F484608
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 883 | 338 | 862 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300049823|Ga0501044_0007419|Ga0501044_0007419_2278_2724 |
| Length | 143 |
| Sequence | MHARPEGIDLAARSRARRRALQALYAWQLSGSHMNAVIEQFRHEQDMEVADLEYFEDLLHGVEKHVAELDALLRPYLDREPIERAALRLAAYELKHRPDVPYRVVINEAIEVTKRFGADHGHSYVNGVLDKLAGQLRSTEKRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 2 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 3 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 4 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 5 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 6 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 7 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 8 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 9 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 10 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 11 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 12 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 13 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 14 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 15 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 16 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 17 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 18 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 19 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 20 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 21 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 22 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 23 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 27 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 28 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 29 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 30 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 31 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 32 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 33 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 34 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 35 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 36 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 37 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 38 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 39 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 109 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 203 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 216 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 217 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 224 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 225 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 226 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 227 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 228 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 229 | 3300044662 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E | Metagenome | Unclassified |
| 230 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 231 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 232 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 239 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 240 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 241 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 242 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 293 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 294 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 295 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 296 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 297 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 298 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 299 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 300 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 301 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 331 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 332 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 333 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 334 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 335 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.7 |
| Metatranscriptomes | 1.93 |
| Isolates | 2.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.89 |
| Nodule | 0 |
| Rhizoplane | 3.06 |
| Rhizosphere | 72.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1039259 | 3300001904 | Bacteria | 728 |
| 2 | JGI24741J21665_1002334 | 3300001915 | Bacteria | 4974 |
| 3 | JGI24741J21665_1002712 | 3300001915 | Bacteria | 4500 |
| 4 | JGI24740J21852_10000701 | 3300001979 | Bacteria | 14520 |
| 5 | JGI24739J22299_10009804 | 3300001989 | Bacteria | 3561 |
| 6 | JGI24737J22298_10026518 | 3300001990 | Bacteria | 1829 |
| 7 | JGI24737J22298_10081336 | 3300001990 | Bacteria | 964 |
| 8 | JGI24735J21928_10004013 | 3300002067 | Bacteria | 4980 |
| 9 | JGI24735J21928_10014324 | 3300002067 | Bacteria | 2485 |
| 10 | JGI24735J21928_10201559 | 3300002067 | Bacteria | 577 |
| 11 | JGI24738J21930_10015494 | 3300002075 | Bacteria | 1620 |
| 12 | JGI25162J39368_1001457 | 3300002737 | Bacteria | 12519 |
| 13 | JGI25162J39368_1002014 | 3300002737 | Bacteria | 9022 |
| 14 | JGI25162J39368_1004214 | 3300002737 | Bacteria | 3489 |
| 15 | JGI25162J39368_1010547 | 3300002737 | Bacteria | 1161 |
| 16 | JGI25154J39366_1007917 | 3300002738 | Bacteria | 1412 |
| 17 | JGI25154J39366_1008133 | 3300002738 | Bacteria | 1375 |
| 18 | JGI25154J39366_1014669 | 3300002738 | Bacteria | 821 |
| 19 | JGI25157J39369_1000224 | 3300002741 | Bacteria | 44715 |
| 20 | JGI25157J39369_1001100 | 3300002741 | Bacteria | 12060 |
| 21 | JGI25157J39369_1002245 | 3300002741 | Bacteria | 5204 |
| 22 | JGI25157J39369_1003667 | 3300002741 | Bacteria | 3041 |
| 23 | JGI25157J39369_1008184 | 3300002741 | Bacteria | 1466 |
| 24 | JGI25157J39369_1021350 | 3300002741 | Bacteria | 770 |
| 25 | JGI25163J39215_1001252 | 3300002771 | Bacteria | 4647 |
| 26 | JGI25164J39214_1000164 | 3300002772 | Bacteria | 62780 |
| 27 | JGI25164J39214_1002054 | 3300002772 | Bacteria | 3491 |
| 28 | JGI25164J39214_1006974 | 3300002772 | Bacteria | 1164 |
| 29 | JGI25165J46597_1000317 | 3300003214 | Bacteria | 58133 |
| 30 | JGI25165J46597_1001472 | 3300003214 | Bacteria | 12233 |
| 31 | JGI25165J46597_1012862 | 3300003214 | Bacteria | 1161 |
| 32 | JGI25165J46597_1030791 | 3300003214 | Bacteria | 692 |
| 33 | JGI25153J46596_10018510 | 3300003215 | Bacteria | 2702 |
| 34 | rootH2_10011924 | 3300003320 | Bacteria | 18770 |
| 35 | Ga0006554J51385_1041028 | 3300003567 | Bacteria | 976 |
| 36 | Ga0006562J51391_1031326 | 3300003578 | Bacteria | 7320 |
| 37 | Ga0006562J51391_1042664 | 3300003578 | Bacteria | 8710 |
| 38 | Ga0006562J51391_1042669 | 3300003578 | Bacteria | 3710 |
| 39 | Ga0055533_1002210 | 3300003756 | Bacteria | 4593 |
| 40 | Ga0055533_1005210 | 3300003756 | Bacteria | 2139 |
| 41 | Ga0055533_1006131 | 3300003756 | Bacteria | 1818 |
| 42 | Ga0055525_1000055 | 3300003759 | Bacteria | 215181 |
| 43 | Ga0055527_1000116 | 3300003760 | Bacteria | 57355 |
| 44 | Ga0055527_1000210 | 3300003760 | Bacteria | 37874 |
| 45 | Ga0055535_1000296 | 3300003761 | Bacteria | 51261 |
| 46 | Ga0055535_1000454 | 3300003761 | Bacteria | 37846 |
| 47 | Ga0055535_1001071 | 3300003761 | Bacteria | 16846 |
| 48 | Ga0055535_1001444 | 3300003761 | Bacteria | 12063 |
| 49 | Ga0055535_1002833 | 3300003761 | Bacteria | 5481 |
| 50 | Ga0055542_1000056 | 3300003762 | Bacteria | 167483 |
| 51 | Ga0055542_1000263 | 3300003762 | Bacteria | 58594 |
| 52 | Ga0055542_1000277 | 3300003762 | Bacteria | 57355 |
| 53 | Ga0055542_1000468 | 3300003762 | Bacteria | 37874 |
| 54 | Ga0055542_1000620 | 3300003762 | Bacteria | 30079 |
| 55 | Ga0055542_1004324 | 3300003762 | Bacteria | 3489 |
| 56 | Ga0055542_1028233 | 3300003762 | Bacteria | 741 |
| 57 | Ga0055529_1000253 | 3300003763 | Bacteria | 64782 |
| 58 | Ga0055529_1000298 | 3300003763 | Bacteria | 57355 |
| 59 | Ga0055529_1000479 | 3300003763 | Bacteria | 37884 |
| 60 | Ga0055529_1001107 | 3300003763 | Bacteria | 12033 |
| 61 | Ga0055529_1003276 | 3300003763 | Bacteria | 2735 |
| 62 | Ga0055543_1007681 | 3300004625 | Bacteria | 2464 |
| 63 | Ga0065165_1000108 | 3300005262 | Bacteria | 139605 |
| 64 | Ga0065165_1005855 | 3300005262 | Bacteria | 6689 |
| 65 | Ga0070658_10001565 | 3300005327 | Bacteria | 19405 |
| 66 | Ga0070658_10118601 | 3300005327 | Bacteria | 2197 |
| 67 | Ga0070658_10523744 | 3300005327 | Bacteria | 1025 |
| 68 | Ga0070658_10550404 | 3300005327 | Bacteria | 998 |
| 69 | Ga0070658_10614628 | 3300005327 | Bacteria | 942 |
| 70 | Ga0070683_100127162 | 3300005329 | Bacteria | 2409 |
| 71 | Ga0070683_100142437 | 3300005329 | Bacteria | 2271 |
| 72 | Ga0070683_100174384 | 3300005329 | Bacteria | 2041 |
| 73 | Ga0070690_100202766 | 3300005330 | Bacteria | 1381 |
| 74 | Ga0070690_100345793 | 3300005330 | Bacteria | 1078 |
| 75 | Ga0070670_100009171 | 3300005331 | Bacteria | 8458 |
| 76 | Ga0070670_100265733 | 3300005331 | Bacteria | 1496 |
| 77 | Ga0070666_10000037 | 3300005335 | Bacteria | 116528 |
| 78 | Ga0070666_10000487 | 3300005335 | Bacteria | 23992 |
| 79 | Ga0070666_10007269 | 3300005335 | Bacteria | 6828 |
| 80 | Ga0070680_100097990 | 3300005336 | Bacteria | 2431 |
| 81 | Ga0070680_100460938 | 3300005336 | Bacteria | 1086 |
| 82 | Ga0070682_100176722 | 3300005337 | Bacteria | 1488 |
| 83 | Ga0068868_100058111 | 3300005338 | Bacteria | 3056 |
| 84 | Ga0070660_100247365 | 3300005339 | Bacteria | 1453 |
| 85 | Ga0070660_100373620 | 3300005339 | Bacteria | 1176 |
| 86 | Ga0070660_100648008 | 3300005339 | Bacteria | 884 |
| 87 | Ga0070691_10032937 | 3300005341 | Bacteria | 2436 |
| 88 | Ga0070691_10533427 | 3300005341 | Bacteria | 683 |
| 89 | Ga0070661_100007367 | 3300005344 | Bacteria | 7588 |
| 90 | Ga0070661_100010149 | 3300005344 | Bacteria | 6540 |
| 91 | Ga0070661_100014442 | 3300005344 | Bacteria | 5566 |
| 92 | Ga0070661_100108677 | 3300005344 | Bacteria | 2069 |
| 93 | Ga0070661_100134943 | 3300005344 | Bacteria | 1856 |
| 94 | Ga0070661_100239179 | 3300005344 | Bacteria | 1397 |
| 95 | Ga0070661_100298248 | 3300005344 | Bacteria | 1254 |
| 96 | Ga0070692_10037193 | 3300005345 | Bacteria | 2473 |
| 97 | Ga0070692_10105382 | 3300005345 | Bacteria | 1552 |
| 98 | Ga0070668_100097591 | 3300005347 | Bacteria | 2324 |
| 99 | Ga0070671_100415382 | 3300005355 | Bacteria | 1152 |
| 100 | Ga0070688_100128609 | 3300005365 | Bacteria | 1706 |
| 101 | Ga0070659_100058492 | 3300005366 | Bacteria | 3042 |
| 102 | Ga0070667_100000072 | 3300005367 | Bacteria | 122929 |
| 103 | Ga0070667_100016061 | 3300005367 | Bacteria | 6193 |
| 104 | Ga0070667_100131582 | 3300005367 | Bacteria | 2184 |
| 105 | Ga0070667_100244360 | 3300005367 | Bacteria | 1603 |
| 106 | Ga0070667_100591501 | 3300005367 | Bacteria | 1022 |
| 107 | Ga0070714_100096930 | 3300005435 | Bacteria | 2592 |
| 108 | Ga0070713_100123179 | 3300005436 | Bacteria | 2276 |
| 109 | Ga0070711_100332269 | 3300005439 | Bacteria | 1217 |
| 110 | Ga0070708_100946346 | 3300005445 | Bacteria | 808 |
| 111 | Ga0070663_100005396 | 3300005455 | Bacteria | 7595 |
| 112 | Ga0070663_100028573 | 3300005455 | Bacteria | 3798 |
| 113 | Ga0070663_100039684 | 3300005455 | Bacteria | 3292 |
| 114 | Ga0070663_100072087 | 3300005455 | Bacteria | 2515 |
| 115 | Ga0070663_100110496 | 3300005455 | Bacteria | 2065 |
| 116 | Ga0070663_100287078 | 3300005455 | Bacteria | 1313 |
| 117 | Ga0070663_100372822 | 3300005455 | Bacteria | 1161 |
| 118 | Ga0070663_100649466 | 3300005455 | Bacteria | 892 |
| 119 | Ga0070663_100789579 | 3300005455 | Bacteria | 813 |
| 120 | Ga0070663_100868267 | 3300005455 | Bacteria | 777 |
| 121 | Ga0070678_100362546 | 3300005456 | Bacteria | 1249 |
| 122 | Ga0070681_10000151 | 3300005458 | Bacteria | 52829 |
| 123 | Ga0070681_10037306 | 3300005458 | Bacteria | 4878 |
| 124 | Ga0070681_10125600 | 3300005458 | Bacteria | 2498 |
| 125 | Ga0070681_10128599 | 3300005458 | Bacteria | 2465 |
| 126 | Ga0068867_100045587 | 3300005459 | Bacteria | 3217 |
| 127 | Ga0068867_101105138 | 3300005459 | Bacteria | 724 |
| 128 | Ga0070685_10014858 | 3300005466 | Bacteria | 4129 |
| 129 | Ga0070699_100485645 | 3300005518 | Bacteria | 1121 |
| 130 | Ga0070679_100000250 | 3300005530 | Bacteria | 45069 |
| 131 | Ga0070679_100055321 | 3300005530 | Bacteria | 3951 |
| 132 | Ga0070684_100089335 | 3300005535 | Bacteria | 2738 |
| 133 | Ga0070684_100131098 | 3300005535 | Bacteria | 2261 |
| 134 | Ga0070684_100288459 | 3300005535 | Bacteria | 1504 |
| 135 | Ga0068853_100006694 | 3300005539 | Bacteria | 9179 |
| 136 | Ga0068853_100016337 | 3300005539 | Bacteria | 6107 |
| 137 | Ga0068853_100016385 | 3300005539 | Bacteria | 6099 |
| 138 | Ga0068853_100035262 | 3300005539 | Bacteria | 4248 |
| 139 | Ga0068853_100053738 | 3300005539 | Bacteria | 3469 |
| 140 | Ga0068853_100241308 | 3300005539 | Bacteria | 1656 |
| 141 | Ga0068853_100265685 | 3300005539 | Bacteria | 1579 |
| 142 | Ga0068853_101179716 | 3300005539 | Bacteria | 739 |
| 143 | Ga0068853_101225682 | 3300005539 | Bacteria | 725 |
| 144 | Ga0070696_100007583 | 3300005546 | Bacteria | 7254 |
| 145 | Ga0070696_100031485 | 3300005546 | Bacteria | 3635 |
| 146 | Ga0070665_100000376 | 3300005548 | Bacteria | 66416 |
| 147 | Ga0070665_100010663 | 3300005548 | Bacteria | 9303 |
| 148 | Ga0068855_100010660 | 3300005563 | Bacteria | 11087 |
| 149 | Ga0068855_100122173 | 3300005563 | Bacteria | 2980 |
| 150 | Ga0068855_100212437 | 3300005563 | Bacteria | 2173 |
| 151 | Ga0070664_100128266 | 3300005564 | Bacteria | 2226 |
| 152 | Ga0068857_100013283 | 3300005577 | Bacteria | 7173 |
| 153 | Ga0068857_100038503 | 3300005577 | Bacteria | 4235 |
| 154 | Ga0068857_100050500 | 3300005577 | Bacteria | 3689 |
| 155 | Ga0068857_100061409 | 3300005577 | Bacteria | 3339 |
| 156 | Ga0068857_100226826 | 3300005577 | Bacteria | 1707 |
| 157 | Ga0068854_100003612 | 3300005578 | Bacteria | 9680 |
| 158 | Ga0068854_100113799 | 3300005578 | Bacteria | 2044 |
| 159 | Ga0068854_100123359 | 3300005578 | Bacteria | 1970 |
| 160 | Ga0068854_100429121 | 3300005578 | Bacteria | 1099 |
| 161 | Ga0068856_100007396 | 3300005614 | Bacteria | 10716 |
| 162 | Ga0068856_100012219 | 3300005614 | Bacteria | 8319 |
| 163 | Ga0068856_100169157 | 3300005614 | Bacteria | 2197 |
| 164 | Ga0068856_100319989 | 3300005614 | Bacteria | 1568 |
| 165 | Ga0068852_100006036 | 3300005616 | Bacteria | 8728 |
| 166 | Ga0068852_100034585 | 3300005616 | Bacteria | 4206 |
| 167 | Ga0068852_100042035 | 3300005616 | Bacteria | 3868 |
| 168 | Ga0068852_100073648 | 3300005616 | Bacteria | 3005 |
| 169 | Ga0068852_100169580 | 3300005616 | Bacteria | 2045 |
| 170 | Ga0068852_100178626 | 3300005616 | Bacteria | 1994 |
| 171 | Ga0068852_100235707 | 3300005616 | Bacteria | 1746 |
| 172 | Ga0068859_100324564 | 3300005617 | Bacteria | 1633 |
| 173 | Ga0068859_101521946 | 3300005617 | Bacteria | 738 |
| 174 | Ga0068864_100004209 | 3300005618 | Bacteria | 11834 |
| 175 | Ga0068851_10000908 | 3300005834 | Bacteria | 12753 |
| 176 | Ga0068851_10010761 | 3300005834 | Bacteria | 4275 |
| 177 | Ga0068851_10019388 | 3300005834 | Bacteria | 3286 |
| 178 | Ga0068851_10196718 | 3300005834 | Bacteria | 1123 |
| 179 | Ga0068863_100006254 | 3300005841 | Bacteria | 11695 |
| 180 | Ga0068863_100556207 | 3300005841 | Bacteria | 1133 |
| 181 | Ga0068863_100981392 | 3300005841 | Bacteria | 847 |
| 182 | Ga0068858_100000817 | 3300005842 | Bacteria | 32476 |
| 183 | Ga0068858_100074088 | 3300005842 | Bacteria | 3161 |
| 184 | Ga0068858_100242140 | 3300005842 | Bacteria | 1712 |
| 185 | Ga0068858_100630593 | 3300005842 | Bacteria | 1041 |
| 186 | Ga0068858_100733808 | 3300005842 | Bacteria | 962 |
| 187 | Ga0068860_100017401 | 3300005843 | Bacteria | 7003 |
| 188 | Ga0068860_100066993 | 3300005843 | Bacteria | 3412 |
| 189 | Ga0068860_100265669 | 3300005843 | Bacteria | 1673 |
| 190 | Ga0068860_100270877 | 3300005843 | Bacteria | 1657 |
| 191 | Ga0068862_100176956 | 3300005844 | Bacteria | 1913 |
| 192 | Ga0068862_100646975 | 3300005844 | Bacteria | 1019 |
| 193 | Ga0075369_10064511 | 3300006186 | Bacteria | 1604 |
| 194 | Ga0097621_100324094 | 3300006237 | Bacteria | 1365 |
| 195 | Ga0097621_100400799 | 3300006237 | Bacteria | 1228 |
| 196 | Ga0097621_100482046 | 3300006237 | Bacteria | 1121 |
| 197 | Ga0068871_100231117 | 3300006358 | Bacteria | 1605 |
| 198 | Ga0068865_100427698 | 3300006881 | Bacteria | 1090 |
| 199 | Ga0097620_100324596 | 3300006931 | Bacteria | 1633 |
| 200 | Ga0097620_101522031 | 3300006931 | Bacteria | 738 |
| 201 | Ga0105240_10002563 | 3300009093 | Bacteria | 29133 |
| 202 | Ga0105240_10009143 | 3300009093 | Bacteria | 14064 |
| 203 | Ga0105240_10009721 | 3300009093 | Bacteria | 13581 |
| 204 | Ga0105240_10011172 | 3300009093 | Bacteria | 12533 |
| 205 | Ga0105240_10023678 | 3300009093 | Bacteria | 8112 |
| 206 | Ga0105240_10055889 | 3300009093 | Bacteria | 4941 |
| 207 | Ga0105240_10152926 | 3300009093 | Bacteria | 2746 |
| 208 | Ga0105240_10256770 | 3300009093 | Bacteria | 2018 |
| 209 | Ga0105240_11226200 | 3300009093 | Bacteria | 794 |
| 210 | Ga0105240_11500257 | 3300009093 | Bacteria | 707 |
| 211 | Ga0105245_10286466 | 3300009098 | Bacteria | 1612 |
| 212 | Ga0105245_10406451 | 3300009098 | Bacteria | 1362 |
| 213 | Ga0105247_10002916 | 3300009101 | Bacteria | 11384 |
| 214 | Ga0105241_10015625 | 3300009174 | Bacteria | 5562 |
| 215 | Ga0105241_10094532 | 3300009174 | Bacteria | 2364 |
| 216 | Ga0105241_10620362 | 3300009174 | Bacteria | 979 |
| 217 | Ga0105241_11415169 | 3300009174 | Bacteria | 666 |
| 218 | Ga0105242_10762084 | 3300009176 | Bacteria | 954 |
| 219 | Ga0105248_10000920 | 3300009177 | Bacteria | 32785 |
| 220 | Ga0105248_10944372 | 3300009177 | Bacteria | 974 |
| 221 | Ga0105237_10000084 | 3300009545 | Bacteria | 125742 |
| 222 | Ga0105237_10000675 | 3300009545 | Bacteria | 47159 |
| 223 | Ga0105237_10008928 | 3300009545 | Bacteria | 10796 |
| 224 | Ga0105237_10009642 | 3300009545 | Bacteria | 10335 |
| 225 | Ga0105237_11987742 | 3300009545 | Bacteria | 590 |
| 226 | Ga0105238_10000131 | 3300009551 | Bacteria | 82050 |
| 227 | Ga0105238_10005144 | 3300009551 | Bacteria | 12931 |
| 228 | Ga0105238_10098301 | 3300009551 | Bacteria | 2911 |
| 229 | Ga0105238_10108501 | 3300009551 | Bacteria | 2757 |
| 230 | Ga0105238_10391495 | 3300009551 | Bacteria | 1382 |
| 231 | Ga0105238_11236530 | 3300009551 | Bacteria | 772 |
| 232 | Ga0105249_10000084 | 3300009553 | Bacteria | 134869 |
| 233 | Ga0105249_10007606 | 3300009553 | Bacteria | 9453 |
| 234 | Ga0105239_10000033 | 3300010375 | Bacteria | 223933 |
| 235 | Ga0105239_10018126 | 3300010375 | Bacteria | 7783 |
| 236 | Ga0105239_10042913 | 3300010375 | Bacteria | 4955 |
| 237 | Ga0105239_10106637 | 3300010375 | Bacteria | 3104 |
| 238 | Ga0105239_10572998 | 3300010375 | Bacteria | 1286 |
| 239 | Ga0105246_10011815 | 3300011119 | Bacteria | 5427 |
| 240 | Ga0105246_10128100 | 3300011119 | Bacteria | 1892 |
| 241 | Ga0105246_11968736 | 3300011119 | Bacteria | 563 |
| 242 | Ga0157314_1000507 | 3300012500 | Bacteria | 3702 |
| 243 | Ga0154012_169161 | 3300013059 | Bacteria | 1120 |
| 244 | Ga0157373_10011463 | 3300013100 | Bacteria | 6519 |
| 245 | Ga0157373_10100595 | 3300013100 | Bacteria | 2034 |
| 246 | Ga0157371_10070400 | 3300013102 | Bacteria | 2476 |
| 247 | Ga0157371_10348755 | 3300013102 | Bacteria | 1077 |
| 248 | Ga0157370_10005440 | 3300013104 | Bacteria | 14285 |
| 249 | Ga0157370_10023809 | 3300013104 | Bacteria | 6075 |
| 250 | Ga0157370_10045998 | 3300013104 | Bacteria | 4186 |
| 251 | Ga0157370_10081025 | 3300013104 | Bacteria | 3055 |
| 252 | Ga0157369_10003012 | 3300013105 | Bacteria | 20149 |
| 253 | Ga0157369_10011973 | 3300013105 | Bacteria | 9855 |
| 254 | Ga0157369_10018985 | 3300013105 | Bacteria | 7700 |
| 255 | Ga0157369_10124679 | 3300013105 | Bacteria | 2732 |
| 256 | Ga0157369_11419744 | 3300013105 | Bacteria | 707 |
| 257 | Ga0157374_11003429 | 3300013296 | Bacteria | 854 |
| 258 | Ga0163162_10000221 | 3300013306 | Bacteria | 52249 |
| 259 | Ga0163162_10069555 | 3300013306 | Bacteria | 3572 |
| 260 | Ga0163162_10489642 | 3300013306 | Bacteria | 1361 |
| 261 | Ga0157372_10000334 | 3300013307 | Bacteria | 51813 |
| 262 | Ga0157372_10044203 | 3300013307 | Bacteria | 4935 |
| 263 | Ga0157372_10066779 | 3300013307 | Bacteria | 4041 |
| 264 | Ga0157372_10081165 | 3300013307 | Bacteria | 3670 |
| 265 | Ga0157372_10173947 | 3300013307 | Bacteria | 2492 |
| 266 | Ga0157372_10213378 | 3300013307 | Bacteria | 2237 |
| 267 | Ga0157372_11449664 | 3300013307 | Bacteria | 791 |
| 268 | Ga0163163_10000112 | 3300014325 | Bacteria | 86324 |
| 269 | Ga0163163_10000585 | 3300014325 | Bacteria | 32121 |
| 270 | Ga0182008_10006516 | 3300014497 | Bacteria | 6516 |
| 271 | Ga0182008_10021422 | 3300014497 | Bacteria | 3318 |
| 272 | Ga0182008_10036778 | 3300014497 | Bacteria | 2449 |
| 273 | Ga0182008_10055909 | 3300014497 | Bacteria | 1951 |
| 274 | Ga0182008_10191861 | 3300014497 | Bacteria | 1037 |
| 275 | Ga0157379_10007853 | 3300014968 | Bacteria | 9242 |
| 276 | Ga0157379_10482832 | 3300014968 | Bacteria | 1147 |
| 277 | Ga0157376_10009210 | 3300014969 | Bacteria | 7162 |
| 278 | Ga0182006_1000031 | 3300015261 | Bacteria | 240055 |
| 279 | Ga0182006_1000496 | 3300015261 | Bacteria | 30592 |
| 280 | Ga0182007_10003787 | 3300015262 | Bacteria | 7047 |
| 281 | Ga0182007_10015105 | 3300015262 | Bacteria | 2890 |
| 282 | Ga0182005_1000049 | 3300015265 | Bacteria | 123003 |
| 283 | Ga0182005_1001001 | 3300015265 | Bacteria | 12121 |
| 284 | Ga0182005_1002650 | 3300015265 | Bacteria | 6301 |
| 285 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 286 | Ga0163161_10007409 | 3300017792 | Bacteria | 7580 |
| 287 | Ga0163161_10066212 | 3300017792 | Bacteria | 2638 |
| 288 | Ga0206356_11026662 | 3300020070 | Bacteria | 4285 |
| 289 | Ga0206356_11905763 | 3300020070 | Bacteria | 1398 |
| 290 | Ga0206351_10589011 | 3300020077 | Bacteria | 1281 |
| 291 | Ga0206351_10768644 | 3300020077 | Bacteria | 1101 |
| 292 | Ga0206352_10871908 | 3300020078 | Bacteria | 1811 |
| 293 | Ga0206350_11455286 | 3300020080 | Bacteria | 1708 |
| 294 | Ga0206354_10524459 | 3300020081 | Bacteria | 4072 |
| 295 | Ga0206353_10447795 | 3300020082 | Bacteria | 2783 |
| 296 | Ga0206353_11143090 | 3300020082 | Bacteria | 799 |
| 297 | Ga0154015_1513628 | 3300020610 | Bacteria | 2906 |
| 298 | Ga0224712_10074632 | 3300022467 | Bacteria | 1386 |
| 299 | Ga0224712_10128125 | 3300022467 | Bacteria | 1106 |
| 300 | Ga0209760_100376 | 3300025207 | Bacteria | 11760 |
| 301 | Ga0209784_100204 | 3300025224 | Bacteria | 42366 |
| 302 | Ga0209566_102111 | 3300025225 | Bacteria | 4074 |
| 303 | Ga0209674_100061 | 3300025226 | Bacteria | 280844 |
| 304 | Ga0209674_100077 | 3300025226 | Bacteria | 206312 |
| 305 | Ga0209674_100785 | 3300025226 | Bacteria | 10709 |
| 306 | Ga0209674_104333 | 3300025226 | Bacteria | 2331 |
| 307 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 308 | Ga0209672_100022 | 3300025228 | Bacteria | 374313 |
| 309 | Ga0209672_100251 | 3300025228 | Bacteria | 39907 |
| 310 | Ga0209672_101130 | 3300025228 | Bacteria | 11110 |
| 311 | Ga0209672_101444 | 3300025228 | Bacteria | 8507 |
| 312 | Ga0209147_107974 | 3300025229 | Bacteria | 1344 |
| 313 | Ga0209563_100076 | 3300025230 | Bacteria | 215269 |
| 314 | Ga0207427_100111 | 3300025231 | Bacteria | 112775 |
| 315 | Ga0207427_100179 | 3300025231 | Bacteria | 67665 |
| 316 | Ga0207427_100185 | 3300025231 | Bacteria | 63916 |
| 317 | Ga0207427_100510 | 3300025231 | Bacteria | 20592 |
| 318 | Ga0209437_100099 | 3300025233 | Bacteria | 229500 |
| 319 | Ga0209437_100113 | 3300025233 | Bacteria | 211240 |
| 320 | Ga0209437_100320 | 3300025233 | Bacteria | 62893 |
| 321 | Ga0209437_100368 | 3300025233 | Bacteria | 48548 |
| 322 | Ga0209437_100782 | 3300025233 | Bacteria | 14969 |
| 323 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 324 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 325 | Ga0209258_100119 | 3300025242 | Bacteria | 183554 |
| 326 | Ga0209258_100122 | 3300025242 | Bacteria | 180314 |
| 327 | Ga0209258_100137 | 3300025242 | Bacteria | 167913 |
| 328 | Ga0209258_100376 | 3300025242 | Bacteria | 57517 |
| 329 | Ga0209258_106897 | 3300025242 | Bacteria | 1730 |
| 330 | Ga0209646_1000985 | 3300025246 | Bacteria | 8811 |
| 331 | Ga0209646_1001103 | 3300025246 | Bacteria | 7995 |
| 332 | Ga0209646_1003374 | 3300025246 | Bacteria | 3173 |
| 333 | Ga0209646_1027599 | 3300025246 | Bacteria | 781 |
| 334 | Ga0209026_1000087 | 3300025250 | Bacteria | 184044 |
| 335 | Ga0209026_1000175 | 3300025250 | Bacteria | 98059 |
| 336 | Ga0209026_1000274 | 3300025250 | Bacteria | 61312 |
| 337 | Ga0209026_1000276 | 3300025250 | Bacteria | 60964 |
| 338 | Ga0209026_1008805 | 3300025250 | Bacteria | 2059 |
| 339 | Ga0209677_101477 | 3300025253 | Bacteria | 10113 |
| 340 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 341 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 342 | Ga0209148_1000036 | 3300025254 | Bacteria | 530505 |
| 343 | Ga0209148_1000062 | 3300025254 | Bacteria | 347704 |
| 344 | Ga0209148_1000083 | 3300025254 | Bacteria | 270142 |
| 345 | Ga0209148_1000137 | 3300025254 | Bacteria | 168097 |
| 346 | Ga0209148_1001786 | 3300025254 | Bacteria | 9177 |
| 347 | Ga0209759_1000136 | 3300025256 | Bacteria | 125393 |
| 348 | Ga0209759_1000320 | 3300025256 | Bacteria | 63830 |
| 349 | Ga0209759_1001153 | 3300025256 | Bacteria | 16782 |
| 350 | Ga0209759_1001565 | 3300025256 | Bacteria | 12489 |
| 351 | Ga0209759_1048645 | 3300025256 | Bacteria | 669 |
| 352 | Ga0209129_1000769 | 3300025258 | Bacteria | 20356 |
| 353 | Ga0209233_1000040 | 3300025261 | Bacteria | 530395 |
| 354 | Ga0209233_1000075 | 3300025261 | Bacteria | 356837 |
| 355 | Ga0209233_1000128 | 3300025261 | Bacteria | 209927 |
| 356 | Ga0209233_1008709 | 3300025261 | Bacteria | 3119 |
| 357 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 358 | Ga0209455_1000040 | 3300025272 | Bacteria | 430197 |
| 359 | Ga0209455_1000084 | 3300025272 | Bacteria | 253164 |
| 360 | Ga0209455_1000095 | 3300025272 | Bacteria | 217487 |
| 361 | Ga0209455_1000164 | 3300025272 | Bacteria | 114011 |
| 362 | Ga0209455_1001294 | 3300025272 | Bacteria | 11681 |
| 363 | Ga0209455_1007907 | 3300025272 | Bacteria | 2947 |
| 364 | Ga0209758_1000301 | 3300025297 | Bacteria | 96998 |
| 365 | Ga0209758_1020451 | 3300025297 | Bacteria | 3131 |
| 366 | Ga0209758_1047231 | 3300025297 | Bacteria | 1543 |
| 367 | Ga0207426_1016040 | 3300025302 | Bacteria | 2702 |
| 368 | Ga0209051_1007151 | 3300025303 | Bacteria | 6152 |
| 369 | Ga0209257_1000067 | 3300025304 | Bacteria | 342468 |
| 370 | Ga0209257_1039691 | 3300025304 | Bacteria | 1412 |
| 371 | Ga0207656_10007153 | 3300025321 | Bacteria | 4056 |
| 372 | Ga0207656_10008269 | 3300025321 | Bacteria | 3820 |
| 373 | Ga0207656_10119317 | 3300025321 | Bacteria | 1226 |
| 374 | Ga0207710_10003748 | 3300025900 | Bacteria | 6728 |
| 375 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 376 | Ga0207680_10000598 | 3300025903 | Bacteria | 17011 |
| 377 | Ga0207680_10001902 | 3300025903 | Bacteria | 9799 |
| 378 | Ga0207680_10388284 | 3300025903 | Bacteria | 985 |
| 379 | Ga0207647_10000034 | 3300025904 | Bacteria | 99280 |
| 380 | Ga0207647_10000262 | 3300025904 | Bacteria | 43207 |
| 381 | Ga0207647_10002208 | 3300025904 | Bacteria | 14832 |
| 382 | Ga0207647_10002308 | 3300025904 | Bacteria | 14534 |
| 383 | Ga0207647_10012004 | 3300025904 | Bacteria | 6046 |
| 384 | Ga0207647_10119619 | 3300025904 | Bacteria | 1553 |
| 385 | Ga0207705_10000560 | 3300025909 | Bacteria | 31207 |
| 386 | Ga0207705_10006860 | 3300025909 | Bacteria | 8417 |
| 387 | Ga0207705_10037183 | 3300025909 | Bacteria | 3483 |
| 388 | Ga0207705_10112632 | 3300025909 | Bacteria | 2012 |
| 389 | Ga0207705_10678893 | 3300025909 | Bacteria | 801 |
| 390 | Ga0207654_10000719 | 3300025911 | Bacteria | 18479 |
| 391 | Ga0207654_10005416 | 3300025911 | Bacteria | 6455 |
| 392 | Ga0207654_10213287 | 3300025911 | Bacteria | 1277 |
| 393 | Ga0207654_10494947 | 3300025911 | Bacteria | 863 |
| 394 | Ga0207707_10000064 | 3300025912 | Bacteria | 107490 |
| 395 | Ga0207707_10006038 | 3300025912 | Bacteria | 10596 |
| 396 | Ga0207707_10006315 | 3300025912 | Bacteria | 10349 |
| 397 | Ga0207707_10029371 | 3300025912 | Bacteria | 4806 |
| 398 | Ga0207707_10094005 | 3300025912 | Bacteria | 2619 |
| 399 | Ga0207695_10000588 | 3300025913 | Bacteria | 73260 |
| 400 | Ga0207695_10001221 | 3300025913 | Bacteria | 44045 |
| 401 | Ga0207695_10001320 | 3300025913 | Bacteria | 42048 |
| 402 | Ga0207695_10002529 | 3300025913 | Bacteria | 26858 |
| 403 | Ga0207695_10003607 | 3300025913 | Bacteria | 21652 |
| 404 | Ga0207695_10004205 | 3300025913 | Bacteria | 19775 |
| 405 | Ga0207695_10027716 | 3300025913 | Bacteria | 6304 |
| 406 | Ga0207695_10056422 | 3300025913 | Bacteria | 4087 |
| 407 | Ga0207695_10103753 | 3300025913 | Bacteria | 2834 |
| 408 | Ga0207695_10123193 | 3300025913 | Bacteria | 2558 |
| 409 | Ga0207695_10176528 | 3300025913 | Bacteria | 2058 |
| 410 | Ga0207695_10544900 | 3300025913 | Bacteria | 1042 |
| 411 | Ga0207671_10000011 | 3300025914 | Bacteria | 530349 |
| 412 | Ga0207671_10012799 | 3300025914 | Bacteria | 6724 |
| 413 | Ga0207671_10013618 | 3300025914 | Bacteria | 6470 |
| 414 | Ga0207671_10094240 | 3300025914 | Bacteria | 2260 |
| 415 | Ga0207663_10040939 | 3300025916 | Bacteria | 2820 |
| 416 | Ga0207660_10001372 | 3300025917 | Bacteria | 16322 |
| 417 | Ga0207660_10001813 | 3300025917 | Bacteria | 14233 |
| 418 | Ga0207660_10003444 | 3300025917 | Bacteria | 10324 |
| 419 | Ga0207660_10135796 | 3300025917 | Bacteria | 1877 |
| 420 | Ga0207657_10002836 | 3300025919 | Bacteria | 18613 |
| 421 | Ga0207657_10029335 | 3300025919 | Bacteria | 5010 |
| 422 | Ga0207657_10029430 | 3300025919 | Bacteria | 5000 |
| 423 | Ga0207649_10001382 | 3300025920 | Bacteria | 14383 |
| 424 | Ga0207649_10006569 | 3300025920 | Bacteria | 6318 |
| 425 | Ga0207649_10006704 | 3300025920 | Bacteria | 6258 |
| 426 | Ga0207649_10010845 | 3300025920 | Bacteria | 5009 |
| 427 | Ga0207649_10249805 | 3300025920 | Bacteria | 1277 |
| 428 | Ga0207649_10811832 | 3300025920 | Bacteria | 730 |
| 429 | Ga0207652_10000019 | 3300025921 | Bacteria | 164416 |
| 430 | Ga0207652_10000801 | 3300025921 | Bacteria | 30036 |
| 431 | Ga0207652_10008959 | 3300025921 | Bacteria | 8065 |
| 432 | Ga0207652_10148733 | 3300025921 | Bacteria | 2096 |
| 433 | Ga0207652_10333672 | 3300025921 | Bacteria | 1369 |
| 434 | Ga0207681_10897705 | 3300025923 | Bacteria | 742 |
| 435 | Ga0207694_10000654 | 3300025924 | Bacteria | 31284 |
| 436 | Ga0207694_10001428 | 3300025924 | Bacteria | 20477 |
| 437 | Ga0207694_10001879 | 3300025924 | Bacteria | 17407 |
| 438 | Ga0207694_10048048 | 3300025924 | Bacteria | 3301 |
| 439 | Ga0207694_10147134 | 3300025924 | Bacteria | 1896 |
| 440 | Ga0207694_10520874 | 3300025924 | Bacteria | 996 |
| 441 | Ga0207694_10613577 | 3300025924 | Bacteria | 915 |
| 442 | Ga0207650_10006245 | 3300025925 | Bacteria | 8118 |
| 443 | Ga0207650_10230356 | 3300025925 | Bacteria | 1494 |
| 444 | Ga0207687_10218969 | 3300025927 | Bacteria | 1498 |
| 445 | Ga0207700_10023119 | 3300025928 | Bacteria | 4279 |
| 446 | Ga0207644_10735062 | 3300025931 | Bacteria | 824 |
| 447 | Ga0207690_10011845 | 3300025932 | Bacteria | 5214 |
| 448 | Ga0207690_10068857 | 3300025932 | Bacteria | 2433 |
| 449 | Ga0207706_10004869 | 3300025933 | Bacteria | 12569 |
| 450 | Ga0207706_10133414 | 3300025933 | Bacteria | 2184 |
| 451 | Ga0207706_10408337 | 3300025933 | Bacteria | 1177 |
| 452 | Ga0207704_10841111 | 3300025938 | Bacteria | 769 |
| 453 | Ga0207711_10001918 | 3300025941 | Bacteria | 18898 |
| 454 | Ga0207661_10036981 | 3300025944 | Bacteria | 3814 |
| 455 | Ga0207661_10448781 | 3300025944 | Bacteria | 1174 |
| 456 | Ga0207679_10054898 | 3300025945 | Bacteria | 2935 |
| 457 | Ga0207679_11742349 | 3300025945 | Bacteria | 570 |
| 458 | Ga0207667_10000219 | 3300025949 | Bacteria | 80218 |
| 459 | Ga0207667_10000446 | 3300025949 | Bacteria | 55443 |
| 460 | Ga0207667_10000574 | 3300025949 | Bacteria | 48011 |
| 461 | Ga0207667_10002469 | 3300025949 | Bacteria | 23071 |
| 462 | Ga0207667_10007024 | 3300025949 | Bacteria | 13600 |
| 463 | Ga0207667_10121219 | 3300025949 | Bacteria | 2694 |
| 464 | Ga0207667_10204493 | 3300025949 | Bacteria | 2025 |
| 465 | Ga0207712_10000140 | 3300025961 | Bacteria | 76381 |
| 466 | Ga0207712_10000395 | 3300025961 | Bacteria | 37905 |
| 467 | Ga0207668_10019465 | 3300025972 | Bacteria | 4293 |
| 468 | Ga0207640_10000280 | 3300025981 | Bacteria | 34294 |
| 469 | Ga0207640_10000495 | 3300025981 | Bacteria | 24008 |
| 470 | Ga0207640_10001128 | 3300025981 | Bacteria | 14684 |
| 471 | Ga0207640_10037290 | 3300025981 | Bacteria | 3057 |
| 472 | Ga0207640_10322638 | 3300025981 | Bacteria | 1230 |
| 473 | Ga0207658_10000997 | 3300025986 | Bacteria | 23236 |
| 474 | Ga0207658_10093031 | 3300025986 | Bacteria | 2343 |
| 475 | Ga0207658_10213853 | 3300025986 | Bacteria | 1617 |
| 476 | Ga0207658_10302291 | 3300025986 | Bacteria | 1379 |
| 477 | Ga0207677_10088491 | 3300026023 | Bacteria | 2245 |
| 478 | Ga0207703_10000766 | 3300026035 | Bacteria | 31634 |
| 479 | Ga0207703_10263265 | 3300026035 | Bacteria | 1559 |
| 480 | Ga0207703_10337519 | 3300026035 | Bacteria | 1384 |
| 481 | Ga0207703_10415415 | 3300026035 | Bacteria | 1251 |
| 482 | Ga0207639_10000277 | 3300026041 | Bacteria | 36931 |
| 483 | Ga0207639_10002487 | 3300026041 | Bacteria | 12350 |
| 484 | Ga0207639_10007555 | 3300026041 | Bacteria | 7414 |
| 485 | Ga0207639_10049181 | 3300026041 | Bacteria | 3195 |
| 486 | Ga0207639_10441995 | 3300026041 | Bacteria | 1179 |
| 487 | Ga0207639_10642877 | 3300026041 | Bacteria | 981 |
| 488 | Ga0207639_11168568 | 3300026041 | Bacteria | 722 |
| 489 | Ga0207639_11200587 | 3300026041 | Bacteria | 712 |
| 490 | Ga0207678_10002665 | 3300026067 | Bacteria | 16207 |
| 491 | Ga0207678_10016613 | 3300026067 | Bacteria | 6466 |
| 492 | Ga0207678_10018779 | 3300026067 | Bacteria | 6073 |
| 493 | Ga0207678_10026967 | 3300026067 | Bacteria | 5010 |
| 494 | Ga0207678_10027074 | 3300026067 | Bacteria | 5000 |
| 495 | Ga0207678_10040297 | 3300026067 | Bacteria | 4052 |
| 496 | Ga0207678_10106813 | 3300026067 | Bacteria | 2388 |
| 497 | Ga0207678_10345286 | 3300026067 | Bacteria | 1283 |
| 498 | Ga0207702_10000132 | 3300026078 | Bacteria | 88794 |
| 499 | Ga0207702_10000338 | 3300026078 | Bacteria | 53744 |
| 500 | Ga0207702_10013397 | 3300026078 | Bacteria | 6820 |
| 501 | Ga0207702_10054245 | 3300026078 | Bacteria | 3396 |
| 502 | Ga0207702_10439479 | 3300026078 | Bacteria | 1264 |
| 503 | Ga0207702_11206364 | 3300026078 | Bacteria | 751 |
| 504 | Ga0207641_10025217 | 3300026088 | Bacteria | 4903 |
| 505 | Ga0207641_10376307 | 3300026088 | Bacteria | 1359 |
| 506 | Ga0207648_10016027 | 3300026089 | Bacteria | 6867 |
| 507 | Ga0207648_10948227 | 3300026089 | Bacteria | 805 |
| 508 | Ga0207648_11103243 | 3300026089 | Bacteria | 744 |
| 509 | Ga0207676_10038682 | 3300026095 | Bacteria | 3643 |
| 510 | Ga0207674_10001145 | 3300026116 | Bacteria | 34394 |
| 511 | Ga0207674_10002886 | 3300026116 | Bacteria | 21357 |
| 512 | Ga0207674_10039493 | 3300026116 | Bacteria | 4891 |
| 513 | Ga0207674_10046326 | 3300026116 | Bacteria | 4465 |
| 514 | Ga0207674_10047098 | 3300026116 | Bacteria | 4423 |
| 515 | Ga0207674_10375402 | 3300026116 | Bacteria | 1374 |
| 516 | Ga0207683_10394289 | 3300026121 | Bacteria | 1273 |
| 517 | Ga0207698_10000491 | 3300026142 | Bacteria | 23071 |
| 518 | Ga0207698_10006628 | 3300026142 | Bacteria | 7246 |
| 519 | Ga0207698_10021688 | 3300026142 | Bacteria | 4449 |
| 520 | Ga0207698_12006094 | 3300026142 | Bacteria | 593 |
| 521 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 522 | Ga0268266_10000075 | 3300028379 | Bacteria | 218045 |
| 523 | Ga0268265_10461712 | 3300028380 | Bacteria | 1188 |
| 524 | Ga0268265_11863648 | 3300028380 | Bacteria | 608 |
| 525 | Ga0268264_10003031 | 3300028381 | Bacteria | 14566 |
| 526 | Ga0268264_10079343 | 3300028381 | Bacteria | 2800 |
| 527 | Ga0268264_10386309 | 3300028381 | Bacteria | 1342 |
| 528 | Ga0268264_10535999 | 3300028381 | Bacteria | 1146 |
| 529 | Ga0307509_10399468 | 3300031507 | Bacteria | 1082 |
| 530 | Ga0307508_10226554 | 3300031616 | Bacteria | 1468 |
| 531 | Ga0316575_10029237 | 3300031665 | Bacteria | 2151 |
| 532 | Ga0307413_10477018 | 3300031824 | Bacteria | 996 |
| 533 | Ga0307412_10043615 | 3300031911 | Bacteria | 2921 |
| 534 | Ga0307412_11252999 | 3300031911 | Bacteria | 666 |
| 535 | Ga0307416_100132487 | 3300032002 | Bacteria | 2247 |
| 536 | Ga0307416_100286179 | 3300032002 | Bacteria | 1629 |
| 537 | Ga0307414_10094121 | 3300032004 | Bacteria | 2235 |
| 538 | Ga0307414_10423568 | 3300032004 | Bacteria | 1161 |
| 539 | Ga0307411_10051057 | 3300032005 | Bacteria | 2697 |
| 540 | Ga0307411_10259112 | 3300032005 | Bacteria | 1372 |
| 541 | Ga0307411_11110105 | 3300032005 | Bacteria | 713 |
| 542 | Ga0307415_100782597 | 3300032126 | Bacteria | 869 |
| 543 | Ga0307507_10102026 | 3300033179 | Bacteria | 2396 |
| 544 | Ga0307507_10374266 | 3300033179 | Bacteria | 824 |
| 545 | Ga0395899_0000110 | 3300037312 | Bacteria | 140811 |
| 546 | Ga0395899_0001023 | 3300037312 | Bacteria | 25559 |
| 547 | Ga0395899_0034712 | 3300037312 | Bacteria | 3788 |
| 548 | Ga0395900_0000049 | 3300037418 | Bacteria | 226847 |
| 549 | Ga0395900_0000060 | 3300037418 | Bacteria | 205509 |
| 550 | Ga0395900_0102529 | 3300037418 | Bacteria | 2939 |
| 551 | Ga0395900_0471806 | 3300037418 | Bacteria | 1208 |
| 552 | Ga0395898_0000023 | 3300037466 | Bacteria | 379477 |
| 553 | Ga0395898_0000237 | 3300037466 | Bacteria | 139991 |
| 554 | Ga0395898_0018522 | 3300037466 | Bacteria | 7096 |
| 555 | Ga0395898_0097752 | 3300037466 | Bacteria | 2819 |
| 556 | Ga0395901_0117942 | 3300038443 | Bacteria | 2789 |
| 557 | Ga0395901_0206518 | 3300038443 | Bacteria | 2057 |
| 558 | Ga0395901_0371738 | 3300038443 | Bacteria | 1472 |
| 559 | Ga0439436_0000032 | 3300041404 | Bacteria | 46437 |
| 560 | Ga0439465_0000530 | 3300041413 | Bacteria | 11438 |
| 561 | Ga0451789_0811766 | 3300041443 | Bacteria | 718 |
| 562 | Ga0451793_1777967 | 3300041452 | Bacteria | 4636 |
| 563 | Ga0451797_0113713 | 3300041453 | Bacteria | 1161 |
| 564 | Ga0451797_1444144 | 3300041453 | Bacteria | 762 |
| 565 | Ga0451795_0322423 | 3300041456 | Bacteria | 925 |
| 566 | Ga0451795_0773849 | 3300041456 | Bacteria | 968 |
| 567 | Ga0451802_0035022 | 3300041460 | Bacteria | 824 |
| 568 | Ga0451806_671699 | 3300041462 | Bacteria | 693 |
| 569 | Ga0451841_0241459 | 3300041498 | Bacteria | 1262 |
| 570 | Ga0450908_000007 | 3300042184 | Bacteria | 55488 |
| 571 | Ga0439459_0061077 | 3300042438 | Bacteria | 852 |
| 572 | Ga0451577_0176764 | 3300042876 | Bacteria | 1924 |
| 573 | Ga0466969_0038934 | 3300044656 | Bacteria | 2390 |
| 574 | Ga0466969_0088821 | 3300044656 | Bacteria | 1467 |
| 575 | Ga0466972_0038589 | 3300044658 | Bacteria | 2332 |
| 576 | Ga0466976_0347589 | 3300044662 | Bacteria | 819 |
| 577 | Ga0466989_0163097 | 3300044663 | Bacteria | 1337 |
| 578 | Ga0466982_0000018 | 3300044672 | Bacteria | 113912 |
| 579 | Ga0466982_0000096 | 3300044672 | Bacteria | 21532 |
| 580 | Ga0466965_0150407 | 3300044683 | Bacteria | 1216 |
| 581 | Ga0466966_0008293 | 3300044684 | Bacteria | 6887 |
| 582 | Ga0466966_0041964 | 3300044684 | Bacteria | 2938 |
| 583 | Ga0466966_0181364 | 3300044684 | Bacteria | 1277 |
| 584 | Ga0466961_0001486 | 3300044693 | Bacteria | 14566 |
| 585 | Ga0466961_0002537 | 3300044693 | Bacteria | 11321 |
| 586 | Ga0466961_0003674 | 3300044693 | Bacteria | 9567 |
| 587 | Ga0466961_0003935 | 3300044693 | Bacteria | 9288 |
| 588 | Ga0466961_0012833 | 3300044693 | Bacteria | 5361 |
| 589 | Ga0466963_0207098 | 3300044694 | Bacteria | 1372 |
| 590 | Ga0466963_0695281 | 3300044694 | Bacteria | 718 |
| 591 | Ga0466964_0001814 | 3300044706 | Bacteria | 7433 |
| 592 | Ga0466964_0025129 | 3300044706 | Bacteria | 2325 |
| 593 | Ga0453684_0000316 | 3300044712 | Bacteria | 204457 |
| 594 | Ga0466971_0001777 | 3300044719 | Bacteria | 9148 |
| 595 | Ga0466971_0015305 | 3300044719 | Bacteria | 3375 |
| 596 | Ga0466971_0015318 | 3300044719 | Bacteria | 3373 |
| 597 | Ga0466971_0111559 | 3300044719 | Bacteria | 1262 |
| 598 | Ga0466968_0001797 | 3300044735 | Bacteria | 7743 |
| 599 | Ga0466968_0012411 | 3300044735 | Bacteria | 3335 |
| 600 | Ga0466970_0004514 | 3300044765 | Bacteria | 6867 |
| 601 | Ga0466970_0019296 | 3300044765 | Bacteria | 3533 |
| 602 | Ga0466957_0002919 | 3300044842 | Bacteria | 9262 |
| 603 | Ga0466957_0039575 | 3300044842 | Bacteria | 2844 |
| 604 | Ga0466957_0133691 | 3300044842 | Bacteria | 1592 |
| 605 | Ga0466957_0251608 | 3300044842 | Bacteria | 1175 |
| 606 | Ga0466957_0643964 | 3300044842 | Bacteria | 745 |
| 607 | Ga0466960_0023732 | 3300044901 | Bacteria | 2757 |
| 608 | Ga0466959_0005091 | 3300045049 | Bacteria | 8940 |
| 609 | Ga0466959_0320532 | 3300045049 | Bacteria | 1059 |
| 610 | Ga0451576_0000128 | 3300045051 | Bacteria | 192071 |
| 611 | Ga0466958_0016421 | 3300045836 | Bacteria | 4263 |
| 612 | Ga0466958_0025788 | 3300045836 | Bacteria | 3469 |
| 613 | Ga0466958_0032951 | 3300045836 | Bacteria | 3085 |
| 614 | Ga0466958_0293822 | 3300045836 | Bacteria | 1042 |
| 615 | Ga0466967_0318912 | 3300045976 | Bacteria | 1498 |
| 616 | Ga0495617_000607 | 3300046452 | Bacteria | 18027 |
| 617 | Ga0495617_001095 | 3300046452 | Bacteria | 12313 |
| 618 | Ga0495638_0000019 | 3300046460 | Bacteria | 384671 |
| 619 | Ga0495638_0000406 | 3300046460 | Bacteria | 52627 |
| 620 | Ga0495638_0000452 | 3300046460 | Bacteria | 49237 |
| 621 | Ga0495638_0001628 | 3300046460 | Bacteria | 19981 |
| 622 | Ga0495650_0000350 | 3300046471 | Bacteria | 81541 |
| 623 | Ga0495650_0000466 | 3300046471 | Bacteria | 62626 |
| 624 | Ga0495650_0000869 | 3300046471 | Bacteria | 35923 |
| 625 | Ga0495605_0126429 | 3300046474 | Bacteria | 1156 |
| 626 | Ga0495584_0001662 | 3300046491 | Bacteria | 13072 |
| 627 | Ga0495585_0001138 | 3300046492 | Bacteria | 21797 |
| 628 | Ga0495585_0040927 | 3300046492 | Bacteria | 2600 |
| 629 | Ga0495607_0000133 | 3300046501 | Bacteria | 78789 |
| 630 | Ga0495607_0001577 | 3300046501 | Bacteria | 19905 |
| 631 | Ga0495607_0007528 | 3300046501 | Bacteria | 7519 |
| 632 | Ga0495583_0011255 | 3300046506 | Bacteria | 5149 |
| 633 | Ga0495606_0000016 | 3300046507 | Bacteria | 284865 |
| 634 | Ga0495606_0000160 | 3300046507 | Bacteria | 118218 |
| 635 | Ga0495606_0001918 | 3300046507 | Bacteria | 25850 |
| 636 | Ga0495606_0002253 | 3300046507 | Bacteria | 22923 |
| 637 | Ga0495606_0234825 | 3300046507 | Bacteria | 1025 |
| 638 | Ga0495606_0269383 | 3300046507 | Bacteria | 936 |
| 639 | Ga0495610_0004501 | 3300046512 | Bacteria | 10271 |
| 640 | Ga0495610_0029998 | 3300046512 | Bacteria | 2855 |
| 641 | Ga0495616_0000006 | 3300046513 | Bacteria | 234766 |
| 642 | Ga0495616_0047917 | 3300046513 | Bacteria | 2149 |
| 643 | Ga0495620_0000711 | 3300046515 | Bacteria | 20541 |
| 644 | Ga0495620_0097744 | 3300046515 | Bacteria | 1172 |
| 645 | Ga0495631_0000036 | 3300046518 | Bacteria | 81635 |
| 646 | Ga0495631_0000318 | 3300046518 | Bacteria | 33436 |
| 647 | Ga0495632_0000010 | 3300046519 | Bacteria | 272360 |
| 648 | Ga0495632_0012658 | 3300046519 | Bacteria | 4852 |
| 649 | Ga0495632_0054517 | 3300046519 | Bacteria | 1960 |
| 650 | Ga0495637_0007175 | 3300046520 | Bacteria | 5547 |
| 651 | Ga0495643_0177310 | 3300046522 | Bacteria | 1038 |
| 652 | Ga0495648_0000881 | 3300046524 | Bacteria | 31575 |
| 653 | Ga0495609_0149052 | 3300046538 | Bacteria | 995 |
| 654 | Ga0495622_0020164 | 3300046557 | Bacteria | 3105 |
| 655 | Ga0495622_0251985 | 3300046557 | Bacteria | 776 |
| 656 | Ga0495668_0005730 | 3300046616 | Bacteria | 8306 |
| 657 | Ga0495611_0000003 | 3300046648 | Bacteria | 395679 |
| 658 | Ga0495611_0000028 | 3300046648 | Bacteria | 116155 |
| 659 | Ga0495625_0000193 | 3300046660 | Bacteria | 97042 |
| 660 | Ga0495625_0006388 | 3300046660 | Bacteria | 10509 |
| 661 | Ga0495625_0015849 | 3300046660 | Bacteria | 5949 |
| 662 | Ga0495625_0048981 | 3300046660 | Bacteria | 3038 |
| 663 | Ga0495625_0090097 | 3300046660 | Bacteria | 2122 |
| 664 | Ga0495661_0001277 | 3300046665 | Bacteria | 21603 |
| 665 | Ga0495670_0000413 | 3300046691 | Bacteria | 20501 |
| 666 | Ga0495670_0013548 | 3300046691 | Bacteria | 4010 |
| 667 | Ga0495670_0026664 | 3300046691 | Bacteria | 2860 |
| 668 | Ga0495671_0000142 | 3300046692 | Bacteria | 63300 |
| 669 | Ga0495649_0009358 | 3300046694 | Bacteria | 5830 |
| 670 | Ga0495649_0023421 | 3300046694 | Bacteria | 3450 |
| 671 | Ga0495589_0000042 | 3300046794 | Bacteria | 138627 |
| 672 | Ga0495660_0004438 | 3300046810 | Bacteria | 8484 |
| 673 | Ga0495660_0010465 | 3300046810 | Bacteria | 5394 |
| 674 | Ga0495683_0000722 | 3300047323 | Bacteria | 24066 |
| 675 | Ga0495679_000046 | 3300047446 | Bacteria | 132566 |
| 676 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 677 | Ga0495673_0000041 | 3300047469 | Bacteria | 296723 |
| 678 | Ga0495673_0004939 | 3300047469 | Bacteria | 8207 |
| 679 | Ga0495681_0111495 | 3300047470 | Bacteria | 1184 |
| 680 | Ga0495686_0000117 | 3300047472 | Bacteria | 166073 |
| 681 | Ga0495686_0000229 | 3300047472 | Bacteria | 103283 |
| 682 | Ga0495686_0002823 | 3300047472 | Bacteria | 15713 |
| 683 | Ga0495686_0007664 | 3300047472 | Bacteria | 8057 |
| 684 | Ga0495686_0011281 | 3300047472 | Bacteria | 6299 |
| 685 | Ga0495686_0023910 | 3300047472 | Bacteria | 4019 |
| 686 | Ga0496100_0090442 | 3300048903 | Bacteria | 2087 |
| 687 | Ga0496101_0004110 | 3300048904 | Bacteria | 9109 |
| 688 | Ga0496102_0197553 | 3300048905 | Bacteria | 1896 |
| 689 | Ga0496102_0413565 | 3300048905 | Bacteria | 1267 |
| 690 | Ga0496103_0026448 | 3300048906 | Bacteria | 3513 |
| 691 | Ga0496104_0031058 | 3300048907 | Bacteria | 4966 |
| 692 | Ga0496104_0194060 | 3300048907 | Bacteria | 1943 |
| 693 | Ga0496105_0042555 | 3300048908 | Bacteria | 3744 |
| 694 | Ga0496106_0001877 | 3300048909 | Bacteria | 15732 |
| 695 | Ga0496106_0199612 | 3300048909 | Bacteria | 1592 |
| 696 | Ga0496107_0092139 | 3300048910 | Bacteria | 2215 |
| 697 | Ga0496108_0260772 | 3300048911 | Bacteria | 1508 |
| 698 | Ga0496113_0011788 | 3300048916 | Bacteria | 5854 |
| 699 | Ga0496114_0067958 | 3300048917 | Bacteria | 2991 |
| 700 | Ga0496115_0000196 | 3300048918 | Bacteria | 56608 |
| 701 | Ga0496115_0000440 | 3300048918 | Bacteria | 33623 |
| 702 | Ga0496115_0032843 | 3300048918 | Bacteria | 4096 |
| 703 | Ga0496115_0214530 | 3300048918 | Bacteria | 1589 |
| 704 | Ga0496115_0733924 | 3300048918 | Bacteria | 774 |
| 705 | Ga0496116_0042941 | 3300048919 | Bacteria | 3084 |
| 706 | Ga0496116_0077088 | 3300048919 | Bacteria | 2085 |
| 707 | Ga0496116_0086439 | 3300048919 | Bacteria | 1924 |
| 708 | Ga0496116_0190880 | 3300048919 | Bacteria | 1084 |
| 709 | Ga0496117_0023133 | 3300048920 | Bacteria | 4963 |
| 710 | Ga0496117_0029156 | 3300048920 | Bacteria | 4259 |
| 711 | Ga0496117_0030912 | 3300048920 | Bacteria | 4099 |
| 712 | Ga0496117_0103448 | 3300048920 | Bacteria | 1795 |
| 713 | Ga0496117_0309500 | 3300048920 | Bacteria | 832 |
| 714 | Ga0496118_0001472 | 3300048921 | Bacteria | 35272 |
| 715 | Ga0496118_0002903 | 3300048921 | Bacteria | 22296 |
| 716 | Ga0496118_0005217 | 3300048921 | Bacteria | 14858 |
| 717 | Ga0496118_0006396 | 3300048921 | Bacteria | 12971 |
| 718 | Ga0496118_0008697 | 3300048921 | Bacteria | 10434 |
| 719 | Ga0496118_0087591 | 3300048921 | Bacteria | 2159 |
| 720 | Ga0496118_0222566 | 3300048921 | Bacteria | 1097 |
| 721 | Ga0496118_0420987 | 3300048921 | Bacteria | 687 |
| 722 | Ga0496119_0000201 | 3300048922 | Bacteria | 84438 |
| 723 | Ga0496119_0005372 | 3300048922 | Bacteria | 12317 |
| 724 | Ga0496119_0018397 | 3300048922 | Bacteria | 5202 |
| 725 | Ga0496120_0000189 | 3300048923 | Bacteria | 105313 |
| 726 | Ga0496120_0000837 | 3300048923 | Bacteria | 43826 |
| 727 | Ga0496121_0000419 | 3300048924 | Bacteria | 84137 |
| 728 | Ga0496121_0000771 | 3300048924 | Bacteria | 58811 |
| 729 | Ga0496121_0001298 | 3300048924 | Bacteria | 42922 |
| 730 | Ga0496121_0003299 | 3300048924 | Bacteria | 23175 |
| 731 | Ga0496121_0014080 | 3300048924 | Bacteria | 8531 |
| 732 | Ga0496121_0032700 | 3300048924 | Bacteria | 4722 |
| 733 | Ga0496121_0051673 | 3300048924 | Bacteria | 3459 |
| 734 | Ga0496121_0064333 | 3300048924 | Bacteria | 2991 |
| 735 | Ga0496121_0071241 | 3300048924 | Bacteria | 2796 |
| 736 | Ga0496121_0363267 | 3300048924 | Bacteria | 960 |
| 737 | Ga0496121_0401542 | 3300048924 | Bacteria | 897 |
| 738 | Ga0496121_0630530 | 3300048924 | Bacteria | 656 |
| 739 | Ga0496122_0001358 | 3300048925 | Bacteria | 39854 |
| 740 | Ga0496122_0007321 | 3300048925 | Bacteria | 12323 |
| 741 | Ga0496122_0019348 | 3300048925 | Bacteria | 6224 |
| 742 | Ga0496122_0082530 | 3300048925 | Bacteria | 2232 |
| 743 | Ga0496122_0116918 | 3300048925 | Bacteria | 1733 |
| 744 | Ga0496123_0004282 | 3300048926 | Bacteria | 15181 |
| 745 | Ga0496123_0004978 | 3300048926 | Bacteria | 13609 |
| 746 | Ga0496123_0009820 | 3300048926 | Bacteria | 8547 |
| 747 | Ga0496123_0042437 | 3300048926 | Bacteria | 3139 |
| 748 | Ga0496123_0096190 | 3300048926 | Bacteria | 1739 |
| 749 | Ga0496124_0000203 | 3300048927 | Bacteria | 117239 |
| 750 | Ga0496124_0001473 | 3300048927 | Bacteria | 34592 |
| 751 | Ga0496124_0109481 | 3300048927 | Bacteria | 2226 |
| 752 | Ga0496125_0001450 | 3300048928 | Bacteria | 34494 |
| 753 | Ga0496125_0008488 | 3300048928 | Bacteria | 10750 |
| 754 | Ga0496125_0027584 | 3300048928 | Bacteria | 5146 |
| 755 | Ga0496125_0152162 | 3300048928 | Bacteria | 1587 |
| 756 | Ga0496126_0001528 | 3300048929 | Bacteria | 35621 |
| 757 | Ga0496126_0009745 | 3300048929 | Bacteria | 10172 |
| 758 | Ga0496126_0016296 | 3300048929 | Bacteria | 7438 |
| 759 | Ga0496126_0052949 | 3300048929 | Bacteria | 3685 |
| 760 | Ga0496126_0062906 | 3300048929 | Bacteria | 3328 |
| 761 | Ga0496126_0070126 | 3300048929 | Bacteria | 3123 |
| 762 | Ga0496126_0073413 | 3300048929 | Bacteria | 3041 |
| 763 | Ga0496126_0319947 | 3300048929 | Bacteria | 1275 |
| 764 | Ga0496126_0442509 | 3300048929 | Bacteria | 1047 |
| 765 | Ga0495678_000066 | 3300049459 | Bacteria | 133706 |
| 766 | Ga0495678_015033 | 3300049459 | Bacteria | 3577 |
| 767 | Ga0495682_0003108 | 3300049460 | Bacteria | 7515 |
| 768 | Ga0495682_0026021 | 3300049460 | Bacteria | 2175 |
| 769 | Ga0495682_0095429 | 3300049460 | Bacteria | 1067 |
| 770 | Ga0501032_0060536 | 3300049569 | Bacteria | 2539 |
| 771 | Ga0501033_0019511 | 3300049570 | Bacteria | 5125 |
| 772 | Ga0501033_0284121 | 3300049570 | Bacteria | 1168 |
| 773 | Ga0501034_0006620 | 3300049571 | Bacteria | 12432 |
| 774 | Ga0501034_0758834 | 3300049571 | Bacteria | 865 |
| 775 | Ga0501036_0394918 | 3300049572 | Bacteria | 1154 |
| 776 | Ga0501037_0018053 | 3300049573 | Bacteria | 5196 |
| 777 | Ga0501037_0152969 | 3300049573 | Bacteria | 1648 |
| 778 | Ga0501038_0015538 | 3300049574 | Bacteria | 6920 |
| 779 | Ga0501038_0418817 | 3300049574 | Bacteria | 1034 |
| 780 | Ga0501039_0120244 | 3300049575 | Bacteria | 2058 |
| 781 | Ga0501039_0358639 | 3300049575 | Bacteria | 1145 |
| 782 | Ga0501043_0022946 | 3300049579 | Bacteria | 4893 |
| 783 | Ga0501043_0031501 | 3300049579 | Bacteria | 4169 |
| 784 | Ga0501043_0086842 | 3300049579 | Bacteria | 2458 |
| 785 | Ga0501043_0196194 | 3300049579 | Bacteria | 1568 |
| 786 | Ga0501043_0255343 | 3300049579 | Bacteria | 1349 |
| 787 | Ga0501046_0008054 | 3300049580 | Bacteria | 9209 |
| 788 | Ga0501046_0200343 | 3300049580 | Bacteria | 1485 |
| 789 | Ga0501046_0234302 | 3300049580 | Bacteria | 1355 |
| 790 | Ga0501047_0002093 | 3300049581 | Bacteria | 19094 |
| 791 | Ga0501047_0003063 | 3300049581 | Bacteria | 15848 |
| 792 | Ga0501047_0045093 | 3300049581 | Bacteria | 4262 |
| 793 | Ga0501047_0059989 | 3300049581 | Bacteria | 3672 |
| 794 | Ga0501047_0060899 | 3300049581 | Bacteria | 3641 |
| 795 | Ga0501047_0140733 | 3300049581 | Bacteria | 2291 |
| 796 | Ga0501048_0065527 | 3300049582 | Bacteria | 2568 |
| 797 | Ga0501048_0111141 | 3300049582 | Bacteria | 1935 |
| 798 | Ga0501067_0000583 | 3300049583 | Bacteria | 19798 |
| 799 | Ga0501068_0184873 | 3300049584 | Bacteria | 1318 |
| 800 | Ga0501069_0001862 | 3300049585 | Bacteria | 10542 |
| 801 | Ga0501069_0002178 | 3300049585 | Bacteria | 9867 |
| 802 | Ga0501069_0026323 | 3300049585 | Bacteria | 3184 |
| 803 | Ga0501069_0066946 | 3300049585 | Bacteria | 2009 |
| 804 | Ga0501069_0113071 | 3300049585 | Bacteria | 1547 |
| 805 | Ga0501070_0004139 | 3300049586 | Bacteria | 12490 |
| 806 | Ga0501070_0004257 | 3300049586 | Bacteria | 12303 |
| 807 | Ga0501070_0061919 | 3300049586 | Bacteria | 3099 |
| 808 | Ga0501070_0066254 | 3300049586 | Bacteria | 2990 |
| 809 | Ga0501070_0146981 | 3300049586 | Bacteria | 1945 |
| 810 | Ga0501070_0458335 | 3300049586 | Bacteria | 1027 |
| 811 | Ga0501071_0008797 | 3300049587 | Bacteria | 6689 |
| 812 | Ga0501072_0002507 | 3300049588 | Bacteria | 13756 |
| 813 | Ga0501072_0143661 | 3300049588 | Bacteria | 1903 |
| 814 | Ga0501073_0008095 | 3300049589 | Bacteria | 7799 |
| 815 | Ga0501073_0015945 | 3300049589 | Bacteria | 5445 |
| 816 | Ga0501073_0159283 | 3300049589 | Bacteria | 1564 |
| 817 | Ga0501073_0209089 | 3300049589 | Bacteria | 1348 |
| 818 | Ga0501073_0284279 | 3300049589 | Bacteria | 1141 |
| 819 | Ga0501074_0003986 | 3300049590 | Bacteria | 10524 |
| 820 | Ga0501074_0005938 | 3300049590 | Bacteria | 8802 |
| 821 | Ga0501074_0025883 | 3300049590 | Bacteria | 4257 |
| 822 | Ga0501074_0062333 | 3300049590 | Bacteria | 2685 |
| 823 | Ga0501074_0065446 | 3300049590 | Bacteria | 2616 |
| 824 | Ga0501074_1063612 | 3300049590 | Bacteria | 568 |
| 825 | Ga0501079_0026319 | 3300049741 | Bacteria | 4461 |
| 826 | Ga0501079_0173661 | 3300049741 | Bacteria | 1680 |
| 827 | Ga0501079_0618568 | 3300049741 | Bacteria | 852 |
| 828 | Ga0501080_0000256 | 3300049742 | Bacteria | 40148 |
| 829 | Ga0501080_0001893 | 3300049742 | Bacteria | 18018 |
| 830 | Ga0501080_0003974 | 3300049742 | Bacteria | 13094 |
| 831 | Ga0501080_0016829 | 3300049742 | Bacteria | 6753 |
| 832 | Ga0501080_0097338 | 3300049742 | Bacteria | 2732 |
| 833 | Ga0501083_0001929 | 3300049744 | Bacteria | 14264 |
| 834 | Ga0501035_0030885 | 3300049822 | Bacteria | 4880 |
| 835 | Ga0501035_0073546 | 3300049822 | Bacteria | 3024 |
| 836 | Ga0501035_0084441 | 3300049822 | Bacteria | 2800 |
| 837 | Ga0501035_0121763 | 3300049822 | Bacteria | 2280 |
| 838 | Ga0501035_0540457 | 3300049822 | Bacteria | 955 |
| 839 | Ga0501044_0003272 | 3300049823 | Bacteria | 18232 |
| 840 | Ga0501044_0007113 | 3300049823 | Bacteria | 12307 |
| 841 | Ga0501044_0007419 | 3300049823 | Bacteria | 12063 |
| 842 | Ga0501044_0014551 | 3300049823 | Bacteria | 8488 |
| 843 | Ga0501044_0114409 | 3300049823 | Bacteria | 2704 |
| 844 | Ga0501044_0205065 | 3300049823 | Bacteria | 1928 |
| 845 | Ga0501044_0296891 | 3300049823 | Bacteria | 1545 |
| 846 | Ga0501044_1283098 | 3300049823 | Bacteria | 599 |
| 847 | nmdc:mga0sz30_92625_c1 | 3300050516 | Bacteria | 1316 |
| 848 | Ga0500643_000036 | 3300053087 | Bacteria | 183253 |
| 849 | Ga0500643_008323 | 3300053087 | Bacteria | 4082 |
| 850 | Ga0500555_001310 | 3300053103 | Bacteria | 7858 |
| 851 | Ga0500597_000016 | 3300053120 | Bacteria | 38903 |
| 852 | Ga0500652_190098 | 3300053131 | Bacteria | 837 |
| 853 | Ga0500633_0001664 | 3300053160 | Bacteria | 4305 |
| 854 | Ga0500645_000639 | 3300053730 | Bacteria | 22272 |
| 855 | Ga0501084_0291415 | 3300054114 | Bacteria | 1379 |
| 856 | Ga0501082_0201301 | 3300060353 | Bacteria | 1732 |
| 857 | Ga0501082_0287069 | 3300060353 | Bacteria | 1432 |
| 858 | Ga0466962_0000272 | 3300061719 | Bacteria | 21817 |
| 859 | Ga0466962_0011816 | 3300061719 | Bacteria | 4203 |
| 860 | Ga0466962_0037551 | 3300061719 | Bacteria | 2319 |
| 861 | Ga0466962_0222261 | 3300061719 | Bacteria | 925 |
| 862 | Ga0466962_0601888 | 3300061719 | Bacteria | 560 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041453 | Ga0451797_1444144 | Ga0451797_1444144_96_530 | 131 |
| 2 | iso_pu_bacteria | 2537561836 | 2538835162 | 141 |
| 3 | iso_pu_bacteria | 2643221562 | 2643829356 | 141 |
| 4 | 3300049822 | Ga0501035_0073546 | Ga0501035_0073546_603_1049 | 143 |
| 5 | 3300049823 | Ga0501044_0007419 | Ga0501044_0007419_2278_2724 | 143 |
| 6 | iso_pu_bacteria | 2842914999 | 2842918672 | 143 |
| 7 | iso_pu_bacteria | 2884411467 | 2884413030 | 143 |
| 8 | iso_pu_bacteria | 2593339238 | 2595447961 | 144 |
| 9 | iso_pu_bacteria | 2739367700 | 2739729927 | 144 |
| 10 | iso_pu_bacteria | 2895395659 | 2895397305 | 144 |
| 11 | iso_pu_bacteria | 2919085039 | 2919087322 | 144 |
| 12 | iso_pu_bacteria | 2928963466 | 2928965885 | 144 |
| 13 | 3300003214 | JGI25165J46597_1030791 | JGI25165J46597_10307911 | 145 |
| 14 | 3300025225 | Ga0209566_102111 | Ga0209566_1021113 | 145 |
| 15 | 3300025246 | Ga0209646_1027599 | Ga0209646_10275992 | 145 |
| 16 | 3300025261 | Ga0209233_1008709 | Ga0209233_10087094 | 145 |
| 17 | 3300049569 | Ga0501032_0060536 | Ga0501032_0060536_493_930 | 145 |
| 18 | 3300049574 | Ga0501038_0418817 | Ga0501038_0418817_146_583 | 145 |
| 19 | 3300049579 | Ga0501043_0031501 | Ga0501043_0031501_1573_2010 | 145 |
| 20 | 3300049580 | Ga0501046_0008054 | Ga0501046_0008054_7872_8309 | 145 |
| 21 | iso_pu_bacteria | 2524614729 | 2525558158 | 145 |
| 22 | iso_pu_bacteria | 2627854209 | 2630649961 | 145 |
| 23 | iso_pu_bacteria | 2718218334 | 2721026089 | 145 |
| 24 | iso_pu_bacteria | 2734482264 | 2735833943 | 145 |
| 25 | iso_pu_bacteria | 2738543009 | 2739229746 | 145 |
| 26 | iso_pu_bacteria | 2818991440 | 2819565567 | 145 |
| 27 | iso_pu_bacteria | 2842918807 | 2842922143 | 145 |
| 28 | iso_pu_bacteria | 2884338543 | 2884341934 | 145 |
| 29 | iso_pu_bacteria | 2904463128 | 2904466059 | 145 |
| 30 | iso_pu_bacteria | 2919404418 | 2919406554 | 145 |
| 31 | iso_pu_bacteria | 2941471342 | 2941474340 | 145 |
| 32 | iso_pu_bacteria | 2953994433 | 2953997261 | 145 |
| 33 | 3300026116 | Ga0207674_10375402 | Ga0207674_103754021 | 146 |
| 34 | 3300031665 | Ga0316575_10029237 | Ga0316575_100292373 | 146 |
| 35 | 3300002067 | JGI24735J21928_10201559 | JGI24735J21928_102015592 | 147 |
| 36 | 3300002737 | JGI25162J39368_1004214 | JGI25162J39368_10042144 | 147 |
| 37 | 3300002738 | JGI25154J39366_1008133 | JGI25154J39366_10081332 | 147 |
| 38 | 3300002741 | JGI25157J39369_1001100 | JGI25157J39369_100110010 | 147 |
| 39 | 3300002741 | JGI25157J39369_1003667 | JGI25157J39369_10036673 | 147 |
| 40 | 3300002771 | JGI25163J39215_1001252 | JGI25163J39215_10012524 | 147 |
| 41 | 3300002772 | JGI25164J39214_1002054 | JGI25164J39214_10020544 | 147 |
| 42 | 3300003214 | JGI25165J46597_1001472 | JGI25165J46597_10014724 | 147 |
| 43 | 3300003761 | Ga0055535_1001444 | Ga0055535_10014444 | 147 |
| 44 | 3300003762 | Ga0055542_1004324 | Ga0055542_10043244 | 147 |
| 45 | 3300003763 | Ga0055529_1001107 | Ga0055529_10011074 | 147 |
| 46 | 3300005439 | Ga0070711_100332269 | Ga0070711_1003322692 | 147 |
| 47 | 3300005455 | Ga0070663_100649466 | Ga0070663_1006494662 | 147 |
| 48 | 3300005458 | Ga0070681_10037306 | Ga0070681_100373065 | 147 |
| 49 | 3300013307 | Ga0157372_10081165 | Ga0157372_100811653 | 147 |
| 50 | 3300015687 | Ga0183368_1002 | Ga0183368_1002728 | 147 |
| 51 | 3300025207 | Ga0209760_100376 | Ga0209760_10037611 | 147 |
| 52 | 3300025224 | Ga0209784_100204 | Ga0209784_10020410 | 147 |
| 53 | 3300025226 | Ga0209674_104333 | Ga0209674_1043334 | 147 |
| 54 | 3300025231 | Ga0207427_100179 | Ga0207427_10017910 | 147 |
| 55 | 3300025233 | Ga0209437_100099 | Ga0209437_10009941 | 147 |
| 56 | 3300025242 | Ga0209258_100119 | Ga0209258_10011911 | 147 |
| 57 | 3300025246 | Ga0209646_1003374 | Ga0209646_10033743 | 147 |
| 58 | 3300025250 | Ga0209026_1000175 | Ga0209026_100017536 | 147 |
| 59 | 3300025250 | Ga0209026_1000276 | Ga0209026_100027651 | 147 |
| 60 | 3300025254 | Ga0209148_1000036 | Ga0209148_1000036310 | 147 |
| 61 | 3300025256 | Ga0209759_1001565 | Ga0209759_100156510 | 147 |
| 62 | 3300025256 | Ga0209759_1048645 | Ga0209759_10486451 | 147 |
| 63 | 3300025261 | Ga0209233_1000040 | Ga0209233_1000040308 | 147 |
| 64 | 3300025272 | Ga0209455_1000164 | Ga0209455_100016441 | 147 |
| 65 | 3300025304 | Ga0209257_1000067 | Ga0209257_1000067142 | 147 |
| 66 | 3300025912 | Ga0207707_10029371 | Ga0207707_100293715 | 147 |
| 67 | 3300025916 | Ga0207663_10040939 | Ga0207663_100409394 | 147 |
| 68 | 3300032002 | Ga0307416_100286179 | Ga0307416_1002861792 | 147 |
| 69 | 3300032005 | Ga0307411_10051057 | Ga0307411_100510572 | 147 |
| 70 | 3300032126 | Ga0307415_100782597 | Ga0307415_1007825972 | 147 |
| 71 | 3300037312 | Ga0395899_0034712 | Ga0395899_0034712_1783_2229 | 147 |
| 72 | 3300037466 | Ga0395898_0018522 | Ga0395898_0018522_4266_4712 | 147 |
| 73 | 3300038443 | Ga0395901_0206518 | Ga0395901_0206518_1166_1612 | 147 |
| 74 | 3300041443 | Ga0451789_0811766 | Ga0451789_0811766_90_545 | 147 |
| 75 | 3300041462 | Ga0451806_671699 | Ga0451806_671699_182_625 | 147 |
| 76 | 3300041498 | Ga0451841_0241459 | Ga0451841_0241459_174_629 | 147 |
| 77 | 3300044694 | Ga0466963_0695281 | Ga0466963_0695281_168_614 | 147 |
| 78 | 3300044842 | Ga0466957_0133691 | Ga0466957_0133691_819_1265 | 147 |
| 79 | 3300048925 | Ga0496122_0007321 | Ga0496122_0007321_912_1376 | 147 |
| 80 | 3300048926 | Ga0496123_0004282 | Ga0496123_0004282_13705_14169 | 147 |
| 81 | 3300048929 | Ga0496126_0052949 | Ga0496126_0052949_990_1454 | 147 |
| 82 | 3300049570 | Ga0501033_0019511 | Ga0501033_0019511_942_1388 | 147 |
| 83 | 3300049570 | Ga0501033_0284121 | Ga0501033_0284121_463_906 | 147 |
| 84 | 3300049571 | Ga0501034_0758834 | Ga0501034_0758834_376_828 | 147 |
| 85 | 3300049573 | Ga0501037_0018053 | Ga0501037_0018053_3270_3722 | 147 |
| 86 | 3300049575 | Ga0501039_0358639 | Ga0501039_0358639_546_989 | 147 |
| 87 | 3300049579 | Ga0501043_0022946 | Ga0501043_0022946_836_1282 | 147 |
| 88 | 3300049580 | Ga0501046_0200343 | Ga0501046_0200343_100_543 | 147 |
| 89 | 3300049581 | Ga0501047_0045093 | Ga0501047_0045093_3578_4030 | 147 |
| 90 | 3300049581 | Ga0501047_0140733 | Ga0501047_0140733_1579_2025 | 147 |
| 91 | 3300049585 | Ga0501069_0113071 | Ga0501069_0113071_464_916 | 147 |
| 92 | 3300049586 | Ga0501070_0066254 | Ga0501070_0066254_1903_2355 | 147 |
| 93 | 3300049587 | Ga0501071_0008797 | Ga0501071_0008797_6061_6513 | 147 |
| 94 | 3300049588 | Ga0501072_0143661 | Ga0501072_0143661_287_739 | 147 |
| 95 | 3300049589 | Ga0501073_0008095 | Ga0501073_0008095_753_1205 | 147 |
| 96 | 3300049590 | Ga0501074_0005938 | Ga0501074_0005938_3448_3900 | 147 |
| 97 | 3300049741 | Ga0501079_0618568 | Ga0501079_0618568_305_757 | 147 |
| 98 | 3300049742 | Ga0501080_0016829 | Ga0501080_0016829_292_744 | 147 |
| 99 | 3300049822 | Ga0501035_0084441 | Ga0501035_0084441_1461_1913 | 147 |
| 100 | 3300049822 | Ga0501035_0540457 | Ga0501035_0540457_359_802 | 147 |
| 101 | 3300049823 | Ga0501044_0014551 | Ga0501044_0014551_4747_5199 | 147 |
| 102 | 3300049823 | Ga0501044_0205065 | Ga0501044_0205065_422_868 | 147 |
| 103 | 3300049823 | Ga0501044_0296891 | Ga0501044_0296891_799_1242 | 147 |
| 104 | 3300061719 | Ga0466962_0601888 | Ga0466962_0601888_92_538 | 147 |
| 105 | 3300001989 | JGI24739J22299_10009804 | JGI24739J22299_100098044 | 148 |
| 106 | 3300001990 | JGI24737J22298_10026518 | JGI24737J22298_100265183 | 148 |
| 107 | 3300001990 | JGI24737J22298_10081336 | JGI24737J22298_100813362 | 148 |
| 108 | 3300002067 | JGI24735J21928_10004013 | JGI24735J21928_100040134 | 148 |
| 109 | 3300002067 | JGI24735J21928_10014324 | JGI24735J21928_100143242 | 148 |
| 110 | 3300002737 | JGI25162J39368_1001457 | JGI25162J39368_100145714 | 148 |
| 111 | 3300002737 | JGI25162J39368_1002014 | JGI25162J39368_10020148 | 148 |
| 112 | 3300002737 | JGI25162J39368_1010547 | JGI25162J39368_10105472 | 148 |
| 113 | 3300002738 | JGI25154J39366_1007917 | JGI25154J39366_10079171 | 148 |
| 114 | 3300002738 | JGI25154J39366_1014669 | JGI25154J39366_10146692 | 148 |
| 115 | 3300002741 | JGI25157J39369_1000224 | JGI25157J39369_100022415 | 148 |
| 116 | 3300002741 | JGI25157J39369_1002245 | JGI25157J39369_10022451 | 148 |
| 117 | 3300002741 | JGI25157J39369_1008184 | JGI25157J39369_10081842 | 148 |
| 118 | 3300002741 | JGI25157J39369_1021350 | JGI25157J39369_10213501 | 148 |
| 119 | 3300002772 | JGI25164J39214_1000164 | JGI25164J39214_100016459 | 148 |
| 120 | 3300002772 | JGI25164J39214_1006974 | JGI25164J39214_10069742 | 148 |
| 121 | 3300003214 | JGI25165J46597_1000317 | JGI25165J46597_100031752 | 148 |
| 122 | 3300003214 | JGI25165J46597_1012862 | JGI25165J46597_10128622 | 148 |
| 123 | 3300003215 | JGI25153J46596_10018510 | JGI25153J46596_100185103 | 148 |
| 124 | 3300003320 | rootH2_10011924 | rootH2_1001192412 | 148 |
| 125 | 3300003578 | Ga0006562J51391_1042664 | Ga0006562J51391_10426649 | 148 |
| 126 | 3300003578 | Ga0006562J51391_1042669 | Ga0006562J51391_10426694 | 148 |
| 127 | 3300003756 | Ga0055533_1002210 | Ga0055533_10022106 | 148 |
| 128 | 3300003756 | Ga0055533_1005210 | Ga0055533_10052102 | 148 |
| 129 | 3300003756 | Ga0055533_1006131 | Ga0055533_10061312 | 148 |
| 130 | 3300003759 | Ga0055525_1000055 | Ga0055525_100005522 | 148 |
| 131 | 3300003760 | Ga0055527_1000116 | Ga0055527_100011642 | 148 |
| 132 | 3300003760 | Ga0055527_1000210 | Ga0055527_100021012 | 148 |
| 133 | 3300003761 | Ga0055535_1000296 | Ga0055535_100029642 | 148 |
| 134 | 3300003761 | Ga0055535_1000454 | Ga0055535_100045423 | 148 |
| 135 | 3300003761 | Ga0055535_1001071 | Ga0055535_10010716 | 148 |
| 136 | 3300003761 | Ga0055535_1002833 | Ga0055535_10028339 | 148 |
| 137 | 3300003762 | Ga0055542_1000056 | Ga0055542_100005643 | 148 |
| 138 | 3300003762 | Ga0055542_1000263 | Ga0055542_10002638 | 148 |
| 139 | 3300003762 | Ga0055542_1000277 | Ga0055542_100027742 | 148 |
| 140 | 3300003762 | Ga0055542_1000468 | Ga0055542_100046823 | 148 |
| 141 | 3300003762 | Ga0055542_1000620 | Ga0055542_100062030 | 148 |
| 142 | 3300003762 | Ga0055542_1028233 | Ga0055542_10282331 | 148 |
| 143 | 3300003763 | Ga0055529_1000253 | Ga0055529_100025358 | 148 |
| 144 | 3300003763 | Ga0055529_1000298 | Ga0055529_100029813 | 148 |
| 145 | 3300003763 | Ga0055529_1000479 | Ga0055529_100047912 | 148 |
| 146 | 3300003763 | Ga0055529_1003276 | Ga0055529_10032765 | 148 |
| 147 | 3300004625 | Ga0055543_1007681 | Ga0055543_10076812 | 148 |
| 148 | 3300005262 | Ga0065165_1000108 | Ga0065165_100010871 | 148 |
| 149 | 3300005262 | Ga0065165_1005855 | Ga0065165_10058552 | 148 |
| 150 | 3300005327 | Ga0070658_10001565 | Ga0070658_1000156523 | 148 |
| 151 | 3300005331 | Ga0070670_100265733 | Ga0070670_1002657332 | 148 |
| 152 | 3300005335 | Ga0070666_10000037 | Ga0070666_100000372 | 148 |
| 153 | 3300005336 | Ga0070680_100460938 | Ga0070680_1004609382 | 148 |
| 154 | 3300005341 | Ga0070691_10533427 | Ga0070691_105334271 | 148 |
| 155 | 3300005344 | Ga0070661_100007367 | Ga0070661_1000073676 | 148 |
| 156 | 3300005344 | Ga0070661_100010149 | Ga0070661_10001014910 | 148 |
| 157 | 3300005347 | Ga0070668_100097591 | Ga0070668_1000975912 | 148 |
| 158 | 3300005365 | Ga0070688_100128609 | Ga0070688_1001286093 | 148 |
| 159 | 3300005367 | Ga0070667_100016061 | Ga0070667_1000160614 | 148 |
| 160 | 3300005435 | Ga0070714_100096930 | Ga0070714_1000969302 | 148 |
| 161 | 3300005436 | Ga0070713_100123179 | Ga0070713_1001231793 | 148 |
| 162 | 3300005455 | Ga0070663_100028573 | Ga0070663_1000285735 | 148 |
| 163 | 3300005455 | Ga0070663_100110496 | Ga0070663_1001104963 | 148 |
| 164 | 3300005455 | Ga0070663_100372822 | Ga0070663_1003728221 | 148 |
| 165 | 3300005456 | Ga0070678_100362546 | Ga0070678_1003625461 | 148 |
| 166 | 3300005458 | Ga0070681_10125600 | Ga0070681_101256003 | 148 |
| 167 | 3300005459 | Ga0068867_101105138 | Ga0068867_1011051382 | 148 |
| 168 | 3300005466 | Ga0070685_10014858 | Ga0070685_100148585 | 148 |
| 169 | 3300005530 | Ga0070679_100055321 | Ga0070679_1000553213 | 148 |
| 170 | 3300005539 | Ga0068853_100265685 | Ga0068853_1002656852 | 148 |
| 171 | 3300005539 | Ga0068853_101225682 | Ga0068853_1012256821 | 148 |
| 172 | 3300005546 | Ga0070696_100007583 | Ga0070696_1000075836 | 148 |
| 173 | 3300005548 | Ga0070665_100010663 | Ga0070665_1000106633 | 148 |
| 174 | 3300005563 | Ga0068855_100122173 | Ga0068855_1001221735 | 148 |
| 175 | 3300005563 | Ga0068855_100212437 | Ga0068855_1002124372 | 148 |
| 176 | 3300005577 | Ga0068857_100013283 | Ga0068857_1000132833 | 148 |
| 177 | 3300005577 | Ga0068857_100061409 | Ga0068857_1000614092 | 148 |
| 178 | 3300005614 | Ga0068856_100007396 | Ga0068856_1000073968 | 148 |
| 179 | 3300005617 | Ga0068859_100324564 | Ga0068859_1003245643 | 148 |
| 180 | 3300005834 | Ga0068851_10000908 | Ga0068851_100009089 | 148 |
| 181 | 3300005842 | Ga0068858_100242140 | Ga0068858_1002421402 | 148 |
| 182 | 3300005843 | Ga0068860_100066993 | Ga0068860_1000669933 | 148 |
| 183 | 3300005843 | Ga0068860_100265669 | Ga0068860_1002656693 | 148 |
| 184 | 3300005844 | Ga0068862_100176956 | Ga0068862_1001769562 | 148 |
| 185 | 3300005844 | Ga0068862_100646975 | Ga0068862_1006469752 | 148 |
| 186 | 3300006186 | Ga0075369_10064511 | Ga0075369_100645112 | 148 |
| 187 | 3300006237 | Ga0097621_100400799 | Ga0097621_1004007992 | 148 |
| 188 | 3300006931 | Ga0097620_100324596 | Ga0097620_1003245963 | 148 |
| 189 | 3300009093 | Ga0105240_10002563 | Ga0105240_1000256318 | 148 |
| 190 | 3300009093 | Ga0105240_10009143 | Ga0105240_100091434 | 148 |
| 191 | 3300009093 | Ga0105240_10009721 | Ga0105240_100097219 | 148 |
| 192 | 3300009093 | Ga0105240_10011172 | Ga0105240_100111724 | 148 |
| 193 | 3300009093 | Ga0105240_10023678 | Ga0105240_100236784 | 148 |
| 194 | 3300009176 | Ga0105242_10762084 | Ga0105242_107620842 | 148 |
| 195 | 3300009545 | Ga0105237_10000084 | Ga0105237_1000008484 | 148 |
| 196 | 3300009545 | Ga0105237_10000675 | Ga0105237_1000067516 | 148 |
| 197 | 3300009551 | Ga0105238_10000131 | Ga0105238_1000013163 | 148 |
| 198 | 3300009551 | Ga0105238_10098301 | Ga0105238_100983012 | 148 |
| 199 | 3300009551 | Ga0105238_10391495 | Ga0105238_103914952 | 148 |
| 200 | 3300010375 | Ga0105239_10000033 | Ga0105239_100000334 | 148 |
| 201 | 3300010375 | Ga0105239_10042913 | Ga0105239_100429132 | 148 |
| 202 | 3300010375 | Ga0105239_10572998 | Ga0105239_105729982 | 148 |
| 203 | 3300012500 | Ga0157314_1000507 | Ga0157314_10005071 | 148 |
| 204 | 3300013104 | Ga0157370_10005440 | Ga0157370_1000544015 | 148 |
| 205 | 3300013104 | Ga0157370_10081025 | Ga0157370_100810255 | 148 |
| 206 | 3300013105 | Ga0157369_10003012 | Ga0157369_1000301212 | 148 |
| 207 | 3300013306 | Ga0163162_10000221 | Ga0163162_1000022138 | 148 |
| 208 | 3300013306 | Ga0163162_10069555 | Ga0163162_100695553 | 148 |
| 209 | 3300013307 | Ga0157372_10173947 | Ga0157372_101739471 | 148 |
| 210 | 3300013307 | Ga0157372_10213378 | Ga0157372_102133782 | 148 |
| 211 | 3300014497 | Ga0182008_10036778 | Ga0182008_100367784 | 148 |
| 212 | 3300014497 | Ga0182008_10191861 | Ga0182008_101918612 | 148 |
| 213 | 3300014969 | Ga0157376_10009210 | Ga0157376_100092108 | 148 |
| 214 | 3300015262 | Ga0182007_10015105 | Ga0182007_100151052 | 148 |
| 215 | 3300015265 | Ga0182005_1000049 | Ga0182005_100004989 | 148 |
| 216 | 3300020070 | Ga0206356_11905763 | Ga0206356_119057632 | 148 |
| 217 | 3300020077 | Ga0206351_10768644 | Ga0206351_107686441 | 148 |
| 218 | 3300022467 | Ga0224712_10128125 | Ga0224712_101281251 | 148 |
| 219 | 3300025226 | Ga0209674_100061 | Ga0209674_100061249 | 148 |
| 220 | 3300025226 | Ga0209674_100077 | Ga0209674_100077128 | 148 |
| 221 | 3300025226 | Ga0209674_100785 | Ga0209674_10078513 | 148 |
| 222 | 3300025228 | Ga0209672_100004 | Ga0209672_1000041142 | 148 |
| 223 | 3300025228 | Ga0209672_100022 | Ga0209672_100022249 | 148 |
| 224 | 3300025228 | Ga0209672_100251 | Ga0209672_10025132 | 148 |
| 225 | 3300025228 | Ga0209672_101130 | Ga0209672_10113012 | 148 |
| 226 | 3300025228 | Ga0209672_101444 | Ga0209672_1014444 | 148 |
| 227 | 3300025230 | Ga0209563_100076 | Ga0209563_10007623 | 148 |
| 228 | 3300025231 | Ga0207427_100111 | Ga0207427_100111100 | 148 |
| 229 | 3300025231 | Ga0207427_100185 | Ga0207427_10018556 | 148 |
| 230 | 3300025231 | Ga0207427_100510 | Ga0207427_10051014 | 148 |
| 231 | 3300025233 | Ga0209437_100113 | Ga0209437_100113146 | 148 |
| 232 | 3300025233 | Ga0209437_100320 | Ga0209437_1003206 | 148 |
| 233 | 3300025233 | Ga0209437_100368 | Ga0209437_1003687 | 148 |
| 234 | 3300025233 | Ga0209437_100782 | Ga0209437_10078210 | 148 |
| 235 | 3300025242 | Ga0209258_100003 | Ga0209258_1000031142 | 148 |
| 236 | 3300025242 | Ga0209258_100004 | Ga0209258_100004131 | 148 |
| 237 | 3300025242 | Ga0209258_100122 | Ga0209258_1001228 | 148 |
| 238 | 3300025242 | Ga0209258_100137 | Ga0209258_100137108 | 148 |
| 239 | 3300025242 | Ga0209258_100376 | Ga0209258_10037645 | 148 |
| 240 | 3300025242 | Ga0209258_106897 | Ga0209258_1068972 | 148 |
| 241 | 3300025246 | Ga0209646_1000985 | Ga0209646_10009859 | 148 |
| 242 | 3300025246 | Ga0209646_1001103 | Ga0209646_10011037 | 148 |
| 243 | 3300025250 | Ga0209026_1000087 | Ga0209026_100008731 | 148 |
| 244 | 3300025250 | Ga0209026_1000274 | Ga0209026_10002745 | 148 |
| 245 | 3300025250 | Ga0209026_1008805 | Ga0209026_10088052 | 148 |
| 246 | 3300025253 | Ga0209677_101477 | Ga0209677_1014774 | 148 |
| 247 | 3300025254 | Ga0209148_1000005 | Ga0209148_10000051327 | 148 |
| 248 | 3300025254 | Ga0209148_1000025 | Ga0209148_1000025446 | 148 |
| 249 | 3300025254 | Ga0209148_1000062 | Ga0209148_1000062152 | 148 |
| 250 | 3300025254 | Ga0209148_1000083 | Ga0209148_1000083125 | 148 |
| 251 | 3300025254 | Ga0209148_1000137 | Ga0209148_1000137108 | 148 |
| 252 | 3300025254 | Ga0209148_1001786 | Ga0209148_10017869 | 148 |
| 253 | 3300025256 | Ga0209759_1000136 | Ga0209759_100013665 | 148 |
| 254 | 3300025256 | Ga0209759_1000320 | Ga0209759_10003209 | 148 |
| 255 | 3300025256 | Ga0209759_1001153 | Ga0209759_10011535 | 148 |
| 256 | 3300025258 | Ga0209129_1000769 | Ga0209129_100076911 | 148 |
| 257 | 3300025261 | Ga0209233_1000075 | Ga0209233_100007578 | 148 |
| 258 | 3300025261 | Ga0209233_1000128 | Ga0209233_1000128164 | 148 |
| 259 | 3300025272 | Ga0209455_1000004 | Ga0209455_10000041142 | 148 |
| 260 | 3300025272 | Ga0209455_1000040 | Ga0209455_1000040158 | 148 |
| 261 | 3300025272 | Ga0209455_1000084 | Ga0209455_1000084125 | 148 |
| 262 | 3300025272 | Ga0209455_1000095 | Ga0209455_1000095114 | 148 |
| 263 | 3300025272 | Ga0209455_1001294 | Ga0209455_10012945 | 148 |
| 264 | 3300025272 | Ga0209455_1007907 | Ga0209455_10079072 | 148 |
| 265 | 3300025297 | Ga0209758_1000301 | Ga0209758_100030120 | 148 |
| 266 | 3300025297 | Ga0209758_1020451 | Ga0209758_10204512 | 148 |
| 267 | 3300025297 | Ga0209758_1047231 | Ga0209758_10472312 | 148 |
| 268 | 3300025302 | Ga0207426_1016040 | Ga0207426_10160403 | 148 |
| 269 | 3300025321 | Ga0207656_10007153 | Ga0207656_100071534 | 148 |
| 270 | 3300025903 | Ga0207680_10000001 | Ga0207680_10000001306 | 148 |
| 271 | 3300025904 | Ga0207647_10002308 | Ga0207647_100023084 | 148 |
| 272 | 3300025904 | Ga0207647_10119619 | Ga0207647_101196192 | 148 |
| 273 | 3300025909 | Ga0207705_10006860 | Ga0207705_100068603 | 148 |
| 274 | 3300025912 | Ga0207707_10006038 | Ga0207707_100060388 | 148 |
| 275 | 3300025913 | Ga0207695_10000588 | Ga0207695_100005884 | 148 |
| 276 | 3300025913 | Ga0207695_10001221 | Ga0207695_1000122113 | 148 |
| 277 | 3300025913 | Ga0207695_10001320 | Ga0207695_1000132013 | 148 |
| 278 | 3300025913 | Ga0207695_10004205 | Ga0207695_100042058 | 148 |
| 279 | 3300025913 | Ga0207695_10123193 | Ga0207695_101231934 | 148 |
| 280 | 3300025914 | Ga0207671_10000011 | Ga0207671_10000011379 | 148 |
| 281 | 3300025914 | Ga0207671_10012799 | Ga0207671_100127994 | 148 |
| 282 | 3300025917 | Ga0207660_10135796 | Ga0207660_101357962 | 148 |
| 283 | 3300025920 | Ga0207649_10006569 | Ga0207649_100065695 | 148 |
| 284 | 3300025920 | Ga0207649_10006704 | Ga0207649_100067045 | 148 |
| 285 | 3300025921 | Ga0207652_10148733 | Ga0207652_101487332 | 148 |
| 286 | 3300025923 | Ga0207681_10897705 | Ga0207681_108977052 | 148 |
| 287 | 3300025924 | Ga0207694_10000654 | Ga0207694_1000065419 | 148 |
| 288 | 3300025924 | Ga0207694_10147134 | Ga0207694_101471342 | 148 |
| 289 | 3300025924 | Ga0207694_10613577 | Ga0207694_106135772 | 148 |
| 290 | 3300025925 | Ga0207650_10230356 | Ga0207650_102303562 | 148 |
| 291 | 3300025928 | Ga0207700_10023119 | Ga0207700_100231193 | 148 |
| 292 | 3300025933 | Ga0207706_10408337 | Ga0207706_104083372 | 148 |
| 293 | 3300025945 | Ga0207679_11742349 | Ga0207679_117423492 | 148 |
| 294 | 3300025949 | Ga0207667_10000219 | Ga0207667_1000021915 | 148 |
| 295 | 3300025949 | Ga0207667_10000446 | Ga0207667_1000044614 | 148 |
| 296 | 3300025949 | Ga0207667_10121219 | Ga0207667_101212192 | 148 |
| 297 | 3300025972 | Ga0207668_10019465 | Ga0207668_100194652 | 148 |
| 298 | 3300025981 | Ga0207640_10000280 | Ga0207640_1000028011 | 148 |
| 299 | 3300025981 | Ga0207640_10322638 | Ga0207640_103226382 | 148 |
| 300 | 3300025986 | Ga0207658_10093031 | Ga0207658_100930312 | 148 |
| 301 | 3300026035 | Ga0207703_10263265 | Ga0207703_102632653 | 148 |
| 302 | 3300026041 | Ga0207639_10642877 | Ga0207639_106428772 | 148 |
| 303 | 3300026041 | Ga0207639_11200587 | Ga0207639_112005872 | 148 |
| 304 | 3300026067 | Ga0207678_10018779 | Ga0207678_100187797 | 148 |
| 305 | 3300026067 | Ga0207678_10040297 | Ga0207678_100402973 | 148 |
| 306 | 3300026078 | Ga0207702_10000132 | Ga0207702_1000013212 | 148 |
| 307 | 3300026078 | Ga0207702_10000338 | Ga0207702_1000033834 | 148 |
| 308 | 3300026078 | Ga0207702_11206364 | Ga0207702_112063642 | 148 |
| 309 | 3300026089 | Ga0207648_10948227 | Ga0207648_109482271 | 148 |
| 310 | 3300026089 | Ga0207648_11103243 | Ga0207648_111032432 | 148 |
| 311 | 3300026116 | Ga0207674_10001145 | Ga0207674_100011457 | 148 |
| 312 | 3300026116 | Ga0207674_10047098 | Ga0207674_100470984 | 148 |
| 313 | 3300026121 | Ga0207683_10394289 | Ga0207683_103942892 | 148 |
| 314 | 3300028379 | Ga0268266_10000075 | Ga0268266_1000007547 | 148 |
| 315 | 3300028380 | Ga0268265_10461712 | Ga0268265_104617122 | 148 |
| 316 | 3300028380 | Ga0268265_11863648 | Ga0268265_118636481 | 148 |
| 317 | 3300028381 | Ga0268264_10079343 | Ga0268264_100793433 | 148 |
| 318 | 3300028381 | Ga0268264_10535999 | Ga0268264_105359992 | 148 |
| 319 | 3300033179 | Ga0307507_10374266 | Ga0307507_103742661 | 148 |
| 320 | 3300037312 | Ga0395899_0000110 | Ga0395899_0000110_1844_2290 | 148 |
| 321 | 3300037312 | Ga0395899_0001023 | Ga0395899_0001023_14004_14450 | 148 |
| 322 | 3300037418 | Ga0395900_0000049 | Ga0395900_0000049_129598_130044 | 148 |
| 323 | 3300037418 | Ga0395900_0000060 | Ga0395900_0000060_74832_75287 | 148 |
| 324 | 3300037466 | Ga0395898_0000023 | Ga0395898_0000023_197025_197471 | 148 |
| 325 | 3300037466 | Ga0395898_0000237 | Ga0395898_0000237_1860_2306 | 148 |
| 326 | 3300038443 | Ga0395901_0117942 | Ga0395901_0117942_205_651 | 148 |
| 327 | 3300041452 | Ga0451793_1777967 | Ga0451793_1777967_42_500 | 148 |
| 328 | 3300041460 | Ga0451802_0035022 | Ga0451802_0035022_132_590 | 148 |
| 329 | 3300042438 | Ga0439459_0061077 | Ga0439459_0061077_288_734 | 148 |
| 330 | 3300044656 | Ga0466969_0038934 | Ga0466969_0038934_114_560 | 148 |
| 331 | 3300044656 | Ga0466969_0088821 | Ga0466969_0088821_235_681 | 148 |
| 332 | 3300044658 | Ga0466972_0038589 | Ga0466972_0038589_1354_1800 | 148 |
| 333 | 3300044662 | Ga0466976_0347589 | Ga0466976_0347589_105_551 | 148 |
| 334 | 3300044672 | Ga0466982_0000018 | Ga0466982_0000018_60096_60542 | 148 |
| 335 | 3300044672 | Ga0466982_0000096 | Ga0466982_0000096_11896_12342 | 148 |
| 336 | 3300044683 | Ga0466965_0150407 | Ga0466965_0150407_11_457 | 148 |
| 337 | 3300044684 | Ga0466966_0008293 | Ga0466966_0008293_1732_2178 | 148 |
| 338 | 3300044684 | Ga0466966_0181364 | Ga0466966_0181364_561_1007 | 148 |
| 339 | 3300044693 | Ga0466961_0001486 | Ga0466961_0001486_12883_13329 | 148 |
| 340 | 3300044693 | Ga0466961_0002537 | Ga0466961_0002537_1170_1616 | 148 |
| 341 | 3300044693 | Ga0466961_0003674 | Ga0466961_0003674_1083_1529 | 148 |
| 342 | 3300044693 | Ga0466961_0003935 | Ga0466961_0003935_4407_4853 | 148 |
| 343 | 3300044693 | Ga0466961_0012833 | Ga0466961_0012833_725_1171 | 148 |
| 344 | 3300044694 | Ga0466963_0207098 | Ga0466963_0207098_517_963 | 148 |
| 345 | 3300044706 | Ga0466964_0001814 | Ga0466964_0001814_1910_2356 | 148 |
| 346 | 3300044706 | Ga0466964_0025129 | Ga0466964_0025129_1473_1919 | 148 |
| 347 | 3300044719 | Ga0466971_0015305 | Ga0466971_0015305_106_552 | 148 |
| 348 | 3300044719 | Ga0466971_0015318 | Ga0466971_0015318_672_1118 | 148 |
| 349 | 3300044719 | Ga0466971_0111559 | Ga0466971_0111559_478_924 | 148 |
| 350 | 3300044735 | Ga0466968_0012411 | Ga0466968_0012411_1032_1478 | 148 |
| 351 | 3300044765 | Ga0466970_0004514 | Ga0466970_0004514_698_1144 | 148 |
| 352 | 3300044765 | Ga0466970_0019296 | Ga0466970_0019296_250_696 | 148 |
| 353 | 3300044842 | Ga0466957_0002919 | Ga0466957_0002919_2466_2912 | 148 |
| 354 | 3300044842 | Ga0466957_0039575 | Ga0466957_0039575_516_962 | 148 |
| 355 | 3300044842 | Ga0466957_0251608 | Ga0466957_0251608_115_561 | 148 |
| 356 | 3300044842 | Ga0466957_0643964 | Ga0466957_0643964_135_581 | 148 |
| 357 | 3300044901 | Ga0466960_0023732 | Ga0466960_0023732_454_900 | 148 |
| 358 | 3300045049 | Ga0466959_0320532 | Ga0466959_0320532_362_808 | 148 |
| 359 | 3300045836 | Ga0466958_0016421 | Ga0466958_0016421_3226_3672 | 148 |
| 360 | 3300045836 | Ga0466958_0025788 | Ga0466958_0025788_1939_2385 | 148 |
| 361 | 3300045836 | Ga0466958_0293822 | Ga0466958_0293822_554_1000 | 148 |
| 362 | 3300045976 | Ga0466967_0318912 | Ga0466967_0318912_65_511 | 148 |
| 363 | 3300046460 | Ga0495638_0000019 | Ga0495638_0000019_159510_159959 | 148 |
| 364 | 3300046460 | Ga0495638_0000406 | Ga0495638_0000406_38575_39021 | 148 |
| 365 | 3300046460 | Ga0495638_0000452 | Ga0495638_0000452_42083_42529 | 148 |
| 366 | 3300046471 | Ga0495650_0000350 | Ga0495650_0000350_48670_49116 | 148 |
| 367 | 3300046471 | Ga0495650_0000466 | Ga0495650_0000466_54850_55296 | 148 |
| 368 | 3300046501 | Ga0495607_0001577 | Ga0495607_0001577_16649_17095 | 148 |
| 369 | 3300046501 | Ga0495607_0007528 | Ga0495607_0007528_5812_6258 | 148 |
| 370 | 3300046507 | Ga0495606_0000016 | Ga0495606_0000016_117723_118169 | 148 |
| 371 | 3300046507 | Ga0495606_0269383 | Ga0495606_0269383_83_529 | 148 |
| 372 | 3300046557 | Ga0495622_0020164 | Ga0495622_0020164_1590_2036 | 148 |
| 373 | 3300046660 | Ga0495625_0015849 | Ga0495625_0015849_4983_5429 | 148 |
| 374 | 3300046660 | Ga0495625_0090097 | Ga0495625_0090097_1606_2052 | 148 |
| 375 | 3300046694 | Ga0495649_0023421 | Ga0495649_0023421_370_816 | 148 |
| 376 | 3300048905 | Ga0496102_0197553 | Ga0496102_0197553_819_1265 | 148 |
| 377 | 3300048907 | Ga0496104_0031058 | Ga0496104_0031058_1724_2170 | 148 |
| 378 | 3300048907 | Ga0496104_0194060 | Ga0496104_0194060_867_1313 | 148 |
| 379 | 3300048908 | Ga0496105_0042555 | Ga0496105_0042555_2740_3186 | 148 |
| 380 | 3300048909 | Ga0496106_0199612 | Ga0496106_0199612_783_1229 | 148 |
| 381 | 3300048910 | Ga0496107_0092139 | Ga0496107_0092139_923_1369 | 148 |
| 382 | 3300048916 | Ga0496113_0011788 | Ga0496113_0011788_152_598 | 148 |
| 383 | 3300048917 | Ga0496114_0067958 | Ga0496114_0067958_1227_1673 | 148 |
| 384 | 3300048918 | Ga0496115_0000196 | Ga0496115_0000196_43820_44266 | 148 |
| 385 | 3300048918 | Ga0496115_0000440 | Ga0496115_0000440_15227_15673 | 148 |
| 386 | 3300048918 | Ga0496115_0032843 | Ga0496115_0032843_2634_3080 | 148 |
| 387 | 3300048918 | Ga0496115_0214530 | Ga0496115_0214530_907_1353 | 148 |
| 388 | 3300048918 | Ga0496115_0733924 | Ga0496115_0733924_25_471 | 148 |
| 389 | 3300048919 | Ga0496116_0042941 | Ga0496116_0042941_1135_1581 | 148 |
| 390 | 3300048919 | Ga0496116_0077088 | Ga0496116_0077088_1029_1475 | 148 |
| 391 | 3300048919 | Ga0496116_0086439 | Ga0496116_0086439_462_908 | 148 |
| 392 | 3300048920 | Ga0496117_0309500 | Ga0496117_0309500_266_712 | 148 |
| 393 | 3300048921 | Ga0496118_0005217 | Ga0496118_0005217_11033_11479 | 148 |
| 394 | 3300048921 | Ga0496118_0087591 | Ga0496118_0087591_24_470 | 148 |
| 395 | 3300048921 | Ga0496118_0222566 | Ga0496118_0222566_549_995 | 148 |
| 396 | 3300048921 | Ga0496118_0420987 | Ga0496118_0420987_151_597 | 148 |
| 397 | 3300048922 | Ga0496119_0000201 | Ga0496119_0000201_80645_81091 | 148 |
| 398 | 3300048922 | Ga0496119_0005372 | Ga0496119_0005372_5334_5780 | 148 |
| 399 | 3300048923 | Ga0496120_0000189 | Ga0496120_0000189_3327_3773 | 148 |
| 400 | 3300048923 | Ga0496120_0000837 | Ga0496120_0000837_8139_8585 | 148 |
| 401 | 3300048924 | Ga0496121_0000419 | Ga0496121_0000419_73685_74131 | 148 |
| 402 | 3300048924 | Ga0496121_0014080 | Ga0496121_0014080_2724_3170 | 148 |
| 403 | 3300048924 | Ga0496121_0051673 | Ga0496121_0051673_2609_3055 | 148 |
| 404 | 3300048924 | Ga0496121_0064333 | Ga0496121_0064333_1506_1952 | 148 |
| 405 | 3300048924 | Ga0496121_0071241 | Ga0496121_0071241_1576_2022 | 148 |
| 406 | 3300048924 | Ga0496121_0401542 | Ga0496121_0401542_102_548 | 148 |
| 407 | 3300048925 | Ga0496122_0019348 | Ga0496122_0019348_4361_4807 | 148 |
| 408 | 3300048926 | Ga0496123_0009820 | Ga0496123_0009820_6544_6990 | 148 |
| 409 | 3300048927 | Ga0496124_0000203 | Ga0496124_0000203_99428_99874 | 148 |
| 410 | 3300048927 | Ga0496124_0001473 | Ga0496124_0001473_17480_17926 | 148 |
| 411 | 3300048927 | Ga0496124_0109481 | Ga0496124_0109481_1037_1483 | 148 |
| 412 | 3300048928 | Ga0496125_0001450 | Ga0496125_0001450_28085_28531 | 148 |
| 413 | 3300048928 | Ga0496125_0027584 | Ga0496125_0027584_144_590 | 148 |
| 414 | 3300048928 | Ga0496125_0152162 | Ga0496125_0152162_627_1073 | 148 |
| 415 | 3300048929 | Ga0496126_0001528 | Ga0496126_0001528_32156_32602 | 148 |
| 416 | 3300048929 | Ga0496126_0009745 | Ga0496126_0009745_8146_8592 | 148 |
| 417 | 3300048929 | Ga0496126_0070126 | Ga0496126_0070126_102_548 | 148 |
| 418 | 3300048929 | Ga0496126_0073413 | Ga0496126_0073413_1811_2257 | 148 |
| 419 | 3300048929 | Ga0496126_0319947 | Ga0496126_0319947_374_820 | 148 |
| 420 | 3300049459 | Ga0495678_015033 | Ga0495678_015033_2327_2773 | 148 |
| 421 | 3300049460 | Ga0495682_0026021 | Ga0495682_0026021_188_634 | 148 |
| 422 | 3300049579 | Ga0501043_0086842 | Ga0501043_0086842_1673_2119 | 148 |
| 423 | 3300049582 | Ga0501048_0065527 | Ga0501048_0065527_841_1287 | 148 |
| 424 | 3300049585 | Ga0501069_0001862 | Ga0501069_0001862_2551_3006 | 148 |
| 425 | 3300049822 | Ga0501035_0121763 | Ga0501035_0121763_1253_1699 | 148 |
| 426 | 3300049823 | Ga0501044_1283098 | Ga0501044_1283098_134_580 | 148 |
| 427 | 3300050516 | nmdc:mga0sz30_92625_c1 | nmdc:mga0sz30_92625_c1_296_742 | 148 |
| 428 | 3300061719 | Ga0466962_0000272 | Ga0466962_0000272_16134_16580 | 148 |
| 429 | 3300061719 | Ga0466962_0011816 | Ga0466962_0011816_2770_3216 | 148 |
| 430 | 3300061719 | Ga0466962_0222261 | Ga0466962_0222261_170_616 | 148 |
| 431 | 3300002075 | JGI24738J21930_10015494 | JGI24738J21930_100154941 | 149 |
| 432 | 3300003567 | Ga0006554J51385_1041028 | Ga0006554J51385_10410282 | 149 |
| 433 | 3300003578 | Ga0006562J51391_1031326 | Ga0006562J51391_10313264 | 149 |
| 434 | 3300005327 | Ga0070658_10523744 | Ga0070658_105237442 | 149 |
| 435 | 3300005331 | Ga0070670_100009171 | Ga0070670_1000091713 | 149 |
| 436 | 3300005335 | Ga0070666_10007269 | Ga0070666_100072698 | 149 |
| 437 | 3300005338 | Ga0068868_100058111 | Ga0068868_1000581112 | 149 |
| 438 | 3300005344 | Ga0070661_100298248 | Ga0070661_1002982482 | 149 |
| 439 | 3300005367 | Ga0070667_100131582 | Ga0070667_1001315822 | 149 |
| 440 | 3300005455 | Ga0070663_100039684 | Ga0070663_1000396844 | 149 |
| 441 | 3300005455 | Ga0070663_100789579 | Ga0070663_1007895791 | 149 |
| 442 | 3300005459 | Ga0068867_100045587 | Ga0068867_1000455873 | 149 |
| 443 | 3300005539 | Ga0068853_100016385 | Ga0068853_1000163856 | 149 |
| 444 | 3300005539 | Ga0068853_100241308 | Ga0068853_1002413083 | 149 |
| 445 | 3300005548 | Ga0070665_100000376 | Ga0070665_10000037620 | 149 |
| 446 | 3300005578 | Ga0068854_100003612 | Ga0068854_1000036127 | 149 |
| 447 | 3300005616 | Ga0068852_100042035 | Ga0068852_1000420353 | 149 |
| 448 | 3300005616 | Ga0068852_100073648 | Ga0068852_1000736484 | 149 |
| 449 | 3300005834 | Ga0068851_10010761 | Ga0068851_100107612 | 149 |
| 450 | 3300005841 | Ga0068863_100981392 | Ga0068863_1009813921 | 149 |
| 451 | 3300005842 | Ga0068858_100000817 | Ga0068858_10000081721 | 149 |
| 452 | 3300006237 | Ga0097621_100324094 | Ga0097621_1003240942 | 149 |
| 453 | 3300006881 | Ga0068865_100427698 | Ga0068865_1004276982 | 149 |
| 454 | 3300009101 | Ga0105247_10002916 | Ga0105247_100029169 | 149 |
| 455 | 3300009177 | Ga0105248_10944372 | Ga0105248_109443722 | 149 |
| 456 | 3300009551 | Ga0105238_10108501 | Ga0105238_101085012 | 149 |
| 457 | 3300009553 | Ga0105249_10007606 | Ga0105249_1000760610 | 149 |
| 458 | 3300011119 | Ga0105246_11968736 | Ga0105246_119687361 | 149 |
| 459 | 3300013104 | Ga0157370_10045998 | Ga0157370_100459984 | 149 |
| 460 | 3300013105 | Ga0157369_10018985 | Ga0157369_100189859 | 149 |
| 461 | 3300013296 | Ga0157374_11003429 | Ga0157374_110034291 | 149 |
| 462 | 3300013306 | Ga0163162_10489642 | Ga0163162_104896422 | 149 |
| 463 | 3300014497 | Ga0182008_10006516 | Ga0182008_100065166 | 149 |
| 464 | 3300014497 | Ga0182008_10021422 | Ga0182008_100214223 | 149 |
| 465 | 3300014968 | Ga0157379_10482832 | Ga0157379_104828322 | 149 |
| 466 | 3300015261 | Ga0182006_1000031 | Ga0182006_100003194 | 149 |
| 467 | 3300015261 | Ga0182006_1000496 | Ga0182006_100049610 | 149 |
| 468 | 3300015262 | Ga0182007_10003787 | Ga0182007_100037875 | 149 |
| 469 | 3300015265 | Ga0182005_1001001 | Ga0182005_10010017 | 149 |
| 470 | 3300015265 | Ga0182005_1002650 | Ga0182005_10026505 | 149 |
| 471 | 3300017792 | Ga0163161_10007409 | Ga0163161_100074097 | 149 |
| 472 | 3300017792 | Ga0163161_10066212 | Ga0163161_100662123 | 149 |
| 473 | 3300025229 | Ga0209147_107974 | Ga0209147_1079742 | 149 |
| 474 | 3300025303 | Ga0209051_1007151 | Ga0209051_10071514 | 149 |
| 475 | 3300025304 | Ga0209257_1039691 | Ga0209257_10396912 | 149 |
| 476 | 3300025321 | Ga0207656_10008269 | Ga0207656_100082694 | 149 |
| 477 | 3300025900 | Ga0207710_10003748 | Ga0207710_100037487 | 149 |
| 478 | 3300025903 | Ga0207680_10001902 | Ga0207680_100019023 | 149 |
| 479 | 3300025904 | Ga0207647_10000034 | Ga0207647_1000003421 | 149 |
| 480 | 3300025904 | Ga0207647_10000262 | Ga0207647_100002629 | 149 |
| 481 | 3300025911 | Ga0207654_10494947 | Ga0207654_104949471 | 149 |
| 482 | 3300025913 | Ga0207695_10027716 | Ga0207695_100277168 | 149 |
| 483 | 3300025913 | Ga0207695_10176528 | Ga0207695_101765283 | 149 |
| 484 | 3300025914 | Ga0207671_10094240 | Ga0207671_100942403 | 149 |
| 485 | 3300025920 | Ga0207649_10249805 | Ga0207649_102498052 | 149 |
| 486 | 3300025920 | Ga0207649_10811832 | Ga0207649_108118322 | 149 |
| 487 | 3300025924 | Ga0207694_10001428 | Ga0207694_1000142821 | 149 |
| 488 | 3300025924 | Ga0207694_10001879 | Ga0207694_1000187919 | 149 |
| 489 | 3300025925 | Ga0207650_10006245 | Ga0207650_100062453 | 149 |
| 490 | 3300025933 | Ga0207706_10004869 | Ga0207706_100048696 | 149 |
| 491 | 3300025938 | Ga0207704_10841111 | Ga0207704_108411111 | 149 |
| 492 | 3300025961 | Ga0207712_10000395 | Ga0207712_100003959 | 149 |
| 493 | 3300025986 | Ga0207658_10213853 | Ga0207658_102138533 | 149 |
| 494 | 3300026023 | Ga0207677_10088491 | Ga0207677_100884913 | 149 |
| 495 | 3300026035 | Ga0207703_10000766 | Ga0207703_1000076614 | 149 |
| 496 | 3300026035 | Ga0207703_10337519 | Ga0207703_103375192 | 149 |
| 497 | 3300026041 | Ga0207639_10000277 | Ga0207639_100002773 | 149 |
| 498 | 3300026041 | Ga0207639_10007555 | Ga0207639_100075557 | 149 |
| 499 | 3300026067 | Ga0207678_10016613 | Ga0207678_100166133 | 149 |
| 500 | 3300026067 | Ga0207678_10106813 | Ga0207678_101068133 | 149 |
| 501 | 3300026088 | Ga0207641_10376307 | Ga0207641_103763072 | 149 |
| 502 | 3300026089 | Ga0207648_10016027 | Ga0207648_100160276 | 149 |
| 503 | 3300028379 | Ga0268266_10000008 | Ga0268266_10000008834 | 149 |
| 504 | 3300031911 | Ga0307412_10043615 | Ga0307412_100436154 | 149 |
| 505 | 3300032002 | Ga0307416_100132487 | Ga0307416_1001324873 | 149 |
| 506 | 3300041404 | Ga0439436_0000032 | Ga0439436_0000032_39050_39499 | 149 |
| 507 | 3300041413 | Ga0439465_0000530 | Ga0439465_0000530_10946_11395 | 149 |
| 508 | 3300041453 | Ga0451797_0113713 | Ga0451797_0113713_614_1075 | 149 |
| 509 | 3300041456 | Ga0451795_0322423 | Ga0451795_0322423_313_762 | 149 |
| 510 | 3300042184 | Ga0450908_000007 | Ga0450908_000007_42630_43079 | 149 |
| 511 | 3300042876 | Ga0451577_0176764 | Ga0451577_0176764_238_696 | 149 |
| 512 | 3300044663 | Ga0466989_0163097 | Ga0466989_0163097_232_681 | 149 |
| 513 | 3300044684 | Ga0466966_0041964 | Ga0466966_0041964_359_808 | 149 |
| 514 | 3300044712 | Ga0453684_0000316 | Ga0453684_0000316_50298_50762 | 149 |
| 515 | 3300044719 | Ga0466971_0001777 | Ga0466971_0001777_8088_8537 | 149 |
| 516 | 3300044735 | Ga0466968_0001797 | Ga0466968_0001797_2919_3368 | 149 |
| 517 | 3300045049 | Ga0466959_0005091 | Ga0466959_0005091_5853_6302 | 149 |
| 518 | 3300045051 | Ga0451576_0000128 | Ga0451576_0000128_37912_38376 | 149 |
| 519 | 3300045836 | Ga0466958_0032951 | Ga0466958_0032951_2072_2521 | 149 |
| 520 | 3300046452 | Ga0495617_000607 | Ga0495617_000607_6678_7127 | 149 |
| 521 | 3300046452 | Ga0495617_001095 | Ga0495617_001095_5731_6180 | 149 |
| 522 | 3300046460 | Ga0495638_0001628 | Ga0495638_0001628_721_1170 | 149 |
| 523 | 3300046471 | Ga0495650_0000869 | Ga0495650_0000869_14225_14674 | 149 |
| 524 | 3300046474 | Ga0495605_0126429 | Ga0495605_0126429_355_804 | 149 |
| 525 | 3300046491 | Ga0495584_0001662 | Ga0495584_0001662_5963_6412 | 149 |
| 526 | 3300046492 | Ga0495585_0001138 | Ga0495585_0001138_491_940 | 149 |
| 527 | 3300046492 | Ga0495585_0040927 | Ga0495585_0040927_491_940 | 149 |
| 528 | 3300046501 | Ga0495607_0000133 | Ga0495607_0000133_9330_9779 | 149 |
| 529 | 3300046506 | Ga0495583_0011255 | Ga0495583_0011255_2431_2880 | 149 |
| 530 | 3300046507 | Ga0495606_0000160 | Ga0495606_0000160_20801_21250 | 149 |
| 531 | 3300046507 | Ga0495606_0001918 | Ga0495606_0001918_21939_22388 | 149 |
| 532 | 3300046507 | Ga0495606_0002253 | Ga0495606_0002253_4877_5326 | 149 |
| 533 | 3300046507 | Ga0495606_0234825 | Ga0495606_0234825_387_836 | 149 |
| 534 | 3300046512 | Ga0495610_0004501 | Ga0495610_0004501_67_516 | 149 |
| 535 | 3300046512 | Ga0495610_0029998 | Ga0495610_0029998_1091_1540 | 149 |
| 536 | 3300046513 | Ga0495616_0000006 | Ga0495616_0000006_105609_106058 | 149 |
| 537 | 3300046513 | Ga0495616_0047917 | Ga0495616_0047917_1223_1672 | 149 |
| 538 | 3300046515 | Ga0495620_0000711 | Ga0495620_0000711_6637_7086 | 149 |
| 539 | 3300046515 | Ga0495620_0097744 | Ga0495620_0097744_515_964 | 149 |
| 540 | 3300046518 | Ga0495631_0000036 | Ga0495631_0000036_45551_46000 | 149 |
| 541 | 3300046518 | Ga0495631_0000318 | Ga0495631_0000318_12077_12526 | 149 |
| 542 | 3300046519 | Ga0495632_0012658 | Ga0495632_0012658_984_1433 | 149 |
| 543 | 3300046519 | Ga0495632_0054517 | Ga0495632_0054517_1218_1667 | 149 |
| 544 | 3300046520 | Ga0495637_0007175 | Ga0495637_0007175_4121_4570 | 149 |
| 545 | 3300046522 | Ga0495643_0177310 | Ga0495643_0177310_189_638 | 149 |
| 546 | 3300046524 | Ga0495648_0000881 | Ga0495648_0000881_26192_26641 | 149 |
| 547 | 3300046538 | Ga0495609_0149052 | Ga0495609_0149052_397_846 | 149 |
| 548 | 3300046557 | Ga0495622_0251985 | Ga0495622_0251985_275_724 | 149 |
| 549 | 3300046616 | Ga0495668_0005730 | Ga0495668_0005730_501_950 | 149 |
| 550 | 3300046648 | Ga0495611_0000003 | Ga0495611_0000003_376421_376870 | 149 |
| 551 | 3300046648 | Ga0495611_0000028 | Ga0495611_0000028_27619_28068 | 149 |
| 552 | 3300046660 | Ga0495625_0000193 | Ga0495625_0000193_18796_19245 | 149 |
| 553 | 3300046660 | Ga0495625_0006388 | Ga0495625_0006388_6772_7221 | 149 |
| 554 | 3300046660 | Ga0495625_0048981 | Ga0495625_0048981_739_1188 | 149 |
| 555 | 3300046665 | Ga0495661_0001277 | Ga0495661_0001277_7164_7613 | 149 |
| 556 | 3300046691 | Ga0495670_0000413 | Ga0495670_0000413_6809_7258 | 149 |
| 557 | 3300046691 | Ga0495670_0013548 | Ga0495670_0013548_2526_2975 | 149 |
| 558 | 3300046691 | Ga0495670_0026664 | Ga0495670_0026664_21_470 | 149 |
| 559 | 3300046692 | Ga0495671_0000142 | Ga0495671_0000142_53523_53972 | 149 |
| 560 | 3300046694 | Ga0495649_0009358 | Ga0495649_0009358_5347_5796 | 149 |
| 561 | 3300046794 | Ga0495589_0000042 | Ga0495589_0000042_19050_19499 | 149 |
| 562 | 3300046810 | Ga0495660_0004438 | Ga0495660_0004438_5320_5769 | 149 |
| 563 | 3300046810 | Ga0495660_0010465 | Ga0495660_0010465_2749_3198 | 149 |
| 564 | 3300047323 | Ga0495683_0000722 | Ga0495683_0000722_18793_19242 | 149 |
| 565 | 3300047446 | Ga0495679_000046 | Ga0495679_000046_18812_19261 | 149 |
| 566 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_582333_582782 | 149 |
| 567 | 3300047469 | Ga0495673_0000041 | Ga0495673_0000041_194115_194564 | 149 |
| 568 | 3300047469 | Ga0495673_0004939 | Ga0495673_0004939_874_1323 | 149 |
| 569 | 3300047470 | Ga0495681_0111495 | Ga0495681_0111495_140_589 | 149 |
| 570 | 3300047472 | Ga0495686_0000117 | Ga0495686_0000117_55136_55585 | 149 |
| 571 | 3300047472 | Ga0495686_0000229 | Ga0495686_0000229_68091_68540 | 149 |
| 572 | 3300047472 | Ga0495686_0002823 | Ga0495686_0002823_7691_8140 | 149 |
| 573 | 3300047472 | Ga0495686_0007664 | Ga0495686_0007664_6468_6917 | 149 |
| 574 | 3300047472 | Ga0495686_0023910 | Ga0495686_0023910_559_1008 | 149 |
| 575 | 3300048903 | Ga0496100_0090442 | Ga0496100_0090442_825_1274 | 149 |
| 576 | 3300048904 | Ga0496101_0004110 | Ga0496101_0004110_7644_8093 | 149 |
| 577 | 3300048905 | Ga0496102_0413565 | Ga0496102_0413565_774_1235 | 149 |
| 578 | 3300048909 | Ga0496106_0001877 | Ga0496106_0001877_10927_11376 | 149 |
| 579 | 3300048911 | Ga0496108_0260772 | Ga0496108_0260772_184_633 | 149 |
| 580 | 3300048919 | Ga0496116_0190880 | Ga0496116_0190880_148_597 | 149 |
| 581 | 3300048920 | Ga0496117_0023133 | Ga0496117_0023133_3666_4115 | 149 |
| 582 | 3300048920 | Ga0496117_0030912 | Ga0496117_0030912_908_1357 | 149 |
| 583 | 3300048921 | Ga0496118_0002903 | Ga0496118_0002903_11013_11462 | 149 |
| 584 | 3300048921 | Ga0496118_0006396 | Ga0496118_0006396_5739_6188 | 149 |
| 585 | 3300048922 | Ga0496119_0018397 | Ga0496119_0018397_1306_1755 | 149 |
| 586 | 3300048924 | Ga0496121_0000771 | Ga0496121_0000771_46798_47247 | 149 |
| 587 | 3300048924 | Ga0496121_0001298 | Ga0496121_0001298_31117_31566 | 149 |
| 588 | 3300048924 | Ga0496121_0003299 | Ga0496121_0003299_9124_9573 | 149 |
| 589 | 3300048924 | Ga0496121_0032700 | Ga0496121_0032700_2692_3141 | 149 |
| 590 | 3300048924 | Ga0496121_0363267 | Ga0496121_0363267_45_506 | 149 |
| 591 | 3300048925 | Ga0496122_0082530 | Ga0496122_0082530_732_1181 | 149 |
| 592 | 3300048925 | Ga0496122_0116918 | Ga0496122_0116918_940_1401 | 149 |
| 593 | 3300048926 | Ga0496123_0042437 | Ga0496123_0042437_185_634 | 149 |
| 594 | 3300048926 | Ga0496123_0096190 | Ga0496123_0096190_935_1384 | 149 |
| 595 | 3300048928 | Ga0496125_0008488 | Ga0496125_0008488_3657_4106 | 149 |
| 596 | 3300048929 | Ga0496126_0016296 | Ga0496126_0016296_3359_3808 | 149 |
| 597 | 3300048929 | Ga0496126_0062906 | Ga0496126_0062906_1131_1592 | 149 |
| 598 | 3300049459 | Ga0495678_000066 | Ga0495678_000066_54776_55225 | 149 |
| 599 | 3300049460 | Ga0495682_0003108 | Ga0495682_0003108_5493_5942 | 149 |
| 600 | 3300049460 | Ga0495682_0095429 | Ga0495682_0095429_494_943 | 149 |
| 601 | 3300053087 | Ga0500643_000036 | Ga0500643_000036_70234_70683 | 149 |
| 602 | 3300053103 | Ga0500555_001310 | Ga0500555_001310_2219_2668 | 149 |
| 603 | 3300053131 | Ga0500652_190098 | Ga0500652_190098_141_590 | 149 |
| 604 | 3300053160 | Ga0500633_0001664 | Ga0500633_0001664_2078_2527 | 149 |
| 605 | 3300053730 | Ga0500645_000639 | Ga0500645_000639_1044_1493 | 149 |
| 606 | 3300061719 | Ga0466962_0037551 | Ga0466962_0037551_1741_2190 | 149 |
| 607 | 3300001904 | JGI24736J21556_1039259 | JGI24736J21556_10392592 | 150 |
| 608 | 3300001915 | JGI24741J21665_1002334 | JGI24741J21665_10023346 | 150 |
| 609 | 3300001915 | JGI24741J21665_1002712 | JGI24741J21665_10027123 | 150 |
| 610 | 3300001979 | JGI24740J21852_10000701 | JGI24740J21852_100007016 | 150 |
| 611 | 3300005327 | Ga0070658_10118601 | Ga0070658_101186013 | 150 |
| 612 | 3300005327 | Ga0070658_10550404 | Ga0070658_105504042 | 150 |
| 613 | 3300005327 | Ga0070658_10614628 | Ga0070658_106146282 | 150 |
| 614 | 3300005329 | Ga0070683_100127162 | Ga0070683_1001271623 | 150 |
| 615 | 3300005329 | Ga0070683_100142437 | Ga0070683_1001424373 | 150 |
| 616 | 3300005329 | Ga0070683_100174384 | Ga0070683_1001743843 | 150 |
| 617 | 3300005330 | Ga0070690_100202766 | Ga0070690_1002027662 | 150 |
| 618 | 3300005330 | Ga0070690_100345793 | Ga0070690_1003457932 | 150 |
| 619 | 3300005335 | Ga0070666_10000487 | Ga0070666_1000048716 | 150 |
| 620 | 3300005336 | Ga0070680_100097990 | Ga0070680_1000979903 | 150 |
| 621 | 3300005337 | Ga0070682_100176722 | Ga0070682_1001767222 | 150 |
| 622 | 3300005339 | Ga0070660_100247365 | Ga0070660_1002473652 | 150 |
| 623 | 3300005339 | Ga0070660_100373620 | Ga0070660_1003736202 | 150 |
| 624 | 3300005339 | Ga0070660_100648008 | Ga0070660_1006480082 | 150 |
| 625 | 3300005341 | Ga0070691_10032937 | Ga0070691_100329373 | 150 |
| 626 | 3300005344 | Ga0070661_100014442 | Ga0070661_1000144426 | 150 |
| 627 | 3300005344 | Ga0070661_100108677 | Ga0070661_1001086773 | 150 |
| 628 | 3300005344 | Ga0070661_100134943 | Ga0070661_1001349433 | 150 |
| 629 | 3300005344 | Ga0070661_100239179 | Ga0070661_1002391792 | 150 |
| 630 | 3300005345 | Ga0070692_10037193 | Ga0070692_100371933 | 150 |
| 631 | 3300005345 | Ga0070692_10105382 | Ga0070692_101053823 | 150 |
| 632 | 3300005355 | Ga0070671_100415382 | Ga0070671_1004153822 | 150 |
| 633 | 3300005366 | Ga0070659_100058492 | Ga0070659_1000584923 | 150 |
| 634 | 3300005367 | Ga0070667_100000072 | Ga0070667_10000007215 | 150 |
| 635 | 3300005367 | Ga0070667_100244360 | Ga0070667_1002443603 | 150 |
| 636 | 3300005367 | Ga0070667_100591501 | Ga0070667_1005915012 | 150 |
| 637 | 3300005445 | Ga0070708_100946346 | Ga0070708_1009463462 | 150 |
| 638 | 3300005455 | Ga0070663_100005396 | Ga0070663_1000053964 | 150 |
| 639 | 3300005455 | Ga0070663_100072087 | Ga0070663_1000720873 | 150 |
| 640 | 3300005455 | Ga0070663_100287078 | Ga0070663_1002870782 | 150 |
| 641 | 3300005455 | Ga0070663_100868267 | Ga0070663_1008682672 | 150 |
| 642 | 3300005458 | Ga0070681_10000151 | Ga0070681_1000015131 | 150 |
| 643 | 3300005458 | Ga0070681_10128599 | Ga0070681_101285993 | 150 |
| 644 | 3300005518 | Ga0070699_100485645 | Ga0070699_1004856452 | 150 |
| 645 | 3300005530 | Ga0070679_100000250 | Ga0070679_10000025022 | 150 |
| 646 | 3300005535 | Ga0070684_100089335 | Ga0070684_1000893353 | 150 |
| 647 | 3300005535 | Ga0070684_100131098 | Ga0070684_1001310983 | 150 |
| 648 | 3300005535 | Ga0070684_100288459 | Ga0070684_1002884592 | 150 |
| 649 | 3300005539 | Ga0068853_100006694 | Ga0068853_1000066943 | 150 |
| 650 | 3300005539 | Ga0068853_100016337 | Ga0068853_1000163377 | 150 |
| 651 | 3300005539 | Ga0068853_100035262 | Ga0068853_1000352622 | 150 |
| 652 | 3300005539 | Ga0068853_100053738 | Ga0068853_1000537383 | 150 |
| 653 | 3300005539 | Ga0068853_101179716 | Ga0068853_1011797162 | 150 |
| 654 | 3300005546 | Ga0070696_100031485 | Ga0070696_1000314853 | 150 |
| 655 | 3300005563 | Ga0068855_100010660 | Ga0068855_1000106607 | 150 |
| 656 | 3300005564 | Ga0070664_100128266 | Ga0070664_1001282663 | 150 |
| 657 | 3300005577 | Ga0068857_100038503 | Ga0068857_1000385035 | 150 |
| 658 | 3300005577 | Ga0068857_100050500 | Ga0068857_1000505005 | 150 |
| 659 | 3300005577 | Ga0068857_100226826 | Ga0068857_1002268261 | 150 |
| 660 | 3300005578 | Ga0068854_100113799 | Ga0068854_1001137992 | 150 |
| 661 | 3300005578 | Ga0068854_100123359 | Ga0068854_1001233592 | 150 |
| 662 | 3300005578 | Ga0068854_100429121 | Ga0068854_1004291212 | 150 |
| 663 | 3300005614 | Ga0068856_100012219 | Ga0068856_1000122197 | 150 |
| 664 | 3300005614 | Ga0068856_100169157 | Ga0068856_1001691573 | 150 |
| 665 | 3300005614 | Ga0068856_100319989 | Ga0068856_1003199892 | 150 |
| 666 | 3300005616 | Ga0068852_100006036 | Ga0068852_1000060366 | 150 |
| 667 | 3300005616 | Ga0068852_100034585 | Ga0068852_1000345853 | 150 |
| 668 | 3300005616 | Ga0068852_100169580 | Ga0068852_1001695802 | 150 |
| 669 | 3300005616 | Ga0068852_100178626 | Ga0068852_1001786263 | 150 |
| 670 | 3300005616 | Ga0068852_100235707 | Ga0068852_1002357072 | 150 |
| 671 | 3300005617 | Ga0068859_101521946 | Ga0068859_1015219462 | 150 |
| 672 | 3300005618 | Ga0068864_100004209 | Ga0068864_10000420910 | 150 |
| 673 | 3300005834 | Ga0068851_10019388 | Ga0068851_100193884 | 150 |
| 674 | 3300005834 | Ga0068851_10196718 | Ga0068851_101967182 | 150 |
| 675 | 3300005841 | Ga0068863_100006254 | Ga0068863_10000625410 | 150 |
| 676 | 3300005841 | Ga0068863_100556207 | Ga0068863_1005562072 | 150 |
| 677 | 3300005842 | Ga0068858_100074088 | Ga0068858_1000740884 | 150 |
| 678 | 3300005842 | Ga0068858_100630593 | Ga0068858_1006305932 | 150 |
| 679 | 3300005842 | Ga0068858_100733808 | Ga0068858_1007338082 | 150 |
| 680 | 3300005843 | Ga0068860_100017401 | Ga0068860_1000174017 | 150 |
| 681 | 3300005843 | Ga0068860_100270877 | Ga0068860_1002708773 | 150 |
| 682 | 3300006237 | Ga0097621_100482046 | Ga0097621_1004820461 | 150 |
| 683 | 3300006358 | Ga0068871_100231117 | Ga0068871_1002311171 | 150 |
| 684 | 3300006931 | Ga0097620_101522031 | Ga0097620_1015220312 | 150 |
| 685 | 3300009093 | Ga0105240_10055889 | Ga0105240_100558892 | 150 |
| 686 | 3300009093 | Ga0105240_10152926 | Ga0105240_101529263 | 150 |
| 687 | 3300009093 | Ga0105240_10256770 | Ga0105240_102567702 | 150 |
| 688 | 3300009093 | Ga0105240_11226200 | Ga0105240_112262002 | 150 |
| 689 | 3300009093 | Ga0105240_11500257 | Ga0105240_115002572 | 150 |
| 690 | 3300009098 | Ga0105245_10286466 | Ga0105245_102864662 | 150 |
| 691 | 3300009098 | Ga0105245_10406451 | Ga0105245_104064512 | 150 |
| 692 | 3300009174 | Ga0105241_10015625 | Ga0105241_100156255 | 150 |
| 693 | 3300009174 | Ga0105241_10094532 | Ga0105241_100945323 | 150 |
| 694 | 3300009174 | Ga0105241_10620362 | Ga0105241_106203622 | 150 |
| 695 | 3300009174 | Ga0105241_11415169 | Ga0105241_114151691 | 150 |
| 696 | 3300009177 | Ga0105248_10000920 | Ga0105248_1000092021 | 150 |
| 697 | 3300009545 | Ga0105237_10008928 | Ga0105237_100089285 | 150 |
| 698 | 3300009545 | Ga0105237_10009642 | Ga0105237_100096429 | 150 |
| 699 | 3300009545 | Ga0105237_11987742 | Ga0105237_119877421 | 150 |
| 700 | 3300009551 | Ga0105238_10005144 | Ga0105238_100051448 | 150 |
| 701 | 3300009551 | Ga0105238_11236530 | Ga0105238_112365302 | 150 |
| 702 | 3300009553 | Ga0105249_10000084 | Ga0105249_1000008498 | 150 |
| 703 | 3300010375 | Ga0105239_10018126 | Ga0105239_100181268 | 150 |
| 704 | 3300010375 | Ga0105239_10106637 | Ga0105239_101066373 | 150 |
| 705 | 3300011119 | Ga0105246_10011815 | Ga0105246_100118152 | 150 |
| 706 | 3300011119 | Ga0105246_10128100 | Ga0105246_101281002 | 150 |
| 707 | 3300013059 | Ga0154012_169161 | Ga0154012_1691612 | 150 |
| 708 | 3300013100 | Ga0157373_10011463 | Ga0157373_100114637 | 150 |
| 709 | 3300013100 | Ga0157373_10100595 | Ga0157373_101005954 | 150 |
| 710 | 3300013102 | Ga0157371_10070400 | Ga0157371_100704002 | 150 |
| 711 | 3300013102 | Ga0157371_10348755 | Ga0157371_103487552 | 150 |
| 712 | 3300013104 | Ga0157370_10023809 | Ga0157370_100238096 | 150 |
| 713 | 3300013105 | Ga0157369_10011973 | Ga0157369_100119739 | 150 |
| 714 | 3300013105 | Ga0157369_10124679 | Ga0157369_101246792 | 150 |
| 715 | 3300013105 | Ga0157369_11419744 | Ga0157369_114197442 | 150 |
| 716 | 3300013307 | Ga0157372_10000334 | Ga0157372_1000033442 | 150 |
| 717 | 3300013307 | Ga0157372_10044203 | Ga0157372_100442034 | 150 |
| 718 | 3300013307 | Ga0157372_10066779 | Ga0157372_100667795 | 150 |
| 719 | 3300013307 | Ga0157372_11449664 | Ga0157372_114496642 | 150 |
| 720 | 3300014325 | Ga0163163_10000112 | Ga0163163_1000011239 | 150 |
| 721 | 3300014325 | Ga0163163_10000585 | Ga0163163_1000058516 | 150 |
| 722 | 3300014497 | Ga0182008_10055909 | Ga0182008_100559092 | 150 |
| 723 | 3300014968 | Ga0157379_10007853 | Ga0157379_100078535 | 150 |
| 724 | 3300020070 | Ga0206356_11026662 | Ga0206356_110266622 | 150 |
| 725 | 3300020077 | Ga0206351_10589011 | Ga0206351_105890113 | 150 |
| 726 | 3300020078 | Ga0206352_10871908 | Ga0206352_108719082 | 150 |
| 727 | 3300020080 | Ga0206350_11455286 | Ga0206350_114552862 | 150 |
| 728 | 3300020081 | Ga0206354_10524459 | Ga0206354_105244592 | 150 |
| 729 | 3300020082 | Ga0206353_10447795 | Ga0206353_104477955 | 150 |
| 730 | 3300020082 | Ga0206353_11143090 | Ga0206353_111430902 | 150 |
| 731 | 3300020610 | Ga0154015_1513628 | Ga0154015_15136283 | 150 |
| 732 | 3300022467 | Ga0224712_10074632 | Ga0224712_100746322 | 150 |
| 733 | 3300025321 | Ga0207656_10119317 | Ga0207656_101193172 | 150 |
| 734 | 3300025903 | Ga0207680_10000598 | Ga0207680_100005988 | 150 |
| 735 | 3300025903 | Ga0207680_10388284 | Ga0207680_103882841 | 150 |
| 736 | 3300025904 | Ga0207647_10002208 | Ga0207647_100022088 | 150 |
| 737 | 3300025904 | Ga0207647_10012004 | Ga0207647_100120045 | 150 |
| 738 | 3300025909 | Ga0207705_10000560 | Ga0207705_1000056011 | 150 |
| 739 | 3300025909 | Ga0207705_10037183 | Ga0207705_100371833 | 150 |
| 740 | 3300025909 | Ga0207705_10112632 | Ga0207705_101126322 | 150 |
| 741 | 3300025909 | Ga0207705_10678893 | Ga0207705_106788932 | 150 |
| 742 | 3300025911 | Ga0207654_10000719 | Ga0207654_100007192 | 150 |
| 743 | 3300025911 | Ga0207654_10005416 | Ga0207654_100054167 | 150 |
| 744 | 3300025911 | Ga0207654_10213287 | Ga0207654_102132872 | 150 |
| 745 | 3300025912 | Ga0207707_10000064 | Ga0207707_1000006434 | 150 |
| 746 | 3300025912 | Ga0207707_10006315 | Ga0207707_100063159 | 150 |
| 747 | 3300025912 | Ga0207707_10094005 | Ga0207707_100940051 | 150 |
| 748 | 3300025913 | Ga0207695_10002529 | Ga0207695_100025292 | 150 |
| 749 | 3300025913 | Ga0207695_10003607 | Ga0207695_1000360717 | 150 |
| 750 | 3300025913 | Ga0207695_10056422 | Ga0207695_100564224 | 150 |
| 751 | 3300025913 | Ga0207695_10103753 | Ga0207695_101037532 | 150 |
| 752 | 3300025913 | Ga0207695_10544900 | Ga0207695_105449002 | 150 |
| 753 | 3300025914 | Ga0207671_10013618 | Ga0207671_100136185 | 150 |
| 754 | 3300025917 | Ga0207660_10001372 | Ga0207660_100013725 | 150 |
| 755 | 3300025917 | Ga0207660_10001813 | Ga0207660_100018138 | 150 |
| 756 | 3300025917 | Ga0207660_10003444 | Ga0207660_100034445 | 150 |
| 757 | 3300025919 | Ga0207657_10002836 | Ga0207657_100028369 | 150 |
| 758 | 3300025919 | Ga0207657_10029335 | Ga0207657_100293353 | 150 |
| 759 | 3300025919 | Ga0207657_10029430 | Ga0207657_100294305 | 150 |
| 760 | 3300025920 | Ga0207649_10001382 | Ga0207649_1000138211 | 150 |
| 761 | 3300025920 | Ga0207649_10010845 | Ga0207649_100108453 | 150 |
| 762 | 3300025921 | Ga0207652_10000019 | Ga0207652_10000019119 | 150 |
| 763 | 3300025921 | Ga0207652_10000801 | Ga0207652_1000080117 | 150 |
| 764 | 3300025921 | Ga0207652_10008959 | Ga0207652_100089592 | 150 |
| 765 | 3300025921 | Ga0207652_10333672 | Ga0207652_103336722 | 150 |
| 766 | 3300025924 | Ga0207694_10048048 | Ga0207694_100480485 | 150 |
| 767 | 3300025924 | Ga0207694_10520874 | Ga0207694_105208742 | 150 |
| 768 | 3300025927 | Ga0207687_10218969 | Ga0207687_102189692 | 150 |
| 769 | 3300025931 | Ga0207644_10735062 | Ga0207644_107350622 | 150 |
| 770 | 3300025932 | Ga0207690_10011845 | Ga0207690_100118455 | 150 |
| 771 | 3300025932 | Ga0207690_10068857 | Ga0207690_100688572 | 150 |
| 772 | 3300025933 | Ga0207706_10133414 | Ga0207706_101334143 | 150 |
| 773 | 3300025941 | Ga0207711_10001918 | Ga0207711_1000191811 | 150 |
| 774 | 3300025944 | Ga0207661_10036981 | Ga0207661_100369815 | 150 |
| 775 | 3300025944 | Ga0207661_10448781 | Ga0207661_104487812 | 150 |
| 776 | 3300025945 | Ga0207679_10054898 | Ga0207679_100548984 | 150 |
| 777 | 3300025949 | Ga0207667_10000574 | Ga0207667_1000057414 | 150 |
| 778 | 3300025949 | Ga0207667_10002469 | Ga0207667_100024695 | 150 |
| 779 | 3300025949 | Ga0207667_10007024 | Ga0207667_100070248 | 150 |
| 780 | 3300025949 | Ga0207667_10204493 | Ga0207667_102044932 | 150 |
| 781 | 3300025961 | Ga0207712_10000140 | Ga0207712_1000014056 | 150 |
| 782 | 3300025981 | Ga0207640_10000495 | Ga0207640_100004955 | 150 |
| 783 | 3300025981 | Ga0207640_10001128 | Ga0207640_100011289 | 150 |
| 784 | 3300025981 | Ga0207640_10037290 | Ga0207640_100372902 | 150 |
| 785 | 3300025986 | Ga0207658_10000997 | Ga0207658_1000099714 | 150 |
| 786 | 3300025986 | Ga0207658_10302291 | Ga0207658_103022912 | 150 |
| 787 | 3300026035 | Ga0207703_10415415 | Ga0207703_104154152 | 150 |
| 788 | 3300026041 | Ga0207639_10002487 | Ga0207639_100024879 | 150 |
| 789 | 3300026041 | Ga0207639_10049181 | Ga0207639_100491815 | 150 |
| 790 | 3300026041 | Ga0207639_10441995 | Ga0207639_104419952 | 150 |
| 791 | 3300026041 | Ga0207639_11168568 | Ga0207639_111685682 | 150 |
| 792 | 3300026067 | Ga0207678_10002665 | Ga0207678_100026659 | 150 |
| 793 | 3300026067 | Ga0207678_10026967 | Ga0207678_100269675 | 150 |
| 794 | 3300026067 | Ga0207678_10027074 | Ga0207678_100270745 | 150 |
| 795 | 3300026067 | Ga0207678_10345286 | Ga0207678_103452862 | 150 |
| 796 | 3300026078 | Ga0207702_10013397 | Ga0207702_100133976 | 150 |
| 797 | 3300026078 | Ga0207702_10054245 | Ga0207702_100542452 | 150 |
| 798 | 3300026078 | Ga0207702_10439479 | Ga0207702_104394792 | 150 |
| 799 | 3300026088 | Ga0207641_10025217 | Ga0207641_100252172 | 150 |
| 800 | 3300026095 | Ga0207676_10038682 | Ga0207676_100386824 | 150 |
| 801 | 3300026116 | Ga0207674_10002886 | Ga0207674_1000288619 | 150 |
| 802 | 3300026116 | Ga0207674_10039493 | Ga0207674_100394933 | 150 |
| 803 | 3300026116 | Ga0207674_10046326 | Ga0207674_100463265 | 150 |
| 804 | 3300026142 | Ga0207698_10000491 | Ga0207698_1000049121 | 150 |
| 805 | 3300026142 | Ga0207698_10006628 | Ga0207698_100066289 | 150 |
| 806 | 3300026142 | Ga0207698_10021688 | Ga0207698_100216882 | 150 |
| 807 | 3300026142 | Ga0207698_12006094 | Ga0207698_120060941 | 150 |
| 808 | 3300028381 | Ga0268264_10003031 | Ga0268264_1000303112 | 150 |
| 809 | 3300028381 | Ga0268264_10386309 | Ga0268264_103863092 | 150 |
| 810 | 3300031507 | Ga0307509_10399468 | Ga0307509_103994682 | 150 |
| 811 | 3300031616 | Ga0307508_10226554 | Ga0307508_102265542 | 150 |
| 812 | 3300031824 | Ga0307413_10477018 | Ga0307413_104770182 | 150 |
| 813 | 3300031911 | Ga0307412_11252999 | Ga0307412_112529992 | 150 |
| 814 | 3300032004 | Ga0307414_10094121 | Ga0307414_100941212 | 150 |
| 815 | 3300032004 | Ga0307414_10423568 | Ga0307414_104235682 | 150 |
| 816 | 3300032005 | Ga0307411_10259112 | Ga0307411_102591122 | 150 |
| 817 | 3300032005 | Ga0307411_11110105 | Ga0307411_111101051 | 150 |
| 818 | 3300033179 | Ga0307507_10102026 | Ga0307507_101020262 | 150 |
| 819 | 3300037418 | Ga0395900_0102529 | Ga0395900_0102529_1649_2101 | 150 |
| 820 | 3300037418 | Ga0395900_0471806 | Ga0395900_0471806_45_497 | 150 |
| 821 | 3300037466 | Ga0395898_0097752 | Ga0395898_0097752_1890_2342 | 150 |
| 822 | 3300038443 | Ga0395901_0371738 | Ga0395901_0371738_898_1350 | 150 |
| 823 | 3300041456 | Ga0451795_0773849 | Ga0451795_0773849_314_769 | 150 |
| 824 | 3300046519 | Ga0495632_0000010 | Ga0495632_0000010_218021_218473 | 150 |
| 825 | 3300047472 | Ga0495686_0011281 | Ga0495686_0011281_3175_3639 | 150 |
| 826 | 3300048906 | Ga0496103_0026448 | Ga0496103_0026448_216_677 | 150 |
| 827 | 3300048920 | Ga0496117_0029156 | Ga0496117_0029156_1981_2445 | 150 |
| 828 | 3300048920 | Ga0496117_0103448 | Ga0496117_0103448_1049_1513 | 150 |
| 829 | 3300048921 | Ga0496118_0001472 | Ga0496118_0001472_33868_34332 | 150 |
| 830 | 3300048921 | Ga0496118_0008697 | Ga0496118_0008697_4459_4920 | 150 |
| 831 | 3300048924 | Ga0496121_0630530 | Ga0496121_0630530_70_534 | 150 |
| 832 | 3300048925 | Ga0496122_0001358 | Ga0496122_0001358_4927_5391 | 150 |
| 833 | 3300048926 | Ga0496123_0004978 | Ga0496123_0004978_7658_8122 | 150 |
| 834 | 3300048929 | Ga0496126_0442509 | Ga0496126_0442509_16_480 | 150 |
| 835 | 3300049571 | Ga0501034_0006620 | Ga0501034_0006620_5135_5599 | 150 |
| 836 | 3300049572 | Ga0501036_0394918 | Ga0501036_0394918_664_1128 | 150 |
| 837 | 3300049573 | Ga0501037_0152969 | Ga0501037_0152969_948_1412 | 150 |
| 838 | 3300049574 | Ga0501038_0015538 | Ga0501038_0015538_3215_3679 | 150 |
| 839 | 3300049575 | Ga0501039_0120244 | Ga0501039_0120244_89_553 | 150 |
| 840 | 3300049579 | Ga0501043_0196194 | Ga0501043_0196194_692_1156 | 150 |
| 841 | 3300049579 | Ga0501043_0255343 | Ga0501043_0255343_419_883 | 150 |
| 842 | 3300049580 | Ga0501046_0234302 | Ga0501046_0234302_330_794 | 150 |
| 843 | 3300049581 | Ga0501047_0002093 | Ga0501047_0002093_11147_11611 | 150 |
| 844 | 3300049581 | Ga0501047_0003063 | Ga0501047_0003063_1516_1980 | 150 |
| 845 | 3300049581 | Ga0501047_0059989 | Ga0501047_0059989_486_950 | 150 |
| 846 | 3300049581 | Ga0501047_0060899 | Ga0501047_0060899_537_989 | 150 |
| 847 | 3300049582 | Ga0501048_0111141 | Ga0501048_0111141_406_870 | 150 |
| 848 | 3300049583 | Ga0501067_0000583 | Ga0501067_0000583_11991_12455 | 150 |
| 849 | 3300049584 | Ga0501068_0184873 | Ga0501068_0184873_564_1028 | 150 |
| 850 | 3300049585 | Ga0501069_0002178 | Ga0501069_0002178_8351_8815 | 150 |
| 851 | 3300049585 | Ga0501069_0026323 | Ga0501069_0026323_1145_1597 | 150 |
| 852 | 3300049585 | Ga0501069_0066946 | Ga0501069_0066946_1327_1791 | 150 |
| 853 | 3300049586 | Ga0501070_0004139 | Ga0501070_0004139_9363_9815 | 150 |
| 854 | 3300049586 | Ga0501070_0004257 | Ga0501070_0004257_6662_7114 | 150 |
| 855 | 3300049586 | Ga0501070_0061919 | Ga0501070_0061919_256_720 | 150 |
| 856 | 3300049586 | Ga0501070_0146981 | Ga0501070_0146981_748_1200 | 150 |
| 857 | 3300049586 | Ga0501070_0458335 | Ga0501070_0458335_80_544 | 150 |
| 858 | 3300049588 | Ga0501072_0002507 | Ga0501072_0002507_12428_12892 | 150 |
| 859 | 3300049589 | Ga0501073_0015945 | Ga0501073_0015945_256_720 | 150 |
| 860 | 3300049589 | Ga0501073_0159283 | Ga0501073_0159283_709_1173 | 150 |
| 861 | 3300049589 | Ga0501073_0209089 | Ga0501073_0209089_455_919 | 150 |
| 862 | 3300049589 | Ga0501073_0284279 | Ga0501073_0284279_206_658 | 150 |
| 863 | 3300049590 | Ga0501074_0003986 | Ga0501074_0003986_8258_8710 | 150 |
| 864 | 3300049590 | Ga0501074_0025883 | Ga0501074_0025883_117_569 | 150 |
| 865 | 3300049590 | Ga0501074_0062333 | Ga0501074_0062333_1556_2020 | 150 |
| 866 | 3300049590 | Ga0501074_0065446 | Ga0501074_0065446_2137_2601 | 150 |
| 867 | 3300049590 | Ga0501074_1063612 | Ga0501074_1063612_26_478 | 150 |
| 868 | 3300049741 | Ga0501079_0026319 | Ga0501079_0026319_2840_3304 | 150 |
| 869 | 3300049741 | Ga0501079_0173661 | Ga0501079_0173661_776_1240 | 150 |
| 870 | 3300049742 | Ga0501080_0000256 | Ga0501080_0000256_13842_14306 | 150 |
| 871 | 3300049742 | Ga0501080_0001893 | Ga0501080_0001893_9905_10369 | 150 |
| 872 | 3300049742 | Ga0501080_0003974 | Ga0501080_0003974_5454_5906 | 150 |
| 873 | 3300049742 | Ga0501080_0097338 | Ga0501080_0097338_235_690 | 150 |
| 874 | 3300049744 | Ga0501083_0001929 | Ga0501083_0001929_3293_3757 | 150 |
| 875 | 3300049822 | Ga0501035_0030885 | Ga0501035_0030885_1119_1571 | 150 |
| 876 | 3300049823 | Ga0501044_0003272 | Ga0501044_0003272_10731_11195 | 150 |
| 877 | 3300049823 | Ga0501044_0007113 | Ga0501044_0007113_454_906 | 150 |
| 878 | 3300049823 | Ga0501044_0114409 | Ga0501044_0114409_1598_2062 | 150 |
| 879 | 3300053087 | Ga0500643_008323 | Ga0500643_008323_2096_2560 | 150 |
| 880 | 3300053120 | Ga0500597_000016 | Ga0500597_000016_5212_5676 | 150 |
| 881 | 3300054114 | Ga0501084_0291415 | Ga0501084_0291415_441_905 | 150 |
| 882 | 3300060353 | Ga0501082_0201301 | Ga0501082_0201301_45_509 | 150 |
| 883 | 3300060353 | Ga0501082_0287069 | Ga0501082_0287069_535_999 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3imq-assembly1.cif.gz_A | crystal structure of the nusb101-s10(delta loop) complex | 0.9666 | 12 | 147 |
| 3imq-assembly1.cif.gz_A | crystal structure of the nusb101-s10(delta loop) complex | 0.9529 | 12 | 147 |
| 3d3c-assembly3.cif.gz_C | structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. | 0.9471 | 11 | 147 |
| 3d3c-assembly3.cif.gz_C | structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. | 0.934 | 11 | 147 |
| 5lm7-assembly2.cif.gz_D | crystal structure of the lambda n-nus factor complex | 0.9107 | 15 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A780_1_139_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9643 | 10 | 147 | 1.10.940.10 |
| af_P0A780_1_139_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9508 | 10 | 147 | 1.10.940.10 |
| 5lm7D00 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9107 | 15 | 144 | 1.10.940.10 |
| af_Q2FY45_1_129_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9007 | 16 | 139 | 1.10.940.10 |
| af_Q2FZ67_2_133_1.10.940.10 | Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like | 0.9007 | 18 | 139 | 1.10.940.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836PN20-F1-model_v4 | Transcription antitermination factor NusB | 0.9922 | 55 | 149 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A368HI50-F1-model_v4 | Transcription antitermination factor NusB | 0.9879 | 52 | 145 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A831Z5G0-F1-model_v4 | Transcription antitermination factor NusB | 0.9854 | 59 | 149 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A7X5U9W7-F1-model_v4 | Transcription antitermination protein NusB (Antitermination factor NusB) | 0.9833 | 8 | 150 |
GO:0003723
GO:0005829 GO:0006353 GO:0031564 |
| AF-A0A7J6JU36-F1-model_v4 | deleted | 0.9829 | 50 | 147 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar