | Ga0075365_10376304 | 3300006038 | Bacteria | 1002 |
| 167 | Ga0075365_10381470 | 3300006038 | Bacteria | 994 |
| 168 | Ga0075368_10245708 | 3300006042 | Unclassified | 764 |
| 169 | Ga0075363_100001314 | 3300006048 | Bacteria | 9286 |
| 170 | Ga0075363_100014606 | 3300006048 | Bacteria | 3843 |
| 171 | Ga0075363_100143851 | 3300006048 | Bacteria | 1344 |
| 172 | Ga0075363_100356770 | 3300006048 | Bacteria | 854 |
| 173 | Ga0075364_10028746 | 3300006051 | Bacteria | 3560 |
| 174 | Ga0075364_10049695 | 3300006051 | Bacteria | 2736 |
| 175 | Ga0075364_10212352 | 3300006051 | Bacteria | 1312 |
| 176 | Ga0075364_10440909 | 3300006051 | Bacteria | 890 |
| 177 | Ga0075364_10706725 | 3300006051 | Bacteria | 688 |
| 178 | Ga0070715_10000021 | 3300006163 | Bacteria | 119283 |
| 179 | Ga0070712_100102609 | 3300006175 | Bacteria | 2119 |
| 180 | Ga0075362_10252284 | 3300006177 | Bacteria | 868 |
| 181 | Ga0075367_10168207 | 3300006178 | Bacteria | 1365 |
| 182 | Ga0075367_10369945 | 3300006178 | Unclassified | 905 |
| 183 | Ga0075367_10414097 | 3300006178 | Bacteria | 853 |
| 184 | Ga0075370_10335443 | 3300006353 | Bacteria | 902 |
| 185 | Ga0075428_101249534 | 3300006844 | Unclassified | 782 |
| 186 | Ga0075431_100918088 | 3300006847 | Bacteria | 845 |
| 187 | Ga0075433_10000897 | 3300006852 | Bacteria | 20988 |
| 188 | Ga0075433_10033900 | 3300006852 | Bacteria | 4381 |
| 189 | Ga0075433_10683866 | 3300006852 | Bacteria | 899 |
| 190 | Ga0068865_100000082 | 3300006881 | Bacteria | 50913 |
| 191 | Ga0068865_100007004 | 3300006881 | Bacteria | 6917 |
| 192 | Ga0097620_100275903 | 3300006931 | Bacteria | 1774 |
| 193 | Ga0097620_100759148 | 3300006931 | Bacteria | 1059 |
| 194 | Ga0075435_100168077 | 3300007076 | Bacteria | 1850 |
| 195 | Ga0105240_10384233 | 3300009093 | Bacteria | 1585 |
| 196 | Ga0105240_10809020 | 3300009093 | Bacteria | 1015 |
| 197 | Ga0111539_10639660 | 3300009094 | Bacteria | 1239 |
| 198 | Ga0105245_10000278 | 3300009098 | Bacteria | 48473 |
| 199 | Ga0105245_10000415 | 3300009098 | Bacteria | 39764 |
| 200 | Ga0105245_10001311 | 3300009098 | Bacteria | 22474 |
| 201 | Ga0105245_10035031 | 3300009098 | Bacteria | 4453 |
| 202 | Ga0105245_10173186 | 3300009098 | Bacteria | 2056 |
| 203 | Ga0105245_10866650 | 3300009098 | Bacteria | 944 |
| 204 | Ga0105247_10001706 | 3300009101 | Bacteria | 15492 |
| 205 | Ga0105247_10174168 | 3300009101 | Bacteria | 1432 |
| 206 | Ga0114129_10027328 | 3300009147 | Bacteria | 8079 |
| 207 | Ga0114129_10119702 | 3300009147 | Bacteria | 3626 |
| 208 | Ga0114129_11011700 | 3300009147 | Bacteria | 1046 |
| 209 | Ga0105243_10003503 | 3300009148 | Bacteria | 12673 |
| 210 | Ga0105243_10007118 | 3300009148 | Bacteria | 8605 |
| 211 | Ga0105243_10165704 | 3300009148 | Bacteria | 1909 |
| 212 | Ga0105243_10379698 | 3300009148 | Bacteria | 1307 |
| 213 | Ga0105243_10530373 | 3300009148 | Bacteria | 1121 |
| 214 | Ga0105241_10069956 | 3300009174 | Bacteria | 2722 |
| 215 | Ga0105241_10160467 | 3300009174 | Bacteria | 1848 |
| 216 | Ga0105242_10000449 | 3300009176 | Bacteria | 32713 |
| 217 | Ga0105242_10000653 | 3300009176 | Bacteria | 27161 |
| 218 | Ga0105242_10017935 | 3300009176 | Bacteria | 5528 |
| 219 | Ga0105242_10308575 | 3300009176 | Bacteria | 1447 |
| 220 | Ga0105242_10574937 | 3300009176 | Bacteria | 1084 |
| 221 | Ga0105242_10775178 | 3300009176 | Bacteria | 947 |
| 222 | Ga0105242_12416894 | 3300009176 | Bacteria | 573 |
| 223 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 224 | Ga0105248_10305649 | 3300009177 | Bacteria | 1791 |
| 225 | Ga0105237_10107344 | 3300009545 | Bacteria | 2784 |
| 226 | Ga0105238_10000055 | 3300009551 | Bacteria | 139232 |
| 227 | Ga0105249_10000143 | 3300009553 | Bacteria | 92539 |
| 228 | Ga0105249_10003360 | 3300009553 | Bacteria | 13850 |
| 229 | Ga0105249_10096461 | 3300009553 | Bacteria | 2774 |
| 230 | Ga0105249_12663713 | 3300009553 | Bacteria | 572 |
| 231 | Ga0105239_10261216 | 3300010375 | Bacteria | 1946 |
| 232 | Ga0105239_10524755 | 3300010375 | Bacteria | 1347 |
| 233 | Ga0105246_10709386 | 3300011119 | Bacteria | 883 |
| 234 | Ga0105246_11618017 | 3300011119 | Bacteria | 613 |
| 235 | Ga0157337_1013043 | 3300012483 | Bacteria | 679 |
| 236 | Ga0157371_10001577 | 3300013102 | Bacteria | 23401 |
| 237 | Ga0157371_11288276 | 3300013102 | Bacteria | 565 |
| 238 | Ga0157370_10003254 | 3300013104 | Bacteria | 19142 |
| 239 | Ga0157370_10047400 | 3300013104 | Bacteria | 4120 |
| 240 | Ga0157370_10629691 | 3300013104 | Bacteria | 981 |
| 241 | Ga0157369_10000074 | 3300013105 | Bacteria | 136668 |
| 242 | Ga0157374_10000486 | 3300013296 | Bacteria | 35981 |
| 243 | Ga0157374_10275238 | 3300013296 | Bacteria | 1661 |
| 244 | Ga0157374_10384590 | 3300013296 | Bacteria | 1398 |
| 245 | Ga0157374_10669027 | 3300013296 | Bacteria | 1050 |
| 246 | Ga0157378_10003241 | 3300013297 | Bacteria | 14481 |
| 247 | Ga0157378_10040737 | 3300013297 | Bacteria | 4120 |
| 248 | Ga0157378_10093937 | 3300013297 | Bacteria | 2731 |
| 249 | Ga0157378_10628867 | 3300013297 | Bacteria | 1087 |
| 250 | Ga0157378_10978479 | 3300013297 | Bacteria | 879 |
| 251 | Ga0163162_10556987 | 3300013306 | Bacteria | 1274 |
| 252 | Ga0157372_10000053 | 3300013307 | Bacteria | 128824 |
| 253 | Ga0157372_10042342 | 3300013307 | Bacteria | 5036 |
| 254 | Ga0157375_10003797 | 3300013308 | Bacteria | 13096 |
| 255 | Ga0157375_10013296 | 3300013308 | Bacteria | 7320 |
| 256 | Ga0157375_13582365 | 3300013308 | Bacteria | 517 |
| 257 | Ga0163163_11167379 | 3300014325 | Bacteria | 833 |
| 258 | Ga0157380_10000016 | 3300014326 | Bacteria | 126029 |
| 259 | Ga0157380_10000236 | 3300014326 | Bacteria | 33220 |
| 260 | Ga0157380_10012273 | 3300014326 | Bacteria | 6208 |
| 261 | Ga0157379_10148336 | 3300014968 | Bacteria | 2115 |
| 262 | Ga0157379_10161252 | 3300014968 | Bacteria | 2024 |
| 263 | Ga0157379_10417767 | 3300014968 | Bacteria | 1235 |
| 264 | Ga0157379_10588730 | 3300014968 | Bacteria | 1037 |
| 265 | Ga0157376_10027214 | 3300014969 | Bacteria | 4530 |
| 266 | Ga0157376_10074468 | 3300014969 | Bacteria | 2894 |
| 267 | Ga0157376_11848914 | 3300014969 | Unclassified | 640 |
| 268 | Ga0163161_10000053 | 3300017792 | Bacteria | 117408 |
| 269 | Ga0163161_10175041 | 3300017792 | Bacteria | 1642 |
| 270 | Ga0163161_10286057 | 3300017792 | Bacteria | 1294 |
| 271 | Ga0163161_10668428 | 3300017792 | Bacteria | 862 |
| 272 | Ga0206356_10868657 | 3300020070 | Bacteria | 651 |
| 273 | Ga0154015_1555886 | 3300020610 | Bacteria | 848 |
| 274 | Ga0213876_10451361 | 3300021384 | Bacteria | 684 |
| 275 | Ga0207656_10000226 | 3300025321 | Bacteria | 20150 |
| 276 | Ga0207656_10027875 | 3300025321 | Bacteria | 2314 |
| 277 | Ga0207692_10166323 | 3300025898 | Bacteria | 1275 |
| 278 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 279 | Ga0207642_10000080 | 3300025899 | Bacteria | 25169 |
| 280 | Ga0207710_10000157 | 3300025900 | Bacteria | 72764 |
| 281 | Ga0207688_10008563 | 3300025901 | Bacteria | 5568 |
| 282 | Ga0207680_10002942 | 3300025903 | Bacteria | 7986 |
| 283 | Ga0207680_10056099 | 3300025903 | Bacteria | 2378 |
| 284 | Ga0207680_10247229 | 3300025903 | Bacteria | 1231 |
| 285 | Ga0207685_10000054 | 3300025905 | Bacteria | 35900 |
| 286 | Ga0207685_10070642 | 3300025905 | Bacteria | 1414 |
| 287 | Ga0207699_10729075 | 3300025906 | Bacteria | 726 |
| 288 | Ga0207705_10082216 | 3300025909 | Bacteria | 2349 |
| 289 | Ga0207654_10057938 | 3300025911 | Bacteria | 2253 |
| 290 | Ga0207707_10289153 | 3300025912 | Bacteria | 1418 |
| 291 | Ga0207707_10708359 | 3300025912 | Bacteria | 845 |
| 292 | Ga0207671_10728427 | 3300025914 | Bacteria | 788 |
| 293 | Ga0207693_10050125 | 3300025915 | Bacteria | 3279 |
| 294 | Ga0207693_10103235 | 3300025915 | Bacteria | 2236 |
| 295 | Ga0207663_10023302 | 3300025916 | Bacteria | 3550 |
| 296 | Ga0207663_10245295 | 3300025916 | Bacteria | 1316 |
| 297 | Ga0207660_10161370 | 3300025917 | Bacteria | 1730 |
| 298 | Ga0207660_10170427 | 3300025917 | Bacteria | 1685 |
| 299 | Ga0207657_10000636 | 3300025919 | Bacteria | 37227 |
| 300 | Ga0207649_10000127 | 3300025920 | Bacteria | 64603 |
| 301 | Ga0207649_10033692 | 3300025920 | Bacteria | 3063 |
| 302 | Ga0207649_10591112 | 3300025920 | Bacteria | 853 |
| 303 | Ga0207652_10000321 | 3300025921 | Bacteria | 49720 |
| 304 | Ga0207652_10001733 | 3300025921 | Bacteria | 19037 |
| 305 | Ga0207652_10193435 | 3300025921 | Bacteria | 1830 |
| 306 | Ga0207681_10135411 | 3300025923 | Bacteria | 1827 |
| 307 | Ga0207694_10000063 | 3300025924 | Bacteria | 139700 |
| 308 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 309 | Ga0207659_10036774 | 3300025926 | Bacteria | 3395 |
| 310 | Ga0207687_10000032 | 3300025927 | Bacteria | 143196 |
| 311 | Ga0207687_10000036 | 3300025927 | Bacteria | 121934 |
| 312 | Ga0207687_10000460 | 3300025927 | Bacteria | 27723 |
| 313 | Ga0207687_10003112 | 3300025927 | Bacteria | 11249 |
| 314 | Ga0207687_10011833 | 3300025927 | Bacteria | 5708 |
| 315 | Ga0207700_10000033 | 3300025928 | Bacteria | 123113 |
| 316 | Ga0207664_10112012 | 3300025929 | Bacteria | 2271 |
| 317 | Ga0207644_10056710 | 3300025931 | Bacteria | 2827 |
| 318 | Ga0207690_10002634 | 3300025932 | Bacteria | 10804 |
| 319 | Ga0207690_10074923 | 3300025932 | Bacteria | 2345 |
| 320 | Ga0207690_10082969 | 3300025932 | Bacteria | 2243 |
| 321 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 322 | Ga0207706_10027571 | 3300025933 | Bacteria | 5078 |
| 323 | Ga0207706_10270954 | 3300025933 | Bacteria | 1481 |
| 324 | Ga0207686_10000097 | 3300025934 | Bacteria | 72219 |
| 325 | Ga0207686_10000921 | 3300025934 | Bacteria | 17629 |
| 326 | Ga0207686_10019225 | 3300025934 | Bacteria | 3882 |
| 327 | Ga0207686_10264992 | 3300025934 | Bacteria | 1261 |
| 328 | Ga0207686_10644370 | 3300025934 | Bacteria | 838 |
| 329 | Ga0207709_10005868 | 3300025935 | Bacteria | 6935 |
| 330 | Ga0207709_10023552 | 3300025935 | Bacteria | 3506 |
| 331 | Ga0207669_10000017 | 3300025937 | Bacteria | 119878 |
| 332 | Ga0207669_10000026 | 3300025937 | Bacteria | 92199 |
| 333 | Ga0207704_10000184 | 3300025938 | Bacteria | 32775 |
| 334 | Ga0207691_10000017 | 3300025940 | Bacteria | 134441 |
| 335 | Ga0207691_10056114 | 3300025940 | Bacteria | 3589 |
| 336 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 337 | Ga0207689_10466253 | 3300025942 | Bacteria | 1057 |
| 338 | Ga0207661_10002110 | 3300025944 | Bacteria | 13678 |
| 339 | Ga0207661_10004460 | 3300025944 | Bacteria | 9836 |
| 340 | Ga0207661_10052819 | 3300025944 | Bacteria | 3249 |
| 341 | Ga0207661_10337590 | 3300025944 | Bacteria | 1357 |
| 342 | Ga0207661_10370703 | 3300025944 | Bacteria | 1294 |
| 343 | Ga0207679_10004050 | 3300025945 | Bacteria | 9104 |
| 344 | Ga0207679_10045587 | 3300025945 | Bacteria | 3172 |
| 345 | Ga0207651_10016930 | 3300025960 | Bacteria | 4290 |
| 346 | Ga0207651_10017969 | 3300025960 | Bacteria | 4194 |
| 347 | Ga0207712_10000058 | 3300025961 | Bacteria | 140948 |
| 348 | Ga0207712_10058206 | 3300025961 | Bacteria | 2730 |
| 349 | Ga0207668_10036707 | 3300025972 | Bacteria | 3273 |
| 350 | Ga0207668_10235463 | 3300025972 | Bacteria | 1478 |
| 351 | Ga0207640_10000093 | 3300025981 | Bacteria | 70374 |
| 352 | Ga0207640_10034577 | 3300025981 | Bacteria | 3155 |
| 353 | Ga0207658_10003551 | 3300025986 | Bacteria | 11011 |
| 354 | Ga0207658_10018897 | 3300025986 | Bacteria | 4766 |
| 355 | Ga0207658_10333568 | 3300025986 | Bacteria | 1316 |
| 356 | Ga0207677_10001038 | 3300026023 | Bacteria | 15272 |
| 357 | Ga0207677_10006605 | 3300026023 | Bacteria | 6362 |
| 358 | Ga0207677_10109007 | 3300026023 | Bacteria | 2058 |
| 359 | Ga0207703_10000061 | 3300026035 | Bacteria | 132671 |
| 360 | Ga0207703_10000385 | 3300026035 | Bacteria | 47298 |
| 361 | Ga0207703_10236705 | 3300026035 | Bacteria | 1640 |
| 362 | Ga0207703_10395833 | 3300026035 | Bacteria | 1281 |
| 363 | Ga0207639_10005999 | 3300026041 | Bacteria | 8242 |
| 364 | Ga0207639_10058185 | 3300026041 | Bacteria | 2972 |
| 365 | Ga0207639_10169391 | 3300026041 | Bacteria | 1848 |
| 366 | Ga0207639_10973510 | 3300026041 | Bacteria | 794 |
| 367 | Ga0207678_10002224 | 3300026067 | Bacteria | 17527 |
| 368 | Ga0207678_10032404 | 3300026067 | Bacteria | 4554 |
| 369 | Ga0207708_10002447 | 3300026075 | Bacteria | 13650 |
| 370 | Ga0207708_10204711 | 3300026075 | Bacteria | 1576 |
| 371 | Ga0207708_10227558 | 3300026075 | Bacteria | 1496 |
| 372 | Ga0207702_10000637 | 3300026078 | Bacteria | 38379 |
| 373 | Ga0207702_10221539 | 3300026078 | Bacteria | 1763 |
| 374 | Ga0207702_11658441 | 3300026078 | Bacteria | 632 |
| 375 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 376 | Ga0207641_10007724 | 3300026088 | Bacteria | 8939 |
| 377 | Ga0207641_10219771 | 3300026088 | Bacteria | 1761 |
| 378 | Ga0207641_10416146 | 3300026088 | Bacteria | 1293 |
| 379 | Ga0207641_10953625 | 3300026088 | Unclassified | 853 |
| 380 | Ga0207648_10017486 | 3300026089 | Bacteria | 6522 |
| 381 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 382 | Ga0207674_10054549 | 3300026116 | Bacteria | 4068 |
| 383 | Ga0207674_10090964 | 3300026116 | Bacteria | 3042 |
| 384 | Ga0207675_100100271 | 3300026118 | Bacteria | 2728 |
| 385 | Ga0207675_101617495 | 3300026118 | Bacteria | 668 |
| 386 | Ga0207683_10132710 | 3300026121 | Bacteria | 2240 |
| 387 | Ga0207683_10164109 | 3300026121 | Bacteria | 2009 |
| 388 | Ga0207683_10257607 | 3300026121 | Bacteria | 1593 |
| 389 | Ga0207683_10331770 | 3300026121 | Bacteria | 1394 |
| 390 | Ga0207683_10683425 | 3300026121 | Bacteria | 951 |
| 391 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 392 | Ga0207698_10005530 | 3300026142 | Bacteria | 7819 |
| 393 | Ga0207698_10013220 | 3300026142 | Bacteria | 5437 |
| 394 | Ga0207698_11932981 | 3300026142 | Bacteria | 605 |
| 395 | Ga0268266_10000056 | 3300028379 | Bacteria | 289176 |
| 396 | Ga0268266_10000601 | 3300028379 | Bacteria | 49250 |
| 397 | Ga0268266_10001254 | 3300028379 | Bacteria | 31003 |
| 398 | Ga0268266_10006356 | 3300028379 | Bacteria | 10831 |
| 399 | Ga0268266_10235712 | 3300028379 | Bacteria | 1687 |
| 400 | Ga0268266_10238666 | 3300028379 | Bacteria | 1677 |
| 401 | Ga0268265_10114943 | 3300028380 | Bacteria | 2205 |
| 402 | Ga0268264_10016645 | 3300028381 | Bacteria | 6021 |
| 403 | Ga0268264_10581070 | 3300028381 | Bacteria | 1102 |
| 404 | Ga0268264_11155999 | 3300028381 | Bacteria | 783 |
| 405 | Ga0265337_1000066 | 3300028556 | Bacteria | 48673 |
| 406 | Ga0265326_10000019 | 3300028558 | Bacteria | 137370 |
| 407 | Ga0265319_1000469 | 3300028563 | Bacteria | 28589 |
| 408 | Ga0265323_10102148 | 3300028653 | Bacteria | 948 |
| 409 | Ga0265322_10000011 | 3300028654 | Bacteria | 167597 |
| 410 | Ga0265336_10003168 | 3300028666 | Bacteria | 6540 |
| 411 | Ga0265338_10000244 | 3300028800 | Bacteria | 100528 |
| 412 | Ga0265338_10282917 | 3300028800 | Bacteria | 1211 |
| 413 | Ga0265324_10000283 | 3300029957 | Bacteria | 37587 |
| 414 | Ga0265324_10051394 | 3300029957 | Bacteria | 1416 |
| 415 | Ga0307511_10082915 | 3300030521 | Bacteria | 2238 |
| 416 | Ga0265328_10000737 | 3300031239 | Bacteria | 15188 |
| 417 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 418 | Ga0265329_10016232 | 3300031242 | Bacteria | 2585 |
| 419 | Ga0265331_10000858 | 3300031250 | Bacteria | 24739 |
| 420 | Ga0265331_10047145 | 3300031250 | Bacteria | 2074 |
| 421 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 422 | Ga0265316_10047188 | 3300031344 | Bacteria | 3408 |
| 423 | Ga0265316_10538901 | 3300031344 | Bacteria | 831 |
| 424 | Ga0307408_100219381 | 3300031548 | Bacteria | 1551 |
| 425 | Ga0316579_10214626 | 3300031691 | Unclassified | 930 |
| 426 | Ga0265314_10000640 | 3300031711 | Bacteria | 42944 |
| 427 | Ga0265342_10048932 | 3300031712 | Bacteria | 2532 |
| 428 | Ga0316576_10840742 | 3300031727 | Unclassified | 659 |
| 429 | Ga0307405_10491037 | 3300031731 | Bacteria | 982 |
| 430 | Ga0316577_10251762 | 3300031733 | Unclassified | 999 |
| 431 | Ga0307413_10324320 | 3300031824 | Bacteria | 1178 |
| 432 | Ga0307409_100429704 | 3300031995 | Bacteria | 1269 |
| 433 | Ga0307416_100007153 | 3300032002 | Bacteria | 7060 |
| 434 | Ga0307415_100023712 | 3300032126 | Bacteria | 3816 |
| 435 | Ga0316583_10045544 | 3300032133 | Bacteria | 1549 |
| 436 | Ga0373936_0279256 | 3300035113 | Bacteria | 750 |
| 437 | Ga0373956_0368746 | 3300035119 | Bacteria | 685 |
| 438 | Ga0373957_0098034 | 3300035120 | Bacteria | 1171 |
| 439 | Ga0316574_0068576 | 3300035398 | Bacteria | 2237 |
| 440 | Ga0316574_0124337 | 3300035398 | Bacteria | 1657 |
| 441 | Ga0316574_0844129 | 3300035398 | Unclassified | 556 |
| 442 | Ga0373937_0053338 | 3300036401 | Bacteria | 3709 |
| 443 | Ga0373937_0090584 | 3300036401 | Bacteria | 2832 |
| 444 | Ga0373937_1027542 | 3300036401 | Bacteria | 773 |
| 445 | Ga0373937_1276367 | 3300036401 | Bacteria | 682 |
| 446 | Ga0316582_0659968 | 3300036647 | Unclassified | 719 |
| 447 | Ga0316584_0001782 | 3300036712 | Bacteria | 13265 |
| 448 | Ga0395899_0577093 | 3300037312 | Bacteria | 719 |
| 449 | Ga0395900_0165224 | 3300037418 | Bacteria | 2256 |
| 450 | Ga0395900_0411672 | 3300037418 | Bacteria | 1314 |
| 451 | Ga0395900_0753030 | 3300037418 | Bacteria | 904 |
| 452 | Ga0395905_0849876 | 3300037471 | Bacteria | 816 |
| 453 | Ga0395901_0179840 | 3300038443 | Bacteria | 2218 |
| 454 | Ga0395901_0190166 | 3300038443 | Bacteria | 2153 |
| 455 | Ga0395901_0369251 | 3300038443 | Bacteria | 1478 |
| 456 | Ga0395901_0563530 | 3300038443 | Bacteria | 1153 |
| 457 | Ga0436365_1901572 | 3300039437 | Bacteria | 608 |
| 458 | Ga0451800_0147095 | 3300041459 | Bacteria | 1880 |
| 459 | Ga0451804_0150049 | 3300041463 | Bacteria | 999 |
| 460 | Ga0451807_1807140 | 3300041486 | Bacteria | 1001 |
| 461 | Ga0451839_1143849 | 3300041496 | Bacteria | 1288 |
| 462 | Ga0451845_0708268 | 3300041501 | Bacteria | 1092 |
| 463 | Ga0451843_0715326 | 3300041509 | Unclassified | 682 |
| 464 | Ga0451853_3832956 | 3300041512 | Bacteria | 1042 |
| 465 | Ga0466963_0000017 | 3300044694 | Bacteria | 58283 |
| 466 | Ga0466963_0358016 | 3300044694 | Bacteria | 1028 |
| 467 | Ga0466968_0401672 | 3300044735 | Bacteria | 672 |
| 468 | Ga0466957_0001414 | 3300044842 | Bacteria | 12517 |
| 469 | Ga0466960_0107322 | 3300044901 | Bacteria | 1446 |
| 470 | Ga0466960_0364103 | 3300044901 | Bacteria | 827 |
| 471 | Ga0466958_0010414 | 3300045836 | Bacteria | 5207 |
| 472 | Ga0466967_0000001 | 3300045976 | Bacteria | 229823 |
| 473 | Ga0466967_0089398 | 3300045976 | Bacteria | 2797 |
| 474 | Ga0466967_0506338 | 3300045976 | Bacteria | 1185 |
| 475 | Ga0466967_1397797 | 3300045976 | Bacteria | 697 |
| 476 | Ga0495592_0000607 | 3300046454 | Bacteria | 25304 |
| 477 | Ga0495592_0128862 | 3300046454 | Bacteria | 1772 |
| 478 | Ga0495592_0141108 | 3300046454 | Bacteria | 1676 |
| 479 | Ga0495592_0217497 | 3300046454 | Bacteria | 1279 |
| 480 | Ga0495603_0000286 | 3300046455 | Bacteria | 26902 |
| 481 | Ga0495603_0001350 | 3300046455 | Bacteria | 14245 |
| 482 | Ga0495603_0023918 | 3300046455 | Bacteria | 3695 |
| 483 | Ga0495591_038251 | 3300046458 | Bacteria | 1383 |
| 484 | Ga0495629_0000245 | 3300046459 | Bacteria | 47272 |
| 485 | Ga0495629_0004704 | 3300046459 | Bacteria | 10231 |
| 486 | Ga0495629_0005286 | 3300046459 | Bacteria | 9650 |
| 487 | Ga0495629_0079298 | 3300046459 | Bacteria | 2293 |
| 488 | Ga0495641_0000005 | 3300046461 | Bacteria | 206626 |
| 489 | Ga0495641_0014257 | 3300046461 | Bacteria | 4308 |
| 490 | Ga0495641_0038618 | 3300046461 | Bacteria | 2230 |
| 491 | Ga0495641_0065442 | 3300046461 | Bacteria | 1636 |
| 492 | Ga0495651_0028208 | 3300046462 | Bacteria | 4375 |
| 493 | Ga0495651_0254350 | 3300046462 | Bacteria | 1198 |
| 494 | Ga0495651_0388555 | 3300046462 | Bacteria | 913 |
| 495 | Ga0495653_0092883 | 3300046463 | Bacteria | 2202 |
| 496 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 497 | Ga0495662_0000001 | 3300046476 | Bacteria | 179185 |
| 498 | Ga0495662_0000848 | 3300046476 | Bacteria | 14886 |
| 499 | Ga0495662_0299230 | 3300046476 | Bacteria | 791 |
| 500 | Ga0495664_0801046 | 3300046477 | Bacteria | 554 |
| 501 | Ga0495584_0250155 | 3300046491 | Bacteria | 901 |
| 502 | Ga0495594_0000089 | 3300046499 | Bacteria | 41876 |
| 503 | Ga0495596_0261213 | 3300046500 | Unclassified | 672 |
| 504 | Ga0495596_0323719 | 3300046500 | Bacteria | 600 |
| 505 | Ga0495606_0000040 | 3300046507 | Bacteria | 223500 |
| 506 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 507 | Ga0495608_0003541 | 3300046511 | Bacteria | 11187 |
| 508 | Ga0495608_0053168 | 3300046511 | Bacteria | 2680 |
| 509 | Ga0495608_0094331 | 3300046511 | Bacteria | 1933 |
| 510 | Ga0495618_0000014 | 3300046514 | Bacteria | 163136 |
| 511 | Ga0495620_0000784 | 3300046515 | Bacteria | 19458 |
| 512 | Ga0495628_0005372 | 3300046516 | Bacteria | 11234 |
| 513 | Ga0495628_0023790 | 3300046516 | Bacteria | 5023 |
| 514 | Ga0495628_0066303 | 3300046516 | Bacteria | 2822 |
| 515 | Ga0495628_0074598 | 3300046516 | Bacteria | 2642 |
| 516 | Ga0495628_0101305 | 3300046516 | Bacteria | 2222 |
| 517 | Ga0495628_0159293 | 3300046516 | Bacteria | 1716 |
| 518 | Ga0495628_0240240 | 3300046516 | Bacteria | 1355 |
| 519 | Ga0495630_0000014 | 3300046517 | Bacteria | 217229 |
| 520 | Ga0495630_0000533 | 3300046517 | Bacteria | 27959 |
| 521 | Ga0495630_0003407 | 3300046517 | Bacteria | 11078 |
| 522 | Ga0495630_0219226 | 3300046517 | Bacteria | 1452 |
| 523 | Ga0495632_0167686 | 3300046519 | Bacteria | 1010 |
| 524 | Ga0495632_0278678 | 3300046519 | Bacteria | 745 |
| 525 | Ga0495637_0229073 | 3300046520 | Bacteria | 674 |
| 526 | Ga0495644_0001871 | 3300046523 | Bacteria | 8485 |
| 527 | Ga0495652_0000037 | 3300046529 | Bacteria | 133232 |
| 528 | Ga0495652_0011995 | 3300046529 | Bacteria | 7834 |
| 529 | Ga0495652_0329517 | 3300046529 | Bacteria | 1100 |
| 530 | Ga0495652_0496417 | 3300046529 | Bacteria | 847 |
| 531 | Ga0495640_0024325 | 3300046533 | Bacteria | 4408 |
| 532 | Ga0495640_0091728 | 3300046533 | Bacteria | 2004 |
| 533 | Ga0495640_0202996 | 3300046533 | Bacteria | 1256 |
| 534 | Ga0495640_0668817 | 3300046533 | Bacteria | 624 |
| 535 | Ga0495586_0003054 | 3300046535 | Bacteria | 9025 |
| 536 | Ga0495586_0508235 | 3300046535 | Bacteria | 695 |
| 537 | Ga0495587_0003966 | 3300046536 | Bacteria | 9814 |
| 538 | Ga0495587_0244258 | 3300046536 | Bacteria | 1010 |
| 539 | Ga0495587_0245051 | 3300046536 | Bacteria | 1008 |
| 540 | Ga0495598_0001582 | 3300046537 | Bacteria | 4560 |
| 541 | Ga0495621_0033813 | 3300046539 | Bacteria | 1764 |
| 542 | Ga0495645_0027447 | 3300046543 | Bacteria | 4137 |
| 543 | Ga0495645_0166294 | 3300046543 | Bacteria | 1521 |
| 544 | Ga0495645_0310285 | 3300046543 | Bacteria | 1027 |
| 545 | Ga0495622_0000080 | 3300046557 | Bacteria | 85557 |
| 546 | Ga0495633_0294546 | 3300046558 | Bacteria | 737 |
| 547 | Ga0495667_0000020 | 3300046559 | Bacteria | 180876 |
| 548 | Ga0495656_0000465 | 3300046615 | Bacteria | 13215 |
| 549 | Ga0495656_0209816 | 3300046615 | Bacteria | 970 |
| 550 | Ga0495668_0041252 | 3300046616 | Bacteria | 2572 |
| 551 | Ga0495634_0000028 | 3300046642 | Bacteria | 114075 |
| 552 | Ga0495634_0001744 | 3300046642 | Bacteria | 18826 |
| 553 | Ga0495634_0182420 | 3300046642 | Bacteria | 1313 |
| 554 | Ga0495634_0324706 | 3300046642 | Bacteria | 926 |
| 555 | Ga0495634_0368028 | 3300046642 | Bacteria | 858 |
| 556 | Ga0495634_0369367 | 3300046642 | Bacteria | 856 |
| 557 | Ga0495611_0368595 | 3300046648 | Bacteria | 658 |
| 558 | Ga0495625_0000349 | 3300046660 | Bacteria | 70631 |
| 559 | Ga0495625_0076676 | 3300046660 | Bacteria | 2337 |
| 560 | Ga0495635_0000076 | 3300046663 | Bacteria | 61665 |
| 561 | Ga0495635_0034289 | 3300046663 | Bacteria | 3521 |
| 562 | Ga0495635_0379265 | 3300046663 | Bacteria | 941 |
| 563 | Ga0495588_0000362 | 3300046674 | Bacteria | 28212 |
| 564 | Ga0495588_0301285 | 3300046674 | Unclassified | 844 |
| 565 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 566 | Ga0495657_0017364 | 3300046675 | Bacteria | 5226 |
| 567 | Ga0495657_0218471 | 3300046675 | Bacteria | 1156 |
| 568 | Ga0495599_0036072 | 3300046678 | Bacteria | 3104 |
| 569 | Ga0495599_0668254 | 3300046678 | Bacteria | 601 |
| 570 | Ga0495623_0055970 | 3300046679 | Bacteria | 2484 |
| 571 | Ga0495623_0124236 | 3300046679 | Bacteria | 1551 |
| 572 | Ga0495646_0201490 | 3300046680 | Bacteria | 1084 |
| 573 | Ga0495647_0000001 | 3300046681 | Bacteria | 222371 |
| 574 | Ga0495647_0000684 | 3300046681 | Bacteria | 10113 |
| 575 | Ga0495647_0005148 | 3300046681 | Bacteria | 4281 |
| 576 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 577 | Ga0495658_0019725 | 3300046683 | Bacteria | 3524 |
| 578 | Ga0495658_0122526 | 3300046683 | Bacteria | 1574 |
| 579 | Ga0495669_0000113 | 3300046684 | Bacteria | 52780 |
| 580 | Ga0495613_0000005 | 3300046689 | Bacteria | 222558 |
| 581 | Ga0495613_0000041 | 3300046689 | Bacteria | 130784 |
| 582 | Ga0495613_0140545 | 3300046689 | Bacteria | 1725 |
| 583 | Ga0495613_0220715 | 3300046689 | Bacteria | 1331 |
| 584 | Ga0495624_0000019 | 3300046690 | Bacteria | 102237 |
| 585 | Ga0495624_0000417 | 3300046690 | Bacteria | 33743 |
| 586 | Ga0495624_0033290 | 3300046690 | Bacteria | 3338 |
| 587 | Ga0495624_0372530 | 3300046690 | Bacteria | 858 |
| 588 | Ga0495670_0020649 | 3300046691 | Bacteria | 3248 |
| 589 | Ga0495649_0002403 | 3300046694 | Bacteria | 13212 |
| 590 | Ga0495600_0011717 | 3300046809 | Bacteria | 5472 |
| 591 | Ga0495600_0034654 | 3300046809 | Bacteria | 3278 |
| 592 | Ga0495581_0147758 | 3300047315 | Bacteria | 1372 |
| 593 | Ga0495604_0000239 | 3300047317 | Bacteria | 49113 |
| 594 | Ga0495604_0001251 | 3300047317 | Bacteria | 20805 |
| 595 | Ga0495604_0003401 | 3300047317 | Bacteria | 12686 |
| 596 | Ga0495604_0190723 | 3300047317 | Bacteria | 1428 |
| 597 | Ga0495674_0000030 | 3300047319 | Bacteria | 115975 |
| 598 | Ga0495674_0639066 | 3300047319 | Bacteria | 840 |
| 599 | Ga0495672_0148694 | 3300047320 | Bacteria | 1217 |
| 600 | Ga0495676_0000827 | 3300047321 | Bacteria | 25944 |
| 601 | Ga0495676_0001461 | 3300047321 | Bacteria | 20394 |
| 602 | Ga0495676_0012579 | 3300047321 | Bacteria | 7619 |
| 603 | Ga0495676_0085869 | 3300047321 | Bacteria | 2370 |
| 604 | Ga0495680_0000143 | 3300047322 | Bacteria | 71946 |
| 605 | Ga0495680_0001430 | 3300047322 | Bacteria | 25733 |
| 606 | Ga0495680_0022126 | 3300047322 | Bacteria | 5308 |
| 607 | Ga0495680_0039154 | 3300047322 | Bacteria | 3783 |
| 608 | Ga0495680_0188089 | 3300047322 | Bacteria | 1486 |
| 609 | Ga0495675_0001421 | 3300047444 | Bacteria | 14505 |
| 610 | Ga0495675_0008742 | 3300047444 | Bacteria | 6286 |
| 611 | Ga0495679_007662 | 3300047446 | Bacteria | 4477 |
| 612 | Ga0495684_0087952 | 3300047471 | Bacteria | 2355 |
| 613 | Ga0495593_0039645 | 3300047673 | Bacteria | 2539 |
| 614 | Ga0495593_0057583 | 3300047673 | Bacteria | 2040 |
| 615 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 616 | Ga0495602_0001031 | 3300048088 | Bacteria | 27141 |
| 617 | Ga0495602_0151755 | 3300048088 | Bacteria | 1820 |
| 618 | Ga0495602_0557479 | 3300048088 | Bacteria | 793 |
| 619 | Ga0495602_0912922 | 3300048088 | Bacteria | 584 |
| 620 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 621 | Ga0496100_0000013 | 3300048903 | Bacteria | 177476 |
| 622 | Ga0496100_0027464 | 3300048903 | Bacteria | 3500 |
| 623 | Ga0496100_0434207 | 3300048903 | Unclassified | 1005 |
| 624 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 625 | Ga0496101_0000035 | 3300048904 | Bacteria | 177237 |
| 626 | Ga0496101_0000894 | 3300048904 | Bacteria | 17535 |
| 627 | Ga0496101_0100950 | 3300048904 | Bacteria | 2160 |
| 628 | Ga0496101_0429650 | 3300048904 | Bacteria | 1041 |
| 629 | Ga0496101_0672337 | 3300048904 | Unclassified | 818 |
| 630 | Ga0496102_0000211 | 3300048905 | Bacteria | 77793 |
| 631 | Ga0496102_0010565 | 3300048905 | Bacteria | 7951 |
| 632 | Ga0496102_0058720 | 3300048905 | Bacteria | 3516 |
| 633 | Ga0496102_0190210 | 3300048905 | Bacteria | 1934 |
| 634 | Ga0496102_0342937 | 3300048905 | Bacteria | 1407 |
| 635 | Ga0496102_0630218 | 3300048905 | Bacteria | 995 |
| 636 | Ga0496102_1296016 | 3300048905 | Bacteria | 648 |
| 637 | Ga0496103_0000083 | 3300048906 | Bacteria | 108615 |
| 638 | Ga0496103_0077061 | 3300048906 | Bacteria | 2093 |
| 639 | Ga0496103_0093172 | 3300048906 | Bacteria | 1902 |
| 640 | Ga0496103_0605103 | 3300048906 | Bacteria | 698 |
| 641 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 642 | Ga0496104_0000052 | 3300048907 | Bacteria | 137286 |
| 643 | Ga0496104_0000765 | 3300048907 | Bacteria | 27516 |
| 644 | Ga0496104_0003858 | 3300048907 | Bacteria | 12971 |
| 645 | Ga0496104_0049764 | 3300048907 | Bacteria | 3952 |
| 646 | Ga0496104_0604536 | 3300048907 | Unclassified | 1007 |
| 647 | Ga0496104_0875618 | 3300048907 | Bacteria | 803 |
| 648 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 649 | Ga0496105_0000030 | 3300048908 | Bacteria | 137325 |
| 650 | Ga0496105_0000409 | 3300048908 | Bacteria | 28168 |
| 651 | Ga0496105_0083478 | 3300048908 | Bacteria | 2638 |
| 652 | Ga0496105_0301387 | 3300048908 | Bacteria | 1288 |
| 653 | Ga0496105_0958289 | 3300048908 | Bacteria | 642 |
| 654 | Ga0496106_0000076 | 3300048909 | Bacteria | 79088 |
| 655 | Ga0496106_0000121 | 3300048909 | Bacteria | 59910 |
| 656 | Ga0496106_0004512 | 3300048909 | Bacteria | 10312 |
| 657 | Ga0496106_0023792 | 3300048909 | Bacteria | 4553 |
| 658 | Ga0496106_0965747 | 3300048909 | Bacteria | 671 |
| 659 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 660 | Ga0496107_0000020 | 3300048910 | Bacteria | 148990 |
| 661 | Ga0496107_0076122 | 3300048910 | Bacteria | 2443 |
| 662 | Ga0496107_0076509 | 3300048910 | Bacteria | 2437 |
| 663 | Ga0496107_0582133 | 3300048910 | Bacteria | 828 |
| 664 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 665 | Ga0496108_0000063 | 3300048911 | Bacteria | 118950 |
| 666 | Ga0496108_0002546 | 3300048911 | Bacteria | 14595 |
| 667 | Ga0496108_0003280 | 3300048911 | Bacteria | 12999 |
| 668 | Ga0496108_0005560 | 3300048911 | Bacteria | 10200 |
| 669 | Ga0496108_0009033 | 3300048911 | Bacteria | 8076 |
| 670 | Ga0496108_0245749 | 3300048911 | Bacteria | 1557 |
| 671 | Ga0496108_0951643 | 3300048911 | Bacteria | 735 |
| 672 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 673 | Ga0496109_0000012 | 3300048912 | Bacteria | 229699 |
| 674 | Ga0496109_0000348 | 3300048912 | Bacteria | 43133 |
| 675 | Ga0496109_0003361 | 3300048912 | Bacteria | 13379 |
| 676 | Ga0496109_0005652 | 3300048912 | Bacteria | 10461 |
| 677 | Ga0496109_0017515 | 3300048912 | Bacteria | 6281 |
| 678 | Ga0496109_0128328 | 3300048912 | Bacteria | 2366 |
| 679 | Ga0496109_0300150 | 3300048912 | Bacteria | 1514 |
| 680 | Ga0496109_0392613 | 3300048912 | Bacteria | 1311 |
| 681 | Ga0496109_1152084 | 3300048912 | Bacteria | 712 |
| 682 | Ga0496110_0002164 | 3300048913 | Bacteria | 14666 |
| 683 | Ga0496110_0010530 | 3300048913 | Bacteria | 7529 |
| 684 | Ga0496110_0047750 | 3300048913 | Bacteria | 3750 |
| 685 | Ga0496110_0246364 | 3300048913 | Bacteria | 1626 |
| 686 | Ga0496110_0334165 | 3300048913 | Bacteria | 1380 |
| 687 | Ga0496111_0000044 | 3300048914 | Bacteria | 49014 |
| 688 | Ga0496111_0017776 | 3300048914 | Bacteria | 4918 |
| 689 | Ga0496111_0070059 | 3300048914 | Bacteria | 2550 |
| 690 | Ga0496111_0125916 | 3300048914 | Bacteria | 1894 |
| 691 | Ga0496111_0409868 | 3300048914 | Bacteria | 1001 |
| 692 | Ga0496111_0506888 | 3300048914 | Bacteria | 888 |
| 693 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 694 | Ga0496112_0013447 | 3300048915 | Bacteria | 7555 |
| 695 | Ga0496112_0030187 | 3300048915 | Bacteria | 5245 |
| 696 | Ga0496112_0226918 | 3300048915 | Bacteria | 1823 |
| 697 | Ga0496113_0000013 | 3300048916 | Bacteria | 81224 |
| 698 | Ga0496113_0004814 | 3300048916 | Bacteria | 8349 |
| 699 | Ga0496113_0018475 | 3300048916 | Bacteria | 4856 |
| 700 | Ga0496113_0038089 | 3300048916 | Bacteria | 3533 |
| 701 | Ga0496113_0180000 | 3300048916 | Bacteria | 1676 |
| 702 | Ga0496113_0220610 | 3300048916 | Bacteria | 1511 |
| 703 | Ga0496113_0414766 | 3300048916 | Bacteria | 1081 |
| 704 | Ga0496113_0562475 | 3300048916 | Bacteria | 914 |
| 705 | Ga0496114_0000039 | 3300048917 | Bacteria | 138486 |
| 706 | Ga0496114_0174601 | 3300048917 | Bacteria | 1874 |
| 707 | Ga0496114_0221118 | 3300048917 | Bacteria | 1662 |
| 708 | Ga0496114_0784039 | 3300048917 | Bacteria | 831 |
| 709 | Ga0496114_1050717 | 3300048917 | Bacteria | 698 |
| 710 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 711 | Ga0496115_0000377 | 3300048918 | Bacteria | 36788 |
| 712 | Ga0496115_0187433 | 3300048918 | Bacteria | 1709 |
| 713 | Ga0496116_0000848 | 3300048919 | Bacteria | 38292 |
| 714 | Ga0496117_0009784 | 3300048920 | Bacteria | 8842 |
| 715 | Ga0496118_0002916 | 3300048921 | Bacteria | 22218 |
| 716 | Ga0496118_0231303 | 3300048921 | Bacteria | 1066 |
| 717 | Ga0496118_0304351 | 3300048921 | Bacteria | 873 |
| 718 | Ga0496119_0011619 | 3300048922 | Bacteria | 7262 |
| 719 | Ga0496120_0024368 | 3300048923 | Bacteria | 3775 |
| 720 | Ga0496120_0049634 | 3300048923 | Bacteria | 2407 |
| 721 | Ga0496121_0022084 | 3300048924 | Bacteria | 6194 |
| 722 | Ga0496121_0283662 | 3300048924 | Bacteria | 1131 |
| 723 | Ga0496121_0465148 | 3300048924 | Bacteria | 811 |
| 724 | Ga0496124_0159321 | 3300048927 | Bacteria | 1761 |
| 725 | Ga0496124_0264727 | 3300048927 | Bacteria | 1263 |
| 726 | Ga0496125_0117153 | 3300048928 | Bacteria | 1911 |
| 727 | Ga0496125_0179392 | 3300048928 | Bacteria | 1413 |
| 728 | Ga0496126_0019594 | 3300048929 | Bacteria | 6660 |
| 729 | Ga0496126_0891062 | 3300048929 | Bacteria | 675 |
| 730 | Ga0501031_0002175 | 3300049568 | Bacteria | 12379 |
| 731 | Ga0501031_0163107 | 3300049568 | Bacteria | 1457 |
| 732 | Ga0501032_0011222 | 3300049569 | Bacteria | 6435 |
| 733 | Ga0501032_0672158 | 3300049569 | Bacteria | 657 |
| 734 | Ga0501033_0003689 | 3300049570 | Bacteria | 12454 |
| 735 | Ga0501034_0307172 | 3300049571 | Bacteria | 1521 |
| 736 | Ga0501034_0400007 | 3300049571 | Bacteria | 1296 |
| 737 | Ga0501036_0020032 | 3300049572 | Bacteria | 5616 |
| 738 | Ga0501037_0002926 | 3300049573 | Bacteria | 12385 |
| 739 | Ga0501038_0005058 | 3300049574 | Bacteria | 12248 |
| 740 | Ga0501038_1175658 | 3300049574 | Bacteria | 558 |
| 741 | Ga0501039_0095570 | 3300049575 | Bacteria | 2317 |
| 742 | Ga0501039_0216094 | 3300049575 | Bacteria | 1507 |
| 743 | Ga0501039_0227319 | 3300049575 | Bacteria | 1467 |
| 744 | Ga0501040_0125576 | 3300049576 | Bacteria | 1802 |
| 745 | Ga0501042_0012872 | 3300049578 | Bacteria | 5681 |
| 746 | Ga0501042_0061274 | 3300049578 | Bacteria | 2688 |
| 747 | Ga0501042_0084546 | 3300049578 | Bacteria | 2275 |
| 748 | Ga0501042_0313241 | 3300049578 | Bacteria | 1134 |
| 749 | Ga0501042_0411606 | 3300049578 | Bacteria | 980 |
| 750 | Ga0501043_0016009 | 3300049579 | Bacteria | 5878 |
| 751 | Ga0501043_1140393 | 3300049579 | Bacteria | 549 |
| 752 | Ga0501046_0004559 | 3300049580 | Bacteria | 12539 |
| 753 | Ga0501046_0393039 | 3300049580 | Bacteria | 1002 |
| 754 | Ga0501046_0571571 | 3300049580 | Archaea | 804 |
| 755 | Ga0501047_0004952 | 3300049581 | Bacteria | 12510 |
| 756 | Ga0501047_0010850 | 3300049581 | Bacteria | 8610 |
| 757 | Ga0501047_0176579 | 3300049581 | Bacteria | 2003 |
| 758 | Ga0501047_0780742 | 3300049581 | Bacteria | 770 |
| 759 | Ga0501047_1161499 | 3300049581 | Bacteria | 585 |
| 760 | Ga0501048_0003128 | 3300049582 | Bacteria | 12640 |
| 761 | Ga0501048_0248226 | 3300049582 | Bacteria | 1263 |
| 762 | Ga0501048_0506283 | 3300049582 | Bacteria | 866 |
| 763 | Ga0501068_0002345 | 3300049584 | Bacteria | 10082 |
| 764 | Ga0501068_0463372 | 3300049584 | Bacteria | 820 |
| 765 | Ga0501069_0014849 | 3300049585 | Bacteria | 4170 |
| 766 | Ga0501069_0087306 | 3300049585 | Bacteria | 1762 |
| 767 | Ga0501070_0004064 | 3300049586 | Bacteria | 12575 |
| 768 | Ga0501070_0047786 | 3300049586 | Bacteria | 3555 |
| 769 | Ga0501070_0048441 | 3300049586 | Bacteria | 3530 |
| 770 | Ga0501070_0148477 | 3300049586 | Bacteria | 1935 |
| 771 | Ga0501070_0570055 | 3300049586 | Bacteria | 905 |
| 772 | Ga0501070_1005321 | 3300049586 | Bacteria | 646 |
| 773 | Ga0501071_0005888 | 3300049587 | Bacteria | 7926 |
| 774 | Ga0501071_0209651 | 3300049587 | Unclassified | 1465 |
| 775 | Ga0501071_0224674 | 3300049587 | Bacteria | 1414 |
| 776 | Ga0501071_0297987 | 3300049587 | Bacteria | 1222 |
| 777 | Ga0501071_0967896 | 3300049587 | Bacteria | 657 |
| 778 | Ga0501071_1139292 | 3300049587 | Bacteria | 603 |
| 779 | Ga0501072_0017464 | 3300049588 | Bacteria | 5513 |
| 780 | Ga0501072_0030329 | 3300049588 | Bacteria | 4229 |
| 781 | Ga0501072_0052302 | 3300049588 | Bacteria | 3216 |
| 782 | Ga0501072_0166082 | 3300049588 | Bacteria | 1761 |
| 783 | Ga0501072_1165303 | 3300049588 | Unclassified | 599 |
| 784 | Ga0501073_0012127 | 3300049589 | Bacteria | 6294 |
| 785 | Ga0501073_0045125 | 3300049589 | Bacteria | 3105 |
| 786 | Ga0501073_0336398 | 3300049589 | Bacteria | 1042 |
| 787 | Ga0501073_1097038 | 3300049589 | Bacteria | 547 |
| 788 | Ga0501074_0018921 | 3300049590 | Bacteria | 5002 |
| 789 | Ga0501074_0257323 | 3300049590 | Bacteria | 1241 |
| 790 | Ga0501074_1137397 | 3300049590 | Bacteria | 548 |
| 791 | Ga0501075_0034272 | 3300049591 | Bacteria | 3780 |
| 792 | Ga0501075_0054219 | 3300049591 | Bacteria | 3015 |
| 793 | Ga0501075_0082710 | 3300049591 | Unclassified | 2432 |
| 794 | Ga0501076_0029982 | 3300049592 | Bacteria | 4235 |
| 795 | Ga0501076_0046698 | 3300049592 | Bacteria | 3422 |
| 796 | Ga0501076_1408551 | 3300049592 | Bacteria | 573 |
| 797 | Ga0501077_0319436 | 3300049593 | Bacteria | 990 |
| 798 | Ga0501079_0073179 | 3300049741 | Bacteria | 2649 |
| 799 | Ga0501079_0080440 | 3300049741 | Bacteria | 2519 |
| 800 | Ga0501079_0087220 | 3300049741 | Bacteria | 2416 |
| 801 | Ga0501079_0912467 | 3300049741 | Bacteria | 692 |
| 802 | Ga0501080_0030783 | 3300049742 | Bacteria | 5000 |
| 803 | Ga0501080_0097730 | 3300049742 | Bacteria | 2726 |
| 804 | Ga0501080_0549464 | 3300049742 | Bacteria | 1029 |
| 805 | Ga0501080_0906253 | 3300049742 | Bacteria | 768 |
| 806 | Ga0501080_1267845 | 3300049742 | Bacteria | 632 |
| 807 | Ga0501081_0068435 | 3300049743 | Bacteria | 2472 |
| 808 | Ga0501081_0086273 | 3300049743 | Unclassified | 2204 |
| 809 | Ga0501081_0111193 | 3300049743 | Bacteria | 1944 |
| 810 | Ga0501081_0692330 | 3300049743 | Bacteria | 765 |
| 811 | Ga0501083_0002614 | 3300049744 | Bacteria | 12402 |
| 812 | Ga0501083_0003895 | 3300049744 | Bacteria | 10485 |
| 813 | Ga0501083_0036093 | 3300049744 | Bacteria | 3373 |
| 814 | Ga0501083_0707609 | 3300049744 | Bacteria | 655 |
| 815 | Ga0501283_062372 | 3300049779 | Bacteria | 675 |
| 816 | Ga0501035_0005116 | 3300049822 | Bacteria | 12420 |
| 817 | Ga0501044_0006919 | 3300049823 | Bacteria | 12483 |
| 818 | Ga0501044_0034851 | 3300049823 | Bacteria | 5275 |
| 819 | Ga0501045_0098388 | 3300049824 | Bacteria | 2164 |
| 820 | Ga0501045_0133474 | 3300049824 | Bacteria | 1846 |
| 821 | Ga0501045_0845346 | 3300049824 | Unclassified | 673 |
| 822 | Ga0501045_1221339 | 3300049824 | Archaea | 548 |
| 823 | nmdc:mga03n38_229497_c1 | 3300050490 | Bacteria | 972 |
| 824 | nmdc:mga00v17_108157_c1 | 3300050491 | Bacteria | 1762 |
| 825 | nmdc:mga00v17_177051_c1 | 3300050491 | Bacteria | 1376 |
| 826 | nmdc:mga00v17_284456_c1 | 3300050491 | Bacteria | 1074 |
| 827 | nmdc:mga00v17_497475_c1 | 3300050491 | Unclassified | 790 |
| 828 | nmdc:mga00v17_51630_c2 | 3300050491 | Bacteria | 1890 |
| 829 | nmdc:mga00v17_800246_c1 | 3300050491 | Unclassified | 601 |
| 830 | nmdc:mga0yw44_142103_c1 | 3300050492 | Bacteria | 1561 |
| 831 | nmdc:mga0yw44_266562_c1 | 3300050492 | Bacteria | 1142 |
| 832 | nmdc:mga0yw44_320642_c1 | 3300050492 | Unclassified | 1040 |
| 833 | nmdc:mga0yw44_479162_c1 | 3300050492 | Bacteria | 844 |
| 834 | nmdc:mga0yw44_623492_c1 | 3300050492 | Bacteria | 733 |
| 835 | nmdc:mga0yw44_81179_c1 | 3300050492 | Bacteria | 2033 |
| 836 | nmdc:mga0yw44_81412_c1 | 3300050492 | Bacteria | 2030 |
| 837 | nmdc:mga05p37_220296_c1 | 3300050507 | Unclassified | 2290 |
| 838 | nmdc:mga05p37_611014_c1 | 3300050507 | Bacteria | 1229 |
| 839 | nmdc:mga08y16_92139_c1 | 3300050511 | Bacteria | 3158 |
| 840 | nmdc:mga0rr50_379733_c1 | 3300050513 | Bacteria | 1191 |
| 841 | nmdc:mga08x19_853142_c1 | 3300050514 | Unclassified | 647 |
| 842 | nmdc:mga0a205_138769_c1 | 3300050515 | Bacteria | 2331 |
| 843 | nmdc:mga0a205_43_c1 | 3300050515 | Bacteria | 51209 |
| 844 | nmdc:mga0a205_53_c2 | 3300050515 | Bacteria | 54696 |
| 845 | Ga0495601_0000060 | 3300053077 | Bacteria | 60600 |
| 846 | Ga0495601_0000165 | 3300053077 | Bacteria | 35521 |
| 847 | Ga0495601_0025379 | 3300053077 | Bacteria | 3654 |
| 848 | Ga0495601_0057074 | 3300053077 | Bacteria | 2473 |
| 849 | Ga0495601_0234552 | 3300053077 | Bacteria | 1198 |
| 850 | Ga0495601_0719291 | 3300053077 | Bacteria | 636 |
| 851 | Ga0495612_0000210 | 3300053078 | Bacteria | 24800 |
| 852 | Ga0495612_0003484 | 3300053078 | Bacteria | 6518 |
| 853 | Ga0495612_0049530 | 3300053078 | Bacteria | 1724 |
| 854 | Ga0495612_0049786 | 3300053078 | Bacteria | 1719 |
| 855 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 856 | Ga0495655_0001463 | 3300053083 | Bacteria | 3616 |
| 857 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 858 | Ga0495595_0000045 | 3300053084 | Bacteria | 63054 |
| 859 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 860 | Ga0495619_0000095 | 3300053085 | Bacteria | 66204 |
| 861 | Ga0495619_0000102 | 3300053085 | Bacteria | 64345 |
| 862 | Ga0495619_0000155 | 3300053085 | Bacteria | 50682 |
| 863 | Ga0495619_0000195 | 3300053085 | Bacteria | 44602 |
| 864 | Ga0495619_0000320 | 3300053085 | Bacteria | 33623 |
| 865 | Ga0495619_0010358 | 3300053085 | Bacteria | 5869 |
| 866 | Ga0495619_0053306 | 3300053085 | Bacteria | 2675 |
| 867 | Ga0495619_0742263 | 3300053085 | Bacteria | 666 |
| 868 | Ga0495619_1164776 | 3300053085 | Bacteria | 511 |
| 869 | Ga0500566_0001093 | 3300053094 | Bacteria | 15689 |
| 870 | Ga0500554_236769 | 3300053102 | Bacteria | 604 |
| 871 | Ga0500595_069413 | 3300053119 | Bacteria | 1048 |
| 872 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 873 | Ga0500658_0263441 | 3300053134 | Bacteria | 792 |
| 874 | Ga0501084_0005040 | 3300054114 | Bacteria | 10806 |
| 875 | Ga0501084_0156761 | 3300054114 | Bacteria | 1920 |
| 876 | Ga0501084_1245649 | 3300054114 | Bacteria | 624 |
| 877 | Ga0587082_113505 | 3300059504 | Bacteria | 604 |
| 878 | Ga0501082_0022699 | 3300060353 | Bacteria | 5403 |
| 879 | Ga0501082_0450607 | 3300060353 | Bacteria | 1124 |
| 880 | Ga0501082_1182950 | 3300060353 | Bacteria | 668 |
| 881 | Ga0501082_1373789 | 3300060353 | Bacteria | 617 |
| 882 | Ga0530510_0010891 | 3300061734 | Bacteria | 6380 |
| 883 | Ga0530510_0019997 | 3300061734 | Bacteria | 4759 |
| 884 | Ga0530510_0355097 | 3300061734 | Bacteria | 1101 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300060353 | Ga0501082_1373789 | Ga0501082_1373789_161_607 | 138 |
| 2 | 3300005937 | Ga0081455_10049005 | Ga0081455_100490054 | 148 |
| 3 | 3300006852 | Ga0075433_10000897 | Ga0075433_100008978 | 148 |
| 4 | 3300009093 | Ga0105240_10384233 | Ga0105240_103842332 | 148 |
| 5 | 3300009174 | Ga0105241_10160467 | Ga0105241_101604672 | 148 |
| 6 | 3300009545 | Ga0105237_10107344 | Ga0105237_101073442 | 148 |
| 7 | 3300037418 | Ga0395900_0411672 | Ga0395900_0411672_845_1294 | 148 |
| 8 | 3300039437 | Ga0436365_1901572 | Ga0436365_1901572_99_545 | 148 |
| 9 | 3300044842 | Ga0466957_0001414 | Ga0466957_0001414_8231_8677 | 148 |
| 10 | 3300046674 | Ga0495588_0301285 | Ga0495588_0301285_84_530 | 148 |
| 11 | 3300046681 | Ga0495647_0000684 | Ga0495647_0000684_28_474 | 148 |
| 12 | 3300047322 | Ga0495680_0022126 | Ga0495680_0022126_1947_2393 | 148 |
| 13 | 3300048088 | Ga0495602_0557479 | Ga0495602_0557479_313_759 | 148 |
| 14 | 3300048904 | Ga0496101_0429650 | Ga0496101_0429650_17_469 | 148 |
| 15 | 3300048904 | Ga0496101_0672337 | Ga0496101_0672337_328_774 | 148 |
| 16 | 3300048907 | Ga0496104_0049764 | Ga0496104_0049764_2712_3164 | 148 |
| 17 | 3300048908 | Ga0496105_0083478 | Ga0496105_0083478_1249_1701 | 148 |
| 18 | 3300048909 | Ga0496106_0965747 | Ga0496106_0965747_197_649 | 148 |
| 19 | 3300048910 | Ga0496107_0582133 | Ga0496107_0582133_75_524 | 148 |
| 20 | 3300048916 | Ga0496113_0562475 | Ga0496113_0562475_78_524 | 148 |
| 21 | 3300048917 | Ga0496114_0174601 | Ga0496114_0174601_435_881 | 148 |
| 22 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_107560_108006 | 148 |
| 23 | 3300048921 | Ga0496118_0231303 | Ga0496118_0231303_241_693 | 148 |
| 24 | 3300048924 | Ga0496121_0022084 | Ga0496121_0022084_344_796 | 148 |
| 25 | 3300048924 | Ga0496121_0283662 | Ga0496121_0283662_412_864 | 148 |
| 26 | 3300048924 | Ga0496121_0465148 | Ga0496121_0465148_55_507 | 148 |
| 27 | 3300048927 | Ga0496124_0159321 | Ga0496124_0159321_1223_1675 | 148 |
| 28 | 3300048928 | Ga0496125_0179392 | Ga0496125_0179392_439_891 | 148 |
| 29 | 3300048929 | Ga0496126_0891062 | Ga0496126_0891062_177_629 | 148 |
| 30 | 3300049586 | Ga0501070_0148477 | Ga0501070_0148477_1110_1556 | 148 |
| 31 | 3300049592 | Ga0501076_1408551 | Ga0501076_1408551_12_458 | 148 |
| 32 | 3300049593 | Ga0501077_0319436 | Ga0501077_0319436_46_492 | 148 |
| 33 | 3300049743 | Ga0501081_0111193 | Ga0501081_0111193_574_1020 | 148 |
| 34 | 3300049743 | Ga0501081_0692330 | Ga0501081_0692330_232_678 | 148 |
| 35 | 3300050515 | nmdc:mga0a205_53_c2 | nmdc:mga0a205_53_c2_12417_12866 | 148 |
| 36 | 3300053085 | Ga0495619_0010358 | Ga0495619_0010358_2835_3323 | 148 |
| 37 | 3300053085 | Ga0495619_1164776 | Ga0495619_1164776_28_474 | 148 |
| 38 | 3300053119 | Ga0500595_069413 | Ga0500595_069413_497_949 | 148 |
| 39 | 3300053134 | Ga0500658_0263441 | Ga0500658_0263441_65_517 | 148 |
| 40 | 3300054114 | Ga0501084_1245649 | Ga0501084_1245649_11_457 | 148 |
| 41 | 3300005356 | Ga0070674_100011888 | Ga0070674_1000118882 | 149 |
| 42 | 3300005718 | Ga0068866_10000008 | Ga0068866_10000008122 | 149 |
| 43 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002547 | 149 |
| 44 | 3300025937 | Ga0207669_10000026 | Ga0207669_100000267 | 149 |
| 45 | 3300005438 | Ga0070701_10310198 | Ga0070701_103101982 | 150 |
| 46 | 3300049589 | Ga0501073_1097038 | Ga0501073_1097038_61_537 | 150 |
| 47 | 3300049779 | Ga0501283_062372 | Ga0501283_062372_127_642 | 150 |
| 48 | 3300059504 | Ga0587082_113505 | Ga0587082_113505_77_550 | 153 |
| 49 | 3300049586 | Ga0501070_0047786 | Ga0501070_0047786_66_533 | 154 |
| 50 | 3300031691 | Ga0316579_10214626 | Ga0316579_102146262 | 156 |
| 51 | 3300031733 | Ga0316577_10251762 | Ga0316577_102517621 | 156 |
| 52 | 3300041463 | Ga0451804_0150049 | Ga0451804_0150049_296_766 | 156 |
| 53 | 3300005435 | Ga0070714_100430087 | Ga0070714_1004300872 | 157 |
| 54 | 3300005544 | Ga0070686_100097960 | Ga0070686_1000979602 | 157 |
| 55 | 3300005614 | Ga0068856_100772303 | Ga0068856_1007723032 | 157 |
| 56 | 3300006028 | Ga0070717_10296430 | Ga0070717_102964302 | 157 |
| 57 | 3300026078 | Ga0207702_11658441 | Ga0207702_116584411 | 157 |
| 58 | 3300048903 | Ga0496100_0027464 | Ga0496100_0027464_2602_3084 | 157 |
| 59 | 3300048904 | Ga0496101_0000894 | Ga0496101_0000894_7532_8014 | 157 |
| 60 | 3300048905 | Ga0496102_0342937 | Ga0496102_0342937_349_831 | 157 |
| 61 | 3300048907 | Ga0496104_0003858 | Ga0496104_0003858_9385_9867 | 157 |
| 62 | 3300048908 | Ga0496105_0301387 | Ga0496105_0301387_615_1097 | 157 |
| 63 | 3300048909 | Ga0496106_0023792 | Ga0496106_0023792_250_732 | 157 |
| 64 | 3300048910 | Ga0496107_0076509 | Ga0496107_0076509_1527_2009 | 157 |
| 65 | 3300048911 | Ga0496108_0002546 | Ga0496108_0002546_5295_5777 | 157 |
| 66 | 3300048912 | Ga0496109_0017515 | Ga0496109_0017515_869_1351 | 157 |
| 67 | 3300048913 | Ga0496110_0010530 | Ga0496110_0010530_186_668 | 157 |
| 68 | 3300048915 | Ga0496112_0013447 | Ga0496112_0013447_2190_2672 | 157 |
| 69 | 3300048916 | Ga0496113_0018475 | Ga0496113_0018475_2496_2978 | 157 |
| 70 | 3300048917 | Ga0496114_1050717 | Ga0496114_1050717_113_595 | 157 |
| 71 | 3300005444 | Ga0070694_100213897 | Ga0070694_1002138971 | 158 |
| 72 | 3300005549 | Ga0070704_100053014 | Ga0070704_1000530143 | 158 |
| 73 | 3300035113 | Ga0373936_0279256 | Ga0373936_0279256_48_560 | 158 |
| 74 | 3300005436 | Ga0070713_101616208 | Ga0070713_1016162081 | 159 |
| 75 | 3300021384 | Ga0213876_10451361 | Ga0213876_104513612 | 159 |
| 76 | 3300045976 | Ga0466967_1397797 | Ga0466967_1397797_70_570 | 159 |
| 77 | 3300001977 | JGI24746J21847_1025538 | JGI24746J21847_10255382 | 160 |
| 78 | 3300001979 | JGI24740J21852_10111435 | JGI24740J21852_101114352 | 160 |
| 79 | 3300001991 | JGI24743J22301_10021951 | JGI24743J22301_100219512 | 160 |
| 80 | 3300002075 | JGI24738J21930_10065889 | JGI24738J21930_100658891 | 160 |
| 81 | 3300002239 | JGI24034J26672_10037482 | JGI24034J26672_100374821 | 160 |
| 82 | 3300005327 | Ga0070658_10120843 | Ga0070658_101208432 | 160 |
| 83 | 3300005329 | Ga0070683_100343962 | Ga0070683_1003439622 | 160 |
| 84 | 3300005337 | Ga0070682_100008571 | Ga0070682_1000085712 | 160 |
| 85 | 3300005338 | Ga0068868_100268553 | Ga0068868_1002685532 | 160 |
| 86 | 3300005339 | Ga0070660_100104391 | Ga0070660_1001043912 | 160 |
| 87 | 3300005341 | Ga0070691_10482053 | Ga0070691_104820531 | 160 |
| 88 | 3300005343 | Ga0070687_100119153 | Ga0070687_1001191531 | 160 |
| 89 | 3300005344 | Ga0070661_100499160 | Ga0070661_1004991602 | 160 |
| 90 | 3300005345 | Ga0070692_10007789 | Ga0070692_100077892 | 160 |
| 91 | 3300005347 | Ga0070668_100149155 | Ga0070668_1001491552 | 160 |
| 92 | 3300005353 | Ga0070669_100264872 | Ga0070669_1002648722 | 160 |
| 93 | 3300005354 | Ga0070675_100248923 | Ga0070675_1002489233 | 160 |
| 94 | 3300005356 | Ga0070674_100012173 | Ga0070674_1000121736 | 160 |
| 95 | 3300005364 | Ga0070673_100064289 | Ga0070673_1000642892 | 160 |
| 96 | 3300005365 | Ga0070688_100095406 | Ga0070688_1000954062 | 160 |
| 97 | 3300005366 | Ga0070659_100007424 | Ga0070659_1000074249 | 160 |
| 98 | 3300005366 | Ga0070659_100395467 | Ga0070659_1003954672 | 160 |
| 99 | 3300005441 | Ga0070700_100116416 | Ga0070700_1001164162 | 160 |
| 100 | 3300005444 | Ga0070694_100098482 | Ga0070694_1000984822 | 160 |
| 101 | 3300005455 | Ga0070663_100007633 | Ga0070663_1000076334 | 160 |
| 102 | 3300005456 | Ga0070678_100118620 | Ga0070678_1001186201 | 160 |
| 103 | 3300005457 | Ga0070662_100014992 | Ga0070662_1000149923 | 160 |
| 104 | 3300005459 | Ga0068867_100143823 | Ga0068867_1001438233 | 160 |
| 105 | 3300005466 | Ga0070685_10063791 | Ga0070685_100637912 | 160 |
| 106 | 3300005539 | Ga0068853_100189350 | Ga0068853_1001893503 | 160 |
| 107 | 3300005543 | Ga0070672_100004196 | Ga0070672_1000041962 | 160 |
| 108 | 3300005544 | Ga0070686_100167235 | Ga0070686_1001672352 | 160 |
| 109 | 3300005547 | Ga0070693_100085963 | Ga0070693_1000859631 | 160 |
| 110 | 3300005548 | Ga0070665_100410741 | Ga0070665_1004107412 | 160 |
| 111 | 3300005578 | Ga0068854_100170113 | Ga0068854_1001701133 | 160 |
| 112 | 3300005615 | Ga0070702_100080455 | Ga0070702_1000804553 | 160 |
| 113 | 3300005616 | Ga0068852_100014610 | Ga0068852_1000146103 | 160 |
| 114 | 3300005617 | Ga0068859_100275896 | Ga0068859_1002758963 | 160 |
| 115 | 3300005618 | Ga0068864_100291873 | Ga0068864_1002918732 | 160 |
| 116 | 3300005718 | Ga0068866_10111683 | Ga0068866_101116832 | 160 |
| 117 | 3300005719 | Ga0068861_101117957 | Ga0068861_1011179572 | 160 |
| 118 | 3300005842 | Ga0068858_100257921 | Ga0068858_1002579211 | 160 |
| 119 | 3300005843 | Ga0068860_101205744 | Ga0068860_1012057442 | 160 |
| 120 | 3300005844 | Ga0068862_100124618 | Ga0068862_1001246183 | 160 |
| 121 | 3300005937 | Ga0081455_10072555 | Ga0081455_100725553 | 160 |
| 122 | 3300006038 | Ga0075365_10002366 | Ga0075365_100023668 | 160 |
| 123 | 3300006038 | Ga0075365_10156417 | Ga0075365_101564172 | 160 |
| 124 | 3300006042 | Ga0075368_10245708 | Ga0075368_102457082 | 160 |
| 125 | 3300006048 | Ga0075363_100001314 | Ga0075363_1000013148 | 160 |
| 126 | 3300006048 | Ga0075363_100014606 | Ga0075363_1000146064 | 160 |
| 127 | 3300006048 | Ga0075363_100143851 | Ga0075363_1001438512 | 160 |
| 128 | 3300006048 | Ga0075363_100356770 | Ga0075363_1003567702 | 160 |
| 129 | 3300006051 | Ga0075364_10049695 | Ga0075364_100496954 | 160 |
| 130 | 3300006177 | Ga0075362_10252284 | Ga0075362_102522841 | 160 |
| 131 | 3300006178 | Ga0075367_10369945 | Ga0075367_103699451 | 160 |
| 132 | 3300006178 | Ga0075367_10414097 | Ga0075367_104140972 | 160 |
| 133 | 3300006353 | Ga0075370_10335443 | Ga0075370_103354432 | 160 |
| 134 | 3300006881 | Ga0068865_100007004 | Ga0068865_1000070044 | 160 |
| 135 | 3300006931 | Ga0097620_100275903 | Ga0097620_1002759033 | 160 |
| 136 | 3300009094 | Ga0111539_10639660 | Ga0111539_106396602 | 160 |
| 137 | 3300009098 | Ga0105245_10035031 | Ga0105245_100350314 | 160 |
| 138 | 3300009148 | Ga0105243_10003503 | Ga0105243_100035039 | 160 |
| 139 | 3300009553 | Ga0105249_10096461 | Ga0105249_100964613 | 160 |
| 140 | 3300010375 | Ga0105239_10261216 | Ga0105239_102612162 | 160 |
| 141 | 3300013296 | Ga0157374_10275238 | Ga0157374_102752382 | 160 |
| 142 | 3300013297 | Ga0157378_10628867 | Ga0157378_106288672 | 160 |
| 143 | 3300013306 | Ga0163162_10556987 | Ga0163162_105569872 | 160 |
| 144 | 3300013307 | Ga0157372_10042342 | Ga0157372_100423424 | 160 |
| 145 | 3300013308 | Ga0157375_10013296 | Ga0157375_100132963 | 160 |
| 146 | 3300014326 | Ga0157380_10012273 | Ga0157380_100122735 | 160 |
| 147 | 3300014968 | Ga0157379_10588730 | Ga0157379_105887302 | 160 |
| 148 | 3300014969 | Ga0157376_11848914 | Ga0157376_118489141 | 160 |
| 149 | 3300025901 | Ga0207688_10008563 | Ga0207688_100085632 | 160 |
| 150 | 3300025909 | Ga0207705_10082216 | Ga0207705_100822162 | 160 |
| 151 | 3300025914 | Ga0207671_10728427 | Ga0207671_107284272 | 160 |
| 152 | 3300025917 | Ga0207660_10170427 | Ga0207660_101704272 | 160 |
| 153 | 3300025919 | Ga0207657_10000636 | Ga0207657_1000063635 | 160 |
| 154 | 3300025920 | Ga0207649_10033692 | Ga0207649_100336923 | 160 |
| 155 | 3300025921 | Ga0207652_10193435 | Ga0207652_101934352 | 160 |
| 156 | 3300025926 | Ga0207659_10036774 | Ga0207659_100367743 | 160 |
| 157 | 3300025927 | Ga0207687_10011833 | Ga0207687_100118332 | 160 |
| 158 | 3300025932 | Ga0207690_10002634 | Ga0207690_100026344 | 160 |
| 159 | 3300025933 | Ga0207706_10027571 | Ga0207706_100275714 | 160 |
| 160 | 3300025934 | Ga0207686_10264992 | Ga0207686_102649922 | 160 |
| 161 | 3300025935 | Ga0207709_10005868 | Ga0207709_100058684 | 160 |
| 162 | 3300025940 | Ga0207691_10056114 | Ga0207691_100561143 | 160 |
| 163 | 3300025945 | Ga0207679_10004050 | Ga0207679_100040501 | 160 |
| 164 | 3300025960 | Ga0207651_10016930 | Ga0207651_100169306 | 160 |
| 165 | 3300025961 | Ga0207712_10058206 | Ga0207712_100582063 | 160 |
| 166 | 3300026023 | Ga0207677_10109007 | Ga0207677_101090072 | 160 |
| 167 | 3300026035 | Ga0207703_10395833 | Ga0207703_103958331 | 160 |
| 168 | 3300026041 | Ga0207639_10169391 | Ga0207639_101693913 | 160 |
| 169 | 3300026067 | Ga0207678_10032404 | Ga0207678_100324043 | 160 |
| 170 | 3300026075 | Ga0207708_10002447 | Ga0207708_100024473 | 160 |
| 171 | 3300026088 | Ga0207641_10953625 | Ga0207641_109536252 | 160 |
| 172 | 3300026089 | Ga0207648_10017486 | Ga0207648_100174866 | 160 |
| 173 | 3300026116 | Ga0207674_10090964 | Ga0207674_100909644 | 160 |
| 174 | 3300026118 | Ga0207675_100100271 | Ga0207675_1001002712 | 160 |
| 175 | 3300026121 | Ga0207683_10164109 | Ga0207683_101641092 | 160 |
| 176 | 3300026121 | Ga0207683_10683425 | Ga0207683_106834252 | 160 |
| 177 | 3300026142 | Ga0207698_10005530 | Ga0207698_100055302 | 160 |
| 178 | 3300028379 | Ga0268266_10238666 | Ga0268266_102386662 | 160 |
| 179 | 3300028380 | Ga0268265_10114943 | Ga0268265_101149432 | 160 |
| 180 | 3300028381 | Ga0268264_11155999 | Ga0268264_111559992 | 160 |
| 181 | 3300031548 | Ga0307408_100219381 | Ga0307408_1002193812 | 160 |
| 182 | 3300031727 | Ga0316576_10840742 | Ga0316576_108407421 | 160 |
| 183 | 3300031995 | Ga0307409_100429704 | Ga0307409_1004297042 | 160 |
| 184 | 3300035398 | Ga0316574_0068576 | Ga0316574_0068576_143_628 | 160 |
| 185 | 3300035398 | Ga0316574_0844129 | Ga0316574_0844129_56_541 | 160 |
| 186 | 3300036647 | Ga0316582_0659968 | Ga0316582_0659968_190_675 | 160 |
| 187 | 3300041512 | Ga0451853_3832956 | Ga0451853_3832956_346_831 | 160 |
| 188 | 3300046491 | Ga0495584_0250155 | Ga0495584_0250155_320_811 | 160 |
| 189 | 3300046500 | Ga0495596_0261213 | Ga0495596_0261213_121_612 | 160 |
| 190 | 3300046615 | Ga0495656_0209816 | Ga0495656_0209816_101_592 | 160 |
| 191 | 3300046648 | Ga0495611_0368595 | Ga0495611_0368595_10_501 | 160 |
| 192 | 3300048904 | Ga0496101_0100950 | Ga0496101_0100950_96_581 | 160 |
| 193 | 3300048905 | Ga0496102_1296016 | Ga0496102_1296016_73_555 | 160 |
| 194 | 3300048906 | Ga0496103_0605103 | Ga0496103_0605103_106_612 | 160 |
| 195 | 3300048907 | Ga0496104_0604536 | Ga0496104_0604536_32_517 | 160 |
| 196 | 3300048911 | Ga0496108_0005560 | Ga0496108_0005560_4834_5319 | 160 |
| 197 | 3300048912 | Ga0496109_0005652 | Ga0496109_0005652_3825_4310 | 160 |
| 198 | 3300048912 | Ga0496109_0128328 | Ga0496109_0128328_1222_1704 | 160 |
| 199 | 3300048914 | Ga0496111_0017776 | Ga0496111_0017776_3812_4294 | 160 |
| 200 | 3300048916 | Ga0496113_0414766 | Ga0496113_0414766_372_857 | 160 |
| 201 | 3300049571 | Ga0501034_0400007 | Ga0501034_0400007_344_829 | 160 |
| 202 | 3300049585 | Ga0501069_0087306 | Ga0501069_0087306_780_1265 | 160 |
| 203 | 3300049586 | Ga0501070_1005321 | Ga0501070_1005321_142_627 | 160 |
| 204 | 3300049587 | Ga0501071_0224674 | Ga0501071_0224674_292_777 | 160 |
| 205 | 3300049588 | Ga0501072_1165303 | Ga0501072_1165303_14_499 | 160 |
| 206 | 3300049589 | Ga0501073_0045125 | Ga0501073_0045125_2552_3037 | 160 |
| 207 | 3300049741 | Ga0501079_0912467 | Ga0501079_0912467_91_576 | 160 |
| 208 | 3300049742 | Ga0501080_1267845 | Ga0501080_1267845_127_615 | 160 |
| 209 | 3300049744 | Ga0501083_0707609 | Ga0501083_0707609_47_532 | 160 |
| 210 | 3300050490 | nmdc:mga03n38_229497_c1 | nmdc:mga03n38_229497_c1_361_846 | 160 |
| 211 | 3300050491 | nmdc:mga00v17_284456_c1 | nmdc:mga00v17_284456_c1_432_920 | 160 |
| 212 | 3300050491 | nmdc:mga00v17_800246_c1 | nmdc:mga00v17_800246_c1_38_526 | 160 |
| 213 | 3300050492 | nmdc:mga0yw44_266562_c1 | nmdc:mga0yw44_266562_c1_75_560 | 160 |
| 214 | 3300050492 | nmdc:mga0yw44_81179_c1 | nmdc:mga0yw44_81179_c1_792_1280 | 160 |
| 215 | 3300050511 | nmdc:mga08y16_92139_c1 | nmdc:mga08y16_92139_c1_335_820 | 160 |
| 216 | 3300025898 | Ga0207692_10166323 | Ga0207692_101663232 | 161 |
| 217 | 3300046500 | Ga0495596_0323719 | Ga0495596_0323719_73_561 | 161 |
| 218 | 3300047321 | Ga0495676_0000827 | Ga0495676_0000827_13351_13836 | 161 |
| 219 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_421048_421533 | 161 |
| 220 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_222400_222885 | 161 |
| 221 | 3300048909 | Ga0496106_0000076 | Ga0496106_0000076_18238_18723 | 161 |
| 222 | 3300048910 | Ga0496107_0000005 | Ga0496107_0000005_108715_109200 | 161 |
| 223 | 3300048916 | Ga0496113_0220610 | Ga0496113_0220610_313_798 | 161 |
| 224 | 3300050492 | nmdc:mga0yw44_479162_c1 | nmdc:mga0yw44_479162_c1_215_706 | 161 |
| 225 | 3300060353 | Ga0501082_0022699 | Ga0501082_0022699_399_884 | 161 |
| 226 | 3300000546 | LJNas_1006049 | LJNas_10060492 | 162 |
| 227 | 3300001977 | JGI24746J21847_1000760 | JGI24746J21847_10007604 | 162 |
| 228 | 3300001979 | JGI24740J21852_10010068 | JGI24740J21852_100100683 | 162 |
| 229 | 3300002074 | JGI24748J21848_1000727 | JGI24748J21848_10007273 | 162 |
| 230 | 3300002239 | JGI24034J26672_10001507 | JGI24034J26672_100015073 | 162 |
| 231 | 3300002244 | JGI24742J22300_10001453 | JGI24742J22300_100014533 | 162 |
| 232 | 3300003659 | JGI25404J52841_10000319 | JGI25404J52841_100003197 | 162 |
| 233 | 3300005329 | Ga0070683_100000404 | Ga0070683_10000040416 | 162 |
| 234 | 3300005329 | Ga0070683_100006627 | Ga0070683_10000662710 | 162 |
| 235 | 3300005329 | Ga0070683_100060798 | Ga0070683_1000607982 | 162 |
| 236 | 3300005329 | Ga0070683_100323177 | Ga0070683_1003231772 | 162 |
| 237 | 3300005329 | Ga0070683_100453508 | Ga0070683_1004535082 | 162 |
| 238 | 3300005331 | Ga0070670_100073330 | Ga0070670_1000733303 | 162 |
| 239 | 3300005335 | Ga0070666_10231693 | Ga0070666_102316931 | 162 |
| 240 | 3300005336 | Ga0070680_100394914 | Ga0070680_1003949142 | 162 |
| 241 | 3300005337 | Ga0070682_100000011 | Ga0070682_1000000112 | 162 |
| 242 | 3300005337 | Ga0070682_100000052 | Ga0070682_100000052121 | 162 |
| 243 | 3300005338 | Ga0068868_100000141 | Ga0068868_10000014138 | 162 |
| 244 | 3300005338 | Ga0068868_100002016 | Ga0068868_10000201610 | 162 |
| 245 | 3300005339 | Ga0070660_100810199 | Ga0070660_1008101991 | 162 |
| 246 | 3300005341 | Ga0070691_10000044 | Ga0070691_100000447 | 162 |
| 247 | 3300005341 | Ga0070691_10000524 | Ga0070691_1000052410 | 162 |
| 248 | 3300005344 | Ga0070661_100000099 | Ga0070661_1000000997 | 162 |
| 249 | 3300005345 | Ga0070692_10088523 | Ga0070692_100885232 | 162 |
| 250 | 3300005347 | Ga0070668_100012531 | Ga0070668_1000125315 | 162 |
| 251 | 3300005347 | Ga0070668_100215454 | Ga0070668_1002154542 | 162 |
| 252 | 3300005353 | Ga0070669_100177175 | Ga0070669_1001771752 | 162 |
| 253 | 3300005354 | Ga0070675_100000036 | Ga0070675_10000003670 | 162 |
| 254 | 3300005355 | Ga0070671_100055512 | Ga0070671_1000555122 | 162 |
| 255 | 3300005356 | Ga0070674_100000012 | Ga0070674_10000001231 | 162 |
| 256 | 3300005356 | Ga0070674_100141733 | Ga0070674_1001417332 | 162 |
| 257 | 3300005364 | Ga0070673_100006402 | Ga0070673_1000064024 | 162 |
| 258 | 3300005365 | Ga0070688_100000071 | Ga0070688_10000007138 | 162 |
| 259 | 3300005365 | Ga0070688_100000206 | Ga0070688_10000020623 | 162 |
| 260 | 3300005366 | Ga0070659_100004223 | Ga0070659_1000042232 | 162 |
| 261 | 3300005366 | Ga0070659_100060959 | Ga0070659_1000609593 | 162 |
| 262 | 3300005367 | Ga0070667_100000603 | Ga0070667_10000060317 | 162 |
| 263 | 3300005367 | Ga0070667_100099083 | Ga0070667_1000990832 | 162 |
| 264 | 3300005367 | Ga0070667_100299101 | Ga0070667_1002991012 | 162 |
| 265 | 3300005367 | Ga0070667_100885391 | Ga0070667_1008853912 | 162 |
| 266 | 3300005435 | Ga0070714_100041184 | Ga0070714_1000411844 | 162 |
| 267 | 3300005436 | Ga0070713_100000047 | Ga0070713_10000004778 | 162 |
| 268 | 3300005439 | Ga0070711_100008252 | Ga0070711_1000082525 | 162 |
| 269 | 3300005439 | Ga0070711_100171837 | Ga0070711_1001718372 | 162 |
| 270 | 3300005441 | Ga0070700_100195005 | Ga0070700_1001950052 | 162 |
| 271 | 3300005444 | Ga0070694_100145983 | Ga0070694_1001459832 | 162 |
| 272 | 3300005444 | Ga0070694_100150163 | Ga0070694_1001501633 | 162 |
| 273 | 3300005455 | Ga0070663_100001716 | Ga0070663_1000017162 | 162 |
| 274 | 3300005456 | Ga0070678_100064983 | Ga0070678_1000649832 | 162 |
| 275 | 3300005457 | Ga0070662_100000002 | Ga0070662_100000002226 | 162 |
| 276 | 3300005458 | Ga0070681_10071340 | Ga0070681_100713402 | 162 |
| 277 | 3300005458 | Ga0070681_10919100 | Ga0070681_109191001 | 162 |
| 278 | 3300005466 | Ga0070685_10000020 | Ga0070685_1000002073 | 162 |
| 279 | 3300005466 | Ga0070685_10000674 | Ga0070685_1000067412 | 162 |
| 280 | 3300005466 | Ga0070685_10778056 | Ga0070685_107780562 | 162 |
| 281 | 3300005530 | Ga0070679_100005826 | Ga0070679_10000582610 | 162 |
| 282 | 3300005530 | Ga0070679_100025853 | Ga0070679_1000258535 | 162 |
| 283 | 3300005535 | Ga0070684_100178634 | Ga0070684_1001786342 | 162 |
| 284 | 3300005535 | Ga0070684_100200471 | Ga0070684_1002004712 | 162 |
| 285 | 3300005535 | Ga0070684_100712970 | Ga0070684_1007129702 | 162 |
| 286 | 3300005539 | Ga0068853_100083524 | Ga0068853_1000835242 | 162 |
| 287 | 3300005539 | Ga0068853_100527751 | Ga0068853_1005277512 | 162 |
| 288 | 3300005543 | Ga0070672_100000001 | Ga0070672_100000001100 | 162 |
| 289 | 3300005546 | Ga0070696_100772833 | Ga0070696_1007728332 | 162 |
| 290 | 3300005546 | Ga0070696_100812601 | Ga0070696_1008126012 | 162 |
| 291 | 3300005547 | Ga0070693_100003731 | Ga0070693_1000037314 | 162 |
| 292 | 3300005548 | Ga0070665_100000135 | Ga0070665_10000013520 | 162 |
| 293 | 3300005548 | Ga0070665_100019237 | Ga0070665_1000192372 | 162 |
| 294 | 3300005548 | Ga0070665_100020661 | Ga0070665_1000206618 | 162 |
| 295 | 3300005548 | Ga0070665_100375688 | Ga0070665_1003756882 | 162 |
| 296 | 3300005549 | Ga0070704_100208484 | Ga0070704_1002084842 | 162 |
| 297 | 3300005549 | Ga0070704_100451029 | Ga0070704_1004510292 | 162 |
| 298 | 3300005563 | Ga0068855_100549030 | Ga0068855_1005490302 | 162 |
| 299 | 3300005564 | Ga0070664_100118845 | Ga0070664_1001188453 | 162 |
| 300 | 3300005577 | Ga0068857_100065380 | Ga0068857_1000653803 | 162 |
| 301 | 3300005578 | Ga0068854_100001203 | Ga0068854_10000120317 | 162 |
| 302 | 3300005578 | Ga0068854_100056337 | Ga0068854_1000563372 | 162 |
| 303 | 3300005616 | Ga0068852_100000002 | Ga0068852_100000002246 | 162 |
| 304 | 3300005617 | Ga0068859_100759111 | Ga0068859_1007591112 | 162 |
| 305 | 3300005618 | Ga0068864_100000015 | Ga0068864_100000015196 | 162 |
| 306 | 3300005718 | Ga0068866_10006530 | Ga0068866_100065305 | 162 |
| 307 | 3300005718 | Ga0068866_10499494 | Ga0068866_104994942 | 162 |
| 308 | 3300005719 | Ga0068861_100312043 | Ga0068861_1003120432 | 162 |
| 309 | 3300005834 | Ga0068851_10013817 | Ga0068851_100138174 | 162 |
| 310 | 3300005841 | Ga0068863_100000022 | Ga0068863_10000002268 | 162 |
| 311 | 3300005841 | Ga0068863_100006236 | Ga0068863_1000062362 | 162 |
| 312 | 3300005841 | Ga0068863_100189242 | Ga0068863_1001892422 | 162 |
| 313 | 3300005841 | Ga0068863_100467130 | Ga0068863_1004671302 | 162 |
| 314 | 3300005842 | Ga0068858_100018138 | Ga0068858_1000181385 | 162 |
| 315 | 3300005842 | Ga0068858_100154568 | Ga0068858_1001545682 | 162 |
| 316 | 3300005843 | Ga0068860_100011591 | Ga0068860_1000115918 | 162 |
| 317 | 3300005843 | Ga0068860_100085754 | Ga0068860_1000857543 | 162 |
| 318 | 3300005844 | Ga0068862_100002782 | Ga0068862_1000027824 | 162 |
| 319 | 3300005937 | Ga0081455_10010756 | Ga0081455_100107566 | 162 |
| 320 | 3300005937 | Ga0081455_10041071 | Ga0081455_100410714 | 162 |
| 321 | 3300005937 | Ga0081455_10067266 | Ga0081455_100672662 | 162 |
| 322 | 3300005937 | Ga0081455_10239729 | Ga0081455_102397291 | 162 |
| 323 | 3300005981 | Ga0081538_10000812 | Ga0081538_1000081235 | 162 |
| 324 | 3300005981 | Ga0081538_10048156 | Ga0081538_100481563 | 162 |
| 325 | 3300005981 | Ga0081538_10156378 | Ga0081538_101563781 | 162 |
| 326 | 3300005981 | Ga0081538_10224873 | Ga0081538_102248732 | 162 |
| 327 | 3300005983 | Ga0081540_1000100 | Ga0081540_10001005 | 162 |
| 328 | 3300005983 | Ga0081540_1000366 | Ga0081540_100036621 | 162 |
| 329 | 3300005983 | Ga0081540_1083410 | Ga0081540_10834102 | 162 |
| 330 | 3300005985 | Ga0081539_10000878 | Ga0081539_100008787 | 162 |
| 331 | 3300005985 | Ga0081539_10024074 | Ga0081539_100240746 | 162 |
| 332 | 3300006038 | Ga0075365_10018720 | Ga0075365_100187202 | 162 |
| 333 | 3300006038 | Ga0075365_10376304 | Ga0075365_103763042 | 162 |
| 334 | 3300006038 | Ga0075365_10381470 | Ga0075365_103814702 | 162 |
| 335 | 3300006051 | Ga0075364_10028746 | Ga0075364_100287463 | 162 |
| 336 | 3300006051 | Ga0075364_10212352 | Ga0075364_102123522 | 162 |
| 337 | 3300006051 | Ga0075364_10440909 | Ga0075364_104409092 | 162 |
| 338 | 3300006051 | Ga0075364_10706725 | Ga0075364_107067251 | 162 |
| 339 | 3300006163 | Ga0070715_10000021 | Ga0070715_100000214 | 162 |
| 340 | 3300006175 | Ga0070712_100102609 | Ga0070712_1001026092 | 162 |
| 341 | 3300006178 | Ga0075367_10168207 | Ga0075367_101682072 | 162 |
| 342 | 3300006844 | Ga0075428_101249534 | Ga0075428_1012495341 | 162 |
| 343 | 3300006847 | Ga0075431_100918088 | Ga0075431_1009180881 | 162 |
| 344 | 3300006852 | Ga0075433_10033900 | Ga0075433_100339003 | 162 |
| 345 | 3300006852 | Ga0075433_10683866 | Ga0075433_106838662 | 162 |
| 346 | 3300006881 | Ga0068865_100000082 | Ga0068865_10000008226 | 162 |
| 347 | 3300006931 | Ga0097620_100759148 | Ga0097620_1007591482 | 162 |
| 348 | 3300007076 | Ga0075435_100168077 | Ga0075435_1001680772 | 162 |
| 349 | 3300009093 | Ga0105240_10809020 | Ga0105240_108090202 | 162 |
| 350 | 3300009098 | Ga0105245_10000278 | Ga0105245_100002788 | 162 |
| 351 | 3300009098 | Ga0105245_10000415 | Ga0105245_100004155 | 162 |
| 352 | 3300009098 | Ga0105245_10001311 | Ga0105245_1000131124 | 162 |
| 353 | 3300009098 | Ga0105245_10173186 | Ga0105245_101731862 | 162 |
| 354 | 3300009098 | Ga0105245_10866650 | Ga0105245_108666501 | 162 |
| 355 | 3300009101 | Ga0105247_10001706 | Ga0105247_1000170614 | 162 |
| 356 | 3300009101 | Ga0105247_10174168 | Ga0105247_101741682 | 162 |
| 357 | 3300009147 | Ga0114129_10027328 | Ga0114129_100273283 | 162 |
| 358 | 3300009147 | Ga0114129_10119702 | Ga0114129_101197023 | 162 |
| 359 | 3300009147 | Ga0114129_11011700 | Ga0114129_110117002 | 162 |
| 360 | 3300009148 | Ga0105243_10007118 | Ga0105243_1000711810 | 162 |
| 361 | 3300009148 | Ga0105243_10165704 | Ga0105243_101657042 | 162 |
| 362 | 3300009148 | Ga0105243_10379698 | Ga0105243_103796982 | 162 |
| 363 | 3300009148 | Ga0105243_10530373 | Ga0105243_105303732 | 162 |
| 364 | 3300009174 | Ga0105241_10069956 | Ga0105241_100699562 | 162 |
| 365 | 3300009176 | Ga0105242_10000449 | Ga0105242_100004493 | 162 |
| 366 | 3300009176 | Ga0105242_10000653 | Ga0105242_1000065318 | 162 |
| 367 | 3300009176 | Ga0105242_10017935 | Ga0105242_100179352 | 162 |
| 368 | 3300009176 | Ga0105242_10308575 | Ga0105242_103085752 | 162 |
| 369 | 3300009176 | Ga0105242_10574937 | Ga0105242_105749372 | 162 |
| 370 | 3300009176 | Ga0105242_10775178 | Ga0105242_107751782 | 162 |
| 371 | 3300009176 | Ga0105242_12416894 | Ga0105242_124168941 | 162 |
| 372 | 3300009177 | Ga0105248_10000020 | Ga0105248_10000020125 | 162 |
| 373 | 3300009177 | Ga0105248_10305649 | Ga0105248_103056492 | 162 |
| 374 | 3300009551 | Ga0105238_10000055 | Ga0105238_1000005518 | 162 |
| 375 | 3300009553 | Ga0105249_10000143 | Ga0105249_1000014373 | 162 |
| 376 | 3300009553 | Ga0105249_10003360 | Ga0105249_100033602 | 162 |
| 377 | 3300009553 | Ga0105249_12663713 | Ga0105249_126637131 | 162 |
| 378 | 3300010375 | Ga0105239_10524755 | Ga0105239_105247551 | 162 |
| 379 | 3300011119 | Ga0105246_10709386 | Ga0105246_107093862 | 162 |
| 380 | 3300011119 | Ga0105246_11618017 | Ga0105246_116180171 | 162 |
| 381 | 3300012483 | Ga0157337_1013043 | Ga0157337_10130432 | 162 |
| 382 | 3300013102 | Ga0157371_10001577 | Ga0157371_100015773 | 162 |
| 383 | 3300013102 | Ga0157371_11288276 | Ga0157371_112882761 | 162 |
| 384 | 3300013104 | Ga0157370_10003254 | Ga0157370_1000325415 | 162 |
| 385 | 3300013104 | Ga0157370_10047400 | Ga0157370_100474003 | 162 |
| 386 | 3300013104 | Ga0157370_10629691 | Ga0157370_106296912 | 162 |
| 387 | 3300013105 | Ga0157369_10000074 | Ga0157369_1000007427 | 162 |
| 388 | 3300013296 | Ga0157374_10000486 | Ga0157374_1000048618 | 162 |
| 389 | 3300013296 | Ga0157374_10384590 | Ga0157374_103845902 | 162 |
| 390 | 3300013296 | Ga0157374_10669027 | Ga0157374_106690272 | 162 |
| 391 | 3300013297 | Ga0157378_10003241 | Ga0157378_100032412 | 162 |
| 392 | 3300013297 | Ga0157378_10040737 | Ga0157378_100407373 | 162 |
| 393 | 3300013297 | Ga0157378_10093937 | Ga0157378_100939372 | 162 |
| 394 | 3300013297 | Ga0157378_10978479 | Ga0157378_109784791 | 162 |
| 395 | 3300013307 | Ga0157372_10000053 | Ga0157372_1000005328 | 162 |
| 396 | 3300013308 | Ga0157375_10003797 | Ga0157375_1000379711 | 162 |
| 397 | 3300013308 | Ga0157375_13582365 | Ga0157375_135823651 | 162 |
| 398 | 3300014325 | Ga0163163_11167379 | Ga0163163_111673792 | 162 |
| 399 | 3300014326 | Ga0157380_10000016 | Ga0157380_10000016100 | 162 |
| 400 | 3300014326 | Ga0157380_10000236 | Ga0157380_100002363 | 162 |
| 401 | 3300014968 | Ga0157379_10148336 | Ga0157379_101483363 | 162 |
| 402 | 3300014968 | Ga0157379_10161252 | Ga0157379_101612522 | 162 |
| 403 | 3300014968 | Ga0157379_10417767 | Ga0157379_104177672 | 162 |
| 404 | 3300014969 | Ga0157376_10027214 | Ga0157376_100272143 | 162 |
| 405 | 3300014969 | Ga0157376_10074468 | Ga0157376_100744683 | 162 |
| 406 | 3300017792 | Ga0163161_10000053 | Ga0163161_10000053122 | 162 |
| 407 | 3300017792 | Ga0163161_10175041 | Ga0163161_101750412 | 162 |
| 408 | 3300017792 | Ga0163161_10286057 | Ga0163161_102860572 | 162 |
| 409 | 3300017792 | Ga0163161_10668428 | Ga0163161_106684282 | 162 |
| 410 | 3300020070 | Ga0206356_10868657 | Ga0206356_108686571 | 162 |
| 411 | 3300020610 | Ga0154015_1555886 | Ga0154015_15558862 | 162 |
| 412 | 3300025321 | Ga0207656_10000226 | Ga0207656_1000022614 | 162 |
| 413 | 3300025321 | Ga0207656_10027875 | Ga0207656_100278752 | 162 |
| 414 | 3300025899 | Ga0207642_10000080 | Ga0207642_1000008015 | 162 |
| 415 | 3300025900 | Ga0207710_10000157 | Ga0207710_1000015767 | 162 |
| 416 | 3300025903 | Ga0207680_10002942 | Ga0207680_100029427 | 162 |
| 417 | 3300025903 | Ga0207680_10056099 | Ga0207680_100560993 | 162 |
| 418 | 3300025903 | Ga0207680_10247229 | Ga0207680_102472291 | 162 |
| 419 | 3300025905 | Ga0207685_10000054 | Ga0207685_1000005414 | 162 |
| 420 | 3300025905 | Ga0207685_10070642 | Ga0207685_100706422 | 162 |
| 421 | 3300025906 | Ga0207699_10729075 | Ga0207699_107290752 | 162 |
| 422 | 3300025911 | Ga0207654_10057938 | Ga0207654_100579382 | 162 |
| 423 | 3300025912 | Ga0207707_10289153 | Ga0207707_102891532 | 162 |
| 424 | 3300025912 | Ga0207707_10708359 | Ga0207707_107083591 | 162 |
| 425 | 3300025915 | Ga0207693_10050125 | Ga0207693_100501253 | 162 |
| 426 | 3300025915 | Ga0207693_10103235 | Ga0207693_101032352 | 162 |
| 427 | 3300025916 | Ga0207663_10023302 | Ga0207663_100233023 | 162 |
| 428 | 3300025916 | Ga0207663_10245295 | Ga0207663_102452952 | 162 |
| 429 | 3300025917 | Ga0207660_10161370 | Ga0207660_101613701 | 162 |
| 430 | 3300025920 | Ga0207649_10000127 | Ga0207649_1000012764 | 162 |
| 431 | 3300025920 | Ga0207649_10591112 | Ga0207649_105911122 | 162 |
| 432 | 3300025921 | Ga0207652_10000321 | Ga0207652_1000032138 | 162 |
| 433 | 3300025921 | Ga0207652_10001733 | Ga0207652_1000173310 | 162 |
| 434 | 3300025923 | Ga0207681_10135411 | Ga0207681_101354112 | 162 |
| 435 | 3300025924 | Ga0207694_10000063 | Ga0207694_10000063123 | 162 |
| 436 | 3300025926 | Ga0207659_10000013 | Ga0207659_1000001390 | 162 |
| 437 | 3300025927 | Ga0207687_10000032 | Ga0207687_1000003217 | 162 |
| 438 | 3300025927 | Ga0207687_10000036 | Ga0207687_10000036123 | 162 |
| 439 | 3300025927 | Ga0207687_10000460 | Ga0207687_100004602 | 162 |
| 440 | 3300025927 | Ga0207687_10003112 | Ga0207687_100031124 | 162 |
| 441 | 3300025928 | Ga0207700_10000033 | Ga0207700_1000003329 | 162 |
| 442 | 3300025929 | Ga0207664_10112012 | Ga0207664_101120122 | 162 |
| 443 | 3300025931 | Ga0207644_10056710 | Ga0207644_100567102 | 162 |
| 444 | 3300025932 | Ga0207690_10074923 | Ga0207690_100749232 | 162 |
| 445 | 3300025932 | Ga0207690_10082969 | Ga0207690_100829692 | 162 |
| 446 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001407 | 162 |
| 447 | 3300025933 | Ga0207706_10270954 | Ga0207706_102709542 | 162 |
| 448 | 3300025934 | Ga0207686_10000097 | Ga0207686_1000009713 | 162 |
| 449 | 3300025934 | Ga0207686_10000921 | Ga0207686_100009219 | 162 |
| 450 | 3300025934 | Ga0207686_10019225 | Ga0207686_100192252 | 162 |
| 451 | 3300025934 | Ga0207686_10644370 | Ga0207686_106443702 | 162 |
| 452 | 3300025935 | Ga0207709_10023552 | Ga0207709_100235524 | 162 |
| 453 | 3300025937 | Ga0207669_10000017 | Ga0207669_1000001716 | 162 |
| 454 | 3300025938 | Ga0207704_10000184 | Ga0207704_1000018420 | 162 |
| 455 | 3300025940 | Ga0207691_10000017 | Ga0207691_1000001727 | 162 |
| 456 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006251 | 162 |
| 457 | 3300025942 | Ga0207689_10466253 | Ga0207689_104662532 | 162 |
| 458 | 3300025944 | Ga0207661_10002110 | Ga0207661_1000211012 | 162 |
| 459 | 3300025944 | Ga0207661_10004460 | Ga0207661_100044602 | 162 |
| 460 | 3300025944 | Ga0207661_10052819 | Ga0207661_100528194 | 162 |
| 461 | 3300025944 | Ga0207661_10337590 | Ga0207661_103375902 | 162 |
| 462 | 3300025944 | Ga0207661_10370703 | Ga0207661_103707032 | 162 |
| 463 | 3300025945 | Ga0207679_10045587 | Ga0207679_100455873 | 162 |
| 464 | 3300025960 | Ga0207651_10017969 | Ga0207651_100179694 | 162 |
| 465 | 3300025961 | Ga0207712_10000058 | Ga0207712_10000058123 | 162 |
| 466 | 3300025972 | Ga0207668_10036707 | Ga0207668_100367072 | 162 |
| 467 | 3300025972 | Ga0207668_10235463 | Ga0207668_102354632 | 162 |
| 468 | 3300025981 | Ga0207640_10000093 | Ga0207640_1000009328 | 162 |
| 469 | 3300025981 | Ga0207640_10034577 | Ga0207640_100345772 | 162 |
| 470 | 3300025986 | Ga0207658_10003551 | Ga0207658_100035514 | 162 |
| 471 | 3300025986 | Ga0207658_10018897 | Ga0207658_100188972 | 162 |
| 472 | 3300025986 | Ga0207658_10333568 | Ga0207658_103335682 | 162 |
| 473 | 3300026023 | Ga0207677_10001038 | Ga0207677_1000103815 | 162 |
| 474 | 3300026023 | Ga0207677_10006605 | Ga0207677_100066052 | 162 |
| 475 | 3300026035 | Ga0207703_10000061 | Ga0207703_10000061131 | 162 |
| 476 | 3300026035 | Ga0207703_10000385 | Ga0207703_100003852 | 162 |
| 477 | 3300026035 | Ga0207703_10236705 | Ga0207703_102367052 | 162 |
| 478 | 3300026041 | Ga0207639_10005999 | Ga0207639_100059992 | 162 |
| 479 | 3300026041 | Ga0207639_10058185 | Ga0207639_100581852 | 162 |
| 480 | 3300026041 | Ga0207639_10973510 | Ga0207639_109735101 | 162 |
| 481 | 3300026067 | Ga0207678_10002224 | Ga0207678_100022246 | 162 |
| 482 | 3300026075 | Ga0207708_10204711 | Ga0207708_102047112 | 162 |
| 483 | 3300026075 | Ga0207708_10227558 | Ga0207708_102275582 | 162 |
| 484 | 3300026078 | Ga0207702_10000637 | Ga0207702_1000063718 | 162 |
| 485 | 3300026078 | Ga0207702_10221539 | Ga0207702_102215392 | 162 |
| 486 | 3300026088 | Ga0207641_10000016 | Ga0207641_10000016189 | 162 |
| 487 | 3300026088 | Ga0207641_10007724 | Ga0207641_100077242 | 162 |
| 488 | 3300026088 | Ga0207641_10219771 | Ga0207641_102197712 | 162 |
| 489 | 3300026088 | Ga0207641_10416146 | Ga0207641_104161461 | 162 |
| 490 | 3300026095 | Ga0207676_10000018 | Ga0207676_10000018104 | 162 |
| 491 | 3300026116 | Ga0207674_10054549 | Ga0207674_100545493 | 162 |
| 492 | 3300026118 | Ga0207675_101617495 | Ga0207675_1016174951 | 162 |
| 493 | 3300026121 | Ga0207683_10132710 | Ga0207683_101327102 | 162 |
| 494 | 3300026121 | Ga0207683_10257607 | Ga0207683_102576072 | 162 |
| 495 | 3300026121 | Ga0207683_10331770 | Ga0207683_103317702 | 162 |
| 496 | 3300026142 | Ga0207698_10000004 | Ga0207698_1000000439 | 162 |
| 497 | 3300026142 | Ga0207698_10013220 | Ga0207698_100132203 | 162 |
| 498 | 3300026142 | Ga0207698_11932981 | Ga0207698_119329811 | 162 |
| 499 | 3300028379 | Ga0268266_10000056 | Ga0268266_10000056169 | 162 |
| 500 | 3300028379 | Ga0268266_10000601 | Ga0268266_100006011 | 162 |
| 501 | 3300028379 | Ga0268266_10001254 | Ga0268266_1000125427 | 162 |
| 502 | 3300028379 | Ga0268266_10006356 | Ga0268266_100063562 | 162 |
| 503 | 3300028379 | Ga0268266_10235712 | Ga0268266_102357122 | 162 |
| 504 | 3300028381 | Ga0268264_10016645 | Ga0268264_100166455 | 162 |
| 505 | 3300028381 | Ga0268264_10581070 | Ga0268264_105810702 | 162 |
| 506 | 3300028556 | Ga0265337_1000066 | Ga0265337_100006618 | 162 |
| 507 | 3300028558 | Ga0265326_10000019 | Ga0265326_10000019138 | 162 |
| 508 | 3300028563 | Ga0265319_1000469 | Ga0265319_100046920 | 162 |
| 509 | 3300028653 | Ga0265323_10102148 | Ga0265323_101021482 | 162 |
| 510 | 3300028654 | Ga0265322_10000011 | Ga0265322_10000011138 | 162 |
| 511 | 3300028666 | Ga0265336_10003168 | Ga0265336_100031682 | 162 |
| 512 | 3300028800 | Ga0265338_10000244 | Ga0265338_1000024488 | 162 |
| 513 | 3300028800 | Ga0265338_10282917 | Ga0265338_102829172 | 162 |
| 514 | 3300029957 | Ga0265324_10000283 | Ga0265324_1000028320 | 162 |
| 515 | 3300029957 | Ga0265324_10051394 | Ga0265324_100513942 | 162 |
| 516 | 3300030521 | Ga0307511_10082915 | Ga0307511_100829152 | 162 |
| 517 | 3300031239 | Ga0265328_10000737 | Ga0265328_1000073717 | 162 |
| 518 | 3300031240 | Ga0265320_10000011 | Ga0265320_10000011138 | 162 |
| 519 | 3300031242 | Ga0265329_10016232 | Ga0265329_100162323 | 162 |
| 520 | 3300031250 | Ga0265331_10000858 | Ga0265331_1000085816 | 162 |
| 521 | 3300031250 | Ga0265331_10047145 | Ga0265331_100471452 | 162 |
| 522 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015246 | 162 |
| 523 | 3300031344 | Ga0265316_10047188 | Ga0265316_100471883 | 162 |
| 524 | 3300031344 | Ga0265316_10538901 | Ga0265316_105389012 | 162 |
| 525 | 3300031711 | Ga0265314_10000640 | Ga0265314_1000064039 | 162 |
| 526 | 3300031712 | Ga0265342_10048932 | Ga0265342_100489322 | 162 |
| 527 | 3300031731 | Ga0307405_10491037 | Ga0307405_104910371 | 162 |
| 528 | 3300031824 | Ga0307413_10324320 | Ga0307413_103243203 | 162 |
| 529 | 3300032002 | Ga0307416_100007153 | Ga0307416_1000071537 | 162 |
| 530 | 3300032126 | Ga0307415_100023712 | Ga0307415_1000237121 | 162 |
| 531 | 3300032133 | Ga0316583_10045544 | Ga0316583_100455442 | 162 |
| 532 | 3300035119 | Ga0373956_0368746 | Ga0373956_0368746_90_578 | 162 |
| 533 | 3300035120 | Ga0373957_0098034 | Ga0373957_0098034_347_835 | 162 |
| 534 | 3300035398 | Ga0316574_0124337 | Ga0316574_0124337_243_788 | 162 |
| 535 | 3300036401 | Ga0373937_0053338 | Ga0373937_0053338_2118_2606 | 162 |
| 536 | 3300036401 | Ga0373937_0090584 | Ga0373937_0090584_2216_2704 | 162 |
| 537 | 3300036401 | Ga0373937_1027542 | Ga0373937_1027542_25_513 | 162 |
| 538 | 3300036401 | Ga0373937_1276367 | Ga0373937_1276367_54_542 | 162 |
| 539 | 3300036712 | Ga0316584_0001782 | Ga0316584_0001782_2629_3174 | 162 |
| 540 | 3300037312 | Ga0395899_0577093 | Ga0395899_0577093_73_564 | 162 |
| 541 | 3300037418 | Ga0395900_0165224 | Ga0395900_0165224_993_1484 | 162 |
| 542 | 3300037418 | Ga0395900_0753030 | Ga0395900_0753030_288_788 | 162 |
| 543 | 3300037471 | Ga0395905_0849876 | Ga0395905_0849876_134_625 | 162 |
| 544 | 3300038443 | Ga0395901_0179840 | Ga0395901_0179840_455_955 | 162 |
| 545 | 3300038443 | Ga0395901_0190166 | Ga0395901_0190166_91_582 | 162 |
| 546 | 3300038443 | Ga0395901_0369251 | Ga0395901_0369251_716_1207 | 162 |
| 547 | 3300038443 | Ga0395901_0563530 | Ga0395901_0563530_320_808 | 162 |
| 548 | 3300041459 | Ga0451800_0147095 | Ga0451800_0147095_585_1079 | 162 |
| 549 | 3300041486 | Ga0451807_1807140 | Ga0451807_1807140_122_616 | 162 |
| 550 | 3300041496 | Ga0451839_1143849 | Ga0451839_1143849_546_1034 | 162 |
| 551 | 3300041501 | Ga0451845_0708268 | Ga0451845_0708268_337_825 | 162 |
| 552 | 3300041509 | Ga0451843_0715326 | Ga0451843_0715326_50_538 | 162 |
| 553 | 3300044694 | Ga0466963_0000017 | Ga0466963_0000017_22339_22827 | 162 |
| 554 | 3300044694 | Ga0466963_0358016 | Ga0466963_0358016_418_906 | 162 |
| 555 | 3300044735 | Ga0466968_0401672 | Ga0466968_0401672_92_586 | 162 |
| 556 | 3300044901 | Ga0466960_0107322 | Ga0466960_0107322_879_1367 | 162 |
| 557 | 3300044901 | Ga0466960_0364103 | Ga0466960_0364103_162_650 | 162 |
| 558 | 3300045836 | Ga0466958_0010414 | Ga0466958_0010414_64_552 | 162 |
| 559 | 3300045976 | Ga0466967_0000001 | Ga0466967_0000001_117690_118178 | 162 |
| 560 | 3300045976 | Ga0466967_0089398 | Ga0466967_0089398_1937_2425 | 162 |
| 561 | 3300045976 | Ga0466967_0506338 | Ga0466967_0506338_617_1105 | 162 |
| 562 | 3300046454 | Ga0495592_0000607 | Ga0495592_0000607_22123_22611 | 162 |
| 563 | 3300046454 | Ga0495592_0128862 | Ga0495592_0128862_801_1316 | 162 |
| 564 | 3300046454 | Ga0495592_0141108 | Ga0495592_0141108_768_1256 | 162 |
| 565 | 3300046454 | Ga0495592_0217497 | Ga0495592_0217497_128_616 | 162 |
| 566 | 3300046455 | Ga0495603_0000286 | Ga0495603_0000286_18903_19391 | 162 |
| 567 | 3300046455 | Ga0495603_0001350 | Ga0495603_0001350_11186_11677 | 162 |
| 568 | 3300046455 | Ga0495603_0023918 | Ga0495603_0023918_2605_3099 | 162 |
| 569 | 3300046458 | Ga0495591_038251 | Ga0495591_038251_402_890 | 162 |
| 570 | 3300046459 | Ga0495629_0000245 | Ga0495629_0000245_35636_36124 | 162 |
| 571 | 3300046459 | Ga0495629_0004704 | Ga0495629_0004704_8843_9331 | 162 |
| 572 | 3300046459 | Ga0495629_0005286 | Ga0495629_0005286_7247_7735 | 162 |
| 573 | 3300046459 | Ga0495629_0079298 | Ga0495629_0079298_148_639 | 162 |
| 574 | 3300046461 | Ga0495641_0000005 | Ga0495641_0000005_180948_181436 | 162 |
| 575 | 3300046461 | Ga0495641_0014257 | Ga0495641_0014257_3341_3829 | 162 |
| 576 | 3300046461 | Ga0495641_0038618 | Ga0495641_0038618_825_1313 | 162 |
| 577 | 3300046461 | Ga0495641_0065442 | Ga0495641_0065442_671_1159 | 162 |
| 578 | 3300046462 | Ga0495651_0028208 | Ga0495651_0028208_926_1414 | 162 |
| 579 | 3300046462 | Ga0495651_0254350 | Ga0495651_0254350_335_823 | 162 |
| 580 | 3300046462 | Ga0495651_0388555 | Ga0495651_0388555_404_892 | 162 |
| 581 | 3300046463 | Ga0495653_0092883 | Ga0495653_0092883_1110_1598 | 162 |
| 582 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_74197_74685 | 162 |
| 583 | 3300046476 | Ga0495662_0000001 | Ga0495662_0000001_23595_24083 | 162 |
| 584 | 3300046476 | Ga0495662_0000848 | Ga0495662_0000848_11799_12287 | 162 |
| 585 | 3300046476 | Ga0495662_0299230 | Ga0495662_0299230_140_631 | 162 |
| 586 | 3300046477 | Ga0495664_0801046 | Ga0495664_0801046_10_501 | 162 |
| 587 | 3300046499 | Ga0495594_0000089 | Ga0495594_0000089_32272_32763 | 162 |
| 588 | 3300046507 | Ga0495606_0000040 | Ga0495606_0000040_49623_50111 | 162 |
| 589 | 3300046511 | Ga0495608_0000007 | Ga0495608_0000007_124939_125427 | 162 |
| 590 | 3300046511 | Ga0495608_0003541 | Ga0495608_0003541_10106_10594 | 162 |
| 591 | 3300046511 | Ga0495608_0053168 | Ga0495608_0053168_1583_2071 | 162 |
| 592 | 3300046511 | Ga0495608_0094331 | Ga0495608_0094331_224_712 | 162 |
| 593 | 3300046514 | Ga0495618_0000014 | Ga0495618_0000014_111127_111615 | 162 |
| 594 | 3300046515 | Ga0495620_0000784 | Ga0495620_0000784_3301_3789 | 162 |
| 595 | 3300046516 | Ga0495628_0005372 | Ga0495628_0005372_10340_10828 | 162 |
| 596 | 3300046516 | Ga0495628_0023790 | Ga0495628_0023790_1193_1681 | 162 |
| 597 | 3300046516 | Ga0495628_0066303 | Ga0495628_0066303_1169_1657 | 162 |
| 598 | 3300046516 | Ga0495628_0074598 | Ga0495628_0074598_390_878 | 162 |
| 599 | 3300046516 | Ga0495628_0101305 | Ga0495628_0101305_990_1478 | 162 |
| 600 | 3300046516 | Ga0495628_0159293 | Ga0495628_0159293_190_678 | 162 |
| 601 | 3300046516 | Ga0495628_0240240 | Ga0495628_0240240_22_510 | 162 |
| 602 | 3300046517 | Ga0495630_0000014 | Ga0495630_0000014_185291_185779 | 162 |
| 603 | 3300046517 | Ga0495630_0000533 | Ga0495630_0000533_5190_5678 | 162 |
| 604 | 3300046517 | Ga0495630_0003407 | Ga0495630_0003407_8050_8538 | 162 |
| 605 | 3300046517 | Ga0495630_0219226 | Ga0495630_0219226_657_1145 | 162 |
| 606 | 3300046519 | Ga0495632_0167686 | Ga0495632_0167686_31_519 | 162 |
| 607 | 3300046519 | Ga0495632_0278678 | Ga0495632_0278678_141_635 | 162 |
| 608 | 3300046520 | Ga0495637_0229073 | Ga0495637_0229073_129_617 | 162 |
| 609 | 3300046523 | Ga0495644_0001871 | Ga0495644_0001871_1315_1803 | 162 |
| 610 | 3300046529 | Ga0495652_0000037 | Ga0495652_0000037_19006_19494 | 162 |
| 611 | 3300046529 | Ga0495652_0011995 | Ga0495652_0011995_3512_4012 | 162 |
| 612 | 3300046529 | Ga0495652_0329517 | Ga0495652_0329517_376_867 | 162 |
| 613 | 3300046529 | Ga0495652_0496417 | Ga0495652_0496417_152_640 | 162 |
| 614 | 3300046533 | Ga0495640_0024325 | Ga0495640_0024325_3323_3811 | 162 |
| 615 | 3300046533 | Ga0495640_0091728 | Ga0495640_0091728_1310_1798 | 162 |
| 616 | 3300046533 | Ga0495640_0202996 | Ga0495640_0202996_458_949 | 162 |
| 617 | 3300046533 | Ga0495640_0668817 | Ga0495640_0668817_34_525 | 162 |
| 618 | 3300046535 | Ga0495586_0003054 | Ga0495586_0003054_7352_7840 | 162 |
| 619 | 3300046535 | Ga0495586_0508235 | Ga0495586_0508235_194_682 | 162 |
| 620 | 3300046536 | Ga0495587_0003966 | Ga0495587_0003966_1882_2370 | 162 |
| 621 | 3300046536 | Ga0495587_0244258 | Ga0495587_0244258_339_827 | 162 |
| 622 | 3300046536 | Ga0495587_0245051 | Ga0495587_0245051_419_910 | 162 |
| 623 | 3300046537 | Ga0495598_0001582 | Ga0495598_0001582_3285_3773 | 162 |
| 624 | 3300046539 | Ga0495621_0033813 | Ga0495621_0033813_496_984 | 162 |
| 625 | 3300046543 | Ga0495645_0027447 | Ga0495645_0027447_3610_4125 | 162 |
| 626 | 3300046543 | Ga0495645_0166294 | Ga0495645_0166294_931_1419 | 162 |
| 627 | 3300046543 | Ga0495645_0310285 | Ga0495645_0310285_445_945 | 162 |
| 628 | 3300046557 | Ga0495622_0000080 | Ga0495622_0000080_82555_83046 | 162 |
| 629 | 3300046558 | Ga0495633_0294546 | Ga0495633_0294546_226_714 | 162 |
| 630 | 3300046559 | Ga0495667_0000020 | Ga0495667_0000020_63677_64165 | 162 |
| 631 | 3300046615 | Ga0495656_0000465 | Ga0495656_0000465_5225_5713 | 162 |
| 632 | 3300046616 | Ga0495668_0041252 | Ga0495668_0041252_2060_2551 | 162 |
| 633 | 3300046642 | Ga0495634_0000028 | Ga0495634_0000028_6970_7458 | 162 |
| 634 | 3300046642 | Ga0495634_0001744 | Ga0495634_0001744_10124_10615 | 162 |
| 635 | 3300046642 | Ga0495634_0182420 | Ga0495634_0182420_606_1094 | 162 |
| 636 | 3300046642 | Ga0495634_0324706 | Ga0495634_0324706_149_637 | 162 |
| 637 | 3300046642 | Ga0495634_0368028 | Ga0495634_0368028_66_554 | 162 |
| 638 | 3300046642 | Ga0495634_0369367 | Ga0495634_0369367_13_501 | 162 |
| 639 | 3300046660 | Ga0495625_0000349 | Ga0495625_0000349_50972_51469 | 162 |
| 640 | 3300046660 | Ga0495625_0076676 | Ga0495625_0076676_289_777 | 162 |
| 641 | 3300046663 | Ga0495635_0000076 | Ga0495635_0000076_2937_3425 | 162 |
| 642 | 3300046663 | Ga0495635_0034289 | Ga0495635_0034289_2556_3044 | 162 |
| 643 | 3300046663 | Ga0495635_0379265 | Ga0495635_0379265_270_758 | 162 |
| 644 | 3300046674 | Ga0495588_0000362 | Ga0495588_0000362_17380_17868 | 162 |
| 645 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_257085_257573 | 162 |
| 646 | 3300046675 | Ga0495657_0017364 | Ga0495657_0017364_2420_2908 | 162 |
| 647 | 3300046675 | Ga0495657_0218471 | Ga0495657_0218471_268_756 | 162 |
| 648 | 3300046678 | Ga0495599_0036072 | Ga0495599_0036072_1577_2065 | 162 |
| 649 | 3300046678 | Ga0495599_0668254 | Ga0495599_0668254_15_515 | 162 |
| 650 | 3300046679 | Ga0495623_0055970 | Ga0495623_0055970_978_1466 | 162 |
| 651 | 3300046679 | Ga0495623_0124236 | Ga0495623_0124236_890_1390 | 162 |
| 652 | 3300046680 | Ga0495646_0201490 | Ga0495646_0201490_221_721 | 162 |
| 653 | 3300046681 | Ga0495647_0000001 | Ga0495647_0000001_106566_107054 | 162 |
| 654 | 3300046681 | Ga0495647_0005148 | Ga0495647_0005148_1382_1870 | 162 |
| 655 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_197803_198291 | 162 |
| 656 | 3300046683 | Ga0495658_0019725 | Ga0495658_0019725_1856_2344 | 162 |
| 657 | 3300046683 | Ga0495658_0122526 | Ga0495658_0122526_341_832 | 162 |
| 658 | 3300046684 | Ga0495669_0000113 | Ga0495669_0000113_28761_29249 | 162 |
| 659 | 3300046689 | Ga0495613_0000005 | Ga0495613_0000005_104476_104964 | 162 |
| 660 | 3300046689 | Ga0495613_0000041 | Ga0495613_0000041_57870_58358 | 162 |
| 661 | 3300046689 | Ga0495613_0140545 | Ga0495613_0140545_1043_1531 | 162 |
| 662 | 3300046689 | Ga0495613_0220715 | Ga0495613_0220715_819_1310 | 162 |
| 663 | 3300046690 | Ga0495624_0000019 | Ga0495624_0000019_100624_101112 | 162 |
| 664 | 3300046690 | Ga0495624_0000417 | Ga0495624_0000417_19899_20387 | 162 |
| 665 | 3300046690 | Ga0495624_0033290 | Ga0495624_0033290_1898_2386 | 162 |
| 666 | 3300046690 | Ga0495624_0372530 | Ga0495624_0372530_329_817 | 162 |
| 667 | 3300046691 | Ga0495670_0020649 | Ga0495670_0020649_1743_2231 | 162 |
| 668 | 3300046694 | Ga0495649_0002403 | Ga0495649_0002403_5183_5671 | 162 |
| 669 | 3300046809 | Ga0495600_0011717 | Ga0495600_0011717_4856_5344 | 162 |
| 670 | 3300046809 | Ga0495600_0034654 | Ga0495600_0034654_82_570 | 162 |
| 671 | 3300047315 | Ga0495581_0147758 | Ga0495581_0147758_335_823 | 162 |
| 672 | 3300047317 | Ga0495604_0000239 | Ga0495604_0000239_7593_8081 | 162 |
| 673 | 3300047317 | Ga0495604_0001251 | Ga0495604_0001251_7623_8120 | 162 |
| 674 | 3300047317 | Ga0495604_0003401 | Ga0495604_0003401_11682_12170 | 162 |
| 675 | 3300047317 | Ga0495604_0190723 | Ga0495604_0190723_22_510 | 162 |
| 676 | 3300047319 | Ga0495674_0000030 | Ga0495674_0000030_9458_9946 | 162 |
| 677 | 3300047319 | Ga0495674_0639066 | Ga0495674_0639066_315_803 | 162 |
| 678 | 3300047320 | Ga0495672_0148694 | Ga0495672_0148694_109_606 | 162 |
| 679 | 3300047321 | Ga0495676_0001461 | Ga0495676_0001461_19316_19804 | 162 |
| 680 | 3300047321 | Ga0495676_0012579 | Ga0495676_0012579_4895_5383 | 162 |
| 681 | 3300047321 | Ga0495676_0085869 | Ga0495676_0085869_452_940 | 162 |
| 682 | 3300047322 | Ga0495680_0000143 | Ga0495680_0000143_8568_9056 | 162 |
| 683 | 3300047322 | Ga0495680_0001430 | Ga0495680_0001430_3515_4012 | 162 |
| 684 | 3300047322 | Ga0495680_0039154 | Ga0495680_0039154_3025_3513 | 162 |
| 685 | 3300047322 | Ga0495680_0188089 | Ga0495680_0188089_658_1146 | 162 |
| 686 | 3300047444 | Ga0495675_0001421 | Ga0495675_0001421_8714_9202 | 162 |
| 687 | 3300047444 | Ga0495675_0008742 | Ga0495675_0008742_5574_6062 | 162 |
| 688 | 3300047446 | Ga0495679_007662 | Ga0495679_007662_463_951 | 162 |
| 689 | 3300047471 | Ga0495684_0087952 | Ga0495684_0087952_1495_1983 | 162 |
| 690 | 3300047673 | Ga0495593_0039645 | Ga0495593_0039645_1764_2252 | 162 |
| 691 | 3300047673 | Ga0495593_0057583 | Ga0495593_0057583_333_821 | 162 |
| 692 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_148150_148638 | 162 |
| 693 | 3300048088 | Ga0495602_0001031 | Ga0495602_0001031_17569_18057 | 162 |
| 694 | 3300048088 | Ga0495602_0151755 | Ga0495602_0151755_1113_1601 | 162 |
| 695 | 3300048088 | Ga0495602_0912922 | Ga0495602_0912922_65_565 | 162 |
| 696 | 3300048903 | Ga0496100_0000013 | Ga0496100_0000013_62277_62765 | 162 |
| 697 | 3300048903 | Ga0496100_0434207 | Ga0496100_0434207_324_830 | 162 |
| 698 | 3300048904 | Ga0496101_0000035 | Ga0496101_0000035_62277_62765 | 162 |
| 699 | 3300048905 | Ga0496102_0000211 | Ga0496102_0000211_6881_7369 | 162 |
| 700 | 3300048905 | Ga0496102_0010565 | Ga0496102_0010565_2520_3014 | 162 |
| 701 | 3300048905 | Ga0496102_0058720 | Ga0496102_0058720_761_1315 | 162 |
| 702 | 3300048905 | Ga0496102_0190210 | Ga0496102_0190210_696_1193 | 162 |
| 703 | 3300048905 | Ga0496102_0630218 | Ga0496102_0630218_245_739 | 162 |
| 704 | 3300048906 | Ga0496103_0000083 | Ga0496103_0000083_44361_44849 | 162 |
| 705 | 3300048906 | Ga0496103_0077061 | Ga0496103_0077061_1488_1982 | 162 |
| 706 | 3300048906 | Ga0496103_0093172 | Ga0496103_0093172_115_609 | 162 |
| 707 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_256761_257249 | 162 |
| 708 | 3300048907 | Ga0496104_0000052 | Ga0496104_0000052_26260_26748 | 162 |
| 709 | 3300048907 | Ga0496104_0000765 | Ga0496104_0000765_24083_24574 | 162 |
| 710 | 3300048907 | Ga0496104_0875618 | Ga0496104_0875618_53_541 | 162 |
| 711 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_218550_219038 | 162 |
| 712 | 3300048908 | Ga0496105_0000030 | Ga0496105_0000030_110578_111066 | 162 |
| 713 | 3300048908 | Ga0496105_0000409 | Ga0496105_0000409_11223_11714 | 162 |
| 714 | 3300048908 | Ga0496105_0958289 | Ga0496105_0958289_138_626 | 162 |
| 715 | 3300048909 | Ga0496106_0000121 | Ga0496106_0000121_32178_32666 | 162 |
| 716 | 3300048909 | Ga0496106_0004512 | Ga0496106_0004512_9083_9571 | 162 |
| 717 | 3300048910 | Ga0496107_0000020 | Ga0496107_0000020_33426_33914 | 162 |
| 718 | 3300048910 | Ga0496107_0076122 | Ga0496107_0076122_143_631 | 162 |
| 719 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_345647_346135 | 162 |
| 720 | 3300048911 | Ga0496108_0000063 | Ga0496108_0000063_86679_87167 | 162 |
| 721 | 3300048911 | Ga0496108_0003280 | Ga0496108_0003280_7494_7982 | 162 |
| 722 | 3300048911 | Ga0496108_0009033 | Ga0496108_0009033_262_750 | 162 |
| 723 | 3300048911 | Ga0496108_0245749 | Ga0496108_0245749_1031_1519 | 162 |
| 724 | 3300048911 | Ga0496108_0951643 | Ga0496108_0951643_115_606 | 162 |
| 725 | 3300048912 | Ga0496109_0000009 | Ga0496109_0000009_112735_113223 | 162 |
| 726 | 3300048912 | Ga0496109_0000012 | Ga0496109_0000012_25580_26068 | 162 |
| 727 | 3300048912 | Ga0496109_0000348 | Ga0496109_0000348_27139_27627 | 162 |
| 728 | 3300048912 | Ga0496109_0003361 | Ga0496109_0003361_7383_7871 | 162 |
| 729 | 3300048912 | Ga0496109_0300150 | Ga0496109_0300150_681_1169 | 162 |
| 730 | 3300048912 | Ga0496109_0392613 | Ga0496109_0392613_490_981 | 162 |
| 731 | 3300048912 | Ga0496109_1152084 | Ga0496109_1152084_119_616 | 162 |
| 732 | 3300048913 | Ga0496110_0002164 | Ga0496110_0002164_5710_6198 | 162 |
| 733 | 3300048913 | Ga0496110_0047750 | Ga0496110_0047750_804_1301 | 162 |
| 734 | 3300048913 | Ga0496110_0246364 | Ga0496110_0246364_150_638 | 162 |
| 735 | 3300048913 | Ga0496110_0334165 | Ga0496110_0334165_274_762 | 162 |
| 736 | 3300048914 | Ga0496111_0000044 | Ga0496111_0000044_29636_30124 | 162 |
| 737 | 3300048914 | Ga0496111_0070059 | Ga0496111_0070059_1302_1799 | 162 |
| 738 | 3300048914 | Ga0496111_0125916 | Ga0496111_0125916_1175_1663 | 162 |
| 739 | 3300048914 | Ga0496111_0409868 | Ga0496111_0409868_207_695 | 162 |
| 740 | 3300048914 | Ga0496111_0506888 | Ga0496111_0506888_28_516 | 162 |
| 741 | 3300048915 | Ga0496112_0000025 | Ga0496112_0000025_113554_114042 | 162 |
| 742 | 3300048915 | Ga0496112_0030187 | Ga0496112_0030187_1097_1585 | 162 |
| 743 | 3300048915 | Ga0496112_0226918 | Ga0496112_0226918_854_1351 | 162 |
| 744 | 3300048916 | Ga0496113_0000013 | Ga0496113_0000013_24882_25370 | 162 |
| 745 | 3300048916 | Ga0496113_0004814 | Ga0496113_0004814_7731_8219 | 162 |
| 746 | 3300048916 | Ga0496113_0038089 | Ga0496113_0038089_392_880 | 162 |
| 747 | 3300048916 | Ga0496113_0180000 | Ga0496113_0180000_464_961 | 162 |
| 748 | 3300048917 | Ga0496114_0000039 | Ga0496114_0000039_26898_27386 | 162 |
| 749 | 3300048917 | Ga0496114_0221118 | Ga0496114_0221118_529_1017 | 162 |
| 750 | 3300048917 | Ga0496114_0784039 | Ga0496114_0784039_29_517 | 162 |
| 751 | 3300048918 | Ga0496115_0000377 | Ga0496115_0000377_20727_21215 | 162 |
| 752 | 3300048918 | Ga0496115_0187433 | Ga0496115_0187433_1119_1607 | 162 |
| 753 | 3300048919 | Ga0496116_0000848 | Ga0496116_0000848_9182_9676 | 162 |
| 754 | 3300048920 | Ga0496117_0009784 | Ga0496117_0009784_4579_5073 | 162 |
| 755 | 3300048921 | Ga0496118_0002916 | Ga0496118_0002916_20925_21419 | 162 |
| 756 | 3300048921 | Ga0496118_0304351 | Ga0496118_0304351_325_819 | 162 |
| 757 | 3300048922 | Ga0496119_0011619 | Ga0496119_0011619_6210_6704 | 162 |
| 758 | 3300048923 | Ga0496120_0024368 | Ga0496120_0024368_1870_2358 | 162 |
| 759 | 3300048923 | Ga0496120_0049634 | Ga0496120_0049634_601_1095 | 162 |
| 760 | 3300048927 | Ga0496124_0264727 | Ga0496124_0264727_295_783 | 162 |
| 761 | 3300048928 | Ga0496125_0117153 | Ga0496125_0117153_1059_1547 | 162 |
| 762 | 3300048929 | Ga0496126_0019594 | Ga0496126_0019594_2056_2550 | 162 |
| 763 | 3300049568 | Ga0501031_0002175 | Ga0501031_0002175_7536_8030 | 162 |
| 764 | 3300049568 | Ga0501031_0163107 | Ga0501031_0163107_730_1227 | 162 |
| 765 | 3300049569 | Ga0501032_0011222 | Ga0501032_0011222_4476_4970 | 162 |
| 766 | 3300049569 | Ga0501032_0672158 | Ga0501032_0672158_23_517 | 162 |
| 767 | 3300049570 | Ga0501033_0003689 | Ga0501033_0003689_7527_8021 | 162 |
| 768 | 3300049571 | Ga0501034_0307172 | Ga0501034_0307172_981_1475 | 162 |
| 769 | 3300049572 | Ga0501036_0020032 | Ga0501036_0020032_733_1227 | 162 |
| 770 | 3300049573 | Ga0501037_0002926 | Ga0501037_0002926_7536_8030 | 162 |
| 771 | 3300049574 | Ga0501038_0005058 | Ga0501038_0005058_7536_8030 | 162 |
| 772 | 3300049574 | Ga0501038_1175658 | Ga0501038_1175658_15_503 | 162 |
| 773 | 3300049575 | Ga0501039_0095570 | Ga0501039_0095570_1351_1848 | 162 |
| 774 | 3300049575 | Ga0501039_0216094 | Ga0501039_0216094_379_873 | 162 |
| 775 | 3300049575 | Ga0501039_0227319 | Ga0501039_0227319_285_773 | 162 |
| 776 | 3300049576 | Ga0501040_0125576 | Ga0501040_0125576_689_1183 | 162 |
| 777 | 3300049578 | Ga0501042_0012872 | Ga0501042_0012872_132_626 | 162 |
| 778 | 3300049578 | Ga0501042_0061274 | Ga0501042_0061274_2104_2601 | 162 |
| 779 | 3300049578 | Ga0501042_0084546 | Ga0501042_0084546_1434_1922 | 162 |
| 780 | 3300049578 | Ga0501042_0313241 | Ga0501042_0313241_509_997 | 162 |
| 781 | 3300049578 | Ga0501042_0411606 | Ga0501042_0411606_231_719 | 162 |
| 782 | 3300049579 | Ga0501043_0016009 | Ga0501043_0016009_4404_4898 | 162 |
| 783 | 3300049579 | Ga0501043_1140393 | Ga0501043_1140393_25_519 | 162 |
| 784 | 3300049580 | Ga0501046_0004559 | Ga0501046_0004559_4530_5024 | 162 |
| 785 | 3300049580 | Ga0501046_0393039 | Ga0501046_0393039_208_702 | 162 |
| 786 | 3300049580 | Ga0501046_0571571 | Ga0501046_0571571_40_528 | 162 |
| 787 | 3300049581 | Ga0501047_0004952 | Ga0501047_0004952_4481_4975 | 162 |
| 788 | 3300049581 | Ga0501047_0010850 | Ga0501047_0010850_6259_6753 | 162 |
| 789 | 3300049581 | Ga0501047_0176579 | Ga0501047_0176579_163_657 | 162 |
| 790 | 3300049581 | Ga0501047_0780742 | Ga0501047_0780742_224_718 | 162 |
| 791 | 3300049581 | Ga0501047_1161499 | Ga0501047_1161499_80_574 | 162 |
| 792 | 3300049582 | Ga0501048_0003128 | Ga0501048_0003128_4407_4901 | 162 |
| 793 | 3300049582 | Ga0501048_0248226 | Ga0501048_0248226_441_935 | 162 |
| 794 | 3300049582 | Ga0501048_0506283 | Ga0501048_0506283_330_818 | 162 |
| 795 | 3300049584 | Ga0501068_0002345 | Ga0501068_0002345_1412_1906 | 162 |
| 796 | 3300049584 | Ga0501068_0463372 | Ga0501068_0463372_297_785 | 162 |
| 797 | 3300049585 | Ga0501069_0014849 | Ga0501069_0014849_479_973 | 162 |
| 798 | 3300049586 | Ga0501070_0004064 | Ga0501070_0004064_4546_5040 | 162 |
| 799 | 3300049586 | Ga0501070_0048441 | Ga0501070_0048441_2167_2655 | 162 |
| 800 | 3300049586 | Ga0501070_0570055 | Ga0501070_0570055_131_619 | 162 |
| 801 | 3300049587 | Ga0501071_0005888 | Ga0501071_0005888_364_858 | 162 |
| 802 | 3300049587 | Ga0501071_0209651 | Ga0501071_0209651_652_1149 | 162 |
| 803 | 3300049587 | Ga0501071_0297987 | Ga0501071_0297987_210_701 | 162 |
| 804 | 3300049587 | Ga0501071_0967896 | Ga0501071_0967896_130_624 | 162 |
| 805 | 3300049587 | Ga0501071_1139292 | Ga0501071_1139292_96_587 | 162 |
| 806 | 3300049588 | Ga0501072_0017464 | Ga0501072_0017464_1632_2126 | 162 |
| 807 | 3300049588 | Ga0501072_0030329 | Ga0501072_0030329_3243_3740 | 162 |
| 808 | 3300049588 | Ga0501072_0052302 | Ga0501072_0052302_571_1068 | 162 |
| 809 | 3300049588 | Ga0501072_0166082 | Ga0501072_0166082_612_1100 | 162 |
| 810 | 3300049589 | Ga0501073_0012127 | Ga0501073_0012127_4252_4746 | 162 |
| 811 | 3300049589 | Ga0501073_0336398 | Ga0501073_0336398_437_931 | 162 |
| 812 | 3300049590 | Ga0501074_0018921 | Ga0501074_0018921_3689_4183 | 162 |
| 813 | 3300049590 | Ga0501074_0257323 | Ga0501074_0257323_676_1170 | 162 |
| 814 | 3300049590 | Ga0501074_1137397 | Ga0501074_1137397_46_534 | 162 |
| 815 | 3300049591 | Ga0501075_0034272 | Ga0501075_0034272_1864_2361 | 162 |
| 816 | 3300049591 | Ga0501075_0054219 | Ga0501075_0054219_591_1079 | 162 |
| 817 | 3300049591 | Ga0501075_0082710 | Ga0501075_0082710_206_697 | 162 |
| 818 | 3300049592 | Ga0501076_0029982 | Ga0501076_0029982_429_917 | 162 |
| 819 | 3300049592 | Ga0501076_0046698 | Ga0501076_0046698_198_698 | 162 |
| 820 | 3300049741 | Ga0501079_0073179 | Ga0501079_0073179_1900_2397 | 162 |
| 821 | 3300049741 | Ga0501079_0080440 | Ga0501079_0080440_827_1321 | 162 |
| 822 | 3300049741 | Ga0501079_0087220 | Ga0501079_0087220_624_1121 | 162 |
| 823 | 3300049742 | Ga0501080_0030783 | Ga0501080_0030783_4474_4968 | 162 |
| 824 | 3300049742 | Ga0501080_0097730 | Ga0501080_0097730_1914_2408 | 162 |
| 825 | 3300049742 | Ga0501080_0549464 | Ga0501080_0549464_95_583 | 162 |
| 826 | 3300049742 | Ga0501080_0906253 | Ga0501080_0906253_106_600 | 162 |
| 827 | 3300049743 | Ga0501081_0068435 | Ga0501081_0068435_930_1427 | 162 |
| 828 | 3300049743 | Ga0501081_0086273 | Ga0501081_0086273_105_602 | 162 |
| 829 | 3300049744 | Ga0501083_0002614 | Ga0501083_0002614_4383_4877 | 162 |
| 830 | 3300049744 | Ga0501083_0003895 | Ga0501083_0003895_6667_7161 | 162 |
| 831 | 3300049744 | Ga0501083_0036093 | Ga0501083_0036093_2573_3067 | 162 |
| 832 | 3300049822 | Ga0501035_0005116 | Ga0501035_0005116_4391_4885 | 162 |
| 833 | 3300049823 | Ga0501044_0006919 | Ga0501044_0006919_4454_4948 | 162 |
| 834 | 3300049823 | Ga0501044_0034851 | Ga0501044_0034851_3875_4369 | 162 |
| 835 | 3300049824 | Ga0501045_0098388 | Ga0501045_0098388_1093_1590 | 162 |
| 836 | 3300049824 | Ga0501045_0133474 | Ga0501045_0133474_342_830 | 162 |
| 837 | 3300049824 | Ga0501045_0845346 | Ga0501045_0845346_29_526 | 162 |
| 838 | 3300049824 | Ga0501045_1221339 | Ga0501045_1221339_32_520 | 162 |
| 839 | 3300050491 | nmdc:mga00v17_108157_c1 | nmdc:mga00v17_108157_c1_649_1143 | 162 |
| 840 | 3300050491 | nmdc:mga00v17_177051_c1 | nmdc:mga00v17_177051_c1_248_757 | 162 |
| 841 | 3300050491 | nmdc:mga00v17_497475_c1 | nmdc:mga00v17_497475_c1_231_722 | 162 |
| 842 | 3300050491 | nmdc:mga00v17_51630_c2 | nmdc:mga00v17_51630_c2_154_672 | 162 |
| 843 | 3300050492 | nmdc:mga0yw44_142103_c1 | nmdc:mga0yw44_142103_c1_919_1413 | 162 |
| 844 | 3300050492 | nmdc:mga0yw44_320642_c1 | nmdc:mga0yw44_320642_c1_251_760 | 162 |
| 845 | 3300050492 | nmdc:mga0yw44_623492_c1 | nmdc:mga0yw44_623492_c1_125_619 | 162 |
| 846 | 3300050492 | nmdc:mga0yw44_81412_c1 | nmdc:mga0yw44_81412_c1_1419_1928 | 162 |
| 847 | 3300050507 | nmdc:mga05p37_220296_c1 | nmdc:mga05p37_220296_c1_945_1442 | 162 |
| 848 | 3300050507 | nmdc:mga05p37_611014_c1 | nmdc:mga05p37_611014_c1_72_569 | 162 |
| 849 | 3300050513 | nmdc:mga0rr50_379733_c1 | nmdc:mga0rr50_379733_c1_313_810 | 162 |
| 850 | 3300050514 | nmdc:mga08x19_853142_c1 | nmdc:mga08x19_853142_c1_102_608 | 162 |
| 851 | 3300050515 | nmdc:mga0a205_138769_c1 | nmdc:mga0a205_138769_c1_775_1281 | 162 |
| 852 | 3300050515 | nmdc:mga0a205_43_c1 | nmdc:mga0a205_43_c1_43866_44354 | 162 |
| 853 | 3300053077 | Ga0495601_0000060 | Ga0495601_0000060_28927_29415 | 162 |
| 854 | 3300053077 | Ga0495601_0000165 | Ga0495601_0000165_12625_13113 | 162 |
| 855 | 3300053077 | Ga0495601_0025379 | Ga0495601_0025379_1411_1899 | 162 |
| 856 | 3300053077 | Ga0495601_0057074 | Ga0495601_0057074_1081_1569 | 162 |
| 857 | 3300053077 | Ga0495601_0234552 | Ga0495601_0234552_495_983 | 162 |
| 858 | 3300053077 | Ga0495601_0719291 | Ga0495601_0719291_88_576 | 162 |
| 859 | 3300053078 | Ga0495612_0000210 | Ga0495612_0000210_10391_10879 | 162 |
| 860 | 3300053078 | Ga0495612_0003484 | Ga0495612_0003484_4687_5175 | 162 |
| 861 | 3300053078 | Ga0495612_0049530 | Ga0495612_0049530_1053_1541 | 162 |
| 862 | 3300053078 | Ga0495612_0049786 | Ga0495612_0049786_832_1320 | 162 |
| 863 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_197132_197620 | 162 |
| 864 | 3300053083 | Ga0495655_0001463 | Ga0495655_0001463_370_858 | 162 |
| 865 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_188069_188557 | 162 |
| 866 | 3300053084 | Ga0495595_0000045 | Ga0495595_0000045_25020_25508 | 162 |
| 867 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_189731_190219 | 162 |
| 868 | 3300053085 | Ga0495619_0000095 | Ga0495619_0000095_5309_5797 | 162 |
| 869 | 3300053085 | Ga0495619_0000102 | Ga0495619_0000102_45553_46041 | 162 |
| 870 | 3300053085 | Ga0495619_0000155 | Ga0495619_0000155_38674_39165 | 162 |
| 871 | 3300053085 | Ga0495619_0000195 | Ga0495619_0000195_1312_1800 | 162 |
| 872 | 3300053085 | Ga0495619_0000320 | Ga0495619_0000320_12512_13000 | 162 |
| 873 | 3300053085 | Ga0495619_0053306 | Ga0495619_0053306_597_1085 | 162 |
| 874 | 3300053085 | Ga0495619_0742263 | Ga0495619_0742263_44_532 | 162 |
| 875 | 3300053094 | Ga0500566_0001093 | Ga0500566_0001093_6703_7191 | 162 |
| 876 | 3300053102 | Ga0500554_236769 | Ga0500554_236769_55_555 | 162 |
| 877 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_285801_286289 | 162 |
| 878 | 3300054114 | Ga0501084_0005040 | Ga0501084_0005040_4509_5006 | 162 |
| 879 | 3300054114 | Ga0501084_0156761 | Ga0501084_0156761_25_519 | 162 |
| 880 | 3300060353 | Ga0501082_0450607 | Ga0501082_0450607_295_783 | 162 |
| 881 | 3300060353 | Ga0501082_1182950 | Ga0501082_1182950_95_589 | 162 |
| 882 | 3300061734 | Ga0530510_0010891 | Ga0530510_0010891_2020_2517 | 162 |
| 883 | 3300061734 | Ga0530510_0019997 | Ga0530510_0019997_861_1358 | 162 |
| 884 | 3300061734 | Ga0530510_0355097 | Ga0530510_0355097_417_914 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6af2-assembly1.cif.gz_C | crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase | 0.8923 | 25 | 159 |
| 6af2-assembly1.cif.gz_B-2 | crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase | 0.8911 | 25 | 159 |
| 6af2-assembly1.cif.gz_A | crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase | 0.887 | 36 | 159 |
| 3wo5-assembly1.cif.gz_A-2 | crystal structure of s147q of rv2613c from mycobacterium tuberculosis | 0.8827 | 25 | 159 |
| 3ano-assembly1.cif.gz_A-2 | crystal structure of a novel diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase from mycobacterium tuberculosis h37rv | 0.8722 | 25 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A140LH01_2_105_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9023 | 39 | 130 | 3.30.428.10 |
| af_P49775_3_108_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8828 | 41 | 132 | 3.30.428.10 |
| 3wo5A00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8827 | 25 | 159 | 3.30.428.10 |
| af_A0A1D8PKG2_1_175_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8725 | 41 | 134 | 3.30.428.10 |
| af_Q10946_226_350_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8577 | 38 | 132 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1E0D2-F1-model_v4 | HIT domain-containing protein | 0.9121 | 25 | 131 |
GO:0000166
GO:0003824 |
| AF-A0A4Y8WZ11-F1-model_v4 | deleted | 0.9009 | 22 | 159 |
|
| AF-A0A0U5AXF4-F1-model_v4 | AP-4-A phosphorylase (EC 2.7.7.53) | 0.9007 | 41 | 134 |
GO:0003877
|
| AF-A0A2W0BB21-F1-model_v4 | HIT family hydrolase | 0.9002 | 26 | 161 |
GO:0000166
GO:0016787 |
| AF-X1AW32-F1-model_v4 | HIT domain-containing protein | 0.8994 | 24 | 162 |
GO:0000166
GO:0003824 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar