F484624

General Info

Members Datasets Scaffolds Average Seq Length
884 368 884 162

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100189242|Ga0068863_1001892422
Length 184
Sequence MTTGGHAPALPRPGTAALGWALVANFRIWAPWRLAYVTDASKDIEEECIFCAKPRGDDDEANLIVHRGESCFVILNLFPYTNGHLMVAPYEHVGDLREISAETLAEMMALAQRAMGRLEEIYSPHGYNVGFNQGRVAGAGVEHHIHMHVVPRWAGDNNFMPVIADTKVMPQSIEQSYEALKGAF

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
177 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
178 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
179 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
180 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
184 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
216 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
219 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
220 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
233 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
234 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
248 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
249 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
250 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
330 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
336 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
337 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
338 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
354 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
357 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
358 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
359 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
360 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
361 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
362 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
363 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
364 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.41
Nodule 0
Rhizoplane 10.86
Rhizosphere 82.01
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1006049 3300000546 Bacteria 1314
2 JGI24746J21847_1000760 3300001977 Bacteria 4956
3 JGI24746J21847_1025538 3300001977 Unclassified 818
4 JGI24740J21852_10010068 3300001979 Bacteria 3662
5 JGI24740J21852_10111435 3300001979 Bacteria 690
6 JGI24743J22301_10021951 3300001991 Bacteria 1222
7 JGI24748J21848_1000727 3300002074 Bacteria 3562
8 JGI24738J21930_10065889 3300002075 Unclassified 746
9 JGI24034J26672_10001507 3300002239 Bacteria 3096
10 JGI24034J26672_10037482 3300002239 Bacteria 806
11 JGI24742J22300_10001453 3300002244 Bacteria 3736
12 JGI25404J52841_10000319 3300003659 Bacteria 6358
13 Ga0070658_10120843 3300005327 Bacteria 2176
14 Ga0070683_100000404 3300005329 Bacteria 29752
15 Ga0070683_100006627 3300005329 Bacteria 9723
16 Ga0070683_100060798 3300005329 Bacteria 3512
17 Ga0070683_100323177 3300005329 Bacteria 1469
18 Ga0070683_100343962 3300005329 Bacteria 1420
19 Ga0070683_100453508 3300005329 Bacteria 1224
20 Ga0070670_100073330 3300005331 Bacteria 2940
21 Ga0070666_10231693 3300005335 Bacteria 1304
22 Ga0070680_100394914 3300005336 Bacteria 1178
23 Ga0070682_100000011 3300005337 Bacteria 266253
24 Ga0070682_100000052 3300005337 Bacteria 118879
25 Ga0070682_100008571 3300005337 Bacteria 5771
26 Ga0068868_100000141 3300005338 Bacteria 46406
27 Ga0068868_100002016 3300005338 Bacteria 13976
28 Ga0068868_100268553 3300005338 Bacteria 1440
29 Ga0070660_100104391 3300005339 Bacteria 2248
30 Ga0070660_100810199 3300005339 Bacteria 788
31 Ga0070691_10000044 3300005341 Bacteria 36029
32 Ga0070691_10000524 3300005341 Bacteria 14453
33 Ga0070691_10482053 3300005341 Bacteria 714
34 Ga0070687_100119153 3300005343 Bacteria 1507
35 Ga0070661_100000099 3300005344 Bacteria 71115
36 Ga0070661_100499160 3300005344 Bacteria 974
37 Ga0070692_10007789 3300005345 Bacteria 4745
38 Ga0070692_10088523 3300005345 Bacteria 1680
39 Ga0070668_100012531 3300005347 Bacteria 6315
40 Ga0070668_100149155 3300005347 Bacteria 1890
41 Ga0070668_100215454 3300005347 Bacteria 1581
42 Ga0070669_100177175 3300005353 Bacteria 1666
43 Ga0070669_100264872 3300005353 Bacteria 1372
44 Ga0070675_100000036 3300005354 Bacteria 85959
45 Ga0070675_100248923 3300005354 Bacteria 1555
46 Ga0070671_100055512 3300005355 Bacteria 3295
47 Ga0070674_100000012 3300005356 Bacteria 130773
48 Ga0070674_100011888 3300005356 Bacteria 5320
49 Ga0070674_100012173 3300005356 Bacteria 5276
50 Ga0070674_100141733 3300005356 Bacteria 1804
51 Ga0070673_100006402 3300005364 Bacteria 7653
52 Ga0070673_100064289 3300005364 Bacteria 2923
53 Ga0070688_100000071 3300005365 Bacteria 50564
54 Ga0070688_100000206 3300005365 Bacteria 31457
55 Ga0070688_100095406 3300005365 Bacteria 1952
56 Ga0070659_100004223 3300005366 Bacteria 10260
57 Ga0070659_100007424 3300005366 Bacteria 7963
58 Ga0070659_100060959 3300005366 Bacteria 2981
59 Ga0070659_100395467 3300005366 Bacteria 1166
60 Ga0070667_100000603 3300005367 Bacteria 35115
61 Ga0070667_100099083 3300005367 Bacteria 2516
62 Ga0070667_100299101 3300005367 Bacteria 1449
63 Ga0070667_100885391 3300005367 Bacteria 831
64 Ga0070714_100041184 3300005435 Bacteria 3897
65 Ga0070714_100430087 3300005435 Bacteria 1251
66 Ga0070713_100000047 3300005436 Bacteria 76760
67 Ga0070713_101616208 3300005436 Unclassified 629
68 Ga0070701_10310198 3300005438 Bacteria 973
69 Ga0070711_100008252 3300005439 Bacteria 6371
70 Ga0070711_100171837 3300005439 Bacteria 1652
71 Ga0070700_100116416 3300005441 Bacteria 1785
72 Ga0070700_100195005 3300005441 Bacteria 1419
73 Ga0070694_100098482 3300005444 Bacteria 2065
74 Ga0070694_100145983 3300005444 Bacteria 1723
75 Ga0070694_100150163 3300005444 Bacteria 1701
76 Ga0070694_100213897 3300005444 Bacteria 1443
77 Ga0070663_100001716 3300005455 Bacteria 12160
78 Ga0070663_100007633 3300005455 Bacteria 6597
79 Ga0070678_100064983 3300005456 Bacteria 2707
80 Ga0070678_100118620 3300005456 Bacteria 2083
81 Ga0070662_100000002 3300005457 Bacteria 253208
82 Ga0070662_100014992 3300005457 Bacteria 5185
83 Ga0070681_10071340 3300005458 Bacteria 3438
84 Ga0070681_10919100 3300005458 Bacteria 794
85 Ga0068867_100143823 3300005459 Bacteria 1867
86 Ga0070685_10000020 3300005466 Bacteria 104332
87 Ga0070685_10000674 3300005466 Bacteria 18541
88 Ga0070685_10063791 3300005466 Bacteria 2164
89 Ga0070685_10778056 3300005466 Bacteria 704
90 Ga0070679_100005826 3300005530 Bacteria 11429
91 Ga0070679_100025853 3300005530 Bacteria 5761
92 Ga0070684_100178634 3300005535 Bacteria 1929
93 Ga0070684_100200471 3300005535 Bacteria 1817
94 Ga0070684_100712970 3300005535 Bacteria 936
95 Ga0068853_100083524 3300005539 Bacteria 2798
96 Ga0068853_100189350 3300005539 Bacteria 1869
97 Ga0068853_100527751 3300005539 Bacteria 1116
98 Ga0070672_100000001 3300005543 Bacteria 204624
99 Ga0070672_100004196 3300005543 Bacteria 9414
100 Ga0070686_100097960 3300005544 Bacteria 1975
101 Ga0070686_100167235 3300005544 Bacteria 1553
102 Ga0070696_100772833 3300005546 Bacteria 789
103 Ga0070696_100812601 3300005546 Bacteria 770
104 Ga0070693_100003731 3300005547 Bacteria 7127
105 Ga0070693_100085963 3300005547 Bacteria 1886
106 Ga0070665_100000135 3300005548 Bacteria 138925
107 Ga0070665_100019237 3300005548 Bacteria 6851
108 Ga0070665_100020661 3300005548 Bacteria 6615
109 Ga0070665_100375688 3300005548 Bacteria 1428
110 Ga0070665_100410741 3300005548 Bacteria 1362
111 Ga0070704_100053014 3300005549 Bacteria 2865
112 Ga0070704_100208484 3300005549 Bacteria 1582
113 Ga0070704_100451029 3300005549 Bacteria 1107
114 Ga0068855_100549030 3300005563 Bacteria 1251
115 Ga0070664_100118845 3300005564 Bacteria 2313
116 Ga0068857_100065380 3300005577 Bacteria 3234
117 Ga0068854_100001203 3300005578 Bacteria 15515
118 Ga0068854_100056337 3300005578 Bacteria 2833
119 Ga0068854_100170113 3300005578 Bacteria 1695
120 Ga0068856_100772303 3300005614 Bacteria 981
121 Ga0070702_100080455 3300005615 Bacteria 1950
122 Ga0068852_100000002 3300005616 Bacteria 268221
123 Ga0068852_100014610 3300005616 Bacteria 6053
124 Ga0068859_100275896 3300005617 Bacteria 1774
125 Ga0068859_100759111 3300005617 Bacteria 1059
126 Ga0068864_100000015 3300005618 Bacteria 303368
127 Ga0068864_100291873 3300005618 Bacteria 1524
128 Ga0068866_10000008 3300005718 Bacteria 117658
129 Ga0068866_10006530 3300005718 Bacteria 4860
130 Ga0068866_10111683 3300005718 Bacteria 1526
131 Ga0068866_10499494 3300005718 Unclassified 805
132 Ga0068861_100312043 3300005719 Bacteria 1367
133 Ga0068861_101117957 3300005719 Bacteria 758
134 Ga0068851_10013817 3300005834 Bacteria 3823
135 Ga0068863_100000022 3300005841 Bacteria 188278
136 Ga0068863_100006236 3300005841 Bacteria 11710
137 Ga0068863_100189242 3300005841 Bacteria 1978
138 Ga0068863_100467130 3300005841 Bacteria 1240
139 Ga0068858_100018138 3300005842 Bacteria 6593
140 Ga0068858_100154568 3300005842 Bacteria 2158
141 Ga0068858_100257921 3300005842 Bacteria 1657
142 Ga0068860_100011591 3300005843 Bacteria 8694
143 Ga0068860_100085754 3300005843 Bacteria 2996
144 Ga0068860_101205744 3300005843 Bacteria 777
145 Ga0068862_100002782 3300005844 Bacteria 15329
146 Ga0068862_100124618 3300005844 Bacteria 2274
147 Ga0081455_10010756 3300005937 Bacteria 9252
148 Ga0081455_10041071 3300005937 Bacteria 4073
149 Ga0081455_10049005 3300005937 Bacteria 3644
150 Ga0081455_10067266 3300005937 Bacteria 2986
151 Ga0081455_10072555 3300005937 Bacteria 2849
152 Ga0081455_10239729 3300005937 Bacteria 1333
153 Ga0081538_10000812 3300005981 Bacteria 33866
154 Ga0081538_10048156 3300005981 Bacteria 2604
155 Ga0081538_10156378 3300005981 Bacteria 1022
156 Ga0081538_10224873 3300005981 Unclassified 740
157 Ga0081540_1000100 3300005983 Bacteria 91640
158 Ga0081540_1000366 3300005983 Bacteria 45428
159 Ga0081540_1083410 3300005983 Bacteria 1430
160 Ga0081539_10000878 3300005985 Bacteria 57633
161 Ga0081539_10024074 3300005985 Bacteria 3963
162 Ga0070717_10296430 3300006028 Bacteria 1437
163 Ga0075365_10002366 3300006038 Bacteria 9203
164 Ga0075365_10018720 3300006038 Bacteria 4264
165 Ga0075365_10156417 3300006038 Bacteria 1587
166 Ga0075365_10376304 3300006038 Bacteria 1002
167 Ga0075365_10381470 3300006038 Bacteria 994
168 Ga0075368_10245708 3300006042 Unclassified 764
169 Ga0075363_100001314 3300006048 Bacteria 9286
170 Ga0075363_100014606 3300006048 Bacteria 3843
171 Ga0075363_100143851 3300006048 Bacteria 1344
172 Ga0075363_100356770 3300006048 Bacteria 854
173 Ga0075364_10028746 3300006051 Bacteria 3560
174 Ga0075364_10049695 3300006051 Bacteria 2736
175 Ga0075364_10212352 3300006051 Bacteria 1312
176 Ga0075364_10440909 3300006051 Bacteria 890
177 Ga0075364_10706725 3300006051 Bacteria 688
178 Ga0070715_10000021 3300006163 Bacteria 119283
179 Ga0070712_100102609 3300006175 Bacteria 2119
180 Ga0075362_10252284 3300006177 Bacteria 868
181 Ga0075367_10168207 3300006178 Bacteria 1365
182 Ga0075367_10369945 3300006178 Unclassified 905
183 Ga0075367_10414097 3300006178 Bacteria 853
184 Ga0075370_10335443 3300006353 Bacteria 902
185 Ga0075428_101249534 3300006844 Unclassified 782
186 Ga0075431_100918088 3300006847 Bacteria 845
187 Ga0075433_10000897 3300006852 Bacteria 20988
188 Ga0075433_10033900 3300006852 Bacteria 4381
189 Ga0075433_10683866 3300006852 Bacteria 899
190 Ga0068865_100000082 3300006881 Bacteria 50913
191 Ga0068865_100007004 3300006881 Bacteria 6917
192 Ga0097620_100275903 3300006931 Bacteria 1774
193 Ga0097620_100759148 3300006931 Bacteria 1059
194 Ga0075435_100168077 3300007076 Bacteria 1850
195 Ga0105240_10384233 3300009093 Bacteria 1585
196 Ga0105240_10809020 3300009093 Bacteria 1015
197 Ga0111539_10639660 3300009094 Bacteria 1239
198 Ga0105245_10000278 3300009098 Bacteria 48473
199 Ga0105245_10000415 3300009098 Bacteria 39764
200 Ga0105245_10001311 3300009098 Bacteria 22474
201 Ga0105245_10035031 3300009098 Bacteria 4453
202 Ga0105245_10173186 3300009098 Bacteria 2056
203 Ga0105245_10866650 3300009098 Bacteria 944
204 Ga0105247_10001706 3300009101 Bacteria 15492
205 Ga0105247_10174168 3300009101 Bacteria 1432
206 Ga0114129_10027328 3300009147 Bacteria 8079
207 Ga0114129_10119702 3300009147 Bacteria 3626
208 Ga0114129_11011700 3300009147 Bacteria 1046
209 Ga0105243_10003503 3300009148 Bacteria 12673
210 Ga0105243_10007118 3300009148 Bacteria 8605
211 Ga0105243_10165704 3300009148 Bacteria 1909
212 Ga0105243_10379698 3300009148 Bacteria 1307
213 Ga0105243_10530373 3300009148 Bacteria 1121
214 Ga0105241_10069956 3300009174 Bacteria 2722
215 Ga0105241_10160467 3300009174 Bacteria 1848
216 Ga0105242_10000449 3300009176 Bacteria 32713
217 Ga0105242_10000653 3300009176 Bacteria 27161
218 Ga0105242_10017935 3300009176 Bacteria 5528
219 Ga0105242_10308575 3300009176 Bacteria 1447
220 Ga0105242_10574937 3300009176 Bacteria 1084
221 Ga0105242_10775178 3300009176 Bacteria 947
222 Ga0105242_12416894 3300009176 Bacteria 573
223 Ga0105248_10000020 3300009177 Bacteria 284637
224 Ga0105248_10305649 3300009177 Bacteria 1791
225 Ga0105237_10107344 3300009545 Bacteria 2784
226 Ga0105238_10000055 3300009551 Bacteria 139232
227 Ga0105249_10000143 3300009553 Bacteria 92539
228 Ga0105249_10003360 3300009553 Bacteria 13850
229 Ga0105249_10096461 3300009553 Bacteria 2774
230 Ga0105249_12663713 3300009553 Bacteria 572
231 Ga0105239_10261216 3300010375 Bacteria 1946
232 Ga0105239_10524755 3300010375 Bacteria 1347
233 Ga0105246_10709386 3300011119 Bacteria 883
234 Ga0105246_11618017 3300011119 Bacteria 613
235 Ga0157337_1013043 3300012483 Bacteria 679
236 Ga0157371_10001577 3300013102 Bacteria 23401
237 Ga0157371_11288276 3300013102 Bacteria 565
238 Ga0157370_10003254 3300013104 Bacteria 19142
239 Ga0157370_10047400 3300013104 Bacteria 4120
240 Ga0157370_10629691 3300013104 Bacteria 981
241 Ga0157369_10000074 3300013105 Bacteria 136668
242 Ga0157374_10000486 3300013296 Bacteria 35981
243 Ga0157374_10275238 3300013296 Bacteria 1661
244 Ga0157374_10384590 3300013296 Bacteria 1398
245 Ga0157374_10669027 3300013296 Bacteria 1050
246 Ga0157378_10003241 3300013297 Bacteria 14481
247 Ga0157378_10040737 3300013297 Bacteria 4120
248 Ga0157378_10093937 3300013297 Bacteria 2731
249 Ga0157378_10628867 3300013297 Bacteria 1087
250 Ga0157378_10978479 3300013297 Bacteria 879
251 Ga0163162_10556987 3300013306 Bacteria 1274
252 Ga0157372_10000053 3300013307 Bacteria 128824
253 Ga0157372_10042342 3300013307 Bacteria 5036
254 Ga0157375_10003797 3300013308 Bacteria 13096
255 Ga0157375_10013296 3300013308 Bacteria 7320
256 Ga0157375_13582365 3300013308 Bacteria 517
257 Ga0163163_11167379 3300014325 Bacteria 833
258 Ga0157380_10000016 3300014326 Bacteria 126029
259 Ga0157380_10000236 3300014326 Bacteria 33220
260 Ga0157380_10012273 3300014326 Bacteria 6208
261 Ga0157379_10148336 3300014968 Bacteria 2115
262 Ga0157379_10161252 3300014968 Bacteria 2024
263 Ga0157379_10417767 3300014968 Bacteria 1235
264 Ga0157379_10588730 3300014968 Bacteria 1037
265 Ga0157376_10027214 3300014969 Bacteria 4530
266 Ga0157376_10074468 3300014969 Bacteria 2894
267 Ga0157376_11848914 3300014969 Unclassified 640
268 Ga0163161_10000053 3300017792 Bacteria 117408
269 Ga0163161_10175041 3300017792 Bacteria 1642
270 Ga0163161_10286057 3300017792 Bacteria 1294
271 Ga0163161_10668428 3300017792 Bacteria 862
272 Ga0206356_10868657 3300020070 Bacteria 651
273 Ga0154015_1555886 3300020610 Bacteria 848
274 Ga0213876_10451361 3300021384 Bacteria 684
275 Ga0207656_10000226 3300025321 Bacteria 20150
276 Ga0207656_10027875 3300025321 Bacteria 2314
277 Ga0207692_10166323 3300025898 Bacteria 1275
278 Ga0207642_10000002 3300025899 Bacteria 658166
279 Ga0207642_10000080 3300025899 Bacteria 25169
280 Ga0207710_10000157 3300025900 Bacteria 72764
281 Ga0207688_10008563 3300025901 Bacteria 5568
282 Ga0207680_10002942 3300025903 Bacteria 7986
283 Ga0207680_10056099 3300025903 Bacteria 2378
284 Ga0207680_10247229 3300025903 Bacteria 1231
285 Ga0207685_10000054 3300025905 Bacteria 35900
286 Ga0207685_10070642 3300025905 Bacteria 1414
287 Ga0207699_10729075 3300025906 Bacteria 726
288 Ga0207705_10082216 3300025909 Bacteria 2349
289 Ga0207654_10057938 3300025911 Bacteria 2253
290 Ga0207707_10289153 3300025912 Bacteria 1418
291 Ga0207707_10708359 3300025912 Bacteria 845
292 Ga0207671_10728427 3300025914 Bacteria 788
293 Ga0207693_10050125 3300025915 Bacteria 3279
294 Ga0207693_10103235 3300025915 Bacteria 2236
295 Ga0207663_10023302 3300025916 Bacteria 3550
296 Ga0207663_10245295 3300025916 Bacteria 1316
297 Ga0207660_10161370 3300025917 Bacteria 1730
298 Ga0207660_10170427 3300025917 Bacteria 1685
299 Ga0207657_10000636 3300025919 Bacteria 37227
300 Ga0207649_10000127 3300025920 Bacteria 64603
301 Ga0207649_10033692 3300025920 Bacteria 3063
302 Ga0207649_10591112 3300025920 Bacteria 853
303 Ga0207652_10000321 3300025921 Bacteria 49720
304 Ga0207652_10001733 3300025921 Bacteria 19037
305 Ga0207652_10193435 3300025921 Bacteria 1830
306 Ga0207681_10135411 3300025923 Bacteria 1827
307 Ga0207694_10000063 3300025924 Bacteria 139700
308 Ga0207659_10000013 3300025926 Bacteria 172742
309 Ga0207659_10036774 3300025926 Bacteria 3395
310 Ga0207687_10000032 3300025927 Bacteria 143196
311 Ga0207687_10000036 3300025927 Bacteria 121934
312 Ga0207687_10000460 3300025927 Bacteria 27723
313 Ga0207687_10003112 3300025927 Bacteria 11249
314 Ga0207687_10011833 3300025927 Bacteria 5708
315 Ga0207700_10000033 3300025928 Bacteria 123113
316 Ga0207664_10112012 3300025929 Bacteria 2271
317 Ga0207644_10056710 3300025931 Bacteria 2827
318 Ga0207690_10002634 3300025932 Bacteria 10804
319 Ga0207690_10074923 3300025932 Bacteria 2345
320 Ga0207690_10082969 3300025932 Bacteria 2243
321 Ga0207706_10000001 3300025933 Bacteria 423014
322 Ga0207706_10027571 3300025933 Bacteria 5078
323 Ga0207706_10270954 3300025933 Bacteria 1481
324 Ga0207686_10000097 3300025934 Bacteria 72219
325 Ga0207686_10000921 3300025934 Bacteria 17629
326 Ga0207686_10019225 3300025934 Bacteria 3882
327 Ga0207686_10264992 3300025934 Bacteria 1261
328 Ga0207686_10644370 3300025934 Bacteria 838
329 Ga0207709_10005868 3300025935 Bacteria 6935
330 Ga0207709_10023552 3300025935 Bacteria 3506
331 Ga0207669_10000017 3300025937 Bacteria 119878
332 Ga0207669_10000026 3300025937 Bacteria 92199
333 Ga0207704_10000184 3300025938 Bacteria 32775
334 Ga0207691_10000017 3300025940 Bacteria 134441
335 Ga0207691_10056114 3300025940 Bacteria 3589
336 Ga0207711_10000006 3300025941 Bacteria 792692
337 Ga0207689_10466253 3300025942 Bacteria 1057
338 Ga0207661_10002110 3300025944 Bacteria 13678
339 Ga0207661_10004460 3300025944 Bacteria 9836
340 Ga0207661_10052819 3300025944 Bacteria 3249
341 Ga0207661_10337590 3300025944 Bacteria 1357
342 Ga0207661_10370703 3300025944 Bacteria 1294
343 Ga0207679_10004050 3300025945 Bacteria 9104
344 Ga0207679_10045587 3300025945 Bacteria 3172
345 Ga0207651_10016930 3300025960 Bacteria 4290
346 Ga0207651_10017969 3300025960 Bacteria 4194
347 Ga0207712_10000058 3300025961 Bacteria 140948
348 Ga0207712_10058206 3300025961 Bacteria 2730
349 Ga0207668_10036707 3300025972 Bacteria 3273
350 Ga0207668_10235463 3300025972 Bacteria 1478
351 Ga0207640_10000093 3300025981 Bacteria 70374
352 Ga0207640_10034577 3300025981 Bacteria 3155
353 Ga0207658_10003551 3300025986 Bacteria 11011
354 Ga0207658_10018897 3300025986 Bacteria 4766
355 Ga0207658_10333568 3300025986 Bacteria 1316
356 Ga0207677_10001038 3300026023 Bacteria 15272
357 Ga0207677_10006605 3300026023 Bacteria 6362
358 Ga0207677_10109007 3300026023 Bacteria 2058
359 Ga0207703_10000061 3300026035 Bacteria 132671
360 Ga0207703_10000385 3300026035 Bacteria 47298
361 Ga0207703_10236705 3300026035 Bacteria 1640
362 Ga0207703_10395833 3300026035 Bacteria 1281
363 Ga0207639_10005999 3300026041 Bacteria 8242
364 Ga0207639_10058185 3300026041 Bacteria 2972
365 Ga0207639_10169391 3300026041 Bacteria 1848
366 Ga0207639_10973510 3300026041 Bacteria 794
367 Ga0207678_10002224 3300026067 Bacteria 17527
368 Ga0207678_10032404 3300026067 Bacteria 4554
369 Ga0207708_10002447 3300026075 Bacteria 13650
370 Ga0207708_10204711 3300026075 Bacteria 1576
371 Ga0207708_10227558 3300026075 Bacteria 1496
372 Ga0207702_10000637 3300026078 Bacteria 38379
373 Ga0207702_10221539 3300026078 Bacteria 1763
374 Ga0207702_11658441 3300026078 Bacteria 632
375 Ga0207641_10000016 3300026088 Bacteria 307363
376 Ga0207641_10007724 3300026088 Bacteria 8939
377 Ga0207641_10219771 3300026088 Bacteria 1761
378 Ga0207641_10416146 3300026088 Bacteria 1293
379 Ga0207641_10953625 3300026088 Unclassified 853
380 Ga0207648_10017486 3300026089 Bacteria 6522
381 Ga0207676_10000018 3300026095 Bacteria 306375
382 Ga0207674_10054549 3300026116 Bacteria 4068
383 Ga0207674_10090964 3300026116 Bacteria 3042
384 Ga0207675_100100271 3300026118 Bacteria 2728
385 Ga0207675_101617495 3300026118 Bacteria 668
386 Ga0207683_10132710 3300026121 Bacteria 2240
387 Ga0207683_10164109 3300026121 Bacteria 2009
388 Ga0207683_10257607 3300026121 Bacteria 1593
389 Ga0207683_10331770 3300026121 Bacteria 1394
390 Ga0207683_10683425 3300026121 Bacteria 951
391 Ga0207698_10000004 3300026142 Bacteria 313614
392 Ga0207698_10005530 3300026142 Bacteria 7819
393 Ga0207698_10013220 3300026142 Bacteria 5437
394 Ga0207698_11932981 3300026142 Bacteria 605
395 Ga0268266_10000056 3300028379 Bacteria 289176
396 Ga0268266_10000601 3300028379 Bacteria 49250
397 Ga0268266_10001254 3300028379 Bacteria 31003
398 Ga0268266_10006356 3300028379 Bacteria 10831
399 Ga0268266_10235712 3300028379 Bacteria 1687
400 Ga0268266_10238666 3300028379 Bacteria 1677
401 Ga0268265_10114943 3300028380 Bacteria 2205
402 Ga0268264_10016645 3300028381 Bacteria 6021
403 Ga0268264_10581070 3300028381 Bacteria 1102
404 Ga0268264_11155999 3300028381 Bacteria 783
405 Ga0265337_1000066 3300028556 Bacteria 48673
406 Ga0265326_10000019 3300028558 Bacteria 137370
407 Ga0265319_1000469 3300028563 Bacteria 28589
408 Ga0265323_10102148 3300028653 Bacteria 948
409 Ga0265322_10000011 3300028654 Bacteria 167597
410 Ga0265336_10003168 3300028666 Bacteria 6540
411 Ga0265338_10000244 3300028800 Bacteria 100528
412 Ga0265338_10282917 3300028800 Bacteria 1211
413 Ga0265324_10000283 3300029957 Bacteria 37587
414 Ga0265324_10051394 3300029957 Bacteria 1416
415 Ga0307511_10082915 3300030521 Bacteria 2238
416 Ga0265328_10000737 3300031239 Bacteria 15188
417 Ga0265320_10000011 3300031240 Bacteria 249534
418 Ga0265329_10016232 3300031242 Bacteria 2585
419 Ga0265331_10000858 3300031250 Bacteria 24739
420 Ga0265331_10047145 3300031250 Bacteria 2074
421 Ga0265327_10000015 3300031251 Bacteria 496677
422 Ga0265316_10047188 3300031344 Bacteria 3408
423 Ga0265316_10538901 3300031344 Bacteria 831
424 Ga0307408_100219381 3300031548 Bacteria 1551
425 Ga0316579_10214626 3300031691 Unclassified 930
426 Ga0265314_10000640 3300031711 Bacteria 42944
427 Ga0265342_10048932 3300031712 Bacteria 2532
428 Ga0316576_10840742 3300031727 Unclassified 659
429 Ga0307405_10491037 3300031731 Bacteria 982
430 Ga0316577_10251762 3300031733 Unclassified 999
431 Ga0307413_10324320 3300031824 Bacteria 1178
432 Ga0307409_100429704 3300031995 Bacteria 1269
433 Ga0307416_100007153 3300032002 Bacteria 7060
434 Ga0307415_100023712 3300032126 Bacteria 3816
435 Ga0316583_10045544 3300032133 Bacteria 1549
436 Ga0373936_0279256 3300035113 Bacteria 750
437 Ga0373956_0368746 3300035119 Bacteria 685
438 Ga0373957_0098034 3300035120 Bacteria 1171
439 Ga0316574_0068576 3300035398 Bacteria 2237
440 Ga0316574_0124337 3300035398 Bacteria 1657
441 Ga0316574_0844129 3300035398 Unclassified 556
442 Ga0373937_0053338 3300036401 Bacteria 3709
443 Ga0373937_0090584 3300036401 Bacteria 2832
444 Ga0373937_1027542 3300036401 Bacteria 773
445 Ga0373937_1276367 3300036401 Bacteria 682
446 Ga0316582_0659968 3300036647 Unclassified 719
447 Ga0316584_0001782 3300036712 Bacteria 13265
448 Ga0395899_0577093 3300037312 Bacteria 719
449 Ga0395900_0165224 3300037418 Bacteria 2256
450 Ga0395900_0411672 3300037418 Bacteria 1314
451 Ga0395900_0753030 3300037418 Bacteria 904
452 Ga0395905_0849876 3300037471 Bacteria 816
453 Ga0395901_0179840 3300038443 Bacteria 2218
454 Ga0395901_0190166 3300038443 Bacteria 2153
455 Ga0395901_0369251 3300038443 Bacteria 1478
456 Ga0395901_0563530 3300038443 Bacteria 1153
457 Ga0436365_1901572 3300039437 Bacteria 608
458 Ga0451800_0147095 3300041459 Bacteria 1880
459 Ga0451804_0150049 3300041463 Bacteria 999
460 Ga0451807_1807140 3300041486 Bacteria 1001
461 Ga0451839_1143849 3300041496 Bacteria 1288
462 Ga0451845_0708268 3300041501 Bacteria 1092
463 Ga0451843_0715326 3300041509 Unclassified 682
464 Ga0451853_3832956 3300041512 Bacteria 1042
465 Ga0466963_0000017 3300044694 Bacteria 58283
466 Ga0466963_0358016 3300044694 Bacteria 1028
467 Ga0466968_0401672 3300044735 Bacteria 672
468 Ga0466957_0001414 3300044842 Bacteria 12517
469 Ga0466960_0107322 3300044901 Bacteria 1446
470 Ga0466960_0364103 3300044901 Bacteria 827
471 Ga0466958_0010414 3300045836 Bacteria 5207
472 Ga0466967_0000001 3300045976 Bacteria 229823
473 Ga0466967_0089398 3300045976 Bacteria 2797
474 Ga0466967_0506338 3300045976 Bacteria 1185
475 Ga0466967_1397797 3300045976 Bacteria 697
476 Ga0495592_0000607 3300046454 Bacteria 25304
477 Ga0495592_0128862 3300046454 Bacteria 1772
478 Ga0495592_0141108 3300046454 Bacteria 1676
479 Ga0495592_0217497 3300046454 Bacteria 1279
480 Ga0495603_0000286 3300046455 Bacteria 26902
481 Ga0495603_0001350 3300046455 Bacteria 14245
482 Ga0495603_0023918 3300046455 Bacteria 3695
483 Ga0495591_038251 3300046458 Bacteria 1383
484 Ga0495629_0000245 3300046459 Bacteria 47272
485 Ga0495629_0004704 3300046459 Bacteria 10231
486 Ga0495629_0005286 3300046459 Bacteria 9650
487 Ga0495629_0079298 3300046459 Bacteria 2293
488 Ga0495641_0000005 3300046461 Bacteria 206626
489 Ga0495641_0014257 3300046461 Bacteria 4308
490 Ga0495641_0038618 3300046461 Bacteria 2230
491 Ga0495641_0065442 3300046461 Bacteria 1636
492 Ga0495651_0028208 3300046462 Bacteria 4375
493 Ga0495651_0254350 3300046462 Bacteria 1198
494 Ga0495651_0388555 3300046462 Bacteria 913
495 Ga0495653_0092883 3300046463 Bacteria 2202
496 Ga0495582_0000001 3300046473 Bacteria 252434
497 Ga0495662_0000001 3300046476 Bacteria 179185
498 Ga0495662_0000848 3300046476 Bacteria 14886
499 Ga0495662_0299230 3300046476 Bacteria 791
500 Ga0495664_0801046 3300046477 Bacteria 554
501 Ga0495584_0250155 3300046491 Bacteria 901
502 Ga0495594_0000089 3300046499 Bacteria 41876
503 Ga0495596_0261213 3300046500 Unclassified 672
504 Ga0495596_0323719 3300046500 Bacteria 600
505 Ga0495606_0000040 3300046507 Bacteria 223500
506 Ga0495608_0000007 3300046511 Bacteria 313495
507 Ga0495608_0003541 3300046511 Bacteria 11187
508 Ga0495608_0053168 3300046511 Bacteria 2680
509 Ga0495608_0094331 3300046511 Bacteria 1933
510 Ga0495618_0000014 3300046514 Bacteria 163136
511 Ga0495620_0000784 3300046515 Bacteria 19458
512 Ga0495628_0005372 3300046516 Bacteria 11234
513 Ga0495628_0023790 3300046516 Bacteria 5023
514 Ga0495628_0066303 3300046516 Bacteria 2822
515 Ga0495628_0074598 3300046516 Bacteria 2642
516 Ga0495628_0101305 3300046516 Bacteria 2222
517 Ga0495628_0159293 3300046516 Bacteria 1716
518 Ga0495628_0240240 3300046516 Bacteria 1355
519 Ga0495630_0000014 3300046517 Bacteria 217229
520 Ga0495630_0000533 3300046517 Bacteria 27959
521 Ga0495630_0003407 3300046517 Bacteria 11078
522 Ga0495630_0219226 3300046517 Bacteria 1452
523 Ga0495632_0167686 3300046519 Bacteria 1010
524 Ga0495632_0278678 3300046519 Bacteria 745
525 Ga0495637_0229073 3300046520 Bacteria 674
526 Ga0495644_0001871 3300046523 Bacteria 8485
527 Ga0495652_0000037 3300046529 Bacteria 133232
528 Ga0495652_0011995 3300046529 Bacteria 7834
529 Ga0495652_0329517 3300046529 Bacteria 1100
530 Ga0495652_0496417 3300046529 Bacteria 847
531 Ga0495640_0024325 3300046533 Bacteria 4408
532 Ga0495640_0091728 3300046533 Bacteria 2004
533 Ga0495640_0202996 3300046533 Bacteria 1256
534 Ga0495640_0668817 3300046533 Bacteria 624
535 Ga0495586_0003054 3300046535 Bacteria 9025
536 Ga0495586_0508235 3300046535 Bacteria 695
537 Ga0495587_0003966 3300046536 Bacteria 9814
538 Ga0495587_0244258 3300046536 Bacteria 1010
539 Ga0495587_0245051 3300046536 Bacteria 1008
540 Ga0495598_0001582 3300046537 Bacteria 4560
541 Ga0495621_0033813 3300046539 Bacteria 1764
542 Ga0495645_0027447 3300046543 Bacteria 4137
543 Ga0495645_0166294 3300046543 Bacteria 1521
544 Ga0495645_0310285 3300046543 Bacteria 1027
545 Ga0495622_0000080 3300046557 Bacteria 85557
546 Ga0495633_0294546 3300046558 Bacteria 737
547 Ga0495667_0000020 3300046559 Bacteria 180876
548 Ga0495656_0000465 3300046615 Bacteria 13215
549 Ga0495656_0209816 3300046615 Bacteria 970
550 Ga0495668_0041252 3300046616 Bacteria 2572
551 Ga0495634_0000028 3300046642 Bacteria 114075
552 Ga0495634_0001744 3300046642 Bacteria 18826
553 Ga0495634_0182420 3300046642 Bacteria 1313
554 Ga0495634_0324706 3300046642 Bacteria 926
555 Ga0495634_0368028 3300046642 Bacteria 858
556 Ga0495634_0369367 3300046642 Bacteria 856
557 Ga0495611_0368595 3300046648 Bacteria 658
558 Ga0495625_0000349 3300046660 Bacteria 70631
559 Ga0495625_0076676 3300046660 Bacteria 2337
560 Ga0495635_0000076 3300046663 Bacteria 61665
561 Ga0495635_0034289 3300046663 Bacteria 3521
562 Ga0495635_0379265 3300046663 Bacteria 941
563 Ga0495588_0000362 3300046674 Bacteria 28212
564 Ga0495588_0301285 3300046674 Unclassified 844
565 Ga0495657_0000001 3300046675 Bacteria 445641
566 Ga0495657_0017364 3300046675 Bacteria 5226
567 Ga0495657_0218471 3300046675 Bacteria 1156
568 Ga0495599_0036072 3300046678 Bacteria 3104
569 Ga0495599_0668254 3300046678 Bacteria 601
570 Ga0495623_0055970 3300046679 Bacteria 2484
571 Ga0495623_0124236 3300046679 Bacteria 1551
572 Ga0495646_0201490 3300046680 Bacteria 1084
573 Ga0495647_0000001 3300046681 Bacteria 222371
574 Ga0495647_0000684 3300046681 Bacteria 10113
575 Ga0495647_0005148 3300046681 Bacteria 4281
576 Ga0495658_0000002 3300046683 Bacteria 309651
577 Ga0495658_0019725 3300046683 Bacteria 3524
578 Ga0495658_0122526 3300046683 Bacteria 1574
579 Ga0495669_0000113 3300046684 Bacteria 52780
580 Ga0495613_0000005 3300046689 Bacteria 222558
581 Ga0495613_0000041 3300046689 Bacteria 130784
582 Ga0495613_0140545 3300046689 Bacteria 1725
583 Ga0495613_0220715 3300046689 Bacteria 1331
584 Ga0495624_0000019 3300046690 Bacteria 102237
585 Ga0495624_0000417 3300046690 Bacteria 33743
586 Ga0495624_0033290 3300046690 Bacteria 3338
587 Ga0495624_0372530 3300046690 Bacteria 858
588 Ga0495670_0020649 3300046691 Bacteria 3248
589 Ga0495649_0002403 3300046694 Bacteria 13212
590 Ga0495600_0011717 3300046809 Bacteria 5472
591 Ga0495600_0034654 3300046809 Bacteria 3278
592 Ga0495581_0147758 3300047315 Bacteria 1372
593 Ga0495604_0000239 3300047317 Bacteria 49113
594 Ga0495604_0001251 3300047317 Bacteria 20805
595 Ga0495604_0003401 3300047317 Bacteria 12686
596 Ga0495604_0190723 3300047317 Bacteria 1428
597 Ga0495674_0000030 3300047319 Bacteria 115975
598 Ga0495674_0639066 3300047319 Bacteria 840
599 Ga0495672_0148694 3300047320 Bacteria 1217
600 Ga0495676_0000827 3300047321 Bacteria 25944
601 Ga0495676_0001461 3300047321 Bacteria 20394
602 Ga0495676_0012579 3300047321 Bacteria 7619
603 Ga0495676_0085869 3300047321 Bacteria 2370
604 Ga0495680_0000143 3300047322 Bacteria 71946
605 Ga0495680_0001430 3300047322 Bacteria 25733
606 Ga0495680_0022126 3300047322 Bacteria 5308
607 Ga0495680_0039154 3300047322 Bacteria 3783
608 Ga0495680_0188089 3300047322 Bacteria 1486
609 Ga0495675_0001421 3300047444 Bacteria 14505
610 Ga0495675_0008742 3300047444 Bacteria 6286
611 Ga0495679_007662 3300047446 Bacteria 4477
612 Ga0495684_0087952 3300047471 Bacteria 2355
613 Ga0495593_0039645 3300047673 Bacteria 2539
614 Ga0495593_0057583 3300047673 Bacteria 2040
615 Ga0495602_0000007 3300048088 Bacteria 273212
616 Ga0495602_0001031 3300048088 Bacteria 27141
617 Ga0495602_0151755 3300048088 Bacteria 1820
618 Ga0495602_0557479 3300048088 Bacteria 793
619 Ga0495602_0912922 3300048088 Bacteria 584
620 Ga0496100_0000001 3300048903 Bacteria 530179
621 Ga0496100_0000013 3300048903 Bacteria 177476
622 Ga0496100_0027464 3300048903 Bacteria 3500
623 Ga0496100_0434207 3300048903 Unclassified 1005
624 Ga0496101_0000004 3300048904 Bacteria 331599
625 Ga0496101_0000035 3300048904 Bacteria 177237
626 Ga0496101_0000894 3300048904 Bacteria 17535
627 Ga0496101_0100950 3300048904 Bacteria 2160
628 Ga0496101_0429650 3300048904 Bacteria 1041
629 Ga0496101_0672337 3300048904 Unclassified 818
630 Ga0496102_0000211 3300048905 Bacteria 77793
631 Ga0496102_0010565 3300048905 Bacteria 7951
632 Ga0496102_0058720 3300048905 Bacteria 3516
633 Ga0496102_0190210 3300048905 Bacteria 1934
634 Ga0496102_0342937 3300048905 Bacteria 1407
635 Ga0496102_0630218 3300048905 Bacteria 995
636 Ga0496102_1296016 3300048905 Bacteria 648
637 Ga0496103_0000083 3300048906 Bacteria 108615
638 Ga0496103_0077061 3300048906 Bacteria 2093
639 Ga0496103_0093172 3300048906 Bacteria 1902
640 Ga0496103_0605103 3300048906 Bacteria 698
641 Ga0496104_0000015 3300048907 Bacteria 374530
642 Ga0496104_0000052 3300048907 Bacteria 137286
643 Ga0496104_0000765 3300048907 Bacteria 27516
644 Ga0496104_0003858 3300048907 Bacteria 12971
645 Ga0496104_0049764 3300048907 Bacteria 3952
646 Ga0496104_0604536 3300048907 Unclassified 1007
647 Ga0496104_0875618 3300048907 Bacteria 803
648 Ga0496105_0000004 3300048908 Bacteria 475798
649 Ga0496105_0000030 3300048908 Bacteria 137325
650 Ga0496105_0000409 3300048908 Bacteria 28168
651 Ga0496105_0083478 3300048908 Bacteria 2638
652 Ga0496105_0301387 3300048908 Bacteria 1288
653 Ga0496105_0958289 3300048908 Bacteria 642
654 Ga0496106_0000076 3300048909 Bacteria 79088
655 Ga0496106_0000121 3300048909 Bacteria 59910
656 Ga0496106_0004512 3300048909 Bacteria 10312
657 Ga0496106_0023792 3300048909 Bacteria 4553
658 Ga0496106_0965747 3300048909 Bacteria 671
659 Ga0496107_0000005 3300048910 Bacteria 281747
660 Ga0496107_0000020 3300048910 Bacteria 148990
661 Ga0496107_0076122 3300048910 Bacteria 2443
662 Ga0496107_0076509 3300048910 Bacteria 2437
663 Ga0496107_0582133 3300048910 Bacteria 828
664 Ga0496108_0000006 3300048911 Bacteria 469473
665 Ga0496108_0000063 3300048911 Bacteria 118950
666 Ga0496108_0002546 3300048911 Bacteria 14595
667 Ga0496108_0003280 3300048911 Bacteria 12999
668 Ga0496108_0005560 3300048911 Bacteria 10200
669 Ga0496108_0009033 3300048911 Bacteria 8076
670 Ga0496108_0245749 3300048911 Bacteria 1557
671 Ga0496108_0951643 3300048911 Bacteria 735
672 Ga0496109_0000009 3300048912 Bacteria 236561
673 Ga0496109_0000012 3300048912 Bacteria 229699
674 Ga0496109_0000348 3300048912 Bacteria 43133
675 Ga0496109_0003361 3300048912 Bacteria 13379
676 Ga0496109_0005652 3300048912 Bacteria 10461
677 Ga0496109_0017515 3300048912 Bacteria 6281
678 Ga0496109_0128328 3300048912 Bacteria 2366
679 Ga0496109_0300150 3300048912 Bacteria 1514
680 Ga0496109_0392613 3300048912 Bacteria 1311
681 Ga0496109_1152084 3300048912 Bacteria 712
682 Ga0496110_0002164 3300048913 Bacteria 14666
683 Ga0496110_0010530 3300048913 Bacteria 7529
684 Ga0496110_0047750 3300048913 Bacteria 3750
685 Ga0496110_0246364 3300048913 Bacteria 1626
686 Ga0496110_0334165 3300048913 Bacteria 1380
687 Ga0496111_0000044 3300048914 Bacteria 49014
688 Ga0496111_0017776 3300048914 Bacteria 4918
689 Ga0496111_0070059 3300048914 Bacteria 2550
690 Ga0496111_0125916 3300048914 Bacteria 1894
691 Ga0496111_0409868 3300048914 Bacteria 1001
692 Ga0496111_0506888 3300048914 Bacteria 888
693 Ga0496112_0000025 3300048915 Bacteria 146197
694 Ga0496112_0013447 3300048915 Bacteria 7555
695 Ga0496112_0030187 3300048915 Bacteria 5245
696 Ga0496112_0226918 3300048915 Bacteria 1823
697 Ga0496113_0000013 3300048916 Bacteria 81224
698 Ga0496113_0004814 3300048916 Bacteria 8349
699 Ga0496113_0018475 3300048916 Bacteria 4856
700 Ga0496113_0038089 3300048916 Bacteria 3533
701 Ga0496113_0180000 3300048916 Bacteria 1676
702 Ga0496113_0220610 3300048916 Bacteria 1511
703 Ga0496113_0414766 3300048916 Bacteria 1081
704 Ga0496113_0562475 3300048916 Bacteria 914
705 Ga0496114_0000039 3300048917 Bacteria 138486
706 Ga0496114_0174601 3300048917 Bacteria 1874
707 Ga0496114_0221118 3300048917 Bacteria 1662
708 Ga0496114_0784039 3300048917 Bacteria 831
709 Ga0496114_1050717 3300048917 Bacteria 698
710 Ga0496115_0000011 3300048918 Bacteria 222529
711 Ga0496115_0000377 3300048918 Bacteria 36788
712 Ga0496115_0187433 3300048918 Bacteria 1709
713 Ga0496116_0000848 3300048919 Bacteria 38292
714 Ga0496117_0009784 3300048920 Bacteria 8842
715 Ga0496118_0002916 3300048921 Bacteria 22218
716 Ga0496118_0231303 3300048921 Bacteria 1066
717 Ga0496118_0304351 3300048921 Bacteria 873
718 Ga0496119_0011619 3300048922 Bacteria 7262
719 Ga0496120_0024368 3300048923 Bacteria 3775
720 Ga0496120_0049634 3300048923 Bacteria 2407
721 Ga0496121_0022084 3300048924 Bacteria 6194
722 Ga0496121_0283662 3300048924 Bacteria 1131
723 Ga0496121_0465148 3300048924 Bacteria 811
724 Ga0496124_0159321 3300048927 Bacteria 1761
725 Ga0496124_0264727 3300048927 Bacteria 1263
726 Ga0496125_0117153 3300048928 Bacteria 1911
727 Ga0496125_0179392 3300048928 Bacteria 1413
728 Ga0496126_0019594 3300048929 Bacteria 6660
729 Ga0496126_0891062 3300048929 Bacteria 675
730 Ga0501031_0002175 3300049568 Bacteria 12379
731 Ga0501031_0163107 3300049568 Bacteria 1457
732 Ga0501032_0011222 3300049569 Bacteria 6435
733 Ga0501032_0672158 3300049569 Bacteria 657
734 Ga0501033_0003689 3300049570 Bacteria 12454
735 Ga0501034_0307172 3300049571 Bacteria 1521
736 Ga0501034_0400007 3300049571 Bacteria 1296
737 Ga0501036_0020032 3300049572 Bacteria 5616
738 Ga0501037_0002926 3300049573 Bacteria 12385
739 Ga0501038_0005058 3300049574 Bacteria 12248
740 Ga0501038_1175658 3300049574 Bacteria 558
741 Ga0501039_0095570 3300049575 Bacteria 2317
742 Ga0501039_0216094 3300049575 Bacteria 1507
743 Ga0501039_0227319 3300049575 Bacteria 1467
744 Ga0501040_0125576 3300049576 Bacteria 1802
745 Ga0501042_0012872 3300049578 Bacteria 5681
746 Ga0501042_0061274 3300049578 Bacteria 2688
747 Ga0501042_0084546 3300049578 Bacteria 2275
748 Ga0501042_0313241 3300049578 Bacteria 1134
749 Ga0501042_0411606 3300049578 Bacteria 980
750 Ga0501043_0016009 3300049579 Bacteria 5878
751 Ga0501043_1140393 3300049579 Bacteria 549
752 Ga0501046_0004559 3300049580 Bacteria 12539
753 Ga0501046_0393039 3300049580 Bacteria 1002
754 Ga0501046_0571571 3300049580 Archaea 804
755 Ga0501047_0004952 3300049581 Bacteria 12510
756 Ga0501047_0010850 3300049581 Bacteria 8610
757 Ga0501047_0176579 3300049581 Bacteria 2003
758 Ga0501047_0780742 3300049581 Bacteria 770
759 Ga0501047_1161499 3300049581 Bacteria 585
760 Ga0501048_0003128 3300049582 Bacteria 12640
761 Ga0501048_0248226 3300049582 Bacteria 1263
762 Ga0501048_0506283 3300049582 Bacteria 866
763 Ga0501068_0002345 3300049584 Bacteria 10082
764 Ga0501068_0463372 3300049584 Bacteria 820
765 Ga0501069_0014849 3300049585 Bacteria 4170
766 Ga0501069_0087306 3300049585 Bacteria 1762
767 Ga0501070_0004064 3300049586 Bacteria 12575
768 Ga0501070_0047786 3300049586 Bacteria 3555
769 Ga0501070_0048441 3300049586 Bacteria 3530
770 Ga0501070_0148477 3300049586 Bacteria 1935
771 Ga0501070_0570055 3300049586 Bacteria 905
772 Ga0501070_1005321 3300049586 Bacteria 646
773 Ga0501071_0005888 3300049587 Bacteria 7926
774 Ga0501071_0209651 3300049587 Unclassified 1465
775 Ga0501071_0224674 3300049587 Bacteria 1414
776 Ga0501071_0297987 3300049587 Bacteria 1222
777 Ga0501071_0967896 3300049587 Bacteria 657
778 Ga0501071_1139292 3300049587 Bacteria 603
779 Ga0501072_0017464 3300049588 Bacteria 5513
780 Ga0501072_0030329 3300049588 Bacteria 4229
781 Ga0501072_0052302 3300049588 Bacteria 3216
782 Ga0501072_0166082 3300049588 Bacteria 1761
783 Ga0501072_1165303 3300049588 Unclassified 599
784 Ga0501073_0012127 3300049589 Bacteria 6294
785 Ga0501073_0045125 3300049589 Bacteria 3105
786 Ga0501073_0336398 3300049589 Bacteria 1042
787 Ga0501073_1097038 3300049589 Bacteria 547
788 Ga0501074_0018921 3300049590 Bacteria 5002
789 Ga0501074_0257323 3300049590 Bacteria 1241
790 Ga0501074_1137397 3300049590 Bacteria 548
791 Ga0501075_0034272 3300049591 Bacteria 3780
792 Ga0501075_0054219 3300049591 Bacteria 3015
793 Ga0501075_0082710 3300049591 Unclassified 2432
794 Ga0501076_0029982 3300049592 Bacteria 4235
795 Ga0501076_0046698 3300049592 Bacteria 3422
796 Ga0501076_1408551 3300049592 Bacteria 573
797 Ga0501077_0319436 3300049593 Bacteria 990
798 Ga0501079_0073179 3300049741 Bacteria 2649
799 Ga0501079_0080440 3300049741 Bacteria 2519
800 Ga0501079_0087220 3300049741 Bacteria 2416
801 Ga0501079_0912467 3300049741 Bacteria 692
802 Ga0501080_0030783 3300049742 Bacteria 5000
803 Ga0501080_0097730 3300049742 Bacteria 2726
804 Ga0501080_0549464 3300049742 Bacteria 1029
805 Ga0501080_0906253 3300049742 Bacteria 768
806 Ga0501080_1267845 3300049742 Bacteria 632
807 Ga0501081_0068435 3300049743 Bacteria 2472
808 Ga0501081_0086273 3300049743 Unclassified 2204
809 Ga0501081_0111193 3300049743 Bacteria 1944
810 Ga0501081_0692330 3300049743 Bacteria 765
811 Ga0501083_0002614 3300049744 Bacteria 12402
812 Ga0501083_0003895 3300049744 Bacteria 10485
813 Ga0501083_0036093 3300049744 Bacteria 3373
814 Ga0501083_0707609 3300049744 Bacteria 655
815 Ga0501283_062372 3300049779 Bacteria 675
816 Ga0501035_0005116 3300049822 Bacteria 12420
817 Ga0501044_0006919 3300049823 Bacteria 12483
818 Ga0501044_0034851 3300049823 Bacteria 5275
819 Ga0501045_0098388 3300049824 Bacteria 2164
820 Ga0501045_0133474 3300049824 Bacteria 1846
821 Ga0501045_0845346 3300049824 Unclassified 673
822 Ga0501045_1221339 3300049824 Archaea 548
823 nmdc:mga03n38_229497_c1 3300050490 Bacteria 972
824 nmdc:mga00v17_108157_c1 3300050491 Bacteria 1762
825 nmdc:mga00v17_177051_c1 3300050491 Bacteria 1376
826 nmdc:mga00v17_284456_c1 3300050491 Bacteria 1074
827 nmdc:mga00v17_497475_c1 3300050491 Unclassified 790
828 nmdc:mga00v17_51630_c2 3300050491 Bacteria 1890
829 nmdc:mga00v17_800246_c1 3300050491 Unclassified 601
830 nmdc:mga0yw44_142103_c1 3300050492 Bacteria 1561
831 nmdc:mga0yw44_266562_c1 3300050492 Bacteria 1142
832 nmdc:mga0yw44_320642_c1 3300050492 Unclassified 1040
833 nmdc:mga0yw44_479162_c1 3300050492 Bacteria 844
834 nmdc:mga0yw44_623492_c1 3300050492 Bacteria 733
835 nmdc:mga0yw44_81179_c1 3300050492 Bacteria 2033
836 nmdc:mga0yw44_81412_c1 3300050492 Bacteria 2030
837 nmdc:mga05p37_220296_c1 3300050507 Unclassified 2290
838 nmdc:mga05p37_611014_c1 3300050507 Bacteria 1229
839 nmdc:mga08y16_92139_c1 3300050511 Bacteria 3158
840 nmdc:mga0rr50_379733_c1 3300050513 Bacteria 1191
841 nmdc:mga08x19_853142_c1 3300050514 Unclassified 647
842 nmdc:mga0a205_138769_c1 3300050515 Bacteria 2331
843 nmdc:mga0a205_43_c1 3300050515 Bacteria 51209
844 nmdc:mga0a205_53_c2 3300050515 Bacteria 54696
845 Ga0495601_0000060 3300053077 Bacteria 60600
846 Ga0495601_0000165 3300053077 Bacteria 35521
847 Ga0495601_0025379 3300053077 Bacteria 3654
848 Ga0495601_0057074 3300053077 Bacteria 2473
849 Ga0495601_0234552 3300053077 Bacteria 1198
850 Ga0495601_0719291 3300053077 Bacteria 636
851 Ga0495612_0000210 3300053078 Bacteria 24800
852 Ga0495612_0003484 3300053078 Bacteria 6518
853 Ga0495612_0049530 3300053078 Bacteria 1724
854 Ga0495612_0049786 3300053078 Bacteria 1719
855 Ga0495655_0000002 3300053083 Bacteria 312752
856 Ga0495655_0001463 3300053083 Bacteria 3616
857 Ga0495595_0000002 3300053084 Bacteria 445641
858 Ga0495595_0000045 3300053084 Bacteria 63054
859 Ga0495619_0000008 3300053085 Bacteria 305999
860 Ga0495619_0000095 3300053085 Bacteria 66204
861 Ga0495619_0000102 3300053085 Bacteria 64345
862 Ga0495619_0000155 3300053085 Bacteria 50682
863 Ga0495619_0000195 3300053085 Bacteria 44602
864 Ga0495619_0000320 3300053085 Bacteria 33623
865 Ga0495619_0010358 3300053085 Bacteria 5869
866 Ga0495619_0053306 3300053085 Bacteria 2675
867 Ga0495619_0742263 3300053085 Bacteria 666
868 Ga0495619_1164776 3300053085 Bacteria 511
869 Ga0500566_0001093 3300053094 Bacteria 15689
870 Ga0500554_236769 3300053102 Bacteria 604
871 Ga0500595_069413 3300053119 Bacteria 1048
872 Ga0500628_000001 3300053129 Bacteria 564074
873 Ga0500658_0263441 3300053134 Bacteria 792
874 Ga0501084_0005040 3300054114 Bacteria 10806
875 Ga0501084_0156761 3300054114 Bacteria 1920
876 Ga0501084_1245649 3300054114 Bacteria 624
877 Ga0587082_113505 3300059504 Bacteria 604
878 Ga0501082_0022699 3300060353 Bacteria 5403
879 Ga0501082_0450607 3300060353 Bacteria 1124
880 Ga0501082_1182950 3300060353 Bacteria 668
881 Ga0501082_1373789 3300060353 Bacteria 617
882 Ga0530510_0010891 3300061734 Bacteria 6380
883 Ga0530510_0019997 3300061734 Bacteria 4759
884 Ga0530510_0355097 3300061734 Bacteria 1101

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_1373789 Ga0501082_1373789_161_607 138
2 3300005937 Ga0081455_10049005 Ga0081455_100490054 148
3 3300006852 Ga0075433_10000897 Ga0075433_100008978 148
4 3300009093 Ga0105240_10384233 Ga0105240_103842332 148
5 3300009174 Ga0105241_10160467 Ga0105241_101604672 148
6 3300009545 Ga0105237_10107344 Ga0105237_101073442 148
7 3300037418 Ga0395900_0411672 Ga0395900_0411672_845_1294 148
8 3300039437 Ga0436365_1901572 Ga0436365_1901572_99_545 148
9 3300044842 Ga0466957_0001414 Ga0466957_0001414_8231_8677 148
10 3300046674 Ga0495588_0301285 Ga0495588_0301285_84_530 148
11 3300046681 Ga0495647_0000684 Ga0495647_0000684_28_474 148
12 3300047322 Ga0495680_0022126 Ga0495680_0022126_1947_2393 148
13 3300048088 Ga0495602_0557479 Ga0495602_0557479_313_759 148
14 3300048904 Ga0496101_0429650 Ga0496101_0429650_17_469 148
15 3300048904 Ga0496101_0672337 Ga0496101_0672337_328_774 148
16 3300048907 Ga0496104_0049764 Ga0496104_0049764_2712_3164 148
17 3300048908 Ga0496105_0083478 Ga0496105_0083478_1249_1701 148
18 3300048909 Ga0496106_0965747 Ga0496106_0965747_197_649 148
19 3300048910 Ga0496107_0582133 Ga0496107_0582133_75_524 148
20 3300048916 Ga0496113_0562475 Ga0496113_0562475_78_524 148
21 3300048917 Ga0496114_0174601 Ga0496114_0174601_435_881 148
22 3300048918 Ga0496115_0000011 Ga0496115_0000011_107560_108006 148
23 3300048921 Ga0496118_0231303 Ga0496118_0231303_241_693 148
24 3300048924 Ga0496121_0022084 Ga0496121_0022084_344_796 148
25 3300048924 Ga0496121_0283662 Ga0496121_0283662_412_864 148
26 3300048924 Ga0496121_0465148 Ga0496121_0465148_55_507 148
27 3300048927 Ga0496124_0159321 Ga0496124_0159321_1223_1675 148
28 3300048928 Ga0496125_0179392 Ga0496125_0179392_439_891 148
29 3300048929 Ga0496126_0891062 Ga0496126_0891062_177_629 148
30 3300049586 Ga0501070_0148477 Ga0501070_0148477_1110_1556 148
31 3300049592 Ga0501076_1408551 Ga0501076_1408551_12_458 148
32 3300049593 Ga0501077_0319436 Ga0501077_0319436_46_492 148
33 3300049743 Ga0501081_0111193 Ga0501081_0111193_574_1020 148
34 3300049743 Ga0501081_0692330 Ga0501081_0692330_232_678 148
35 3300050515 nmdc:mga0a205_53_c2 nmdc:mga0a205_53_c2_12417_12866 148
36 3300053085 Ga0495619_0010358 Ga0495619_0010358_2835_3323 148
37 3300053085 Ga0495619_1164776 Ga0495619_1164776_28_474 148
38 3300053119 Ga0500595_069413 Ga0500595_069413_497_949 148
39 3300053134 Ga0500658_0263441 Ga0500658_0263441_65_517 148
40 3300054114 Ga0501084_1245649 Ga0501084_1245649_11_457 148
41 3300005356 Ga0070674_100011888 Ga0070674_1000118882 149
42 3300005718 Ga0068866_10000008 Ga0068866_10000008122 149
43 3300025899 Ga0207642_10000002 Ga0207642_10000002547 149
44 3300025937 Ga0207669_10000026 Ga0207669_100000267 149
45 3300005438 Ga0070701_10310198 Ga0070701_103101982 150
46 3300049589 Ga0501073_1097038 Ga0501073_1097038_61_537 150
47 3300049779 Ga0501283_062372 Ga0501283_062372_127_642 150
48 3300059504 Ga0587082_113505 Ga0587082_113505_77_550 153
49 3300049586 Ga0501070_0047786 Ga0501070_0047786_66_533 154
50 3300031691 Ga0316579_10214626 Ga0316579_102146262 156
51 3300031733 Ga0316577_10251762 Ga0316577_102517621 156
52 3300041463 Ga0451804_0150049 Ga0451804_0150049_296_766 156
53 3300005435 Ga0070714_100430087 Ga0070714_1004300872 157
54 3300005544 Ga0070686_100097960 Ga0070686_1000979602 157
55 3300005614 Ga0068856_100772303 Ga0068856_1007723032 157
56 3300006028 Ga0070717_10296430 Ga0070717_102964302 157
57 3300026078 Ga0207702_11658441 Ga0207702_116584411 157
58 3300048903 Ga0496100_0027464 Ga0496100_0027464_2602_3084 157
59 3300048904 Ga0496101_0000894 Ga0496101_0000894_7532_8014 157
60 3300048905 Ga0496102_0342937 Ga0496102_0342937_349_831 157
61 3300048907 Ga0496104_0003858 Ga0496104_0003858_9385_9867 157
62 3300048908 Ga0496105_0301387 Ga0496105_0301387_615_1097 157
63 3300048909 Ga0496106_0023792 Ga0496106_0023792_250_732 157
64 3300048910 Ga0496107_0076509 Ga0496107_0076509_1527_2009 157
65 3300048911 Ga0496108_0002546 Ga0496108_0002546_5295_5777 157
66 3300048912 Ga0496109_0017515 Ga0496109_0017515_869_1351 157
67 3300048913 Ga0496110_0010530 Ga0496110_0010530_186_668 157
68 3300048915 Ga0496112_0013447 Ga0496112_0013447_2190_2672 157
69 3300048916 Ga0496113_0018475 Ga0496113_0018475_2496_2978 157
70 3300048917 Ga0496114_1050717 Ga0496114_1050717_113_595 157
71 3300005444 Ga0070694_100213897 Ga0070694_1002138971 158
72 3300005549 Ga0070704_100053014 Ga0070704_1000530143 158
73 3300035113 Ga0373936_0279256 Ga0373936_0279256_48_560 158
74 3300005436 Ga0070713_101616208 Ga0070713_1016162081 159
75 3300021384 Ga0213876_10451361 Ga0213876_104513612 159
76 3300045976 Ga0466967_1397797 Ga0466967_1397797_70_570 159
77 3300001977 JGI24746J21847_1025538 JGI24746J21847_10255382 160
78 3300001979 JGI24740J21852_10111435 JGI24740J21852_101114352 160
79 3300001991 JGI24743J22301_10021951 JGI24743J22301_100219512 160
80 3300002075 JGI24738J21930_10065889 JGI24738J21930_100658891 160
81 3300002239 JGI24034J26672_10037482 JGI24034J26672_100374821 160
82 3300005327 Ga0070658_10120843 Ga0070658_101208432 160
83 3300005329 Ga0070683_100343962 Ga0070683_1003439622 160
84 3300005337 Ga0070682_100008571 Ga0070682_1000085712 160
85 3300005338 Ga0068868_100268553 Ga0068868_1002685532 160
86 3300005339 Ga0070660_100104391 Ga0070660_1001043912 160
87 3300005341 Ga0070691_10482053 Ga0070691_104820531 160
88 3300005343 Ga0070687_100119153 Ga0070687_1001191531 160
89 3300005344 Ga0070661_100499160 Ga0070661_1004991602 160
90 3300005345 Ga0070692_10007789 Ga0070692_100077892 160
91 3300005347 Ga0070668_100149155 Ga0070668_1001491552 160
92 3300005353 Ga0070669_100264872 Ga0070669_1002648722 160
93 3300005354 Ga0070675_100248923 Ga0070675_1002489233 160
94 3300005356 Ga0070674_100012173 Ga0070674_1000121736 160
95 3300005364 Ga0070673_100064289 Ga0070673_1000642892 160
96 3300005365 Ga0070688_100095406 Ga0070688_1000954062 160
97 3300005366 Ga0070659_100007424 Ga0070659_1000074249 160
98 3300005366 Ga0070659_100395467 Ga0070659_1003954672 160
99 3300005441 Ga0070700_100116416 Ga0070700_1001164162 160
100 3300005444 Ga0070694_100098482 Ga0070694_1000984822 160
101 3300005455 Ga0070663_100007633 Ga0070663_1000076334 160
102 3300005456 Ga0070678_100118620 Ga0070678_1001186201 160
103 3300005457 Ga0070662_100014992 Ga0070662_1000149923 160
104 3300005459 Ga0068867_100143823 Ga0068867_1001438233 160
105 3300005466 Ga0070685_10063791 Ga0070685_100637912 160
106 3300005539 Ga0068853_100189350 Ga0068853_1001893503 160
107 3300005543 Ga0070672_100004196 Ga0070672_1000041962 160
108 3300005544 Ga0070686_100167235 Ga0070686_1001672352 160
109 3300005547 Ga0070693_100085963 Ga0070693_1000859631 160
110 3300005548 Ga0070665_100410741 Ga0070665_1004107412 160
111 3300005578 Ga0068854_100170113 Ga0068854_1001701133 160
112 3300005615 Ga0070702_100080455 Ga0070702_1000804553 160
113 3300005616 Ga0068852_100014610 Ga0068852_1000146103 160
114 3300005617 Ga0068859_100275896 Ga0068859_1002758963 160
115 3300005618 Ga0068864_100291873 Ga0068864_1002918732 160
116 3300005718 Ga0068866_10111683 Ga0068866_101116832 160
117 3300005719 Ga0068861_101117957 Ga0068861_1011179572 160
118 3300005842 Ga0068858_100257921 Ga0068858_1002579211 160
119 3300005843 Ga0068860_101205744 Ga0068860_1012057442 160
120 3300005844 Ga0068862_100124618 Ga0068862_1001246183 160
121 3300005937 Ga0081455_10072555 Ga0081455_100725553 160
122 3300006038 Ga0075365_10002366 Ga0075365_100023668 160
123 3300006038 Ga0075365_10156417 Ga0075365_101564172 160
124 3300006042 Ga0075368_10245708 Ga0075368_102457082 160
125 3300006048 Ga0075363_100001314 Ga0075363_1000013148 160
126 3300006048 Ga0075363_100014606 Ga0075363_1000146064 160
127 3300006048 Ga0075363_100143851 Ga0075363_1001438512 160
128 3300006048 Ga0075363_100356770 Ga0075363_1003567702 160
129 3300006051 Ga0075364_10049695 Ga0075364_100496954 160
130 3300006177 Ga0075362_10252284 Ga0075362_102522841 160
131 3300006178 Ga0075367_10369945 Ga0075367_103699451 160
132 3300006178 Ga0075367_10414097 Ga0075367_104140972 160
133 3300006353 Ga0075370_10335443 Ga0075370_103354432 160
134 3300006881 Ga0068865_100007004 Ga0068865_1000070044 160
135 3300006931 Ga0097620_100275903 Ga0097620_1002759033 160
136 3300009094 Ga0111539_10639660 Ga0111539_106396602 160
137 3300009098 Ga0105245_10035031 Ga0105245_100350314 160
138 3300009148 Ga0105243_10003503 Ga0105243_100035039 160
139 3300009553 Ga0105249_10096461 Ga0105249_100964613 160
140 3300010375 Ga0105239_10261216 Ga0105239_102612162 160
141 3300013296 Ga0157374_10275238 Ga0157374_102752382 160
142 3300013297 Ga0157378_10628867 Ga0157378_106288672 160
143 3300013306 Ga0163162_10556987 Ga0163162_105569872 160
144 3300013307 Ga0157372_10042342 Ga0157372_100423424 160
145 3300013308 Ga0157375_10013296 Ga0157375_100132963 160
146 3300014326 Ga0157380_10012273 Ga0157380_100122735 160
147 3300014968 Ga0157379_10588730 Ga0157379_105887302 160
148 3300014969 Ga0157376_11848914 Ga0157376_118489141 160
149 3300025901 Ga0207688_10008563 Ga0207688_100085632 160
150 3300025909 Ga0207705_10082216 Ga0207705_100822162 160
151 3300025914 Ga0207671_10728427 Ga0207671_107284272 160
152 3300025917 Ga0207660_10170427 Ga0207660_101704272 160
153 3300025919 Ga0207657_10000636 Ga0207657_1000063635 160
154 3300025920 Ga0207649_10033692 Ga0207649_100336923 160
155 3300025921 Ga0207652_10193435 Ga0207652_101934352 160
156 3300025926 Ga0207659_10036774 Ga0207659_100367743 160
157 3300025927 Ga0207687_10011833 Ga0207687_100118332 160
158 3300025932 Ga0207690_10002634 Ga0207690_100026344 160
159 3300025933 Ga0207706_10027571 Ga0207706_100275714 160
160 3300025934 Ga0207686_10264992 Ga0207686_102649922 160
161 3300025935 Ga0207709_10005868 Ga0207709_100058684 160
162 3300025940 Ga0207691_10056114 Ga0207691_100561143 160
163 3300025945 Ga0207679_10004050 Ga0207679_100040501 160
164 3300025960 Ga0207651_10016930 Ga0207651_100169306 160
165 3300025961 Ga0207712_10058206 Ga0207712_100582063 160
166 3300026023 Ga0207677_10109007 Ga0207677_101090072 160
167 3300026035 Ga0207703_10395833 Ga0207703_103958331 160
168 3300026041 Ga0207639_10169391 Ga0207639_101693913 160
169 3300026067 Ga0207678_10032404 Ga0207678_100324043 160
170 3300026075 Ga0207708_10002447 Ga0207708_100024473 160
171 3300026088 Ga0207641_10953625 Ga0207641_109536252 160
172 3300026089 Ga0207648_10017486 Ga0207648_100174866 160
173 3300026116 Ga0207674_10090964 Ga0207674_100909644 160
174 3300026118 Ga0207675_100100271 Ga0207675_1001002712 160
175 3300026121 Ga0207683_10164109 Ga0207683_101641092 160
176 3300026121 Ga0207683_10683425 Ga0207683_106834252 160
177 3300026142 Ga0207698_10005530 Ga0207698_100055302 160
178 3300028379 Ga0268266_10238666 Ga0268266_102386662 160
179 3300028380 Ga0268265_10114943 Ga0268265_101149432 160
180 3300028381 Ga0268264_11155999 Ga0268264_111559992 160
181 3300031548 Ga0307408_100219381 Ga0307408_1002193812 160
182 3300031727 Ga0316576_10840742 Ga0316576_108407421 160
183 3300031995 Ga0307409_100429704 Ga0307409_1004297042 160
184 3300035398 Ga0316574_0068576 Ga0316574_0068576_143_628 160
185 3300035398 Ga0316574_0844129 Ga0316574_0844129_56_541 160
186 3300036647 Ga0316582_0659968 Ga0316582_0659968_190_675 160
187 3300041512 Ga0451853_3832956 Ga0451853_3832956_346_831 160
188 3300046491 Ga0495584_0250155 Ga0495584_0250155_320_811 160
189 3300046500 Ga0495596_0261213 Ga0495596_0261213_121_612 160
190 3300046615 Ga0495656_0209816 Ga0495656_0209816_101_592 160
191 3300046648 Ga0495611_0368595 Ga0495611_0368595_10_501 160
192 3300048904 Ga0496101_0100950 Ga0496101_0100950_96_581 160
193 3300048905 Ga0496102_1296016 Ga0496102_1296016_73_555 160
194 3300048906 Ga0496103_0605103 Ga0496103_0605103_106_612 160
195 3300048907 Ga0496104_0604536 Ga0496104_0604536_32_517 160
196 3300048911 Ga0496108_0005560 Ga0496108_0005560_4834_5319 160
197 3300048912 Ga0496109_0005652 Ga0496109_0005652_3825_4310 160
198 3300048912 Ga0496109_0128328 Ga0496109_0128328_1222_1704 160
199 3300048914 Ga0496111_0017776 Ga0496111_0017776_3812_4294 160
200 3300048916 Ga0496113_0414766 Ga0496113_0414766_372_857 160
201 3300049571 Ga0501034_0400007 Ga0501034_0400007_344_829 160
202 3300049585 Ga0501069_0087306 Ga0501069_0087306_780_1265 160
203 3300049586 Ga0501070_1005321 Ga0501070_1005321_142_627 160
204 3300049587 Ga0501071_0224674 Ga0501071_0224674_292_777 160
205 3300049588 Ga0501072_1165303 Ga0501072_1165303_14_499 160
206 3300049589 Ga0501073_0045125 Ga0501073_0045125_2552_3037 160
207 3300049741 Ga0501079_0912467 Ga0501079_0912467_91_576 160
208 3300049742 Ga0501080_1267845 Ga0501080_1267845_127_615 160
209 3300049744 Ga0501083_0707609 Ga0501083_0707609_47_532 160
210 3300050490 nmdc:mga03n38_229497_c1 nmdc:mga03n38_229497_c1_361_846 160
211 3300050491 nmdc:mga00v17_284456_c1 nmdc:mga00v17_284456_c1_432_920 160
212 3300050491 nmdc:mga00v17_800246_c1 nmdc:mga00v17_800246_c1_38_526 160
213 3300050492 nmdc:mga0yw44_266562_c1 nmdc:mga0yw44_266562_c1_75_560 160
214 3300050492 nmdc:mga0yw44_81179_c1 nmdc:mga0yw44_81179_c1_792_1280 160
215 3300050511 nmdc:mga08y16_92139_c1 nmdc:mga08y16_92139_c1_335_820 160
216 3300025898 Ga0207692_10166323 Ga0207692_101663232 161
217 3300046500 Ga0495596_0323719 Ga0495596_0323719_73_561 161
218 3300047321 Ga0495676_0000827 Ga0495676_0000827_13351_13836 161
219 3300048903 Ga0496100_0000001 Ga0496100_0000001_421048_421533 161
220 3300048904 Ga0496101_0000004 Ga0496101_0000004_222400_222885 161
221 3300048909 Ga0496106_0000076 Ga0496106_0000076_18238_18723 161
222 3300048910 Ga0496107_0000005 Ga0496107_0000005_108715_109200 161
223 3300048916 Ga0496113_0220610 Ga0496113_0220610_313_798 161
224 3300050492 nmdc:mga0yw44_479162_c1 nmdc:mga0yw44_479162_c1_215_706 161
225 3300060353 Ga0501082_0022699 Ga0501082_0022699_399_884 161
226 3300000546 LJNas_1006049 LJNas_10060492 162
227 3300001977 JGI24746J21847_1000760 JGI24746J21847_10007604 162
228 3300001979 JGI24740J21852_10010068 JGI24740J21852_100100683 162
229 3300002074 JGI24748J21848_1000727 JGI24748J21848_10007273 162
230 3300002239 JGI24034J26672_10001507 JGI24034J26672_100015073 162
231 3300002244 JGI24742J22300_10001453 JGI24742J22300_100014533 162
232 3300003659 JGI25404J52841_10000319 JGI25404J52841_100003197 162
233 3300005329 Ga0070683_100000404 Ga0070683_10000040416 162
234 3300005329 Ga0070683_100006627 Ga0070683_10000662710 162
235 3300005329 Ga0070683_100060798 Ga0070683_1000607982 162
236 3300005329 Ga0070683_100323177 Ga0070683_1003231772 162
237 3300005329 Ga0070683_100453508 Ga0070683_1004535082 162
238 3300005331 Ga0070670_100073330 Ga0070670_1000733303 162
239 3300005335 Ga0070666_10231693 Ga0070666_102316931 162
240 3300005336 Ga0070680_100394914 Ga0070680_1003949142 162
241 3300005337 Ga0070682_100000011 Ga0070682_1000000112 162
242 3300005337 Ga0070682_100000052 Ga0070682_100000052121 162
243 3300005338 Ga0068868_100000141 Ga0068868_10000014138 162
244 3300005338 Ga0068868_100002016 Ga0068868_10000201610 162
245 3300005339 Ga0070660_100810199 Ga0070660_1008101991 162
246 3300005341 Ga0070691_10000044 Ga0070691_100000447 162
247 3300005341 Ga0070691_10000524 Ga0070691_1000052410 162
248 3300005344 Ga0070661_100000099 Ga0070661_1000000997 162
249 3300005345 Ga0070692_10088523 Ga0070692_100885232 162
250 3300005347 Ga0070668_100012531 Ga0070668_1000125315 162
251 3300005347 Ga0070668_100215454 Ga0070668_1002154542 162
252 3300005353 Ga0070669_100177175 Ga0070669_1001771752 162
253 3300005354 Ga0070675_100000036 Ga0070675_10000003670 162
254 3300005355 Ga0070671_100055512 Ga0070671_1000555122 162
255 3300005356 Ga0070674_100000012 Ga0070674_10000001231 162
256 3300005356 Ga0070674_100141733 Ga0070674_1001417332 162
257 3300005364 Ga0070673_100006402 Ga0070673_1000064024 162
258 3300005365 Ga0070688_100000071 Ga0070688_10000007138 162
259 3300005365 Ga0070688_100000206 Ga0070688_10000020623 162
260 3300005366 Ga0070659_100004223 Ga0070659_1000042232 162
261 3300005366 Ga0070659_100060959 Ga0070659_1000609593 162
262 3300005367 Ga0070667_100000603 Ga0070667_10000060317 162
263 3300005367 Ga0070667_100099083 Ga0070667_1000990832 162
264 3300005367 Ga0070667_100299101 Ga0070667_1002991012 162
265 3300005367 Ga0070667_100885391 Ga0070667_1008853912 162
266 3300005435 Ga0070714_100041184 Ga0070714_1000411844 162
267 3300005436 Ga0070713_100000047 Ga0070713_10000004778 162
268 3300005439 Ga0070711_100008252 Ga0070711_1000082525 162
269 3300005439 Ga0070711_100171837 Ga0070711_1001718372 162
270 3300005441 Ga0070700_100195005 Ga0070700_1001950052 162
271 3300005444 Ga0070694_100145983 Ga0070694_1001459832 162
272 3300005444 Ga0070694_100150163 Ga0070694_1001501633 162
273 3300005455 Ga0070663_100001716 Ga0070663_1000017162 162
274 3300005456 Ga0070678_100064983 Ga0070678_1000649832 162
275 3300005457 Ga0070662_100000002 Ga0070662_100000002226 162
276 3300005458 Ga0070681_10071340 Ga0070681_100713402 162
277 3300005458 Ga0070681_10919100 Ga0070681_109191001 162
278 3300005466 Ga0070685_10000020 Ga0070685_1000002073 162
279 3300005466 Ga0070685_10000674 Ga0070685_1000067412 162
280 3300005466 Ga0070685_10778056 Ga0070685_107780562 162
281 3300005530 Ga0070679_100005826 Ga0070679_10000582610 162
282 3300005530 Ga0070679_100025853 Ga0070679_1000258535 162
283 3300005535 Ga0070684_100178634 Ga0070684_1001786342 162
284 3300005535 Ga0070684_100200471 Ga0070684_1002004712 162
285 3300005535 Ga0070684_100712970 Ga0070684_1007129702 162
286 3300005539 Ga0068853_100083524 Ga0068853_1000835242 162
287 3300005539 Ga0068853_100527751 Ga0068853_1005277512 162
288 3300005543 Ga0070672_100000001 Ga0070672_100000001100 162
289 3300005546 Ga0070696_100772833 Ga0070696_1007728332 162
290 3300005546 Ga0070696_100812601 Ga0070696_1008126012 162
291 3300005547 Ga0070693_100003731 Ga0070693_1000037314 162
292 3300005548 Ga0070665_100000135 Ga0070665_10000013520 162
293 3300005548 Ga0070665_100019237 Ga0070665_1000192372 162
294 3300005548 Ga0070665_100020661 Ga0070665_1000206618 162
295 3300005548 Ga0070665_100375688 Ga0070665_1003756882 162
296 3300005549 Ga0070704_100208484 Ga0070704_1002084842 162
297 3300005549 Ga0070704_100451029 Ga0070704_1004510292 162
298 3300005563 Ga0068855_100549030 Ga0068855_1005490302 162
299 3300005564 Ga0070664_100118845 Ga0070664_1001188453 162
300 3300005577 Ga0068857_100065380 Ga0068857_1000653803 162
301 3300005578 Ga0068854_100001203 Ga0068854_10000120317 162
302 3300005578 Ga0068854_100056337 Ga0068854_1000563372 162
303 3300005616 Ga0068852_100000002 Ga0068852_100000002246 162
304 3300005617 Ga0068859_100759111 Ga0068859_1007591112 162
305 3300005618 Ga0068864_100000015 Ga0068864_100000015196 162
306 3300005718 Ga0068866_10006530 Ga0068866_100065305 162
307 3300005718 Ga0068866_10499494 Ga0068866_104994942 162
308 3300005719 Ga0068861_100312043 Ga0068861_1003120432 162
309 3300005834 Ga0068851_10013817 Ga0068851_100138174 162
310 3300005841 Ga0068863_100000022 Ga0068863_10000002268 162
311 3300005841 Ga0068863_100006236 Ga0068863_1000062362 162
312 3300005841 Ga0068863_100189242 Ga0068863_1001892422 162
313 3300005841 Ga0068863_100467130 Ga0068863_1004671302 162
314 3300005842 Ga0068858_100018138 Ga0068858_1000181385 162
315 3300005842 Ga0068858_100154568 Ga0068858_1001545682 162
316 3300005843 Ga0068860_100011591 Ga0068860_1000115918 162
317 3300005843 Ga0068860_100085754 Ga0068860_1000857543 162
318 3300005844 Ga0068862_100002782 Ga0068862_1000027824 162
319 3300005937 Ga0081455_10010756 Ga0081455_100107566 162
320 3300005937 Ga0081455_10041071 Ga0081455_100410714 162
321 3300005937 Ga0081455_10067266 Ga0081455_100672662 162
322 3300005937 Ga0081455_10239729 Ga0081455_102397291 162
323 3300005981 Ga0081538_10000812 Ga0081538_1000081235 162
324 3300005981 Ga0081538_10048156 Ga0081538_100481563 162
325 3300005981 Ga0081538_10156378 Ga0081538_101563781 162
326 3300005981 Ga0081538_10224873 Ga0081538_102248732 162
327 3300005983 Ga0081540_1000100 Ga0081540_10001005 162
328 3300005983 Ga0081540_1000366 Ga0081540_100036621 162
329 3300005983 Ga0081540_1083410 Ga0081540_10834102 162
330 3300005985 Ga0081539_10000878 Ga0081539_100008787 162
331 3300005985 Ga0081539_10024074 Ga0081539_100240746 162
332 3300006038 Ga0075365_10018720 Ga0075365_100187202 162
333 3300006038 Ga0075365_10376304 Ga0075365_103763042 162
334 3300006038 Ga0075365_10381470 Ga0075365_103814702 162
335 3300006051 Ga0075364_10028746 Ga0075364_100287463 162
336 3300006051 Ga0075364_10212352 Ga0075364_102123522 162
337 3300006051 Ga0075364_10440909 Ga0075364_104409092 162
338 3300006051 Ga0075364_10706725 Ga0075364_107067251 162
339 3300006163 Ga0070715_10000021 Ga0070715_100000214 162
340 3300006175 Ga0070712_100102609 Ga0070712_1001026092 162
341 3300006178 Ga0075367_10168207 Ga0075367_101682072 162
342 3300006844 Ga0075428_101249534 Ga0075428_1012495341 162
343 3300006847 Ga0075431_100918088 Ga0075431_1009180881 162
344 3300006852 Ga0075433_10033900 Ga0075433_100339003 162
345 3300006852 Ga0075433_10683866 Ga0075433_106838662 162
346 3300006881 Ga0068865_100000082 Ga0068865_10000008226 162
347 3300006931 Ga0097620_100759148 Ga0097620_1007591482 162
348 3300007076 Ga0075435_100168077 Ga0075435_1001680772 162
349 3300009093 Ga0105240_10809020 Ga0105240_108090202 162
350 3300009098 Ga0105245_10000278 Ga0105245_100002788 162
351 3300009098 Ga0105245_10000415 Ga0105245_100004155 162
352 3300009098 Ga0105245_10001311 Ga0105245_1000131124 162
353 3300009098 Ga0105245_10173186 Ga0105245_101731862 162
354 3300009098 Ga0105245_10866650 Ga0105245_108666501 162
355 3300009101 Ga0105247_10001706 Ga0105247_1000170614 162
356 3300009101 Ga0105247_10174168 Ga0105247_101741682 162
357 3300009147 Ga0114129_10027328 Ga0114129_100273283 162
358 3300009147 Ga0114129_10119702 Ga0114129_101197023 162
359 3300009147 Ga0114129_11011700 Ga0114129_110117002 162
360 3300009148 Ga0105243_10007118 Ga0105243_1000711810 162
361 3300009148 Ga0105243_10165704 Ga0105243_101657042 162
362 3300009148 Ga0105243_10379698 Ga0105243_103796982 162
363 3300009148 Ga0105243_10530373 Ga0105243_105303732 162
364 3300009174 Ga0105241_10069956 Ga0105241_100699562 162
365 3300009176 Ga0105242_10000449 Ga0105242_100004493 162
366 3300009176 Ga0105242_10000653 Ga0105242_1000065318 162
367 3300009176 Ga0105242_10017935 Ga0105242_100179352 162
368 3300009176 Ga0105242_10308575 Ga0105242_103085752 162
369 3300009176 Ga0105242_10574937 Ga0105242_105749372 162
370 3300009176 Ga0105242_10775178 Ga0105242_107751782 162
371 3300009176 Ga0105242_12416894 Ga0105242_124168941 162
372 3300009177 Ga0105248_10000020 Ga0105248_10000020125 162
373 3300009177 Ga0105248_10305649 Ga0105248_103056492 162
374 3300009551 Ga0105238_10000055 Ga0105238_1000005518 162
375 3300009553 Ga0105249_10000143 Ga0105249_1000014373 162
376 3300009553 Ga0105249_10003360 Ga0105249_100033602 162
377 3300009553 Ga0105249_12663713 Ga0105249_126637131 162
378 3300010375 Ga0105239_10524755 Ga0105239_105247551 162
379 3300011119 Ga0105246_10709386 Ga0105246_107093862 162
380 3300011119 Ga0105246_11618017 Ga0105246_116180171 162
381 3300012483 Ga0157337_1013043 Ga0157337_10130432 162
382 3300013102 Ga0157371_10001577 Ga0157371_100015773 162
383 3300013102 Ga0157371_11288276 Ga0157371_112882761 162
384 3300013104 Ga0157370_10003254 Ga0157370_1000325415 162
385 3300013104 Ga0157370_10047400 Ga0157370_100474003 162
386 3300013104 Ga0157370_10629691 Ga0157370_106296912 162
387 3300013105 Ga0157369_10000074 Ga0157369_1000007427 162
388 3300013296 Ga0157374_10000486 Ga0157374_1000048618 162
389 3300013296 Ga0157374_10384590 Ga0157374_103845902 162
390 3300013296 Ga0157374_10669027 Ga0157374_106690272 162
391 3300013297 Ga0157378_10003241 Ga0157378_100032412 162
392 3300013297 Ga0157378_10040737 Ga0157378_100407373 162
393 3300013297 Ga0157378_10093937 Ga0157378_100939372 162
394 3300013297 Ga0157378_10978479 Ga0157378_109784791 162
395 3300013307 Ga0157372_10000053 Ga0157372_1000005328 162
396 3300013308 Ga0157375_10003797 Ga0157375_1000379711 162
397 3300013308 Ga0157375_13582365 Ga0157375_135823651 162
398 3300014325 Ga0163163_11167379 Ga0163163_111673792 162
399 3300014326 Ga0157380_10000016 Ga0157380_10000016100 162
400 3300014326 Ga0157380_10000236 Ga0157380_100002363 162
401 3300014968 Ga0157379_10148336 Ga0157379_101483363 162
402 3300014968 Ga0157379_10161252 Ga0157379_101612522 162
403 3300014968 Ga0157379_10417767 Ga0157379_104177672 162
404 3300014969 Ga0157376_10027214 Ga0157376_100272143 162
405 3300014969 Ga0157376_10074468 Ga0157376_100744683 162
406 3300017792 Ga0163161_10000053 Ga0163161_10000053122 162
407 3300017792 Ga0163161_10175041 Ga0163161_101750412 162
408 3300017792 Ga0163161_10286057 Ga0163161_102860572 162
409 3300017792 Ga0163161_10668428 Ga0163161_106684282 162
410 3300020070 Ga0206356_10868657 Ga0206356_108686571 162
411 3300020610 Ga0154015_1555886 Ga0154015_15558862 162
412 3300025321 Ga0207656_10000226 Ga0207656_1000022614 162
413 3300025321 Ga0207656_10027875 Ga0207656_100278752 162
414 3300025899 Ga0207642_10000080 Ga0207642_1000008015 162
415 3300025900 Ga0207710_10000157 Ga0207710_1000015767 162
416 3300025903 Ga0207680_10002942 Ga0207680_100029427 162
417 3300025903 Ga0207680_10056099 Ga0207680_100560993 162
418 3300025903 Ga0207680_10247229 Ga0207680_102472291 162
419 3300025905 Ga0207685_10000054 Ga0207685_1000005414 162
420 3300025905 Ga0207685_10070642 Ga0207685_100706422 162
421 3300025906 Ga0207699_10729075 Ga0207699_107290752 162
422 3300025911 Ga0207654_10057938 Ga0207654_100579382 162
423 3300025912 Ga0207707_10289153 Ga0207707_102891532 162
424 3300025912 Ga0207707_10708359 Ga0207707_107083591 162
425 3300025915 Ga0207693_10050125 Ga0207693_100501253 162
426 3300025915 Ga0207693_10103235 Ga0207693_101032352 162
427 3300025916 Ga0207663_10023302 Ga0207663_100233023 162
428 3300025916 Ga0207663_10245295 Ga0207663_102452952 162
429 3300025917 Ga0207660_10161370 Ga0207660_101613701 162
430 3300025920 Ga0207649_10000127 Ga0207649_1000012764 162
431 3300025920 Ga0207649_10591112 Ga0207649_105911122 162
432 3300025921 Ga0207652_10000321 Ga0207652_1000032138 162
433 3300025921 Ga0207652_10001733 Ga0207652_1000173310 162
434 3300025923 Ga0207681_10135411 Ga0207681_101354112 162
435 3300025924 Ga0207694_10000063 Ga0207694_10000063123 162
436 3300025926 Ga0207659_10000013 Ga0207659_1000001390 162
437 3300025927 Ga0207687_10000032 Ga0207687_1000003217 162
438 3300025927 Ga0207687_10000036 Ga0207687_10000036123 162
439 3300025927 Ga0207687_10000460 Ga0207687_100004602 162
440 3300025927 Ga0207687_10003112 Ga0207687_100031124 162
441 3300025928 Ga0207700_10000033 Ga0207700_1000003329 162
442 3300025929 Ga0207664_10112012 Ga0207664_101120122 162
443 3300025931 Ga0207644_10056710 Ga0207644_100567102 162
444 3300025932 Ga0207690_10074923 Ga0207690_100749232 162
445 3300025932 Ga0207690_10082969 Ga0207690_100829692 162
446 3300025933 Ga0207706_10000001 Ga0207706_10000001407 162
447 3300025933 Ga0207706_10270954 Ga0207706_102709542 162
448 3300025934 Ga0207686_10000097 Ga0207686_1000009713 162
449 3300025934 Ga0207686_10000921 Ga0207686_100009219 162
450 3300025934 Ga0207686_10019225 Ga0207686_100192252 162
451 3300025934 Ga0207686_10644370 Ga0207686_106443702 162
452 3300025935 Ga0207709_10023552 Ga0207709_100235524 162
453 3300025937 Ga0207669_10000017 Ga0207669_1000001716 162
454 3300025938 Ga0207704_10000184 Ga0207704_1000018420 162
455 3300025940 Ga0207691_10000017 Ga0207691_1000001727 162
456 3300025941 Ga0207711_10000006 Ga0207711_10000006251 162
457 3300025942 Ga0207689_10466253 Ga0207689_104662532 162
458 3300025944 Ga0207661_10002110 Ga0207661_1000211012 162
459 3300025944 Ga0207661_10004460 Ga0207661_100044602 162
460 3300025944 Ga0207661_10052819 Ga0207661_100528194 162
461 3300025944 Ga0207661_10337590 Ga0207661_103375902 162
462 3300025944 Ga0207661_10370703 Ga0207661_103707032 162
463 3300025945 Ga0207679_10045587 Ga0207679_100455873 162
464 3300025960 Ga0207651_10017969 Ga0207651_100179694 162
465 3300025961 Ga0207712_10000058 Ga0207712_10000058123 162
466 3300025972 Ga0207668_10036707 Ga0207668_100367072 162
467 3300025972 Ga0207668_10235463 Ga0207668_102354632 162
468 3300025981 Ga0207640_10000093 Ga0207640_1000009328 162
469 3300025981 Ga0207640_10034577 Ga0207640_100345772 162
470 3300025986 Ga0207658_10003551 Ga0207658_100035514 162
471 3300025986 Ga0207658_10018897 Ga0207658_100188972 162
472 3300025986 Ga0207658_10333568 Ga0207658_103335682 162
473 3300026023 Ga0207677_10001038 Ga0207677_1000103815 162
474 3300026023 Ga0207677_10006605 Ga0207677_100066052 162
475 3300026035 Ga0207703_10000061 Ga0207703_10000061131 162
476 3300026035 Ga0207703_10000385 Ga0207703_100003852 162
477 3300026035 Ga0207703_10236705 Ga0207703_102367052 162
478 3300026041 Ga0207639_10005999 Ga0207639_100059992 162
479 3300026041 Ga0207639_10058185 Ga0207639_100581852 162
480 3300026041 Ga0207639_10973510 Ga0207639_109735101 162
481 3300026067 Ga0207678_10002224 Ga0207678_100022246 162
482 3300026075 Ga0207708_10204711 Ga0207708_102047112 162
483 3300026075 Ga0207708_10227558 Ga0207708_102275582 162
484 3300026078 Ga0207702_10000637 Ga0207702_1000063718 162
485 3300026078 Ga0207702_10221539 Ga0207702_102215392 162
486 3300026088 Ga0207641_10000016 Ga0207641_10000016189 162
487 3300026088 Ga0207641_10007724 Ga0207641_100077242 162
488 3300026088 Ga0207641_10219771 Ga0207641_102197712 162
489 3300026088 Ga0207641_10416146 Ga0207641_104161461 162
490 3300026095 Ga0207676_10000018 Ga0207676_10000018104 162
491 3300026116 Ga0207674_10054549 Ga0207674_100545493 162
492 3300026118 Ga0207675_101617495 Ga0207675_1016174951 162
493 3300026121 Ga0207683_10132710 Ga0207683_101327102 162
494 3300026121 Ga0207683_10257607 Ga0207683_102576072 162
495 3300026121 Ga0207683_10331770 Ga0207683_103317702 162
496 3300026142 Ga0207698_10000004 Ga0207698_1000000439 162
497 3300026142 Ga0207698_10013220 Ga0207698_100132203 162
498 3300026142 Ga0207698_11932981 Ga0207698_119329811 162
499 3300028379 Ga0268266_10000056 Ga0268266_10000056169 162
500 3300028379 Ga0268266_10000601 Ga0268266_100006011 162
501 3300028379 Ga0268266_10001254 Ga0268266_1000125427 162
502 3300028379 Ga0268266_10006356 Ga0268266_100063562 162
503 3300028379 Ga0268266_10235712 Ga0268266_102357122 162
504 3300028381 Ga0268264_10016645 Ga0268264_100166455 162
505 3300028381 Ga0268264_10581070 Ga0268264_105810702 162
506 3300028556 Ga0265337_1000066 Ga0265337_100006618 162
507 3300028558 Ga0265326_10000019 Ga0265326_10000019138 162
508 3300028563 Ga0265319_1000469 Ga0265319_100046920 162
509 3300028653 Ga0265323_10102148 Ga0265323_101021482 162
510 3300028654 Ga0265322_10000011 Ga0265322_10000011138 162
511 3300028666 Ga0265336_10003168 Ga0265336_100031682 162
512 3300028800 Ga0265338_10000244 Ga0265338_1000024488 162
513 3300028800 Ga0265338_10282917 Ga0265338_102829172 162
514 3300029957 Ga0265324_10000283 Ga0265324_1000028320 162
515 3300029957 Ga0265324_10051394 Ga0265324_100513942 162
516 3300030521 Ga0307511_10082915 Ga0307511_100829152 162
517 3300031239 Ga0265328_10000737 Ga0265328_1000073717 162
518 3300031240 Ga0265320_10000011 Ga0265320_10000011138 162
519 3300031242 Ga0265329_10016232 Ga0265329_100162323 162
520 3300031250 Ga0265331_10000858 Ga0265331_1000085816 162
521 3300031250 Ga0265331_10047145 Ga0265331_100471452 162
522 3300031251 Ga0265327_10000015 Ga0265327_10000015246 162
523 3300031344 Ga0265316_10047188 Ga0265316_100471883 162
524 3300031344 Ga0265316_10538901 Ga0265316_105389012 162
525 3300031711 Ga0265314_10000640 Ga0265314_1000064039 162
526 3300031712 Ga0265342_10048932 Ga0265342_100489322 162
527 3300031731 Ga0307405_10491037 Ga0307405_104910371 162
528 3300031824 Ga0307413_10324320 Ga0307413_103243203 162
529 3300032002 Ga0307416_100007153 Ga0307416_1000071537 162
530 3300032126 Ga0307415_100023712 Ga0307415_1000237121 162
531 3300032133 Ga0316583_10045544 Ga0316583_100455442 162
532 3300035119 Ga0373956_0368746 Ga0373956_0368746_90_578 162
533 3300035120 Ga0373957_0098034 Ga0373957_0098034_347_835 162
534 3300035398 Ga0316574_0124337 Ga0316574_0124337_243_788 162
535 3300036401 Ga0373937_0053338 Ga0373937_0053338_2118_2606 162
536 3300036401 Ga0373937_0090584 Ga0373937_0090584_2216_2704 162
537 3300036401 Ga0373937_1027542 Ga0373937_1027542_25_513 162
538 3300036401 Ga0373937_1276367 Ga0373937_1276367_54_542 162
539 3300036712 Ga0316584_0001782 Ga0316584_0001782_2629_3174 162
540 3300037312 Ga0395899_0577093 Ga0395899_0577093_73_564 162
541 3300037418 Ga0395900_0165224 Ga0395900_0165224_993_1484 162
542 3300037418 Ga0395900_0753030 Ga0395900_0753030_288_788 162
543 3300037471 Ga0395905_0849876 Ga0395905_0849876_134_625 162
544 3300038443 Ga0395901_0179840 Ga0395901_0179840_455_955 162
545 3300038443 Ga0395901_0190166 Ga0395901_0190166_91_582 162
546 3300038443 Ga0395901_0369251 Ga0395901_0369251_716_1207 162
547 3300038443 Ga0395901_0563530 Ga0395901_0563530_320_808 162
548 3300041459 Ga0451800_0147095 Ga0451800_0147095_585_1079 162
549 3300041486 Ga0451807_1807140 Ga0451807_1807140_122_616 162
550 3300041496 Ga0451839_1143849 Ga0451839_1143849_546_1034 162
551 3300041501 Ga0451845_0708268 Ga0451845_0708268_337_825 162
552 3300041509 Ga0451843_0715326 Ga0451843_0715326_50_538 162
553 3300044694 Ga0466963_0000017 Ga0466963_0000017_22339_22827 162
554 3300044694 Ga0466963_0358016 Ga0466963_0358016_418_906 162
555 3300044735 Ga0466968_0401672 Ga0466968_0401672_92_586 162
556 3300044901 Ga0466960_0107322 Ga0466960_0107322_879_1367 162
557 3300044901 Ga0466960_0364103 Ga0466960_0364103_162_650 162
558 3300045836 Ga0466958_0010414 Ga0466958_0010414_64_552 162
559 3300045976 Ga0466967_0000001 Ga0466967_0000001_117690_118178 162
560 3300045976 Ga0466967_0089398 Ga0466967_0089398_1937_2425 162
561 3300045976 Ga0466967_0506338 Ga0466967_0506338_617_1105 162
562 3300046454 Ga0495592_0000607 Ga0495592_0000607_22123_22611 162
563 3300046454 Ga0495592_0128862 Ga0495592_0128862_801_1316 162
564 3300046454 Ga0495592_0141108 Ga0495592_0141108_768_1256 162
565 3300046454 Ga0495592_0217497 Ga0495592_0217497_128_616 162
566 3300046455 Ga0495603_0000286 Ga0495603_0000286_18903_19391 162
567 3300046455 Ga0495603_0001350 Ga0495603_0001350_11186_11677 162
568 3300046455 Ga0495603_0023918 Ga0495603_0023918_2605_3099 162
569 3300046458 Ga0495591_038251 Ga0495591_038251_402_890 162
570 3300046459 Ga0495629_0000245 Ga0495629_0000245_35636_36124 162
571 3300046459 Ga0495629_0004704 Ga0495629_0004704_8843_9331 162
572 3300046459 Ga0495629_0005286 Ga0495629_0005286_7247_7735 162
573 3300046459 Ga0495629_0079298 Ga0495629_0079298_148_639 162
574 3300046461 Ga0495641_0000005 Ga0495641_0000005_180948_181436 162
575 3300046461 Ga0495641_0014257 Ga0495641_0014257_3341_3829 162
576 3300046461 Ga0495641_0038618 Ga0495641_0038618_825_1313 162
577 3300046461 Ga0495641_0065442 Ga0495641_0065442_671_1159 162
578 3300046462 Ga0495651_0028208 Ga0495651_0028208_926_1414 162
579 3300046462 Ga0495651_0254350 Ga0495651_0254350_335_823 162
580 3300046462 Ga0495651_0388555 Ga0495651_0388555_404_892 162
581 3300046463 Ga0495653_0092883 Ga0495653_0092883_1110_1598 162
582 3300046473 Ga0495582_0000001 Ga0495582_0000001_74197_74685 162
583 3300046476 Ga0495662_0000001 Ga0495662_0000001_23595_24083 162
584 3300046476 Ga0495662_0000848 Ga0495662_0000848_11799_12287 162
585 3300046476 Ga0495662_0299230 Ga0495662_0299230_140_631 162
586 3300046477 Ga0495664_0801046 Ga0495664_0801046_10_501 162
587 3300046499 Ga0495594_0000089 Ga0495594_0000089_32272_32763 162
588 3300046507 Ga0495606_0000040 Ga0495606_0000040_49623_50111 162
589 3300046511 Ga0495608_0000007 Ga0495608_0000007_124939_125427 162
590 3300046511 Ga0495608_0003541 Ga0495608_0003541_10106_10594 162
591 3300046511 Ga0495608_0053168 Ga0495608_0053168_1583_2071 162
592 3300046511 Ga0495608_0094331 Ga0495608_0094331_224_712 162
593 3300046514 Ga0495618_0000014 Ga0495618_0000014_111127_111615 162
594 3300046515 Ga0495620_0000784 Ga0495620_0000784_3301_3789 162
595 3300046516 Ga0495628_0005372 Ga0495628_0005372_10340_10828 162
596 3300046516 Ga0495628_0023790 Ga0495628_0023790_1193_1681 162
597 3300046516 Ga0495628_0066303 Ga0495628_0066303_1169_1657 162
598 3300046516 Ga0495628_0074598 Ga0495628_0074598_390_878 162
599 3300046516 Ga0495628_0101305 Ga0495628_0101305_990_1478 162
600 3300046516 Ga0495628_0159293 Ga0495628_0159293_190_678 162
601 3300046516 Ga0495628_0240240 Ga0495628_0240240_22_510 162
602 3300046517 Ga0495630_0000014 Ga0495630_0000014_185291_185779 162
603 3300046517 Ga0495630_0000533 Ga0495630_0000533_5190_5678 162
604 3300046517 Ga0495630_0003407 Ga0495630_0003407_8050_8538 162
605 3300046517 Ga0495630_0219226 Ga0495630_0219226_657_1145 162
606 3300046519 Ga0495632_0167686 Ga0495632_0167686_31_519 162
607 3300046519 Ga0495632_0278678 Ga0495632_0278678_141_635 162
608 3300046520 Ga0495637_0229073 Ga0495637_0229073_129_617 162
609 3300046523 Ga0495644_0001871 Ga0495644_0001871_1315_1803 162
610 3300046529 Ga0495652_0000037 Ga0495652_0000037_19006_19494 162
611 3300046529 Ga0495652_0011995 Ga0495652_0011995_3512_4012 162
612 3300046529 Ga0495652_0329517 Ga0495652_0329517_376_867 162
613 3300046529 Ga0495652_0496417 Ga0495652_0496417_152_640 162
614 3300046533 Ga0495640_0024325 Ga0495640_0024325_3323_3811 162
615 3300046533 Ga0495640_0091728 Ga0495640_0091728_1310_1798 162
616 3300046533 Ga0495640_0202996 Ga0495640_0202996_458_949 162
617 3300046533 Ga0495640_0668817 Ga0495640_0668817_34_525 162
618 3300046535 Ga0495586_0003054 Ga0495586_0003054_7352_7840 162
619 3300046535 Ga0495586_0508235 Ga0495586_0508235_194_682 162
620 3300046536 Ga0495587_0003966 Ga0495587_0003966_1882_2370 162
621 3300046536 Ga0495587_0244258 Ga0495587_0244258_339_827 162
622 3300046536 Ga0495587_0245051 Ga0495587_0245051_419_910 162
623 3300046537 Ga0495598_0001582 Ga0495598_0001582_3285_3773 162
624 3300046539 Ga0495621_0033813 Ga0495621_0033813_496_984 162
625 3300046543 Ga0495645_0027447 Ga0495645_0027447_3610_4125 162
626 3300046543 Ga0495645_0166294 Ga0495645_0166294_931_1419 162
627 3300046543 Ga0495645_0310285 Ga0495645_0310285_445_945 162
628 3300046557 Ga0495622_0000080 Ga0495622_0000080_82555_83046 162
629 3300046558 Ga0495633_0294546 Ga0495633_0294546_226_714 162
630 3300046559 Ga0495667_0000020 Ga0495667_0000020_63677_64165 162
631 3300046615 Ga0495656_0000465 Ga0495656_0000465_5225_5713 162
632 3300046616 Ga0495668_0041252 Ga0495668_0041252_2060_2551 162
633 3300046642 Ga0495634_0000028 Ga0495634_0000028_6970_7458 162
634 3300046642 Ga0495634_0001744 Ga0495634_0001744_10124_10615 162
635 3300046642 Ga0495634_0182420 Ga0495634_0182420_606_1094 162
636 3300046642 Ga0495634_0324706 Ga0495634_0324706_149_637 162
637 3300046642 Ga0495634_0368028 Ga0495634_0368028_66_554 162
638 3300046642 Ga0495634_0369367 Ga0495634_0369367_13_501 162
639 3300046660 Ga0495625_0000349 Ga0495625_0000349_50972_51469 162
640 3300046660 Ga0495625_0076676 Ga0495625_0076676_289_777 162
641 3300046663 Ga0495635_0000076 Ga0495635_0000076_2937_3425 162
642 3300046663 Ga0495635_0034289 Ga0495635_0034289_2556_3044 162
643 3300046663 Ga0495635_0379265 Ga0495635_0379265_270_758 162
644 3300046674 Ga0495588_0000362 Ga0495588_0000362_17380_17868 162
645 3300046675 Ga0495657_0000001 Ga0495657_0000001_257085_257573 162
646 3300046675 Ga0495657_0017364 Ga0495657_0017364_2420_2908 162
647 3300046675 Ga0495657_0218471 Ga0495657_0218471_268_756 162
648 3300046678 Ga0495599_0036072 Ga0495599_0036072_1577_2065 162
649 3300046678 Ga0495599_0668254 Ga0495599_0668254_15_515 162
650 3300046679 Ga0495623_0055970 Ga0495623_0055970_978_1466 162
651 3300046679 Ga0495623_0124236 Ga0495623_0124236_890_1390 162
652 3300046680 Ga0495646_0201490 Ga0495646_0201490_221_721 162
653 3300046681 Ga0495647_0000001 Ga0495647_0000001_106566_107054 162
654 3300046681 Ga0495647_0005148 Ga0495647_0005148_1382_1870 162
655 3300046683 Ga0495658_0000002 Ga0495658_0000002_197803_198291 162
656 3300046683 Ga0495658_0019725 Ga0495658_0019725_1856_2344 162
657 3300046683 Ga0495658_0122526 Ga0495658_0122526_341_832 162
658 3300046684 Ga0495669_0000113 Ga0495669_0000113_28761_29249 162
659 3300046689 Ga0495613_0000005 Ga0495613_0000005_104476_104964 162
660 3300046689 Ga0495613_0000041 Ga0495613_0000041_57870_58358 162
661 3300046689 Ga0495613_0140545 Ga0495613_0140545_1043_1531 162
662 3300046689 Ga0495613_0220715 Ga0495613_0220715_819_1310 162
663 3300046690 Ga0495624_0000019 Ga0495624_0000019_100624_101112 162
664 3300046690 Ga0495624_0000417 Ga0495624_0000417_19899_20387 162
665 3300046690 Ga0495624_0033290 Ga0495624_0033290_1898_2386 162
666 3300046690 Ga0495624_0372530 Ga0495624_0372530_329_817 162
667 3300046691 Ga0495670_0020649 Ga0495670_0020649_1743_2231 162
668 3300046694 Ga0495649_0002403 Ga0495649_0002403_5183_5671 162
669 3300046809 Ga0495600_0011717 Ga0495600_0011717_4856_5344 162
670 3300046809 Ga0495600_0034654 Ga0495600_0034654_82_570 162
671 3300047315 Ga0495581_0147758 Ga0495581_0147758_335_823 162
672 3300047317 Ga0495604_0000239 Ga0495604_0000239_7593_8081 162
673 3300047317 Ga0495604_0001251 Ga0495604_0001251_7623_8120 162
674 3300047317 Ga0495604_0003401 Ga0495604_0003401_11682_12170 162
675 3300047317 Ga0495604_0190723 Ga0495604_0190723_22_510 162
676 3300047319 Ga0495674_0000030 Ga0495674_0000030_9458_9946 162
677 3300047319 Ga0495674_0639066 Ga0495674_0639066_315_803 162
678 3300047320 Ga0495672_0148694 Ga0495672_0148694_109_606 162
679 3300047321 Ga0495676_0001461 Ga0495676_0001461_19316_19804 162
680 3300047321 Ga0495676_0012579 Ga0495676_0012579_4895_5383 162
681 3300047321 Ga0495676_0085869 Ga0495676_0085869_452_940 162
682 3300047322 Ga0495680_0000143 Ga0495680_0000143_8568_9056 162
683 3300047322 Ga0495680_0001430 Ga0495680_0001430_3515_4012 162
684 3300047322 Ga0495680_0039154 Ga0495680_0039154_3025_3513 162
685 3300047322 Ga0495680_0188089 Ga0495680_0188089_658_1146 162
686 3300047444 Ga0495675_0001421 Ga0495675_0001421_8714_9202 162
687 3300047444 Ga0495675_0008742 Ga0495675_0008742_5574_6062 162
688 3300047446 Ga0495679_007662 Ga0495679_007662_463_951 162
689 3300047471 Ga0495684_0087952 Ga0495684_0087952_1495_1983 162
690 3300047673 Ga0495593_0039645 Ga0495593_0039645_1764_2252 162
691 3300047673 Ga0495593_0057583 Ga0495593_0057583_333_821 162
692 3300048088 Ga0495602_0000007 Ga0495602_0000007_148150_148638 162
693 3300048088 Ga0495602_0001031 Ga0495602_0001031_17569_18057 162
694 3300048088 Ga0495602_0151755 Ga0495602_0151755_1113_1601 162
695 3300048088 Ga0495602_0912922 Ga0495602_0912922_65_565 162
696 3300048903 Ga0496100_0000013 Ga0496100_0000013_62277_62765 162
697 3300048903 Ga0496100_0434207 Ga0496100_0434207_324_830 162
698 3300048904 Ga0496101_0000035 Ga0496101_0000035_62277_62765 162
699 3300048905 Ga0496102_0000211 Ga0496102_0000211_6881_7369 162
700 3300048905 Ga0496102_0010565 Ga0496102_0010565_2520_3014 162
701 3300048905 Ga0496102_0058720 Ga0496102_0058720_761_1315 162
702 3300048905 Ga0496102_0190210 Ga0496102_0190210_696_1193 162
703 3300048905 Ga0496102_0630218 Ga0496102_0630218_245_739 162
704 3300048906 Ga0496103_0000083 Ga0496103_0000083_44361_44849 162
705 3300048906 Ga0496103_0077061 Ga0496103_0077061_1488_1982 162
706 3300048906 Ga0496103_0093172 Ga0496103_0093172_115_609 162
707 3300048907 Ga0496104_0000015 Ga0496104_0000015_256761_257249 162
708 3300048907 Ga0496104_0000052 Ga0496104_0000052_26260_26748 162
709 3300048907 Ga0496104_0000765 Ga0496104_0000765_24083_24574 162
710 3300048907 Ga0496104_0875618 Ga0496104_0875618_53_541 162
711 3300048908 Ga0496105_0000004 Ga0496105_0000004_218550_219038 162
712 3300048908 Ga0496105_0000030 Ga0496105_0000030_110578_111066 162
713 3300048908 Ga0496105_0000409 Ga0496105_0000409_11223_11714 162
714 3300048908 Ga0496105_0958289 Ga0496105_0958289_138_626 162
715 3300048909 Ga0496106_0000121 Ga0496106_0000121_32178_32666 162
716 3300048909 Ga0496106_0004512 Ga0496106_0004512_9083_9571 162
717 3300048910 Ga0496107_0000020 Ga0496107_0000020_33426_33914 162
718 3300048910 Ga0496107_0076122 Ga0496107_0076122_143_631 162
719 3300048911 Ga0496108_0000006 Ga0496108_0000006_345647_346135 162
720 3300048911 Ga0496108_0000063 Ga0496108_0000063_86679_87167 162
721 3300048911 Ga0496108_0003280 Ga0496108_0003280_7494_7982 162
722 3300048911 Ga0496108_0009033 Ga0496108_0009033_262_750 162
723 3300048911 Ga0496108_0245749 Ga0496108_0245749_1031_1519 162
724 3300048911 Ga0496108_0951643 Ga0496108_0951643_115_606 162
725 3300048912 Ga0496109_0000009 Ga0496109_0000009_112735_113223 162
726 3300048912 Ga0496109_0000012 Ga0496109_0000012_25580_26068 162
727 3300048912 Ga0496109_0000348 Ga0496109_0000348_27139_27627 162
728 3300048912 Ga0496109_0003361 Ga0496109_0003361_7383_7871 162
729 3300048912 Ga0496109_0300150 Ga0496109_0300150_681_1169 162
730 3300048912 Ga0496109_0392613 Ga0496109_0392613_490_981 162
731 3300048912 Ga0496109_1152084 Ga0496109_1152084_119_616 162
732 3300048913 Ga0496110_0002164 Ga0496110_0002164_5710_6198 162
733 3300048913 Ga0496110_0047750 Ga0496110_0047750_804_1301 162
734 3300048913 Ga0496110_0246364 Ga0496110_0246364_150_638 162
735 3300048913 Ga0496110_0334165 Ga0496110_0334165_274_762 162
736 3300048914 Ga0496111_0000044 Ga0496111_0000044_29636_30124 162
737 3300048914 Ga0496111_0070059 Ga0496111_0070059_1302_1799 162
738 3300048914 Ga0496111_0125916 Ga0496111_0125916_1175_1663 162
739 3300048914 Ga0496111_0409868 Ga0496111_0409868_207_695 162
740 3300048914 Ga0496111_0506888 Ga0496111_0506888_28_516 162
741 3300048915 Ga0496112_0000025 Ga0496112_0000025_113554_114042 162
742 3300048915 Ga0496112_0030187 Ga0496112_0030187_1097_1585 162
743 3300048915 Ga0496112_0226918 Ga0496112_0226918_854_1351 162
744 3300048916 Ga0496113_0000013 Ga0496113_0000013_24882_25370 162
745 3300048916 Ga0496113_0004814 Ga0496113_0004814_7731_8219 162
746 3300048916 Ga0496113_0038089 Ga0496113_0038089_392_880 162
747 3300048916 Ga0496113_0180000 Ga0496113_0180000_464_961 162
748 3300048917 Ga0496114_0000039 Ga0496114_0000039_26898_27386 162
749 3300048917 Ga0496114_0221118 Ga0496114_0221118_529_1017 162
750 3300048917 Ga0496114_0784039 Ga0496114_0784039_29_517 162
751 3300048918 Ga0496115_0000377 Ga0496115_0000377_20727_21215 162
752 3300048918 Ga0496115_0187433 Ga0496115_0187433_1119_1607 162
753 3300048919 Ga0496116_0000848 Ga0496116_0000848_9182_9676 162
754 3300048920 Ga0496117_0009784 Ga0496117_0009784_4579_5073 162
755 3300048921 Ga0496118_0002916 Ga0496118_0002916_20925_21419 162
756 3300048921 Ga0496118_0304351 Ga0496118_0304351_325_819 162
757 3300048922 Ga0496119_0011619 Ga0496119_0011619_6210_6704 162
758 3300048923 Ga0496120_0024368 Ga0496120_0024368_1870_2358 162
759 3300048923 Ga0496120_0049634 Ga0496120_0049634_601_1095 162
760 3300048927 Ga0496124_0264727 Ga0496124_0264727_295_783 162
761 3300048928 Ga0496125_0117153 Ga0496125_0117153_1059_1547 162
762 3300048929 Ga0496126_0019594 Ga0496126_0019594_2056_2550 162
763 3300049568 Ga0501031_0002175 Ga0501031_0002175_7536_8030 162
764 3300049568 Ga0501031_0163107 Ga0501031_0163107_730_1227 162
765 3300049569 Ga0501032_0011222 Ga0501032_0011222_4476_4970 162
766 3300049569 Ga0501032_0672158 Ga0501032_0672158_23_517 162
767 3300049570 Ga0501033_0003689 Ga0501033_0003689_7527_8021 162
768 3300049571 Ga0501034_0307172 Ga0501034_0307172_981_1475 162
769 3300049572 Ga0501036_0020032 Ga0501036_0020032_733_1227 162
770 3300049573 Ga0501037_0002926 Ga0501037_0002926_7536_8030 162
771 3300049574 Ga0501038_0005058 Ga0501038_0005058_7536_8030 162
772 3300049574 Ga0501038_1175658 Ga0501038_1175658_15_503 162
773 3300049575 Ga0501039_0095570 Ga0501039_0095570_1351_1848 162
774 3300049575 Ga0501039_0216094 Ga0501039_0216094_379_873 162
775 3300049575 Ga0501039_0227319 Ga0501039_0227319_285_773 162
776 3300049576 Ga0501040_0125576 Ga0501040_0125576_689_1183 162
777 3300049578 Ga0501042_0012872 Ga0501042_0012872_132_626 162
778 3300049578 Ga0501042_0061274 Ga0501042_0061274_2104_2601 162
779 3300049578 Ga0501042_0084546 Ga0501042_0084546_1434_1922 162
780 3300049578 Ga0501042_0313241 Ga0501042_0313241_509_997 162
781 3300049578 Ga0501042_0411606 Ga0501042_0411606_231_719 162
782 3300049579 Ga0501043_0016009 Ga0501043_0016009_4404_4898 162
783 3300049579 Ga0501043_1140393 Ga0501043_1140393_25_519 162
784 3300049580 Ga0501046_0004559 Ga0501046_0004559_4530_5024 162
785 3300049580 Ga0501046_0393039 Ga0501046_0393039_208_702 162
786 3300049580 Ga0501046_0571571 Ga0501046_0571571_40_528 162
787 3300049581 Ga0501047_0004952 Ga0501047_0004952_4481_4975 162
788 3300049581 Ga0501047_0010850 Ga0501047_0010850_6259_6753 162
789 3300049581 Ga0501047_0176579 Ga0501047_0176579_163_657 162
790 3300049581 Ga0501047_0780742 Ga0501047_0780742_224_718 162
791 3300049581 Ga0501047_1161499 Ga0501047_1161499_80_574 162
792 3300049582 Ga0501048_0003128 Ga0501048_0003128_4407_4901 162
793 3300049582 Ga0501048_0248226 Ga0501048_0248226_441_935 162
794 3300049582 Ga0501048_0506283 Ga0501048_0506283_330_818 162
795 3300049584 Ga0501068_0002345 Ga0501068_0002345_1412_1906 162
796 3300049584 Ga0501068_0463372 Ga0501068_0463372_297_785 162
797 3300049585 Ga0501069_0014849 Ga0501069_0014849_479_973 162
798 3300049586 Ga0501070_0004064 Ga0501070_0004064_4546_5040 162
799 3300049586 Ga0501070_0048441 Ga0501070_0048441_2167_2655 162
800 3300049586 Ga0501070_0570055 Ga0501070_0570055_131_619 162
801 3300049587 Ga0501071_0005888 Ga0501071_0005888_364_858 162
802 3300049587 Ga0501071_0209651 Ga0501071_0209651_652_1149 162
803 3300049587 Ga0501071_0297987 Ga0501071_0297987_210_701 162
804 3300049587 Ga0501071_0967896 Ga0501071_0967896_130_624 162
805 3300049587 Ga0501071_1139292 Ga0501071_1139292_96_587 162
806 3300049588 Ga0501072_0017464 Ga0501072_0017464_1632_2126 162
807 3300049588 Ga0501072_0030329 Ga0501072_0030329_3243_3740 162
808 3300049588 Ga0501072_0052302 Ga0501072_0052302_571_1068 162
809 3300049588 Ga0501072_0166082 Ga0501072_0166082_612_1100 162
810 3300049589 Ga0501073_0012127 Ga0501073_0012127_4252_4746 162
811 3300049589 Ga0501073_0336398 Ga0501073_0336398_437_931 162
812 3300049590 Ga0501074_0018921 Ga0501074_0018921_3689_4183 162
813 3300049590 Ga0501074_0257323 Ga0501074_0257323_676_1170 162
814 3300049590 Ga0501074_1137397 Ga0501074_1137397_46_534 162
815 3300049591 Ga0501075_0034272 Ga0501075_0034272_1864_2361 162
816 3300049591 Ga0501075_0054219 Ga0501075_0054219_591_1079 162
817 3300049591 Ga0501075_0082710 Ga0501075_0082710_206_697 162
818 3300049592 Ga0501076_0029982 Ga0501076_0029982_429_917 162
819 3300049592 Ga0501076_0046698 Ga0501076_0046698_198_698 162
820 3300049741 Ga0501079_0073179 Ga0501079_0073179_1900_2397 162
821 3300049741 Ga0501079_0080440 Ga0501079_0080440_827_1321 162
822 3300049741 Ga0501079_0087220 Ga0501079_0087220_624_1121 162
823 3300049742 Ga0501080_0030783 Ga0501080_0030783_4474_4968 162
824 3300049742 Ga0501080_0097730 Ga0501080_0097730_1914_2408 162
825 3300049742 Ga0501080_0549464 Ga0501080_0549464_95_583 162
826 3300049742 Ga0501080_0906253 Ga0501080_0906253_106_600 162
827 3300049743 Ga0501081_0068435 Ga0501081_0068435_930_1427 162
828 3300049743 Ga0501081_0086273 Ga0501081_0086273_105_602 162
829 3300049744 Ga0501083_0002614 Ga0501083_0002614_4383_4877 162
830 3300049744 Ga0501083_0003895 Ga0501083_0003895_6667_7161 162
831 3300049744 Ga0501083_0036093 Ga0501083_0036093_2573_3067 162
832 3300049822 Ga0501035_0005116 Ga0501035_0005116_4391_4885 162
833 3300049823 Ga0501044_0006919 Ga0501044_0006919_4454_4948 162
834 3300049823 Ga0501044_0034851 Ga0501044_0034851_3875_4369 162
835 3300049824 Ga0501045_0098388 Ga0501045_0098388_1093_1590 162
836 3300049824 Ga0501045_0133474 Ga0501045_0133474_342_830 162
837 3300049824 Ga0501045_0845346 Ga0501045_0845346_29_526 162
838 3300049824 Ga0501045_1221339 Ga0501045_1221339_32_520 162
839 3300050491 nmdc:mga00v17_108157_c1 nmdc:mga00v17_108157_c1_649_1143 162
840 3300050491 nmdc:mga00v17_177051_c1 nmdc:mga00v17_177051_c1_248_757 162
841 3300050491 nmdc:mga00v17_497475_c1 nmdc:mga00v17_497475_c1_231_722 162
842 3300050491 nmdc:mga00v17_51630_c2 nmdc:mga00v17_51630_c2_154_672 162
843 3300050492 nmdc:mga0yw44_142103_c1 nmdc:mga0yw44_142103_c1_919_1413 162
844 3300050492 nmdc:mga0yw44_320642_c1 nmdc:mga0yw44_320642_c1_251_760 162
845 3300050492 nmdc:mga0yw44_623492_c1 nmdc:mga0yw44_623492_c1_125_619 162
846 3300050492 nmdc:mga0yw44_81412_c1 nmdc:mga0yw44_81412_c1_1419_1928 162
847 3300050507 nmdc:mga05p37_220296_c1 nmdc:mga05p37_220296_c1_945_1442 162
848 3300050507 nmdc:mga05p37_611014_c1 nmdc:mga05p37_611014_c1_72_569 162
849 3300050513 nmdc:mga0rr50_379733_c1 nmdc:mga0rr50_379733_c1_313_810 162
850 3300050514 nmdc:mga08x19_853142_c1 nmdc:mga08x19_853142_c1_102_608 162
851 3300050515 nmdc:mga0a205_138769_c1 nmdc:mga0a205_138769_c1_775_1281 162
852 3300050515 nmdc:mga0a205_43_c1 nmdc:mga0a205_43_c1_43866_44354 162
853 3300053077 Ga0495601_0000060 Ga0495601_0000060_28927_29415 162
854 3300053077 Ga0495601_0000165 Ga0495601_0000165_12625_13113 162
855 3300053077 Ga0495601_0025379 Ga0495601_0025379_1411_1899 162
856 3300053077 Ga0495601_0057074 Ga0495601_0057074_1081_1569 162
857 3300053077 Ga0495601_0234552 Ga0495601_0234552_495_983 162
858 3300053077 Ga0495601_0719291 Ga0495601_0719291_88_576 162
859 3300053078 Ga0495612_0000210 Ga0495612_0000210_10391_10879 162
860 3300053078 Ga0495612_0003484 Ga0495612_0003484_4687_5175 162
861 3300053078 Ga0495612_0049530 Ga0495612_0049530_1053_1541 162
862 3300053078 Ga0495612_0049786 Ga0495612_0049786_832_1320 162
863 3300053083 Ga0495655_0000002 Ga0495655_0000002_197132_197620 162
864 3300053083 Ga0495655_0001463 Ga0495655_0001463_370_858 162
865 3300053084 Ga0495595_0000002 Ga0495595_0000002_188069_188557 162
866 3300053084 Ga0495595_0000045 Ga0495595_0000045_25020_25508 162
867 3300053085 Ga0495619_0000008 Ga0495619_0000008_189731_190219 162
868 3300053085 Ga0495619_0000095 Ga0495619_0000095_5309_5797 162
869 3300053085 Ga0495619_0000102 Ga0495619_0000102_45553_46041 162
870 3300053085 Ga0495619_0000155 Ga0495619_0000155_38674_39165 162
871 3300053085 Ga0495619_0000195 Ga0495619_0000195_1312_1800 162
872 3300053085 Ga0495619_0000320 Ga0495619_0000320_12512_13000 162
873 3300053085 Ga0495619_0053306 Ga0495619_0053306_597_1085 162
874 3300053085 Ga0495619_0742263 Ga0495619_0742263_44_532 162
875 3300053094 Ga0500566_0001093 Ga0500566_0001093_6703_7191 162
876 3300053102 Ga0500554_236769 Ga0500554_236769_55_555 162
877 3300053129 Ga0500628_000001 Ga0500628_000001_285801_286289 162
878 3300054114 Ga0501084_0005040 Ga0501084_0005040_4509_5006 162
879 3300054114 Ga0501084_0156761 Ga0501084_0156761_25_519 162
880 3300060353 Ga0501082_0450607 Ga0501082_0450607_295_783 162
881 3300060353 Ga0501082_1182950 Ga0501082_1182950_95_589 162
882 3300061734 Ga0530510_0010891 Ga0530510_0010891_2020_2517 162
883 3300061734 Ga0530510_0019997 Ga0530510_0019997_861_1358 162
884 3300061734 Ga0530510_0355097 Ga0530510_0355097_417_914 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

58

155

0.94

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

38

152

0.78

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

47

158

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_C crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8923 25 159
6af2-assembly1.cif.gz_B-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8911 25 159
6af2-assembly1.cif.gz_A crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.887 36 159
3wo5-assembly1.cif.gz_A-2 crystal structure of s147q of rv2613c from mycobacterium tuberculosis 0.8827 25 159
3ano-assembly1.cif.gz_A-2 crystal structure of a novel diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase from mycobacterium tuberculosis h37rv 0.8722 25 159
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9023 39 130 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8828 41 132 3.30.428.10
3wo5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8827 25 159 3.30.428.10
af_A0A1D8PKG2_1_175_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8725 41 134 3.30.428.10
af_Q10946_226_350_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8577 38 132 3.30.428.10
ID Description Score Start End GO Terms
AF-X1E0D2-F1-model_v4 HIT domain-containing protein 0.9121 25 131 GO:0000166
GO:0003824
AF-A0A4Y8WZ11-F1-model_v4 deleted 0.9009 22 159
AF-A0A0U5AXF4-F1-model_v4 AP-4-A phosphorylase (EC 2.7.7.53) 0.9007 41 134 GO:0003877
AF-A0A2W0BB21-F1-model_v4 HIT family hydrolase 0.9002 26 161 GO:0000166
GO:0016787
AF-X1AW32-F1-model_v4 HIT domain-containing protein 0.8994 24 162 GO:0000166
GO:0003824

Feature Viewer

pLDDT pTM Quality
80.11 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map