F484608

General Info

Members Datasets Scaffolds Average Seq Length
883 338 862 150

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0007419|Ga0501044_0007419_2278_2724
Length 143
Sequence MHARPEGIDLAARSRARRRALQALYAWQLSGSHMNAVIEQFRHEQDMEVADLEYFEDLLHGVEKHVAELDALLRPYLDREPIERAALRLAAYELKHRPDVPYRVVINEAIEVTKRFGADHGHSYVNGVLDKLAGQLRSTEKRA

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
4 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
5 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
6 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
7 2734482264 Dyella sp. AD052 Isolate Unclassified
8 2738543009 Luteibacter sp. OK325 Isolate Unclassified
9 2739367700 Dyella sp. YR388 Isolate Unclassified
10 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
11 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
12 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
13 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
14 2884411467 Dyella sp. AD56 Isolate Rhizosphere
15 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
16 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
17 2919085039 Luteibacter sp. 1214 Isolate Unclassified
18 2919404418 Luteibacter sp. 3190 Isolate Unclassified
19 2928963466 Dyella japonica 1073 Isolate Unclassified
20 2941471342 Luteibacter sp. 621 Isolate Unclassified
21 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
22 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
23 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
31 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
32 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
33 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
42 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
43 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
109 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
149 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
150 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
151 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
203 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
216 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
217 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
218 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
219 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
220 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
221 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
222 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
223 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
224 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
225 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
228 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
229 3300044662 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E Metagenome Unclassified
230 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
231 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
232 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
251 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
277 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
278 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
330 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
331 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
332 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
333 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
334 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
335 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
338 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.7
Metatranscriptomes 1.93
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.89
Nodule 0
Rhizoplane 3.06
Rhizosphere 72.48
Stem 0
Stem Tuber 0
Unclassified 12.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1039259 3300001904 Bacteria 728
2 JGI24741J21665_1002334 3300001915 Bacteria 4974
3 JGI24741J21665_1002712 3300001915 Bacteria 4500
4 JGI24740J21852_10000701 3300001979 Bacteria 14520
5 JGI24739J22299_10009804 3300001989 Bacteria 3561
6 JGI24737J22298_10026518 3300001990 Bacteria 1829
7 JGI24737J22298_10081336 3300001990 Bacteria 964
8 JGI24735J21928_10004013 3300002067 Bacteria 4980
9 JGI24735J21928_10014324 3300002067 Bacteria 2485
10 JGI24735J21928_10201559 3300002067 Bacteria 577
11 JGI24738J21930_10015494 3300002075 Bacteria 1620
12 JGI25162J39368_1001457 3300002737 Bacteria 12519
13 JGI25162J39368_1002014 3300002737 Bacteria 9022
14 JGI25162J39368_1004214 3300002737 Bacteria 3489
15 JGI25162J39368_1010547 3300002737 Bacteria 1161
16 JGI25154J39366_1007917 3300002738 Bacteria 1412
17 JGI25154J39366_1008133 3300002738 Bacteria 1375
18 JGI25154J39366_1014669 3300002738 Bacteria 821
19 JGI25157J39369_1000224 3300002741 Bacteria 44715
20 JGI25157J39369_1001100 3300002741 Bacteria 12060
21 JGI25157J39369_1002245 3300002741 Bacteria 5204
22 JGI25157J39369_1003667 3300002741 Bacteria 3041
23 JGI25157J39369_1008184 3300002741 Bacteria 1466
24 JGI25157J39369_1021350 3300002741 Bacteria 770
25 JGI25163J39215_1001252 3300002771 Bacteria 4647
26 JGI25164J39214_1000164 3300002772 Bacteria 62780
27 JGI25164J39214_1002054 3300002772 Bacteria 3491
28 JGI25164J39214_1006974 3300002772 Bacteria 1164
29 JGI25165J46597_1000317 3300003214 Bacteria 58133
30 JGI25165J46597_1001472 3300003214 Bacteria 12233
31 JGI25165J46597_1012862 3300003214 Bacteria 1161
32 JGI25165J46597_1030791 3300003214 Bacteria 692
33 JGI25153J46596_10018510 3300003215 Bacteria 2702
34 rootH2_10011924 3300003320 Bacteria 18770
35 Ga0006554J51385_1041028 3300003567 Bacteria 976
36 Ga0006562J51391_1031326 3300003578 Bacteria 7320
37 Ga0006562J51391_1042664 3300003578 Bacteria 8710
38 Ga0006562J51391_1042669 3300003578 Bacteria 3710
39 Ga0055533_1002210 3300003756 Bacteria 4593
40 Ga0055533_1005210 3300003756 Bacteria 2139
41 Ga0055533_1006131 3300003756 Bacteria 1818
42 Ga0055525_1000055 3300003759 Bacteria 215181
43 Ga0055527_1000116 3300003760 Bacteria 57355
44 Ga0055527_1000210 3300003760 Bacteria 37874
45 Ga0055535_1000296 3300003761 Bacteria 51261
46 Ga0055535_1000454 3300003761 Bacteria 37846
47 Ga0055535_1001071 3300003761 Bacteria 16846
48 Ga0055535_1001444 3300003761 Bacteria 12063
49 Ga0055535_1002833 3300003761 Bacteria 5481
50 Ga0055542_1000056 3300003762 Bacteria 167483
51 Ga0055542_1000263 3300003762 Bacteria 58594
52 Ga0055542_1000277 3300003762 Bacteria 57355
53 Ga0055542_1000468 3300003762 Bacteria 37874
54 Ga0055542_1000620 3300003762 Bacteria 30079
55 Ga0055542_1004324 3300003762 Bacteria 3489
56 Ga0055542_1028233 3300003762 Bacteria 741
57 Ga0055529_1000253 3300003763 Bacteria 64782
58 Ga0055529_1000298 3300003763 Bacteria 57355
59 Ga0055529_1000479 3300003763 Bacteria 37884
60 Ga0055529_1001107 3300003763 Bacteria 12033
61 Ga0055529_1003276 3300003763 Bacteria 2735
62 Ga0055543_1007681 3300004625 Bacteria 2464
63 Ga0065165_1000108 3300005262 Bacteria 139605
64 Ga0065165_1005855 3300005262 Bacteria 6689
65 Ga0070658_10001565 3300005327 Bacteria 19405
66 Ga0070658_10118601 3300005327 Bacteria 2197
67 Ga0070658_10523744 3300005327 Bacteria 1025
68 Ga0070658_10550404 3300005327 Bacteria 998
69 Ga0070658_10614628 3300005327 Bacteria 942
70 Ga0070683_100127162 3300005329 Bacteria 2409
71 Ga0070683_100142437 3300005329 Bacteria 2271
72 Ga0070683_100174384 3300005329 Bacteria 2041
73 Ga0070690_100202766 3300005330 Bacteria 1381
74 Ga0070690_100345793 3300005330 Bacteria 1078
75 Ga0070670_100009171 3300005331 Bacteria 8458
76 Ga0070670_100265733 3300005331 Bacteria 1496
77 Ga0070666_10000037 3300005335 Bacteria 116528
78 Ga0070666_10000487 3300005335 Bacteria 23992
79 Ga0070666_10007269 3300005335 Bacteria 6828
80 Ga0070680_100097990 3300005336 Bacteria 2431
81 Ga0070680_100460938 3300005336 Bacteria 1086
82 Ga0070682_100176722 3300005337 Bacteria 1488
83 Ga0068868_100058111 3300005338 Bacteria 3056
84 Ga0070660_100247365 3300005339 Bacteria 1453
85 Ga0070660_100373620 3300005339 Bacteria 1176
86 Ga0070660_100648008 3300005339 Bacteria 884
87 Ga0070691_10032937 3300005341 Bacteria 2436
88 Ga0070691_10533427 3300005341 Bacteria 683
89 Ga0070661_100007367 3300005344 Bacteria 7588
90 Ga0070661_100010149 3300005344 Bacteria 6540
91 Ga0070661_100014442 3300005344 Bacteria 5566
92 Ga0070661_100108677 3300005344 Bacteria 2069
93 Ga0070661_100134943 3300005344 Bacteria 1856
94 Ga0070661_100239179 3300005344 Bacteria 1397
95 Ga0070661_100298248 3300005344 Bacteria 1254
96 Ga0070692_10037193 3300005345 Bacteria 2473
97 Ga0070692_10105382 3300005345 Bacteria 1552
98 Ga0070668_100097591 3300005347 Bacteria 2324
99 Ga0070671_100415382 3300005355 Bacteria 1152
100 Ga0070688_100128609 3300005365 Bacteria 1706
101 Ga0070659_100058492 3300005366 Bacteria 3042
102 Ga0070667_100000072 3300005367 Bacteria 122929
103 Ga0070667_100016061 3300005367 Bacteria 6193
104 Ga0070667_100131582 3300005367 Bacteria 2184
105 Ga0070667_100244360 3300005367 Bacteria 1603
106 Ga0070667_100591501 3300005367 Bacteria 1022
107 Ga0070714_100096930 3300005435 Bacteria 2592
108 Ga0070713_100123179 3300005436 Bacteria 2276
109 Ga0070711_100332269 3300005439 Bacteria 1217
110 Ga0070708_100946346 3300005445 Bacteria 808
111 Ga0070663_100005396 3300005455 Bacteria 7595
112 Ga0070663_100028573 3300005455 Bacteria 3798
113 Ga0070663_100039684 3300005455 Bacteria 3292
114 Ga0070663_100072087 3300005455 Bacteria 2515
115 Ga0070663_100110496 3300005455 Bacteria 2065
116 Ga0070663_100287078 3300005455 Bacteria 1313
117 Ga0070663_100372822 3300005455 Bacteria 1161
118 Ga0070663_100649466 3300005455 Bacteria 892
119 Ga0070663_100789579 3300005455 Bacteria 813
120 Ga0070663_100868267 3300005455 Bacteria 777
121 Ga0070678_100362546 3300005456 Bacteria 1249
122 Ga0070681_10000151 3300005458 Bacteria 52829
123 Ga0070681_10037306 3300005458 Bacteria 4878
124 Ga0070681_10125600 3300005458 Bacteria 2498
125 Ga0070681_10128599 3300005458 Bacteria 2465
126 Ga0068867_100045587 3300005459 Bacteria 3217
127 Ga0068867_101105138 3300005459 Bacteria 724
128 Ga0070685_10014858 3300005466 Bacteria 4129
129 Ga0070699_100485645 3300005518 Bacteria 1121
130 Ga0070679_100000250 3300005530 Bacteria 45069
131 Ga0070679_100055321 3300005530 Bacteria 3951
132 Ga0070684_100089335 3300005535 Bacteria 2738
133 Ga0070684_100131098 3300005535 Bacteria 2261
134 Ga0070684_100288459 3300005535 Bacteria 1504
135 Ga0068853_100006694 3300005539 Bacteria 9179
136 Ga0068853_100016337 3300005539 Bacteria 6107
137 Ga0068853_100016385 3300005539 Bacteria 6099
138 Ga0068853_100035262 3300005539 Bacteria 4248
139 Ga0068853_100053738 3300005539 Bacteria 3469
140 Ga0068853_100241308 3300005539 Bacteria 1656
141 Ga0068853_100265685 3300005539 Bacteria 1579
142 Ga0068853_101179716 3300005539 Bacteria 739
143 Ga0068853_101225682 3300005539 Bacteria 725
144 Ga0070696_100007583 3300005546 Bacteria 7254
145 Ga0070696_100031485 3300005546 Bacteria 3635
146 Ga0070665_100000376 3300005548 Bacteria 66416
147 Ga0070665_100010663 3300005548 Bacteria 9303
148 Ga0068855_100010660 3300005563 Bacteria 11087
149 Ga0068855_100122173 3300005563 Bacteria 2980
150 Ga0068855_100212437 3300005563 Bacteria 2173
151 Ga0070664_100128266 3300005564 Bacteria 2226
152 Ga0068857_100013283 3300005577 Bacteria 7173
153 Ga0068857_100038503 3300005577 Bacteria 4235
154 Ga0068857_100050500 3300005577 Bacteria 3689
155 Ga0068857_100061409 3300005577 Bacteria 3339
156 Ga0068857_100226826 3300005577 Bacteria 1707
157 Ga0068854_100003612 3300005578 Bacteria 9680
158 Ga0068854_100113799 3300005578 Bacteria 2044
159 Ga0068854_100123359 3300005578 Bacteria 1970
160 Ga0068854_100429121 3300005578 Bacteria 1099
161 Ga0068856_100007396 3300005614 Bacteria 10716
162 Ga0068856_100012219 3300005614 Bacteria 8319
163 Ga0068856_100169157 3300005614 Bacteria 2197
164 Ga0068856_100319989 3300005614 Bacteria 1568
165 Ga0068852_100006036 3300005616 Bacteria 8728
166 Ga0068852_100034585 3300005616 Bacteria 4206
167 Ga0068852_100042035 3300005616 Bacteria 3868
168 Ga0068852_100073648 3300005616 Bacteria 3005
169 Ga0068852_100169580 3300005616 Bacteria 2045
170 Ga0068852_100178626 3300005616 Bacteria 1994
171 Ga0068852_100235707 3300005616 Bacteria 1746
172 Ga0068859_100324564 3300005617 Bacteria 1633
173 Ga0068859_101521946 3300005617 Bacteria 738
174 Ga0068864_100004209 3300005618 Bacteria 11834
175 Ga0068851_10000908 3300005834 Bacteria 12753
176 Ga0068851_10010761 3300005834 Bacteria 4275
177 Ga0068851_10019388 3300005834 Bacteria 3286
178 Ga0068851_10196718 3300005834 Bacteria 1123
179 Ga0068863_100006254 3300005841 Bacteria 11695
180 Ga0068863_100556207 3300005841 Bacteria 1133
181 Ga0068863_100981392 3300005841 Bacteria 847
182 Ga0068858_100000817 3300005842 Bacteria 32476
183 Ga0068858_100074088 3300005842 Bacteria 3161
184 Ga0068858_100242140 3300005842 Bacteria 1712
185 Ga0068858_100630593 3300005842 Bacteria 1041
186 Ga0068858_100733808 3300005842 Bacteria 962
187 Ga0068860_100017401 3300005843 Bacteria 7003
188 Ga0068860_100066993 3300005843 Bacteria 3412
189 Ga0068860_100265669 3300005843 Bacteria 1673
190 Ga0068860_100270877 3300005843 Bacteria 1657
191 Ga0068862_100176956 3300005844 Bacteria 1913
192 Ga0068862_100646975 3300005844 Bacteria 1019
193 Ga0075369_10064511 3300006186 Bacteria 1604
194 Ga0097621_100324094 3300006237 Bacteria 1365
195 Ga0097621_100400799 3300006237 Bacteria 1228
196 Ga0097621_100482046 3300006237 Bacteria 1121
197 Ga0068871_100231117 3300006358 Bacteria 1605
198 Ga0068865_100427698 3300006881 Bacteria 1090
199 Ga0097620_100324596 3300006931 Bacteria 1633
200 Ga0097620_101522031 3300006931 Bacteria 738
201 Ga0105240_10002563 3300009093 Bacteria 29133
202 Ga0105240_10009143 3300009093 Bacteria 14064
203 Ga0105240_10009721 3300009093 Bacteria 13581
204 Ga0105240_10011172 3300009093 Bacteria 12533
205 Ga0105240_10023678 3300009093 Bacteria 8112
206 Ga0105240_10055889 3300009093 Bacteria 4941
207 Ga0105240_10152926 3300009093 Bacteria 2746
208 Ga0105240_10256770 3300009093 Bacteria 2018
209 Ga0105240_11226200 3300009093 Bacteria 794
210 Ga0105240_11500257 3300009093 Bacteria 707
211 Ga0105245_10286466 3300009098 Bacteria 1612
212 Ga0105245_10406451 3300009098 Bacteria 1362
213 Ga0105247_10002916 3300009101 Bacteria 11384
214 Ga0105241_10015625 3300009174 Bacteria 5562
215 Ga0105241_10094532 3300009174 Bacteria 2364
216 Ga0105241_10620362 3300009174 Bacteria 979
217 Ga0105241_11415169 3300009174 Bacteria 666
218 Ga0105242_10762084 3300009176 Bacteria 954
219 Ga0105248_10000920 3300009177 Bacteria 32785
220 Ga0105248_10944372 3300009177 Bacteria 974
221 Ga0105237_10000084 3300009545 Bacteria 125742
222 Ga0105237_10000675 3300009545 Bacteria 47159
223 Ga0105237_10008928 3300009545 Bacteria 10796
224 Ga0105237_10009642 3300009545 Bacteria 10335
225 Ga0105237_11987742 3300009545 Bacteria 590
226 Ga0105238_10000131 3300009551 Bacteria 82050
227 Ga0105238_10005144 3300009551 Bacteria 12931
228 Ga0105238_10098301 3300009551 Bacteria 2911
229 Ga0105238_10108501 3300009551 Bacteria 2757
230 Ga0105238_10391495 3300009551 Bacteria 1382
231 Ga0105238_11236530 3300009551 Bacteria 772
232 Ga0105249_10000084 3300009553 Bacteria 134869
233 Ga0105249_10007606 3300009553 Bacteria 9453
234 Ga0105239_10000033 3300010375 Bacteria 223933
235 Ga0105239_10018126 3300010375 Bacteria 7783
236 Ga0105239_10042913 3300010375 Bacteria 4955
237 Ga0105239_10106637 3300010375 Bacteria 3104
238 Ga0105239_10572998 3300010375 Bacteria 1286
239 Ga0105246_10011815 3300011119 Bacteria 5427
240 Ga0105246_10128100 3300011119 Bacteria 1892
241 Ga0105246_11968736 3300011119 Bacteria 563
242 Ga0157314_1000507 3300012500 Bacteria 3702
243 Ga0154012_169161 3300013059 Bacteria 1120
244 Ga0157373_10011463 3300013100 Bacteria 6519
245 Ga0157373_10100595 3300013100 Bacteria 2034
246 Ga0157371_10070400 3300013102 Bacteria 2476
247 Ga0157371_10348755 3300013102 Bacteria 1077
248 Ga0157370_10005440 3300013104 Bacteria 14285
249 Ga0157370_10023809 3300013104 Bacteria 6075
250 Ga0157370_10045998 3300013104 Bacteria 4186
251 Ga0157370_10081025 3300013104 Bacteria 3055
252 Ga0157369_10003012 3300013105 Bacteria 20149
253 Ga0157369_10011973 3300013105 Bacteria 9855
254 Ga0157369_10018985 3300013105 Bacteria 7700
255 Ga0157369_10124679 3300013105 Bacteria 2732
256 Ga0157369_11419744 3300013105 Bacteria 707
257 Ga0157374_11003429 3300013296 Bacteria 854
258 Ga0163162_10000221 3300013306 Bacteria 52249
259 Ga0163162_10069555 3300013306 Bacteria 3572
260 Ga0163162_10489642 3300013306 Bacteria 1361
261 Ga0157372_10000334 3300013307 Bacteria 51813
262 Ga0157372_10044203 3300013307 Bacteria 4935
263 Ga0157372_10066779 3300013307 Bacteria 4041
264 Ga0157372_10081165 3300013307 Bacteria 3670
265 Ga0157372_10173947 3300013307 Bacteria 2492
266 Ga0157372_10213378 3300013307 Bacteria 2237
267 Ga0157372_11449664 3300013307 Bacteria 791
268 Ga0163163_10000112 3300014325 Bacteria 86324
269 Ga0163163_10000585 3300014325 Bacteria 32121
270 Ga0182008_10006516 3300014497 Bacteria 6516
271 Ga0182008_10021422 3300014497 Bacteria 3318
272 Ga0182008_10036778 3300014497 Bacteria 2449
273 Ga0182008_10055909 3300014497 Bacteria 1951
274 Ga0182008_10191861 3300014497 Bacteria 1037
275 Ga0157379_10007853 3300014968 Bacteria 9242
276 Ga0157379_10482832 3300014968 Bacteria 1147
277 Ga0157376_10009210 3300014969 Bacteria 7162
278 Ga0182006_1000031 3300015261 Bacteria 240055
279 Ga0182006_1000496 3300015261 Bacteria 30592
280 Ga0182007_10003787 3300015262 Bacteria 7047
281 Ga0182007_10015105 3300015262 Bacteria 2890
282 Ga0182005_1000049 3300015265 Bacteria 123003
283 Ga0182005_1001001 3300015265 Bacteria 12121
284 Ga0182005_1002650 3300015265 Bacteria 6301
285 Ga0183368_1002 3300015687 Bacteria 1865598
286 Ga0163161_10007409 3300017792 Bacteria 7580
287 Ga0163161_10066212 3300017792 Bacteria 2638
288 Ga0206356_11026662 3300020070 Bacteria 4285
289 Ga0206356_11905763 3300020070 Bacteria 1398
290 Ga0206351_10589011 3300020077 Bacteria 1281
291 Ga0206351_10768644 3300020077 Bacteria 1101
292 Ga0206352_10871908 3300020078 Bacteria 1811
293 Ga0206350_11455286 3300020080 Bacteria 1708
294 Ga0206354_10524459 3300020081 Bacteria 4072
295 Ga0206353_10447795 3300020082 Bacteria 2783
296 Ga0206353_11143090 3300020082 Bacteria 799
297 Ga0154015_1513628 3300020610 Bacteria 2906
298 Ga0224712_10074632 3300022467 Bacteria 1386
299 Ga0224712_10128125 3300022467 Bacteria 1106
300 Ga0209760_100376 3300025207 Bacteria 11760
301 Ga0209784_100204 3300025224 Bacteria 42366
302 Ga0209566_102111 3300025225 Bacteria 4074
303 Ga0209674_100061 3300025226 Bacteria 280844
304 Ga0209674_100077 3300025226 Bacteria 206312
305 Ga0209674_100785 3300025226 Bacteria 10709
306 Ga0209674_104333 3300025226 Bacteria 2331
307 Ga0209672_100004 3300025228 Bacteria 1467504
308 Ga0209672_100022 3300025228 Bacteria 374313
309 Ga0209672_100251 3300025228 Bacteria 39907
310 Ga0209672_101130 3300025228 Bacteria 11110
311 Ga0209672_101444 3300025228 Bacteria 8507
312 Ga0209147_107974 3300025229 Bacteria 1344
313 Ga0209563_100076 3300025230 Bacteria 215269
314 Ga0207427_100111 3300025231 Bacteria 112775
315 Ga0207427_100179 3300025231 Bacteria 67665
316 Ga0207427_100185 3300025231 Bacteria 63916
317 Ga0207427_100510 3300025231 Bacteria 20592
318 Ga0209437_100099 3300025233 Bacteria 229500
319 Ga0209437_100113 3300025233 Bacteria 211240
320 Ga0209437_100320 3300025233 Bacteria 62893
321 Ga0209437_100368 3300025233 Bacteria 48548
322 Ga0209437_100782 3300025233 Bacteria 14969
323 Ga0209258_100003 3300025242 Bacteria 1467504
324 Ga0209258_100004 3300025242 Bacteria 1376422
325 Ga0209258_100119 3300025242 Bacteria 183554
326 Ga0209258_100122 3300025242 Bacteria 180314
327 Ga0209258_100137 3300025242 Bacteria 167913
328 Ga0209258_100376 3300025242 Bacteria 57517
329 Ga0209258_106897 3300025242 Bacteria 1730
330 Ga0209646_1000985 3300025246 Bacteria 8811
331 Ga0209646_1001103 3300025246 Bacteria 7995
332 Ga0209646_1003374 3300025246 Bacteria 3173
333 Ga0209646_1027599 3300025246 Bacteria 781
334 Ga0209026_1000087 3300025250 Bacteria 184044
335 Ga0209026_1000175 3300025250 Bacteria 98059
336 Ga0209026_1000274 3300025250 Bacteria 61312
337 Ga0209026_1000276 3300025250 Bacteria 60964
338 Ga0209026_1008805 3300025250 Bacteria 2059
339 Ga0209677_101477 3300025253 Bacteria 10113
340 Ga0209148_1000005 3300025254 Bacteria 1806504
341 Ga0209148_1000025 3300025254 Bacteria 663262
342 Ga0209148_1000036 3300025254 Bacteria 530505
343 Ga0209148_1000062 3300025254 Bacteria 347704
344 Ga0209148_1000083 3300025254 Bacteria 270142
345 Ga0209148_1000137 3300025254 Bacteria 168097
346 Ga0209148_1001786 3300025254 Bacteria 9177
347 Ga0209759_1000136 3300025256 Bacteria 125393
348 Ga0209759_1000320 3300025256 Bacteria 63830
349 Ga0209759_1001153 3300025256 Bacteria 16782
350 Ga0209759_1001565 3300025256 Bacteria 12489
351 Ga0209759_1048645 3300025256 Bacteria 669
352 Ga0209129_1000769 3300025258 Bacteria 20356
353 Ga0209233_1000040 3300025261 Bacteria 530395
354 Ga0209233_1000075 3300025261 Bacteria 356837
355 Ga0209233_1000128 3300025261 Bacteria 209927
356 Ga0209233_1008709 3300025261 Bacteria 3119
357 Ga0209455_1000004 3300025272 Bacteria 1467504
358 Ga0209455_1000040 3300025272 Bacteria 430197
359 Ga0209455_1000084 3300025272 Bacteria 253164
360 Ga0209455_1000095 3300025272 Bacteria 217487
361 Ga0209455_1000164 3300025272 Bacteria 114011
362 Ga0209455_1001294 3300025272 Bacteria 11681
363 Ga0209455_1007907 3300025272 Bacteria 2947
364 Ga0209758_1000301 3300025297 Bacteria 96998
365 Ga0209758_1020451 3300025297 Bacteria 3131
366 Ga0209758_1047231 3300025297 Bacteria 1543
367 Ga0207426_1016040 3300025302 Bacteria 2702
368 Ga0209051_1007151 3300025303 Bacteria 6152
369 Ga0209257_1000067 3300025304 Bacteria 342468
370 Ga0209257_1039691 3300025304 Bacteria 1412
371 Ga0207656_10007153 3300025321 Bacteria 4056
372 Ga0207656_10008269 3300025321 Bacteria 3820
373 Ga0207656_10119317 3300025321 Bacteria 1226
374 Ga0207710_10003748 3300025900 Bacteria 6728
375 Ga0207680_10000001 3300025903 Bacteria 1091453
376 Ga0207680_10000598 3300025903 Bacteria 17011
377 Ga0207680_10001902 3300025903 Bacteria 9799
378 Ga0207680_10388284 3300025903 Bacteria 985
379 Ga0207647_10000034 3300025904 Bacteria 99280
380 Ga0207647_10000262 3300025904 Bacteria 43207
381 Ga0207647_10002208 3300025904 Bacteria 14832
382 Ga0207647_10002308 3300025904 Bacteria 14534
383 Ga0207647_10012004 3300025904 Bacteria 6046
384 Ga0207647_10119619 3300025904 Bacteria 1553
385 Ga0207705_10000560 3300025909 Bacteria 31207
386 Ga0207705_10006860 3300025909 Bacteria 8417
387 Ga0207705_10037183 3300025909 Bacteria 3483
388 Ga0207705_10112632 3300025909 Bacteria 2012
389 Ga0207705_10678893 3300025909 Bacteria 801
390 Ga0207654_10000719 3300025911 Bacteria 18479
391 Ga0207654_10005416 3300025911 Bacteria 6455
392 Ga0207654_10213287 3300025911 Bacteria 1277
393 Ga0207654_10494947 3300025911 Bacteria 863
394 Ga0207707_10000064 3300025912 Bacteria 107490
395 Ga0207707_10006038 3300025912 Bacteria 10596
396 Ga0207707_10006315 3300025912 Bacteria 10349
397 Ga0207707_10029371 3300025912 Bacteria 4806
398 Ga0207707_10094005 3300025912 Bacteria 2619
399 Ga0207695_10000588 3300025913 Bacteria 73260
400 Ga0207695_10001221 3300025913 Bacteria 44045
401 Ga0207695_10001320 3300025913 Bacteria 42048
402 Ga0207695_10002529 3300025913 Bacteria 26858
403 Ga0207695_10003607 3300025913 Bacteria 21652
404 Ga0207695_10004205 3300025913 Bacteria 19775
405 Ga0207695_10027716 3300025913 Bacteria 6304
406 Ga0207695_10056422 3300025913 Bacteria 4087
407 Ga0207695_10103753 3300025913 Bacteria 2834
408 Ga0207695_10123193 3300025913 Bacteria 2558
409 Ga0207695_10176528 3300025913 Bacteria 2058
410 Ga0207695_10544900 3300025913 Bacteria 1042
411 Ga0207671_10000011 3300025914 Bacteria 530349
412 Ga0207671_10012799 3300025914 Bacteria 6724
413 Ga0207671_10013618 3300025914 Bacteria 6470
414 Ga0207671_10094240 3300025914 Bacteria 2260
415 Ga0207663_10040939 3300025916 Bacteria 2820
416 Ga0207660_10001372 3300025917 Bacteria 16322
417 Ga0207660_10001813 3300025917 Bacteria 14233
418 Ga0207660_10003444 3300025917 Bacteria 10324
419 Ga0207660_10135796 3300025917 Bacteria 1877
420 Ga0207657_10002836 3300025919 Bacteria 18613
421 Ga0207657_10029335 3300025919 Bacteria 5010
422 Ga0207657_10029430 3300025919 Bacteria 5000
423 Ga0207649_10001382 3300025920 Bacteria 14383
424 Ga0207649_10006569 3300025920 Bacteria 6318
425 Ga0207649_10006704 3300025920 Bacteria 6258
426 Ga0207649_10010845 3300025920 Bacteria 5009
427 Ga0207649_10249805 3300025920 Bacteria 1277
428 Ga0207649_10811832 3300025920 Bacteria 730
429 Ga0207652_10000019 3300025921 Bacteria 164416
430 Ga0207652_10000801 3300025921 Bacteria 30036
431 Ga0207652_10008959 3300025921 Bacteria 8065
432 Ga0207652_10148733 3300025921 Bacteria 2096
433 Ga0207652_10333672 3300025921 Bacteria 1369
434 Ga0207681_10897705 3300025923 Bacteria 742
435 Ga0207694_10000654 3300025924 Bacteria 31284
436 Ga0207694_10001428 3300025924 Bacteria 20477
437 Ga0207694_10001879 3300025924 Bacteria 17407
438 Ga0207694_10048048 3300025924 Bacteria 3301
439 Ga0207694_10147134 3300025924 Bacteria 1896
440 Ga0207694_10520874 3300025924 Bacteria 996
441 Ga0207694_10613577 3300025924 Bacteria 915
442 Ga0207650_10006245 3300025925 Bacteria 8118
443 Ga0207650_10230356 3300025925 Bacteria 1494
444 Ga0207687_10218969 3300025927 Bacteria 1498
445 Ga0207700_10023119 3300025928 Bacteria 4279
446 Ga0207644_10735062 3300025931 Bacteria 824
447 Ga0207690_10011845 3300025932 Bacteria 5214
448 Ga0207690_10068857 3300025932 Bacteria 2433
449 Ga0207706_10004869 3300025933 Bacteria 12569
450 Ga0207706_10133414 3300025933 Bacteria 2184
451 Ga0207706_10408337 3300025933 Bacteria 1177
452 Ga0207704_10841111 3300025938 Bacteria 769
453 Ga0207711_10001918 3300025941 Bacteria 18898
454 Ga0207661_10036981 3300025944 Bacteria 3814
455 Ga0207661_10448781 3300025944 Bacteria 1174
456 Ga0207679_10054898 3300025945 Bacteria 2935
457 Ga0207679_11742349 3300025945 Bacteria 570
458 Ga0207667_10000219 3300025949 Bacteria 80218
459 Ga0207667_10000446 3300025949 Bacteria 55443
460 Ga0207667_10000574 3300025949 Bacteria 48011
461 Ga0207667_10002469 3300025949 Bacteria 23071
462 Ga0207667_10007024 3300025949 Bacteria 13600
463 Ga0207667_10121219 3300025949 Bacteria 2694
464 Ga0207667_10204493 3300025949 Bacteria 2025
465 Ga0207712_10000140 3300025961 Bacteria 76381
466 Ga0207712_10000395 3300025961 Bacteria 37905
467 Ga0207668_10019465 3300025972 Bacteria 4293
468 Ga0207640_10000280 3300025981 Bacteria 34294
469 Ga0207640_10000495 3300025981 Bacteria 24008
470 Ga0207640_10001128 3300025981 Bacteria 14684
471 Ga0207640_10037290 3300025981 Bacteria 3057
472 Ga0207640_10322638 3300025981 Bacteria 1230
473 Ga0207658_10000997 3300025986 Bacteria 23236
474 Ga0207658_10093031 3300025986 Bacteria 2343
475 Ga0207658_10213853 3300025986 Bacteria 1617
476 Ga0207658_10302291 3300025986 Bacteria 1379
477 Ga0207677_10088491 3300026023 Bacteria 2245
478 Ga0207703_10000766 3300026035 Bacteria 31634
479 Ga0207703_10263265 3300026035 Bacteria 1559
480 Ga0207703_10337519 3300026035 Bacteria 1384
481 Ga0207703_10415415 3300026035 Bacteria 1251
482 Ga0207639_10000277 3300026041 Bacteria 36931
483 Ga0207639_10002487 3300026041 Bacteria 12350
484 Ga0207639_10007555 3300026041 Bacteria 7414
485 Ga0207639_10049181 3300026041 Bacteria 3195
486 Ga0207639_10441995 3300026041 Bacteria 1179
487 Ga0207639_10642877 3300026041 Bacteria 981
488 Ga0207639_11168568 3300026041 Bacteria 722
489 Ga0207639_11200587 3300026041 Bacteria 712
490 Ga0207678_10002665 3300026067 Bacteria 16207
491 Ga0207678_10016613 3300026067 Bacteria 6466
492 Ga0207678_10018779 3300026067 Bacteria 6073
493 Ga0207678_10026967 3300026067 Bacteria 5010
494 Ga0207678_10027074 3300026067 Bacteria 5000
495 Ga0207678_10040297 3300026067 Bacteria 4052
496 Ga0207678_10106813 3300026067 Bacteria 2388
497 Ga0207678_10345286 3300026067 Bacteria 1283
498 Ga0207702_10000132 3300026078 Bacteria 88794
499 Ga0207702_10000338 3300026078 Bacteria 53744
500 Ga0207702_10013397 3300026078 Bacteria 6820
501 Ga0207702_10054245 3300026078 Bacteria 3396
502 Ga0207702_10439479 3300026078 Bacteria 1264
503 Ga0207702_11206364 3300026078 Bacteria 751
504 Ga0207641_10025217 3300026088 Bacteria 4903
505 Ga0207641_10376307 3300026088 Bacteria 1359
506 Ga0207648_10016027 3300026089 Bacteria 6867
507 Ga0207648_10948227 3300026089 Bacteria 805
508 Ga0207648_11103243 3300026089 Bacteria 744
509 Ga0207676_10038682 3300026095 Bacteria 3643
510 Ga0207674_10001145 3300026116 Bacteria 34394
511 Ga0207674_10002886 3300026116 Bacteria 21357
512 Ga0207674_10039493 3300026116 Bacteria 4891
513 Ga0207674_10046326 3300026116 Bacteria 4465
514 Ga0207674_10047098 3300026116 Bacteria 4423
515 Ga0207674_10375402 3300026116 Bacteria 1374
516 Ga0207683_10394289 3300026121 Bacteria 1273
517 Ga0207698_10000491 3300026142 Bacteria 23071
518 Ga0207698_10006628 3300026142 Bacteria 7246
519 Ga0207698_10021688 3300026142 Bacteria 4449
520 Ga0207698_12006094 3300026142 Bacteria 593
521 Ga0268266_10000008 3300028379 Bacteria 1161875
522 Ga0268266_10000075 3300028379 Bacteria 218045
523 Ga0268265_10461712 3300028380 Bacteria 1188
524 Ga0268265_11863648 3300028380 Bacteria 608
525 Ga0268264_10003031 3300028381 Bacteria 14566
526 Ga0268264_10079343 3300028381 Bacteria 2800
527 Ga0268264_10386309 3300028381 Bacteria 1342
528 Ga0268264_10535999 3300028381 Bacteria 1146
529 Ga0307509_10399468 3300031507 Bacteria 1082
530 Ga0307508_10226554 3300031616 Bacteria 1468
531 Ga0316575_10029237 3300031665 Bacteria 2151
532 Ga0307413_10477018 3300031824 Bacteria 996
533 Ga0307412_10043615 3300031911 Bacteria 2921
534 Ga0307412_11252999 3300031911 Bacteria 666
535 Ga0307416_100132487 3300032002 Bacteria 2247
536 Ga0307416_100286179 3300032002 Bacteria 1629
537 Ga0307414_10094121 3300032004 Bacteria 2235
538 Ga0307414_10423568 3300032004 Bacteria 1161
539 Ga0307411_10051057 3300032005 Bacteria 2697
540 Ga0307411_10259112 3300032005 Bacteria 1372
541 Ga0307411_11110105 3300032005 Bacteria 713
542 Ga0307415_100782597 3300032126 Bacteria 869
543 Ga0307507_10102026 3300033179 Bacteria 2396
544 Ga0307507_10374266 3300033179 Bacteria 824
545 Ga0395899_0000110 3300037312 Bacteria 140811
546 Ga0395899_0001023 3300037312 Bacteria 25559
547 Ga0395899_0034712 3300037312 Bacteria 3788
548 Ga0395900_0000049 3300037418 Bacteria 226847
549 Ga0395900_0000060 3300037418 Bacteria 205509
550 Ga0395900_0102529 3300037418 Bacteria 2939
551 Ga0395900_0471806 3300037418 Bacteria 1208
552 Ga0395898_0000023 3300037466 Bacteria 379477
553 Ga0395898_0000237 3300037466 Bacteria 139991
554 Ga0395898_0018522 3300037466 Bacteria 7096
555 Ga0395898_0097752 3300037466 Bacteria 2819
556 Ga0395901_0117942 3300038443 Bacteria 2789
557 Ga0395901_0206518 3300038443 Bacteria 2057
558 Ga0395901_0371738 3300038443 Bacteria 1472
559 Ga0439436_0000032 3300041404 Bacteria 46437
560 Ga0439465_0000530 3300041413 Bacteria 11438
561 Ga0451789_0811766 3300041443 Bacteria 718
562 Ga0451793_1777967 3300041452 Bacteria 4636
563 Ga0451797_0113713 3300041453 Bacteria 1161
564 Ga0451797_1444144 3300041453 Bacteria 762
565 Ga0451795_0322423 3300041456 Bacteria 925
566 Ga0451795_0773849 3300041456 Bacteria 968
567 Ga0451802_0035022 3300041460 Bacteria 824
568 Ga0451806_671699 3300041462 Bacteria 693
569 Ga0451841_0241459 3300041498 Bacteria 1262
570 Ga0450908_000007 3300042184 Bacteria 55488
571 Ga0439459_0061077 3300042438 Bacteria 852
572 Ga0451577_0176764 3300042876 Bacteria 1924
573 Ga0466969_0038934 3300044656 Bacteria 2390
574 Ga0466969_0088821 3300044656 Bacteria 1467
575 Ga0466972_0038589 3300044658 Bacteria 2332
576 Ga0466976_0347589 3300044662 Bacteria 819
577 Ga0466989_0163097 3300044663 Bacteria 1337
578 Ga0466982_0000018 3300044672 Bacteria 113912
579 Ga0466982_0000096 3300044672 Bacteria 21532
580 Ga0466965_0150407 3300044683 Bacteria 1216
581 Ga0466966_0008293 3300044684 Bacteria 6887
582 Ga0466966_0041964 3300044684 Bacteria 2938
583 Ga0466966_0181364 3300044684 Bacteria 1277
584 Ga0466961_0001486 3300044693 Bacteria 14566
585 Ga0466961_0002537 3300044693 Bacteria 11321
586 Ga0466961_0003674 3300044693 Bacteria 9567
587 Ga0466961_0003935 3300044693 Bacteria 9288
588 Ga0466961_0012833 3300044693 Bacteria 5361
589 Ga0466963_0207098 3300044694 Bacteria 1372
590 Ga0466963_0695281 3300044694 Bacteria 718
591 Ga0466964_0001814 3300044706 Bacteria 7433
592 Ga0466964_0025129 3300044706 Bacteria 2325
593 Ga0453684_0000316 3300044712 Bacteria 204457
594 Ga0466971_0001777 3300044719 Bacteria 9148
595 Ga0466971_0015305 3300044719 Bacteria 3375
596 Ga0466971_0015318 3300044719 Bacteria 3373
597 Ga0466971_0111559 3300044719 Bacteria 1262
598 Ga0466968_0001797 3300044735 Bacteria 7743
599 Ga0466968_0012411 3300044735 Bacteria 3335
600 Ga0466970_0004514 3300044765 Bacteria 6867
601 Ga0466970_0019296 3300044765 Bacteria 3533
602 Ga0466957_0002919 3300044842 Bacteria 9262
603 Ga0466957_0039575 3300044842 Bacteria 2844
604 Ga0466957_0133691 3300044842 Bacteria 1592
605 Ga0466957_0251608 3300044842 Bacteria 1175
606 Ga0466957_0643964 3300044842 Bacteria 745
607 Ga0466960_0023732 3300044901 Bacteria 2757
608 Ga0466959_0005091 3300045049 Bacteria 8940
609 Ga0466959_0320532 3300045049 Bacteria 1059
610 Ga0451576_0000128 3300045051 Bacteria 192071
611 Ga0466958_0016421 3300045836 Bacteria 4263
612 Ga0466958_0025788 3300045836 Bacteria 3469
613 Ga0466958_0032951 3300045836 Bacteria 3085
614 Ga0466958_0293822 3300045836 Bacteria 1042
615 Ga0466967_0318912 3300045976 Bacteria 1498
616 Ga0495617_000607 3300046452 Bacteria 18027
617 Ga0495617_001095 3300046452 Bacteria 12313
618 Ga0495638_0000019 3300046460 Bacteria 384671
619 Ga0495638_0000406 3300046460 Bacteria 52627
620 Ga0495638_0000452 3300046460 Bacteria 49237
621 Ga0495638_0001628 3300046460 Bacteria 19981
622 Ga0495650_0000350 3300046471 Bacteria 81541
623 Ga0495650_0000466 3300046471 Bacteria 62626
624 Ga0495650_0000869 3300046471 Bacteria 35923
625 Ga0495605_0126429 3300046474 Bacteria 1156
626 Ga0495584_0001662 3300046491 Bacteria 13072
627 Ga0495585_0001138 3300046492 Bacteria 21797
628 Ga0495585_0040927 3300046492 Bacteria 2600
629 Ga0495607_0000133 3300046501 Bacteria 78789
630 Ga0495607_0001577 3300046501 Bacteria 19905
631 Ga0495607_0007528 3300046501 Bacteria 7519
632 Ga0495583_0011255 3300046506 Bacteria 5149
633 Ga0495606_0000016 3300046507 Bacteria 284865
634 Ga0495606_0000160 3300046507 Bacteria 118218
635 Ga0495606_0001918 3300046507 Bacteria 25850
636 Ga0495606_0002253 3300046507 Bacteria 22923
637 Ga0495606_0234825 3300046507 Bacteria 1025
638 Ga0495606_0269383 3300046507 Bacteria 936
639 Ga0495610_0004501 3300046512 Bacteria 10271
640 Ga0495610_0029998 3300046512 Bacteria 2855
641 Ga0495616_0000006 3300046513 Bacteria 234766
642 Ga0495616_0047917 3300046513 Bacteria 2149
643 Ga0495620_0000711 3300046515 Bacteria 20541
644 Ga0495620_0097744 3300046515 Bacteria 1172
645 Ga0495631_0000036 3300046518 Bacteria 81635
646 Ga0495631_0000318 3300046518 Bacteria 33436
647 Ga0495632_0000010 3300046519 Bacteria 272360
648 Ga0495632_0012658 3300046519 Bacteria 4852
649 Ga0495632_0054517 3300046519 Bacteria 1960
650 Ga0495637_0007175 3300046520 Bacteria 5547
651 Ga0495643_0177310 3300046522 Bacteria 1038
652 Ga0495648_0000881 3300046524 Bacteria 31575
653 Ga0495609_0149052 3300046538 Bacteria 995
654 Ga0495622_0020164 3300046557 Bacteria 3105
655 Ga0495622_0251985 3300046557 Bacteria 776
656 Ga0495668_0005730 3300046616 Bacteria 8306
657 Ga0495611_0000003 3300046648 Bacteria 395679
658 Ga0495611_0000028 3300046648 Bacteria 116155
659 Ga0495625_0000193 3300046660 Bacteria 97042
660 Ga0495625_0006388 3300046660 Bacteria 10509
661 Ga0495625_0015849 3300046660 Bacteria 5949
662 Ga0495625_0048981 3300046660 Bacteria 3038
663 Ga0495625_0090097 3300046660 Bacteria 2122
664 Ga0495661_0001277 3300046665 Bacteria 21603
665 Ga0495670_0000413 3300046691 Bacteria 20501
666 Ga0495670_0013548 3300046691 Bacteria 4010
667 Ga0495670_0026664 3300046691 Bacteria 2860
668 Ga0495671_0000142 3300046692 Bacteria 63300
669 Ga0495649_0009358 3300046694 Bacteria 5830
670 Ga0495649_0023421 3300046694 Bacteria 3450
671 Ga0495589_0000042 3300046794 Bacteria 138627
672 Ga0495660_0004438 3300046810 Bacteria 8484
673 Ga0495660_0010465 3300046810 Bacteria 5394
674 Ga0495683_0000722 3300047323 Bacteria 24066
675 Ga0495679_000046 3300047446 Bacteria 132566
676 Ga0495673_0000004 3300047469 Bacteria 1354526
677 Ga0495673_0000041 3300047469 Bacteria 296723
678 Ga0495673_0004939 3300047469 Bacteria 8207
679 Ga0495681_0111495 3300047470 Bacteria 1184
680 Ga0495686_0000117 3300047472 Bacteria 166073
681 Ga0495686_0000229 3300047472 Bacteria 103283
682 Ga0495686_0002823 3300047472 Bacteria 15713
683 Ga0495686_0007664 3300047472 Bacteria 8057
684 Ga0495686_0011281 3300047472 Bacteria 6299
685 Ga0495686_0023910 3300047472 Bacteria 4019
686 Ga0496100_0090442 3300048903 Bacteria 2087
687 Ga0496101_0004110 3300048904 Bacteria 9109
688 Ga0496102_0197553 3300048905 Bacteria 1896
689 Ga0496102_0413565 3300048905 Bacteria 1267
690 Ga0496103_0026448 3300048906 Bacteria 3513
691 Ga0496104_0031058 3300048907 Bacteria 4966
692 Ga0496104_0194060 3300048907 Bacteria 1943
693 Ga0496105_0042555 3300048908 Bacteria 3744
694 Ga0496106_0001877 3300048909 Bacteria 15732
695 Ga0496106_0199612 3300048909 Bacteria 1592
696 Ga0496107_0092139 3300048910 Bacteria 2215
697 Ga0496108_0260772 3300048911 Bacteria 1508
698 Ga0496113_0011788 3300048916 Bacteria 5854
699 Ga0496114_0067958 3300048917 Bacteria 2991
700 Ga0496115_0000196 3300048918 Bacteria 56608
701 Ga0496115_0000440 3300048918 Bacteria 33623
702 Ga0496115_0032843 3300048918 Bacteria 4096
703 Ga0496115_0214530 3300048918 Bacteria 1589
704 Ga0496115_0733924 3300048918 Bacteria 774
705 Ga0496116_0042941 3300048919 Bacteria 3084
706 Ga0496116_0077088 3300048919 Bacteria 2085
707 Ga0496116_0086439 3300048919 Bacteria 1924
708 Ga0496116_0190880 3300048919 Bacteria 1084
709 Ga0496117_0023133 3300048920 Bacteria 4963
710 Ga0496117_0029156 3300048920 Bacteria 4259
711 Ga0496117_0030912 3300048920 Bacteria 4099
712 Ga0496117_0103448 3300048920 Bacteria 1795
713 Ga0496117_0309500 3300048920 Bacteria 832
714 Ga0496118_0001472 3300048921 Bacteria 35272
715 Ga0496118_0002903 3300048921 Bacteria 22296
716 Ga0496118_0005217 3300048921 Bacteria 14858
717 Ga0496118_0006396 3300048921 Bacteria 12971
718 Ga0496118_0008697 3300048921 Bacteria 10434
719 Ga0496118_0087591 3300048921 Bacteria 2159
720 Ga0496118_0222566 3300048921 Bacteria 1097
721 Ga0496118_0420987 3300048921 Bacteria 687
722 Ga0496119_0000201 3300048922 Bacteria 84438
723 Ga0496119_0005372 3300048922 Bacteria 12317
724 Ga0496119_0018397 3300048922 Bacteria 5202
725 Ga0496120_0000189 3300048923 Bacteria 105313
726 Ga0496120_0000837 3300048923 Bacteria 43826
727 Ga0496121_0000419 3300048924 Bacteria 84137
728 Ga0496121_0000771 3300048924 Bacteria 58811
729 Ga0496121_0001298 3300048924 Bacteria 42922
730 Ga0496121_0003299 3300048924 Bacteria 23175
731 Ga0496121_0014080 3300048924 Bacteria 8531
732 Ga0496121_0032700 3300048924 Bacteria 4722
733 Ga0496121_0051673 3300048924 Bacteria 3459
734 Ga0496121_0064333 3300048924 Bacteria 2991
735 Ga0496121_0071241 3300048924 Bacteria 2796
736 Ga0496121_0363267 3300048924 Bacteria 960
737 Ga0496121_0401542 3300048924 Bacteria 897
738 Ga0496121_0630530 3300048924 Bacteria 656
739 Ga0496122_0001358 3300048925 Bacteria 39854
740 Ga0496122_0007321 3300048925 Bacteria 12323
741 Ga0496122_0019348 3300048925 Bacteria 6224
742 Ga0496122_0082530 3300048925 Bacteria 2232
743 Ga0496122_0116918 3300048925 Bacteria 1733
744 Ga0496123_0004282 3300048926 Bacteria 15181
745 Ga0496123_0004978 3300048926 Bacteria 13609
746 Ga0496123_0009820 3300048926 Bacteria 8547
747 Ga0496123_0042437 3300048926 Bacteria 3139
748 Ga0496123_0096190 3300048926 Bacteria 1739
749 Ga0496124_0000203 3300048927 Bacteria 117239
750 Ga0496124_0001473 3300048927 Bacteria 34592
751 Ga0496124_0109481 3300048927 Bacteria 2226
752 Ga0496125_0001450 3300048928 Bacteria 34494
753 Ga0496125_0008488 3300048928 Bacteria 10750
754 Ga0496125_0027584 3300048928 Bacteria 5146
755 Ga0496125_0152162 3300048928 Bacteria 1587
756 Ga0496126_0001528 3300048929 Bacteria 35621
757 Ga0496126_0009745 3300048929 Bacteria 10172
758 Ga0496126_0016296 3300048929 Bacteria 7438
759 Ga0496126_0052949 3300048929 Bacteria 3685
760 Ga0496126_0062906 3300048929 Bacteria 3328
761 Ga0496126_0070126 3300048929 Bacteria 3123
762 Ga0496126_0073413 3300048929 Bacteria 3041
763 Ga0496126_0319947 3300048929 Bacteria 1275
764 Ga0496126_0442509 3300048929 Bacteria 1047
765 Ga0495678_000066 3300049459 Bacteria 133706
766 Ga0495678_015033 3300049459 Bacteria 3577
767 Ga0495682_0003108 3300049460 Bacteria 7515
768 Ga0495682_0026021 3300049460 Bacteria 2175
769 Ga0495682_0095429 3300049460 Bacteria 1067
770 Ga0501032_0060536 3300049569 Bacteria 2539
771 Ga0501033_0019511 3300049570 Bacteria 5125
772 Ga0501033_0284121 3300049570 Bacteria 1168
773 Ga0501034_0006620 3300049571 Bacteria 12432
774 Ga0501034_0758834 3300049571 Bacteria 865
775 Ga0501036_0394918 3300049572 Bacteria 1154
776 Ga0501037_0018053 3300049573 Bacteria 5196
777 Ga0501037_0152969 3300049573 Bacteria 1648
778 Ga0501038_0015538 3300049574 Bacteria 6920
779 Ga0501038_0418817 3300049574 Bacteria 1034
780 Ga0501039_0120244 3300049575 Bacteria 2058
781 Ga0501039_0358639 3300049575 Bacteria 1145
782 Ga0501043_0022946 3300049579 Bacteria 4893
783 Ga0501043_0031501 3300049579 Bacteria 4169
784 Ga0501043_0086842 3300049579 Bacteria 2458
785 Ga0501043_0196194 3300049579 Bacteria 1568
786 Ga0501043_0255343 3300049579 Bacteria 1349
787 Ga0501046_0008054 3300049580 Bacteria 9209
788 Ga0501046_0200343 3300049580 Bacteria 1485
789 Ga0501046_0234302 3300049580 Bacteria 1355
790 Ga0501047_0002093 3300049581 Bacteria 19094
791 Ga0501047_0003063 3300049581 Bacteria 15848
792 Ga0501047_0045093 3300049581 Bacteria 4262
793 Ga0501047_0059989 3300049581 Bacteria 3672
794 Ga0501047_0060899 3300049581 Bacteria 3641
795 Ga0501047_0140733 3300049581 Bacteria 2291
796 Ga0501048_0065527 3300049582 Bacteria 2568
797 Ga0501048_0111141 3300049582 Bacteria 1935
798 Ga0501067_0000583 3300049583 Bacteria 19798
799 Ga0501068_0184873 3300049584 Bacteria 1318
800 Ga0501069_0001862 3300049585 Bacteria 10542
801 Ga0501069_0002178 3300049585 Bacteria 9867
802 Ga0501069_0026323 3300049585 Bacteria 3184
803 Ga0501069_0066946 3300049585 Bacteria 2009
804 Ga0501069_0113071 3300049585 Bacteria 1547
805 Ga0501070_0004139 3300049586 Bacteria 12490
806 Ga0501070_0004257 3300049586 Bacteria 12303
807 Ga0501070_0061919 3300049586 Bacteria 3099
808 Ga0501070_0066254 3300049586 Bacteria 2990
809 Ga0501070_0146981 3300049586 Bacteria 1945
810 Ga0501070_0458335 3300049586 Bacteria 1027
811 Ga0501071_0008797 3300049587 Bacteria 6689
812 Ga0501072_0002507 3300049588 Bacteria 13756
813 Ga0501072_0143661 3300049588 Bacteria 1903
814 Ga0501073_0008095 3300049589 Bacteria 7799
815 Ga0501073_0015945 3300049589 Bacteria 5445
816 Ga0501073_0159283 3300049589 Bacteria 1564
817 Ga0501073_0209089 3300049589 Bacteria 1348
818 Ga0501073_0284279 3300049589 Bacteria 1141
819 Ga0501074_0003986 3300049590 Bacteria 10524
820 Ga0501074_0005938 3300049590 Bacteria 8802
821 Ga0501074_0025883 3300049590 Bacteria 4257
822 Ga0501074_0062333 3300049590 Bacteria 2685
823 Ga0501074_0065446 3300049590 Bacteria 2616
824 Ga0501074_1063612 3300049590 Bacteria 568
825 Ga0501079_0026319 3300049741 Bacteria 4461
826 Ga0501079_0173661 3300049741 Bacteria 1680
827 Ga0501079_0618568 3300049741 Bacteria 852
828 Ga0501080_0000256 3300049742 Bacteria 40148
829 Ga0501080_0001893 3300049742 Bacteria 18018
830 Ga0501080_0003974 3300049742 Bacteria 13094
831 Ga0501080_0016829 3300049742 Bacteria 6753
832 Ga0501080_0097338 3300049742 Bacteria 2732
833 Ga0501083_0001929 3300049744 Bacteria 14264
834 Ga0501035_0030885 3300049822 Bacteria 4880
835 Ga0501035_0073546 3300049822 Bacteria 3024
836 Ga0501035_0084441 3300049822 Bacteria 2800
837 Ga0501035_0121763 3300049822 Bacteria 2280
838 Ga0501035_0540457 3300049822 Bacteria 955
839 Ga0501044_0003272 3300049823 Bacteria 18232
840 Ga0501044_0007113 3300049823 Bacteria 12307
841 Ga0501044_0007419 3300049823 Bacteria 12063
842 Ga0501044_0014551 3300049823 Bacteria 8488
843 Ga0501044_0114409 3300049823 Bacteria 2704
844 Ga0501044_0205065 3300049823 Bacteria 1928
845 Ga0501044_0296891 3300049823 Bacteria 1545
846 Ga0501044_1283098 3300049823 Bacteria 599
847 nmdc:mga0sz30_92625_c1 3300050516 Bacteria 1316
848 Ga0500643_000036 3300053087 Bacteria 183253
849 Ga0500643_008323 3300053087 Bacteria 4082
850 Ga0500555_001310 3300053103 Bacteria 7858
851 Ga0500597_000016 3300053120 Bacteria 38903
852 Ga0500652_190098 3300053131 Bacteria 837
853 Ga0500633_0001664 3300053160 Bacteria 4305
854 Ga0500645_000639 3300053730 Bacteria 22272
855 Ga0501084_0291415 3300054114 Bacteria 1379
856 Ga0501082_0201301 3300060353 Bacteria 1732
857 Ga0501082_0287069 3300060353 Bacteria 1432
858 Ga0466962_0000272 3300061719 Bacteria 21817
859 Ga0466962_0011816 3300061719 Bacteria 4203
860 Ga0466962_0037551 3300061719 Bacteria 2319
861 Ga0466962_0222261 3300061719 Bacteria 925
862 Ga0466962_0601888 3300061719 Bacteria 560

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041453 Ga0451797_1444144 Ga0451797_1444144_96_530 131
2 iso_pu_bacteria 2537561836 2538835162 141
3 iso_pu_bacteria 2643221562 2643829356 141
4 3300049822 Ga0501035_0073546 Ga0501035_0073546_603_1049 143
5 3300049823 Ga0501044_0007419 Ga0501044_0007419_2278_2724 143
6 iso_pu_bacteria 2842914999 2842918672 143
7 iso_pu_bacteria 2884411467 2884413030 143
8 iso_pu_bacteria 2593339238 2595447961 144
9 iso_pu_bacteria 2739367700 2739729927 144
10 iso_pu_bacteria 2895395659 2895397305 144
11 iso_pu_bacteria 2919085039 2919087322 144
12 iso_pu_bacteria 2928963466 2928965885 144
13 3300003214 JGI25165J46597_1030791 JGI25165J46597_10307911 145
14 3300025225 Ga0209566_102111 Ga0209566_1021113 145
15 3300025246 Ga0209646_1027599 Ga0209646_10275992 145
16 3300025261 Ga0209233_1008709 Ga0209233_10087094 145
17 3300049569 Ga0501032_0060536 Ga0501032_0060536_493_930 145
18 3300049574 Ga0501038_0418817 Ga0501038_0418817_146_583 145
19 3300049579 Ga0501043_0031501 Ga0501043_0031501_1573_2010 145
20 3300049580 Ga0501046_0008054 Ga0501046_0008054_7872_8309 145
21 iso_pu_bacteria 2524614729 2525558158 145
22 iso_pu_bacteria 2627854209 2630649961 145
23 iso_pu_bacteria 2718218334 2721026089 145
24 iso_pu_bacteria 2734482264 2735833943 145
25 iso_pu_bacteria 2738543009 2739229746 145
26 iso_pu_bacteria 2818991440 2819565567 145
27 iso_pu_bacteria 2842918807 2842922143 145
28 iso_pu_bacteria 2884338543 2884341934 145
29 iso_pu_bacteria 2904463128 2904466059 145
30 iso_pu_bacteria 2919404418 2919406554 145
31 iso_pu_bacteria 2941471342 2941474340 145
32 iso_pu_bacteria 2953994433 2953997261 145
33 3300026116 Ga0207674_10375402 Ga0207674_103754021 146
34 3300031665 Ga0316575_10029237 Ga0316575_100292373 146
35 3300002067 JGI24735J21928_10201559 JGI24735J21928_102015592 147
36 3300002737 JGI25162J39368_1004214 JGI25162J39368_10042144 147
37 3300002738 JGI25154J39366_1008133 JGI25154J39366_10081332 147
38 3300002741 JGI25157J39369_1001100 JGI25157J39369_100110010 147
39 3300002741 JGI25157J39369_1003667 JGI25157J39369_10036673 147
40 3300002771 JGI25163J39215_1001252 JGI25163J39215_10012524 147
41 3300002772 JGI25164J39214_1002054 JGI25164J39214_10020544 147
42 3300003214 JGI25165J46597_1001472 JGI25165J46597_10014724 147
43 3300003761 Ga0055535_1001444 Ga0055535_10014444 147
44 3300003762 Ga0055542_1004324 Ga0055542_10043244 147
45 3300003763 Ga0055529_1001107 Ga0055529_10011074 147
46 3300005439 Ga0070711_100332269 Ga0070711_1003322692 147
47 3300005455 Ga0070663_100649466 Ga0070663_1006494662 147
48 3300005458 Ga0070681_10037306 Ga0070681_100373065 147
49 3300013307 Ga0157372_10081165 Ga0157372_100811653 147
50 3300015687 Ga0183368_1002 Ga0183368_1002728 147
51 3300025207 Ga0209760_100376 Ga0209760_10037611 147
52 3300025224 Ga0209784_100204 Ga0209784_10020410 147
53 3300025226 Ga0209674_104333 Ga0209674_1043334 147
54 3300025231 Ga0207427_100179 Ga0207427_10017910 147
55 3300025233 Ga0209437_100099 Ga0209437_10009941 147
56 3300025242 Ga0209258_100119 Ga0209258_10011911 147
57 3300025246 Ga0209646_1003374 Ga0209646_10033743 147
58 3300025250 Ga0209026_1000175 Ga0209026_100017536 147
59 3300025250 Ga0209026_1000276 Ga0209026_100027651 147
60 3300025254 Ga0209148_1000036 Ga0209148_1000036310 147
61 3300025256 Ga0209759_1001565 Ga0209759_100156510 147
62 3300025256 Ga0209759_1048645 Ga0209759_10486451 147
63 3300025261 Ga0209233_1000040 Ga0209233_1000040308 147
64 3300025272 Ga0209455_1000164 Ga0209455_100016441 147
65 3300025304 Ga0209257_1000067 Ga0209257_1000067142 147
66 3300025912 Ga0207707_10029371 Ga0207707_100293715 147
67 3300025916 Ga0207663_10040939 Ga0207663_100409394 147
68 3300032002 Ga0307416_100286179 Ga0307416_1002861792 147
69 3300032005 Ga0307411_10051057 Ga0307411_100510572 147
70 3300032126 Ga0307415_100782597 Ga0307415_1007825972 147
71 3300037312 Ga0395899_0034712 Ga0395899_0034712_1783_2229 147
72 3300037466 Ga0395898_0018522 Ga0395898_0018522_4266_4712 147
73 3300038443 Ga0395901_0206518 Ga0395901_0206518_1166_1612 147
74 3300041443 Ga0451789_0811766 Ga0451789_0811766_90_545 147
75 3300041462 Ga0451806_671699 Ga0451806_671699_182_625 147
76 3300041498 Ga0451841_0241459 Ga0451841_0241459_174_629 147
77 3300044694 Ga0466963_0695281 Ga0466963_0695281_168_614 147
78 3300044842 Ga0466957_0133691 Ga0466957_0133691_819_1265 147
79 3300048925 Ga0496122_0007321 Ga0496122_0007321_912_1376 147
80 3300048926 Ga0496123_0004282 Ga0496123_0004282_13705_14169 147
81 3300048929 Ga0496126_0052949 Ga0496126_0052949_990_1454 147
82 3300049570 Ga0501033_0019511 Ga0501033_0019511_942_1388 147
83 3300049570 Ga0501033_0284121 Ga0501033_0284121_463_906 147
84 3300049571 Ga0501034_0758834 Ga0501034_0758834_376_828 147
85 3300049573 Ga0501037_0018053 Ga0501037_0018053_3270_3722 147
86 3300049575 Ga0501039_0358639 Ga0501039_0358639_546_989 147
87 3300049579 Ga0501043_0022946 Ga0501043_0022946_836_1282 147
88 3300049580 Ga0501046_0200343 Ga0501046_0200343_100_543 147
89 3300049581 Ga0501047_0045093 Ga0501047_0045093_3578_4030 147
90 3300049581 Ga0501047_0140733 Ga0501047_0140733_1579_2025 147
91 3300049585 Ga0501069_0113071 Ga0501069_0113071_464_916 147
92 3300049586 Ga0501070_0066254 Ga0501070_0066254_1903_2355 147
93 3300049587 Ga0501071_0008797 Ga0501071_0008797_6061_6513 147
94 3300049588 Ga0501072_0143661 Ga0501072_0143661_287_739 147
95 3300049589 Ga0501073_0008095 Ga0501073_0008095_753_1205 147
96 3300049590 Ga0501074_0005938 Ga0501074_0005938_3448_3900 147
97 3300049741 Ga0501079_0618568 Ga0501079_0618568_305_757 147
98 3300049742 Ga0501080_0016829 Ga0501080_0016829_292_744 147
99 3300049822 Ga0501035_0084441 Ga0501035_0084441_1461_1913 147
100 3300049822 Ga0501035_0540457 Ga0501035_0540457_359_802 147
101 3300049823 Ga0501044_0014551 Ga0501044_0014551_4747_5199 147
102 3300049823 Ga0501044_0205065 Ga0501044_0205065_422_868 147
103 3300049823 Ga0501044_0296891 Ga0501044_0296891_799_1242 147
104 3300061719 Ga0466962_0601888 Ga0466962_0601888_92_538 147
105 3300001989 JGI24739J22299_10009804 JGI24739J22299_100098044 148
106 3300001990 JGI24737J22298_10026518 JGI24737J22298_100265183 148
107 3300001990 JGI24737J22298_10081336 JGI24737J22298_100813362 148
108 3300002067 JGI24735J21928_10004013 JGI24735J21928_100040134 148
109 3300002067 JGI24735J21928_10014324 JGI24735J21928_100143242 148
110 3300002737 JGI25162J39368_1001457 JGI25162J39368_100145714 148
111 3300002737 JGI25162J39368_1002014 JGI25162J39368_10020148 148
112 3300002737 JGI25162J39368_1010547 JGI25162J39368_10105472 148
113 3300002738 JGI25154J39366_1007917 JGI25154J39366_10079171 148
114 3300002738 JGI25154J39366_1014669 JGI25154J39366_10146692 148
115 3300002741 JGI25157J39369_1000224 JGI25157J39369_100022415 148
116 3300002741 JGI25157J39369_1002245 JGI25157J39369_10022451 148
117 3300002741 JGI25157J39369_1008184 JGI25157J39369_10081842 148
118 3300002741 JGI25157J39369_1021350 JGI25157J39369_10213501 148
119 3300002772 JGI25164J39214_1000164 JGI25164J39214_100016459 148
120 3300002772 JGI25164J39214_1006974 JGI25164J39214_10069742 148
121 3300003214 JGI25165J46597_1000317 JGI25165J46597_100031752 148
122 3300003214 JGI25165J46597_1012862 JGI25165J46597_10128622 148
123 3300003215 JGI25153J46596_10018510 JGI25153J46596_100185103 148
124 3300003320 rootH2_10011924 rootH2_1001192412 148
125 3300003578 Ga0006562J51391_1042664 Ga0006562J51391_10426649 148
126 3300003578 Ga0006562J51391_1042669 Ga0006562J51391_10426694 148
127 3300003756 Ga0055533_1002210 Ga0055533_10022106 148
128 3300003756 Ga0055533_1005210 Ga0055533_10052102 148
129 3300003756 Ga0055533_1006131 Ga0055533_10061312 148
130 3300003759 Ga0055525_1000055 Ga0055525_100005522 148
131 3300003760 Ga0055527_1000116 Ga0055527_100011642 148
132 3300003760 Ga0055527_1000210 Ga0055527_100021012 148
133 3300003761 Ga0055535_1000296 Ga0055535_100029642 148
134 3300003761 Ga0055535_1000454 Ga0055535_100045423 148
135 3300003761 Ga0055535_1001071 Ga0055535_10010716 148
136 3300003761 Ga0055535_1002833 Ga0055535_10028339 148
137 3300003762 Ga0055542_1000056 Ga0055542_100005643 148
138 3300003762 Ga0055542_1000263 Ga0055542_10002638 148
139 3300003762 Ga0055542_1000277 Ga0055542_100027742 148
140 3300003762 Ga0055542_1000468 Ga0055542_100046823 148
141 3300003762 Ga0055542_1000620 Ga0055542_100062030 148
142 3300003762 Ga0055542_1028233 Ga0055542_10282331 148
143 3300003763 Ga0055529_1000253 Ga0055529_100025358 148
144 3300003763 Ga0055529_1000298 Ga0055529_100029813 148
145 3300003763 Ga0055529_1000479 Ga0055529_100047912 148
146 3300003763 Ga0055529_1003276 Ga0055529_10032765 148
147 3300004625 Ga0055543_1007681 Ga0055543_10076812 148
148 3300005262 Ga0065165_1000108 Ga0065165_100010871 148
149 3300005262 Ga0065165_1005855 Ga0065165_10058552 148
150 3300005327 Ga0070658_10001565 Ga0070658_1000156523 148
151 3300005331 Ga0070670_100265733 Ga0070670_1002657332 148
152 3300005335 Ga0070666_10000037 Ga0070666_100000372 148
153 3300005336 Ga0070680_100460938 Ga0070680_1004609382 148
154 3300005341 Ga0070691_10533427 Ga0070691_105334271 148
155 3300005344 Ga0070661_100007367 Ga0070661_1000073676 148
156 3300005344 Ga0070661_100010149 Ga0070661_10001014910 148
157 3300005347 Ga0070668_100097591 Ga0070668_1000975912 148
158 3300005365 Ga0070688_100128609 Ga0070688_1001286093 148
159 3300005367 Ga0070667_100016061 Ga0070667_1000160614 148
160 3300005435 Ga0070714_100096930 Ga0070714_1000969302 148
161 3300005436 Ga0070713_100123179 Ga0070713_1001231793 148
162 3300005455 Ga0070663_100028573 Ga0070663_1000285735 148
163 3300005455 Ga0070663_100110496 Ga0070663_1001104963 148
164 3300005455 Ga0070663_100372822 Ga0070663_1003728221 148
165 3300005456 Ga0070678_100362546 Ga0070678_1003625461 148
166 3300005458 Ga0070681_10125600 Ga0070681_101256003 148
167 3300005459 Ga0068867_101105138 Ga0068867_1011051382 148
168 3300005466 Ga0070685_10014858 Ga0070685_100148585 148
169 3300005530 Ga0070679_100055321 Ga0070679_1000553213 148
170 3300005539 Ga0068853_100265685 Ga0068853_1002656852 148
171 3300005539 Ga0068853_101225682 Ga0068853_1012256821 148
172 3300005546 Ga0070696_100007583 Ga0070696_1000075836 148
173 3300005548 Ga0070665_100010663 Ga0070665_1000106633 148
174 3300005563 Ga0068855_100122173 Ga0068855_1001221735 148
175 3300005563 Ga0068855_100212437 Ga0068855_1002124372 148
176 3300005577 Ga0068857_100013283 Ga0068857_1000132833 148
177 3300005577 Ga0068857_100061409 Ga0068857_1000614092 148
178 3300005614 Ga0068856_100007396 Ga0068856_1000073968 148
179 3300005617 Ga0068859_100324564 Ga0068859_1003245643 148
180 3300005834 Ga0068851_10000908 Ga0068851_100009089 148
181 3300005842 Ga0068858_100242140 Ga0068858_1002421402 148
182 3300005843 Ga0068860_100066993 Ga0068860_1000669933 148
183 3300005843 Ga0068860_100265669 Ga0068860_1002656693 148
184 3300005844 Ga0068862_100176956 Ga0068862_1001769562 148
185 3300005844 Ga0068862_100646975 Ga0068862_1006469752 148
186 3300006186 Ga0075369_10064511 Ga0075369_100645112 148
187 3300006237 Ga0097621_100400799 Ga0097621_1004007992 148
188 3300006931 Ga0097620_100324596 Ga0097620_1003245963 148
189 3300009093 Ga0105240_10002563 Ga0105240_1000256318 148
190 3300009093 Ga0105240_10009143 Ga0105240_100091434 148
191 3300009093 Ga0105240_10009721 Ga0105240_100097219 148
192 3300009093 Ga0105240_10011172 Ga0105240_100111724 148
193 3300009093 Ga0105240_10023678 Ga0105240_100236784 148
194 3300009176 Ga0105242_10762084 Ga0105242_107620842 148
195 3300009545 Ga0105237_10000084 Ga0105237_1000008484 148
196 3300009545 Ga0105237_10000675 Ga0105237_1000067516 148
197 3300009551 Ga0105238_10000131 Ga0105238_1000013163 148
198 3300009551 Ga0105238_10098301 Ga0105238_100983012 148
199 3300009551 Ga0105238_10391495 Ga0105238_103914952 148
200 3300010375 Ga0105239_10000033 Ga0105239_100000334 148
201 3300010375 Ga0105239_10042913 Ga0105239_100429132 148
202 3300010375 Ga0105239_10572998 Ga0105239_105729982 148
203 3300012500 Ga0157314_1000507 Ga0157314_10005071 148
204 3300013104 Ga0157370_10005440 Ga0157370_1000544015 148
205 3300013104 Ga0157370_10081025 Ga0157370_100810255 148
206 3300013105 Ga0157369_10003012 Ga0157369_1000301212 148
207 3300013306 Ga0163162_10000221 Ga0163162_1000022138 148
208 3300013306 Ga0163162_10069555 Ga0163162_100695553 148
209 3300013307 Ga0157372_10173947 Ga0157372_101739471 148
210 3300013307 Ga0157372_10213378 Ga0157372_102133782 148
211 3300014497 Ga0182008_10036778 Ga0182008_100367784 148
212 3300014497 Ga0182008_10191861 Ga0182008_101918612 148
213 3300014969 Ga0157376_10009210 Ga0157376_100092108 148
214 3300015262 Ga0182007_10015105 Ga0182007_100151052 148
215 3300015265 Ga0182005_1000049 Ga0182005_100004989 148
216 3300020070 Ga0206356_11905763 Ga0206356_119057632 148
217 3300020077 Ga0206351_10768644 Ga0206351_107686441 148
218 3300022467 Ga0224712_10128125 Ga0224712_101281251 148
219 3300025226 Ga0209674_100061 Ga0209674_100061249 148
220 3300025226 Ga0209674_100077 Ga0209674_100077128 148
221 3300025226 Ga0209674_100785 Ga0209674_10078513 148
222 3300025228 Ga0209672_100004 Ga0209672_1000041142 148
223 3300025228 Ga0209672_100022 Ga0209672_100022249 148
224 3300025228 Ga0209672_100251 Ga0209672_10025132 148
225 3300025228 Ga0209672_101130 Ga0209672_10113012 148
226 3300025228 Ga0209672_101444 Ga0209672_1014444 148
227 3300025230 Ga0209563_100076 Ga0209563_10007623 148
228 3300025231 Ga0207427_100111 Ga0207427_100111100 148
229 3300025231 Ga0207427_100185 Ga0207427_10018556 148
230 3300025231 Ga0207427_100510 Ga0207427_10051014 148
231 3300025233 Ga0209437_100113 Ga0209437_100113146 148
232 3300025233 Ga0209437_100320 Ga0209437_1003206 148
233 3300025233 Ga0209437_100368 Ga0209437_1003687 148
234 3300025233 Ga0209437_100782 Ga0209437_10078210 148
235 3300025242 Ga0209258_100003 Ga0209258_1000031142 148
236 3300025242 Ga0209258_100004 Ga0209258_100004131 148
237 3300025242 Ga0209258_100122 Ga0209258_1001228 148
238 3300025242 Ga0209258_100137 Ga0209258_100137108 148
239 3300025242 Ga0209258_100376 Ga0209258_10037645 148
240 3300025242 Ga0209258_106897 Ga0209258_1068972 148
241 3300025246 Ga0209646_1000985 Ga0209646_10009859 148
242 3300025246 Ga0209646_1001103 Ga0209646_10011037 148
243 3300025250 Ga0209026_1000087 Ga0209026_100008731 148
244 3300025250 Ga0209026_1000274 Ga0209026_10002745 148
245 3300025250 Ga0209026_1008805 Ga0209026_10088052 148
246 3300025253 Ga0209677_101477 Ga0209677_1014774 148
247 3300025254 Ga0209148_1000005 Ga0209148_10000051327 148
248 3300025254 Ga0209148_1000025 Ga0209148_1000025446 148
249 3300025254 Ga0209148_1000062 Ga0209148_1000062152 148
250 3300025254 Ga0209148_1000083 Ga0209148_1000083125 148
251 3300025254 Ga0209148_1000137 Ga0209148_1000137108 148
252 3300025254 Ga0209148_1001786 Ga0209148_10017869 148
253 3300025256 Ga0209759_1000136 Ga0209759_100013665 148
254 3300025256 Ga0209759_1000320 Ga0209759_10003209 148
255 3300025256 Ga0209759_1001153 Ga0209759_10011535 148
256 3300025258 Ga0209129_1000769 Ga0209129_100076911 148
257 3300025261 Ga0209233_1000075 Ga0209233_100007578 148
258 3300025261 Ga0209233_1000128 Ga0209233_1000128164 148
259 3300025272 Ga0209455_1000004 Ga0209455_10000041142 148
260 3300025272 Ga0209455_1000040 Ga0209455_1000040158 148
261 3300025272 Ga0209455_1000084 Ga0209455_1000084125 148
262 3300025272 Ga0209455_1000095 Ga0209455_1000095114 148
263 3300025272 Ga0209455_1001294 Ga0209455_10012945 148
264 3300025272 Ga0209455_1007907 Ga0209455_10079072 148
265 3300025297 Ga0209758_1000301 Ga0209758_100030120 148
266 3300025297 Ga0209758_1020451 Ga0209758_10204512 148
267 3300025297 Ga0209758_1047231 Ga0209758_10472312 148
268 3300025302 Ga0207426_1016040 Ga0207426_10160403 148
269 3300025321 Ga0207656_10007153 Ga0207656_100071534 148
270 3300025903 Ga0207680_10000001 Ga0207680_10000001306 148
271 3300025904 Ga0207647_10002308 Ga0207647_100023084 148
272 3300025904 Ga0207647_10119619 Ga0207647_101196192 148
273 3300025909 Ga0207705_10006860 Ga0207705_100068603 148
274 3300025912 Ga0207707_10006038 Ga0207707_100060388 148
275 3300025913 Ga0207695_10000588 Ga0207695_100005884 148
276 3300025913 Ga0207695_10001221 Ga0207695_1000122113 148
277 3300025913 Ga0207695_10001320 Ga0207695_1000132013 148
278 3300025913 Ga0207695_10004205 Ga0207695_100042058 148
279 3300025913 Ga0207695_10123193 Ga0207695_101231934 148
280 3300025914 Ga0207671_10000011 Ga0207671_10000011379 148
281 3300025914 Ga0207671_10012799 Ga0207671_100127994 148
282 3300025917 Ga0207660_10135796 Ga0207660_101357962 148
283 3300025920 Ga0207649_10006569 Ga0207649_100065695 148
284 3300025920 Ga0207649_10006704 Ga0207649_100067045 148
285 3300025921 Ga0207652_10148733 Ga0207652_101487332 148
286 3300025923 Ga0207681_10897705 Ga0207681_108977052 148
287 3300025924 Ga0207694_10000654 Ga0207694_1000065419 148
288 3300025924 Ga0207694_10147134 Ga0207694_101471342 148
289 3300025924 Ga0207694_10613577 Ga0207694_106135772 148
290 3300025925 Ga0207650_10230356 Ga0207650_102303562 148
291 3300025928 Ga0207700_10023119 Ga0207700_100231193 148
292 3300025933 Ga0207706_10408337 Ga0207706_104083372 148
293 3300025945 Ga0207679_11742349 Ga0207679_117423492 148
294 3300025949 Ga0207667_10000219 Ga0207667_1000021915 148
295 3300025949 Ga0207667_10000446 Ga0207667_1000044614 148
296 3300025949 Ga0207667_10121219 Ga0207667_101212192 148
297 3300025972 Ga0207668_10019465 Ga0207668_100194652 148
298 3300025981 Ga0207640_10000280 Ga0207640_1000028011 148
299 3300025981 Ga0207640_10322638 Ga0207640_103226382 148
300 3300025986 Ga0207658_10093031 Ga0207658_100930312 148
301 3300026035 Ga0207703_10263265 Ga0207703_102632653 148
302 3300026041 Ga0207639_10642877 Ga0207639_106428772 148
303 3300026041 Ga0207639_11200587 Ga0207639_112005872 148
304 3300026067 Ga0207678_10018779 Ga0207678_100187797 148
305 3300026067 Ga0207678_10040297 Ga0207678_100402973 148
306 3300026078 Ga0207702_10000132 Ga0207702_1000013212 148
307 3300026078 Ga0207702_10000338 Ga0207702_1000033834 148
308 3300026078 Ga0207702_11206364 Ga0207702_112063642 148
309 3300026089 Ga0207648_10948227 Ga0207648_109482271 148
310 3300026089 Ga0207648_11103243 Ga0207648_111032432 148
311 3300026116 Ga0207674_10001145 Ga0207674_100011457 148
312 3300026116 Ga0207674_10047098 Ga0207674_100470984 148
313 3300026121 Ga0207683_10394289 Ga0207683_103942892 148
314 3300028379 Ga0268266_10000075 Ga0268266_1000007547 148
315 3300028380 Ga0268265_10461712 Ga0268265_104617122 148
316 3300028380 Ga0268265_11863648 Ga0268265_118636481 148
317 3300028381 Ga0268264_10079343 Ga0268264_100793433 148
318 3300028381 Ga0268264_10535999 Ga0268264_105359992 148
319 3300033179 Ga0307507_10374266 Ga0307507_103742661 148
320 3300037312 Ga0395899_0000110 Ga0395899_0000110_1844_2290 148
321 3300037312 Ga0395899_0001023 Ga0395899_0001023_14004_14450 148
322 3300037418 Ga0395900_0000049 Ga0395900_0000049_129598_130044 148
323 3300037418 Ga0395900_0000060 Ga0395900_0000060_74832_75287 148
324 3300037466 Ga0395898_0000023 Ga0395898_0000023_197025_197471 148
325 3300037466 Ga0395898_0000237 Ga0395898_0000237_1860_2306 148
326 3300038443 Ga0395901_0117942 Ga0395901_0117942_205_651 148
327 3300041452 Ga0451793_1777967 Ga0451793_1777967_42_500 148
328 3300041460 Ga0451802_0035022 Ga0451802_0035022_132_590 148
329 3300042438 Ga0439459_0061077 Ga0439459_0061077_288_734 148
330 3300044656 Ga0466969_0038934 Ga0466969_0038934_114_560 148
331 3300044656 Ga0466969_0088821 Ga0466969_0088821_235_681 148
332 3300044658 Ga0466972_0038589 Ga0466972_0038589_1354_1800 148
333 3300044662 Ga0466976_0347589 Ga0466976_0347589_105_551 148
334 3300044672 Ga0466982_0000018 Ga0466982_0000018_60096_60542 148
335 3300044672 Ga0466982_0000096 Ga0466982_0000096_11896_12342 148
336 3300044683 Ga0466965_0150407 Ga0466965_0150407_11_457 148
337 3300044684 Ga0466966_0008293 Ga0466966_0008293_1732_2178 148
338 3300044684 Ga0466966_0181364 Ga0466966_0181364_561_1007 148
339 3300044693 Ga0466961_0001486 Ga0466961_0001486_12883_13329 148
340 3300044693 Ga0466961_0002537 Ga0466961_0002537_1170_1616 148
341 3300044693 Ga0466961_0003674 Ga0466961_0003674_1083_1529 148
342 3300044693 Ga0466961_0003935 Ga0466961_0003935_4407_4853 148
343 3300044693 Ga0466961_0012833 Ga0466961_0012833_725_1171 148
344 3300044694 Ga0466963_0207098 Ga0466963_0207098_517_963 148
345 3300044706 Ga0466964_0001814 Ga0466964_0001814_1910_2356 148
346 3300044706 Ga0466964_0025129 Ga0466964_0025129_1473_1919 148
347 3300044719 Ga0466971_0015305 Ga0466971_0015305_106_552 148
348 3300044719 Ga0466971_0015318 Ga0466971_0015318_672_1118 148
349 3300044719 Ga0466971_0111559 Ga0466971_0111559_478_924 148
350 3300044735 Ga0466968_0012411 Ga0466968_0012411_1032_1478 148
351 3300044765 Ga0466970_0004514 Ga0466970_0004514_698_1144 148
352 3300044765 Ga0466970_0019296 Ga0466970_0019296_250_696 148
353 3300044842 Ga0466957_0002919 Ga0466957_0002919_2466_2912 148
354 3300044842 Ga0466957_0039575 Ga0466957_0039575_516_962 148
355 3300044842 Ga0466957_0251608 Ga0466957_0251608_115_561 148
356 3300044842 Ga0466957_0643964 Ga0466957_0643964_135_581 148
357 3300044901 Ga0466960_0023732 Ga0466960_0023732_454_900 148
358 3300045049 Ga0466959_0320532 Ga0466959_0320532_362_808 148
359 3300045836 Ga0466958_0016421 Ga0466958_0016421_3226_3672 148
360 3300045836 Ga0466958_0025788 Ga0466958_0025788_1939_2385 148
361 3300045836 Ga0466958_0293822 Ga0466958_0293822_554_1000 148
362 3300045976 Ga0466967_0318912 Ga0466967_0318912_65_511 148
363 3300046460 Ga0495638_0000019 Ga0495638_0000019_159510_159959 148
364 3300046460 Ga0495638_0000406 Ga0495638_0000406_38575_39021 148
365 3300046460 Ga0495638_0000452 Ga0495638_0000452_42083_42529 148
366 3300046471 Ga0495650_0000350 Ga0495650_0000350_48670_49116 148
367 3300046471 Ga0495650_0000466 Ga0495650_0000466_54850_55296 148
368 3300046501 Ga0495607_0001577 Ga0495607_0001577_16649_17095 148
369 3300046501 Ga0495607_0007528 Ga0495607_0007528_5812_6258 148
370 3300046507 Ga0495606_0000016 Ga0495606_0000016_117723_118169 148
371 3300046507 Ga0495606_0269383 Ga0495606_0269383_83_529 148
372 3300046557 Ga0495622_0020164 Ga0495622_0020164_1590_2036 148
373 3300046660 Ga0495625_0015849 Ga0495625_0015849_4983_5429 148
374 3300046660 Ga0495625_0090097 Ga0495625_0090097_1606_2052 148
375 3300046694 Ga0495649_0023421 Ga0495649_0023421_370_816 148
376 3300048905 Ga0496102_0197553 Ga0496102_0197553_819_1265 148
377 3300048907 Ga0496104_0031058 Ga0496104_0031058_1724_2170 148
378 3300048907 Ga0496104_0194060 Ga0496104_0194060_867_1313 148
379 3300048908 Ga0496105_0042555 Ga0496105_0042555_2740_3186 148
380 3300048909 Ga0496106_0199612 Ga0496106_0199612_783_1229 148
381 3300048910 Ga0496107_0092139 Ga0496107_0092139_923_1369 148
382 3300048916 Ga0496113_0011788 Ga0496113_0011788_152_598 148
383 3300048917 Ga0496114_0067958 Ga0496114_0067958_1227_1673 148
384 3300048918 Ga0496115_0000196 Ga0496115_0000196_43820_44266 148
385 3300048918 Ga0496115_0000440 Ga0496115_0000440_15227_15673 148
386 3300048918 Ga0496115_0032843 Ga0496115_0032843_2634_3080 148
387 3300048918 Ga0496115_0214530 Ga0496115_0214530_907_1353 148
388 3300048918 Ga0496115_0733924 Ga0496115_0733924_25_471 148
389 3300048919 Ga0496116_0042941 Ga0496116_0042941_1135_1581 148
390 3300048919 Ga0496116_0077088 Ga0496116_0077088_1029_1475 148
391 3300048919 Ga0496116_0086439 Ga0496116_0086439_462_908 148
392 3300048920 Ga0496117_0309500 Ga0496117_0309500_266_712 148
393 3300048921 Ga0496118_0005217 Ga0496118_0005217_11033_11479 148
394 3300048921 Ga0496118_0087591 Ga0496118_0087591_24_470 148
395 3300048921 Ga0496118_0222566 Ga0496118_0222566_549_995 148
396 3300048921 Ga0496118_0420987 Ga0496118_0420987_151_597 148
397 3300048922 Ga0496119_0000201 Ga0496119_0000201_80645_81091 148
398 3300048922 Ga0496119_0005372 Ga0496119_0005372_5334_5780 148
399 3300048923 Ga0496120_0000189 Ga0496120_0000189_3327_3773 148
400 3300048923 Ga0496120_0000837 Ga0496120_0000837_8139_8585 148
401 3300048924 Ga0496121_0000419 Ga0496121_0000419_73685_74131 148
402 3300048924 Ga0496121_0014080 Ga0496121_0014080_2724_3170 148
403 3300048924 Ga0496121_0051673 Ga0496121_0051673_2609_3055 148
404 3300048924 Ga0496121_0064333 Ga0496121_0064333_1506_1952 148
405 3300048924 Ga0496121_0071241 Ga0496121_0071241_1576_2022 148
406 3300048924 Ga0496121_0401542 Ga0496121_0401542_102_548 148
407 3300048925 Ga0496122_0019348 Ga0496122_0019348_4361_4807 148
408 3300048926 Ga0496123_0009820 Ga0496123_0009820_6544_6990 148
409 3300048927 Ga0496124_0000203 Ga0496124_0000203_99428_99874 148
410 3300048927 Ga0496124_0001473 Ga0496124_0001473_17480_17926 148
411 3300048927 Ga0496124_0109481 Ga0496124_0109481_1037_1483 148
412 3300048928 Ga0496125_0001450 Ga0496125_0001450_28085_28531 148
413 3300048928 Ga0496125_0027584 Ga0496125_0027584_144_590 148
414 3300048928 Ga0496125_0152162 Ga0496125_0152162_627_1073 148
415 3300048929 Ga0496126_0001528 Ga0496126_0001528_32156_32602 148
416 3300048929 Ga0496126_0009745 Ga0496126_0009745_8146_8592 148
417 3300048929 Ga0496126_0070126 Ga0496126_0070126_102_548 148
418 3300048929 Ga0496126_0073413 Ga0496126_0073413_1811_2257 148
419 3300048929 Ga0496126_0319947 Ga0496126_0319947_374_820 148
420 3300049459 Ga0495678_015033 Ga0495678_015033_2327_2773 148
421 3300049460 Ga0495682_0026021 Ga0495682_0026021_188_634 148
422 3300049579 Ga0501043_0086842 Ga0501043_0086842_1673_2119 148
423 3300049582 Ga0501048_0065527 Ga0501048_0065527_841_1287 148
424 3300049585 Ga0501069_0001862 Ga0501069_0001862_2551_3006 148
425 3300049822 Ga0501035_0121763 Ga0501035_0121763_1253_1699 148
426 3300049823 Ga0501044_1283098 Ga0501044_1283098_134_580 148
427 3300050516 nmdc:mga0sz30_92625_c1 nmdc:mga0sz30_92625_c1_296_742 148
428 3300061719 Ga0466962_0000272 Ga0466962_0000272_16134_16580 148
429 3300061719 Ga0466962_0011816 Ga0466962_0011816_2770_3216 148
430 3300061719 Ga0466962_0222261 Ga0466962_0222261_170_616 148
431 3300002075 JGI24738J21930_10015494 JGI24738J21930_100154941 149
432 3300003567 Ga0006554J51385_1041028 Ga0006554J51385_10410282 149
433 3300003578 Ga0006562J51391_1031326 Ga0006562J51391_10313264 149
434 3300005327 Ga0070658_10523744 Ga0070658_105237442 149
435 3300005331 Ga0070670_100009171 Ga0070670_1000091713 149
436 3300005335 Ga0070666_10007269 Ga0070666_100072698 149
437 3300005338 Ga0068868_100058111 Ga0068868_1000581112 149
438 3300005344 Ga0070661_100298248 Ga0070661_1002982482 149
439 3300005367 Ga0070667_100131582 Ga0070667_1001315822 149
440 3300005455 Ga0070663_100039684 Ga0070663_1000396844 149
441 3300005455 Ga0070663_100789579 Ga0070663_1007895791 149
442 3300005459 Ga0068867_100045587 Ga0068867_1000455873 149
443 3300005539 Ga0068853_100016385 Ga0068853_1000163856 149
444 3300005539 Ga0068853_100241308 Ga0068853_1002413083 149
445 3300005548 Ga0070665_100000376 Ga0070665_10000037620 149
446 3300005578 Ga0068854_100003612 Ga0068854_1000036127 149
447 3300005616 Ga0068852_100042035 Ga0068852_1000420353 149
448 3300005616 Ga0068852_100073648 Ga0068852_1000736484 149
449 3300005834 Ga0068851_10010761 Ga0068851_100107612 149
450 3300005841 Ga0068863_100981392 Ga0068863_1009813921 149
451 3300005842 Ga0068858_100000817 Ga0068858_10000081721 149
452 3300006237 Ga0097621_100324094 Ga0097621_1003240942 149
453 3300006881 Ga0068865_100427698 Ga0068865_1004276982 149
454 3300009101 Ga0105247_10002916 Ga0105247_100029169 149
455 3300009177 Ga0105248_10944372 Ga0105248_109443722 149
456 3300009551 Ga0105238_10108501 Ga0105238_101085012 149
457 3300009553 Ga0105249_10007606 Ga0105249_1000760610 149
458 3300011119 Ga0105246_11968736 Ga0105246_119687361 149
459 3300013104 Ga0157370_10045998 Ga0157370_100459984 149
460 3300013105 Ga0157369_10018985 Ga0157369_100189859 149
461 3300013296 Ga0157374_11003429 Ga0157374_110034291 149
462 3300013306 Ga0163162_10489642 Ga0163162_104896422 149
463 3300014497 Ga0182008_10006516 Ga0182008_100065166 149
464 3300014497 Ga0182008_10021422 Ga0182008_100214223 149
465 3300014968 Ga0157379_10482832 Ga0157379_104828322 149
466 3300015261 Ga0182006_1000031 Ga0182006_100003194 149
467 3300015261 Ga0182006_1000496 Ga0182006_100049610 149
468 3300015262 Ga0182007_10003787 Ga0182007_100037875 149
469 3300015265 Ga0182005_1001001 Ga0182005_10010017 149
470 3300015265 Ga0182005_1002650 Ga0182005_10026505 149
471 3300017792 Ga0163161_10007409 Ga0163161_100074097 149
472 3300017792 Ga0163161_10066212 Ga0163161_100662123 149
473 3300025229 Ga0209147_107974 Ga0209147_1079742 149
474 3300025303 Ga0209051_1007151 Ga0209051_10071514 149
475 3300025304 Ga0209257_1039691 Ga0209257_10396912 149
476 3300025321 Ga0207656_10008269 Ga0207656_100082694 149
477 3300025900 Ga0207710_10003748 Ga0207710_100037487 149
478 3300025903 Ga0207680_10001902 Ga0207680_100019023 149
479 3300025904 Ga0207647_10000034 Ga0207647_1000003421 149
480 3300025904 Ga0207647_10000262 Ga0207647_100002629 149
481 3300025911 Ga0207654_10494947 Ga0207654_104949471 149
482 3300025913 Ga0207695_10027716 Ga0207695_100277168 149
483 3300025913 Ga0207695_10176528 Ga0207695_101765283 149
484 3300025914 Ga0207671_10094240 Ga0207671_100942403 149
485 3300025920 Ga0207649_10249805 Ga0207649_102498052 149
486 3300025920 Ga0207649_10811832 Ga0207649_108118322 149
487 3300025924 Ga0207694_10001428 Ga0207694_1000142821 149
488 3300025924 Ga0207694_10001879 Ga0207694_1000187919 149
489 3300025925 Ga0207650_10006245 Ga0207650_100062453 149
490 3300025933 Ga0207706_10004869 Ga0207706_100048696 149
491 3300025938 Ga0207704_10841111 Ga0207704_108411111 149
492 3300025961 Ga0207712_10000395 Ga0207712_100003959 149
493 3300025986 Ga0207658_10213853 Ga0207658_102138533 149
494 3300026023 Ga0207677_10088491 Ga0207677_100884913 149
495 3300026035 Ga0207703_10000766 Ga0207703_1000076614 149
496 3300026035 Ga0207703_10337519 Ga0207703_103375192 149
497 3300026041 Ga0207639_10000277 Ga0207639_100002773 149
498 3300026041 Ga0207639_10007555 Ga0207639_100075557 149
499 3300026067 Ga0207678_10016613 Ga0207678_100166133 149
500 3300026067 Ga0207678_10106813 Ga0207678_101068133 149
501 3300026088 Ga0207641_10376307 Ga0207641_103763072 149
502 3300026089 Ga0207648_10016027 Ga0207648_100160276 149
503 3300028379 Ga0268266_10000008 Ga0268266_10000008834 149
504 3300031911 Ga0307412_10043615 Ga0307412_100436154 149
505 3300032002 Ga0307416_100132487 Ga0307416_1001324873 149
506 3300041404 Ga0439436_0000032 Ga0439436_0000032_39050_39499 149
507 3300041413 Ga0439465_0000530 Ga0439465_0000530_10946_11395 149
508 3300041453 Ga0451797_0113713 Ga0451797_0113713_614_1075 149
509 3300041456 Ga0451795_0322423 Ga0451795_0322423_313_762 149
510 3300042184 Ga0450908_000007 Ga0450908_000007_42630_43079 149
511 3300042876 Ga0451577_0176764 Ga0451577_0176764_238_696 149
512 3300044663 Ga0466989_0163097 Ga0466989_0163097_232_681 149
513 3300044684 Ga0466966_0041964 Ga0466966_0041964_359_808 149
514 3300044712 Ga0453684_0000316 Ga0453684_0000316_50298_50762 149
515 3300044719 Ga0466971_0001777 Ga0466971_0001777_8088_8537 149
516 3300044735 Ga0466968_0001797 Ga0466968_0001797_2919_3368 149
517 3300045049 Ga0466959_0005091 Ga0466959_0005091_5853_6302 149
518 3300045051 Ga0451576_0000128 Ga0451576_0000128_37912_38376 149
519 3300045836 Ga0466958_0032951 Ga0466958_0032951_2072_2521 149
520 3300046452 Ga0495617_000607 Ga0495617_000607_6678_7127 149
521 3300046452 Ga0495617_001095 Ga0495617_001095_5731_6180 149
522 3300046460 Ga0495638_0001628 Ga0495638_0001628_721_1170 149
523 3300046471 Ga0495650_0000869 Ga0495650_0000869_14225_14674 149
524 3300046474 Ga0495605_0126429 Ga0495605_0126429_355_804 149
525 3300046491 Ga0495584_0001662 Ga0495584_0001662_5963_6412 149
526 3300046492 Ga0495585_0001138 Ga0495585_0001138_491_940 149
527 3300046492 Ga0495585_0040927 Ga0495585_0040927_491_940 149
528 3300046501 Ga0495607_0000133 Ga0495607_0000133_9330_9779 149
529 3300046506 Ga0495583_0011255 Ga0495583_0011255_2431_2880 149
530 3300046507 Ga0495606_0000160 Ga0495606_0000160_20801_21250 149
531 3300046507 Ga0495606_0001918 Ga0495606_0001918_21939_22388 149
532 3300046507 Ga0495606_0002253 Ga0495606_0002253_4877_5326 149
533 3300046507 Ga0495606_0234825 Ga0495606_0234825_387_836 149
534 3300046512 Ga0495610_0004501 Ga0495610_0004501_67_516 149
535 3300046512 Ga0495610_0029998 Ga0495610_0029998_1091_1540 149
536 3300046513 Ga0495616_0000006 Ga0495616_0000006_105609_106058 149
537 3300046513 Ga0495616_0047917 Ga0495616_0047917_1223_1672 149
538 3300046515 Ga0495620_0000711 Ga0495620_0000711_6637_7086 149
539 3300046515 Ga0495620_0097744 Ga0495620_0097744_515_964 149
540 3300046518 Ga0495631_0000036 Ga0495631_0000036_45551_46000 149
541 3300046518 Ga0495631_0000318 Ga0495631_0000318_12077_12526 149
542 3300046519 Ga0495632_0012658 Ga0495632_0012658_984_1433 149
543 3300046519 Ga0495632_0054517 Ga0495632_0054517_1218_1667 149
544 3300046520 Ga0495637_0007175 Ga0495637_0007175_4121_4570 149
545 3300046522 Ga0495643_0177310 Ga0495643_0177310_189_638 149
546 3300046524 Ga0495648_0000881 Ga0495648_0000881_26192_26641 149
547 3300046538 Ga0495609_0149052 Ga0495609_0149052_397_846 149
548 3300046557 Ga0495622_0251985 Ga0495622_0251985_275_724 149
549 3300046616 Ga0495668_0005730 Ga0495668_0005730_501_950 149
550 3300046648 Ga0495611_0000003 Ga0495611_0000003_376421_376870 149
551 3300046648 Ga0495611_0000028 Ga0495611_0000028_27619_28068 149
552 3300046660 Ga0495625_0000193 Ga0495625_0000193_18796_19245 149
553 3300046660 Ga0495625_0006388 Ga0495625_0006388_6772_7221 149
554 3300046660 Ga0495625_0048981 Ga0495625_0048981_739_1188 149
555 3300046665 Ga0495661_0001277 Ga0495661_0001277_7164_7613 149
556 3300046691 Ga0495670_0000413 Ga0495670_0000413_6809_7258 149
557 3300046691 Ga0495670_0013548 Ga0495670_0013548_2526_2975 149
558 3300046691 Ga0495670_0026664 Ga0495670_0026664_21_470 149
559 3300046692 Ga0495671_0000142 Ga0495671_0000142_53523_53972 149
560 3300046694 Ga0495649_0009358 Ga0495649_0009358_5347_5796 149
561 3300046794 Ga0495589_0000042 Ga0495589_0000042_19050_19499 149
562 3300046810 Ga0495660_0004438 Ga0495660_0004438_5320_5769 149
563 3300046810 Ga0495660_0010465 Ga0495660_0010465_2749_3198 149
564 3300047323 Ga0495683_0000722 Ga0495683_0000722_18793_19242 149
565 3300047446 Ga0495679_000046 Ga0495679_000046_18812_19261 149
566 3300047469 Ga0495673_0000004 Ga0495673_0000004_582333_582782 149
567 3300047469 Ga0495673_0000041 Ga0495673_0000041_194115_194564 149
568 3300047469 Ga0495673_0004939 Ga0495673_0004939_874_1323 149
569 3300047470 Ga0495681_0111495 Ga0495681_0111495_140_589 149
570 3300047472 Ga0495686_0000117 Ga0495686_0000117_55136_55585 149
571 3300047472 Ga0495686_0000229 Ga0495686_0000229_68091_68540 149
572 3300047472 Ga0495686_0002823 Ga0495686_0002823_7691_8140 149
573 3300047472 Ga0495686_0007664 Ga0495686_0007664_6468_6917 149
574 3300047472 Ga0495686_0023910 Ga0495686_0023910_559_1008 149
575 3300048903 Ga0496100_0090442 Ga0496100_0090442_825_1274 149
576 3300048904 Ga0496101_0004110 Ga0496101_0004110_7644_8093 149
577 3300048905 Ga0496102_0413565 Ga0496102_0413565_774_1235 149
578 3300048909 Ga0496106_0001877 Ga0496106_0001877_10927_11376 149
579 3300048911 Ga0496108_0260772 Ga0496108_0260772_184_633 149
580 3300048919 Ga0496116_0190880 Ga0496116_0190880_148_597 149
581 3300048920 Ga0496117_0023133 Ga0496117_0023133_3666_4115 149
582 3300048920 Ga0496117_0030912 Ga0496117_0030912_908_1357 149
583 3300048921 Ga0496118_0002903 Ga0496118_0002903_11013_11462 149
584 3300048921 Ga0496118_0006396 Ga0496118_0006396_5739_6188 149
585 3300048922 Ga0496119_0018397 Ga0496119_0018397_1306_1755 149
586 3300048924 Ga0496121_0000771 Ga0496121_0000771_46798_47247 149
587 3300048924 Ga0496121_0001298 Ga0496121_0001298_31117_31566 149
588 3300048924 Ga0496121_0003299 Ga0496121_0003299_9124_9573 149
589 3300048924 Ga0496121_0032700 Ga0496121_0032700_2692_3141 149
590 3300048924 Ga0496121_0363267 Ga0496121_0363267_45_506 149
591 3300048925 Ga0496122_0082530 Ga0496122_0082530_732_1181 149
592 3300048925 Ga0496122_0116918 Ga0496122_0116918_940_1401 149
593 3300048926 Ga0496123_0042437 Ga0496123_0042437_185_634 149
594 3300048926 Ga0496123_0096190 Ga0496123_0096190_935_1384 149
595 3300048928 Ga0496125_0008488 Ga0496125_0008488_3657_4106 149
596 3300048929 Ga0496126_0016296 Ga0496126_0016296_3359_3808 149
597 3300048929 Ga0496126_0062906 Ga0496126_0062906_1131_1592 149
598 3300049459 Ga0495678_000066 Ga0495678_000066_54776_55225 149
599 3300049460 Ga0495682_0003108 Ga0495682_0003108_5493_5942 149
600 3300049460 Ga0495682_0095429 Ga0495682_0095429_494_943 149
601 3300053087 Ga0500643_000036 Ga0500643_000036_70234_70683 149
602 3300053103 Ga0500555_001310 Ga0500555_001310_2219_2668 149
603 3300053131 Ga0500652_190098 Ga0500652_190098_141_590 149
604 3300053160 Ga0500633_0001664 Ga0500633_0001664_2078_2527 149
605 3300053730 Ga0500645_000639 Ga0500645_000639_1044_1493 149
606 3300061719 Ga0466962_0037551 Ga0466962_0037551_1741_2190 149
607 3300001904 JGI24736J21556_1039259 JGI24736J21556_10392592 150
608 3300001915 JGI24741J21665_1002334 JGI24741J21665_10023346 150
609 3300001915 JGI24741J21665_1002712 JGI24741J21665_10027123 150
610 3300001979 JGI24740J21852_10000701 JGI24740J21852_100007016 150
611 3300005327 Ga0070658_10118601 Ga0070658_101186013 150
612 3300005327 Ga0070658_10550404 Ga0070658_105504042 150
613 3300005327 Ga0070658_10614628 Ga0070658_106146282 150
614 3300005329 Ga0070683_100127162 Ga0070683_1001271623 150
615 3300005329 Ga0070683_100142437 Ga0070683_1001424373 150
616 3300005329 Ga0070683_100174384 Ga0070683_1001743843 150
617 3300005330 Ga0070690_100202766 Ga0070690_1002027662 150
618 3300005330 Ga0070690_100345793 Ga0070690_1003457932 150
619 3300005335 Ga0070666_10000487 Ga0070666_1000048716 150
620 3300005336 Ga0070680_100097990 Ga0070680_1000979903 150
621 3300005337 Ga0070682_100176722 Ga0070682_1001767222 150
622 3300005339 Ga0070660_100247365 Ga0070660_1002473652 150
623 3300005339 Ga0070660_100373620 Ga0070660_1003736202 150
624 3300005339 Ga0070660_100648008 Ga0070660_1006480082 150
625 3300005341 Ga0070691_10032937 Ga0070691_100329373 150
626 3300005344 Ga0070661_100014442 Ga0070661_1000144426 150
627 3300005344 Ga0070661_100108677 Ga0070661_1001086773 150
628 3300005344 Ga0070661_100134943 Ga0070661_1001349433 150
629 3300005344 Ga0070661_100239179 Ga0070661_1002391792 150
630 3300005345 Ga0070692_10037193 Ga0070692_100371933 150
631 3300005345 Ga0070692_10105382 Ga0070692_101053823 150
632 3300005355 Ga0070671_100415382 Ga0070671_1004153822 150
633 3300005366 Ga0070659_100058492 Ga0070659_1000584923 150
634 3300005367 Ga0070667_100000072 Ga0070667_10000007215 150
635 3300005367 Ga0070667_100244360 Ga0070667_1002443603 150
636 3300005367 Ga0070667_100591501 Ga0070667_1005915012 150
637 3300005445 Ga0070708_100946346 Ga0070708_1009463462 150
638 3300005455 Ga0070663_100005396 Ga0070663_1000053964 150
639 3300005455 Ga0070663_100072087 Ga0070663_1000720873 150
640 3300005455 Ga0070663_100287078 Ga0070663_1002870782 150
641 3300005455 Ga0070663_100868267 Ga0070663_1008682672 150
642 3300005458 Ga0070681_10000151 Ga0070681_1000015131 150
643 3300005458 Ga0070681_10128599 Ga0070681_101285993 150
644 3300005518 Ga0070699_100485645 Ga0070699_1004856452 150
645 3300005530 Ga0070679_100000250 Ga0070679_10000025022 150
646 3300005535 Ga0070684_100089335 Ga0070684_1000893353 150
647 3300005535 Ga0070684_100131098 Ga0070684_1001310983 150
648 3300005535 Ga0070684_100288459 Ga0070684_1002884592 150
649 3300005539 Ga0068853_100006694 Ga0068853_1000066943 150
650 3300005539 Ga0068853_100016337 Ga0068853_1000163377 150
651 3300005539 Ga0068853_100035262 Ga0068853_1000352622 150
652 3300005539 Ga0068853_100053738 Ga0068853_1000537383 150
653 3300005539 Ga0068853_101179716 Ga0068853_1011797162 150
654 3300005546 Ga0070696_100031485 Ga0070696_1000314853 150
655 3300005563 Ga0068855_100010660 Ga0068855_1000106607 150
656 3300005564 Ga0070664_100128266 Ga0070664_1001282663 150
657 3300005577 Ga0068857_100038503 Ga0068857_1000385035 150
658 3300005577 Ga0068857_100050500 Ga0068857_1000505005 150
659 3300005577 Ga0068857_100226826 Ga0068857_1002268261 150
660 3300005578 Ga0068854_100113799 Ga0068854_1001137992 150
661 3300005578 Ga0068854_100123359 Ga0068854_1001233592 150
662 3300005578 Ga0068854_100429121 Ga0068854_1004291212 150
663 3300005614 Ga0068856_100012219 Ga0068856_1000122197 150
664 3300005614 Ga0068856_100169157 Ga0068856_1001691573 150
665 3300005614 Ga0068856_100319989 Ga0068856_1003199892 150
666 3300005616 Ga0068852_100006036 Ga0068852_1000060366 150
667 3300005616 Ga0068852_100034585 Ga0068852_1000345853 150
668 3300005616 Ga0068852_100169580 Ga0068852_1001695802 150
669 3300005616 Ga0068852_100178626 Ga0068852_1001786263 150
670 3300005616 Ga0068852_100235707 Ga0068852_1002357072 150
671 3300005617 Ga0068859_101521946 Ga0068859_1015219462 150
672 3300005618 Ga0068864_100004209 Ga0068864_10000420910 150
673 3300005834 Ga0068851_10019388 Ga0068851_100193884 150
674 3300005834 Ga0068851_10196718 Ga0068851_101967182 150
675 3300005841 Ga0068863_100006254 Ga0068863_10000625410 150
676 3300005841 Ga0068863_100556207 Ga0068863_1005562072 150
677 3300005842 Ga0068858_100074088 Ga0068858_1000740884 150
678 3300005842 Ga0068858_100630593 Ga0068858_1006305932 150
679 3300005842 Ga0068858_100733808 Ga0068858_1007338082 150
680 3300005843 Ga0068860_100017401 Ga0068860_1000174017 150
681 3300005843 Ga0068860_100270877 Ga0068860_1002708773 150
682 3300006237 Ga0097621_100482046 Ga0097621_1004820461 150
683 3300006358 Ga0068871_100231117 Ga0068871_1002311171 150
684 3300006931 Ga0097620_101522031 Ga0097620_1015220312 150
685 3300009093 Ga0105240_10055889 Ga0105240_100558892 150
686 3300009093 Ga0105240_10152926 Ga0105240_101529263 150
687 3300009093 Ga0105240_10256770 Ga0105240_102567702 150
688 3300009093 Ga0105240_11226200 Ga0105240_112262002 150
689 3300009093 Ga0105240_11500257 Ga0105240_115002572 150
690 3300009098 Ga0105245_10286466 Ga0105245_102864662 150
691 3300009098 Ga0105245_10406451 Ga0105245_104064512 150
692 3300009174 Ga0105241_10015625 Ga0105241_100156255 150
693 3300009174 Ga0105241_10094532 Ga0105241_100945323 150
694 3300009174 Ga0105241_10620362 Ga0105241_106203622 150
695 3300009174 Ga0105241_11415169 Ga0105241_114151691 150
696 3300009177 Ga0105248_10000920 Ga0105248_1000092021 150
697 3300009545 Ga0105237_10008928 Ga0105237_100089285 150
698 3300009545 Ga0105237_10009642 Ga0105237_100096429 150
699 3300009545 Ga0105237_11987742 Ga0105237_119877421 150
700 3300009551 Ga0105238_10005144 Ga0105238_100051448 150
701 3300009551 Ga0105238_11236530 Ga0105238_112365302 150
702 3300009553 Ga0105249_10000084 Ga0105249_1000008498 150
703 3300010375 Ga0105239_10018126 Ga0105239_100181268 150
704 3300010375 Ga0105239_10106637 Ga0105239_101066373 150
705 3300011119 Ga0105246_10011815 Ga0105246_100118152 150
706 3300011119 Ga0105246_10128100 Ga0105246_101281002 150
707 3300013059 Ga0154012_169161 Ga0154012_1691612 150
708 3300013100 Ga0157373_10011463 Ga0157373_100114637 150
709 3300013100 Ga0157373_10100595 Ga0157373_101005954 150
710 3300013102 Ga0157371_10070400 Ga0157371_100704002 150
711 3300013102 Ga0157371_10348755 Ga0157371_103487552 150
712 3300013104 Ga0157370_10023809 Ga0157370_100238096 150
713 3300013105 Ga0157369_10011973 Ga0157369_100119739 150
714 3300013105 Ga0157369_10124679 Ga0157369_101246792 150
715 3300013105 Ga0157369_11419744 Ga0157369_114197442 150
716 3300013307 Ga0157372_10000334 Ga0157372_1000033442 150
717 3300013307 Ga0157372_10044203 Ga0157372_100442034 150
718 3300013307 Ga0157372_10066779 Ga0157372_100667795 150
719 3300013307 Ga0157372_11449664 Ga0157372_114496642 150
720 3300014325 Ga0163163_10000112 Ga0163163_1000011239 150
721 3300014325 Ga0163163_10000585 Ga0163163_1000058516 150
722 3300014497 Ga0182008_10055909 Ga0182008_100559092 150
723 3300014968 Ga0157379_10007853 Ga0157379_100078535 150
724 3300020070 Ga0206356_11026662 Ga0206356_110266622 150
725 3300020077 Ga0206351_10589011 Ga0206351_105890113 150
726 3300020078 Ga0206352_10871908 Ga0206352_108719082 150
727 3300020080 Ga0206350_11455286 Ga0206350_114552862 150
728 3300020081 Ga0206354_10524459 Ga0206354_105244592 150
729 3300020082 Ga0206353_10447795 Ga0206353_104477955 150
730 3300020082 Ga0206353_11143090 Ga0206353_111430902 150
731 3300020610 Ga0154015_1513628 Ga0154015_15136283 150
732 3300022467 Ga0224712_10074632 Ga0224712_100746322 150
733 3300025321 Ga0207656_10119317 Ga0207656_101193172 150
734 3300025903 Ga0207680_10000598 Ga0207680_100005988 150
735 3300025903 Ga0207680_10388284 Ga0207680_103882841 150
736 3300025904 Ga0207647_10002208 Ga0207647_100022088 150
737 3300025904 Ga0207647_10012004 Ga0207647_100120045 150
738 3300025909 Ga0207705_10000560 Ga0207705_1000056011 150
739 3300025909 Ga0207705_10037183 Ga0207705_100371833 150
740 3300025909 Ga0207705_10112632 Ga0207705_101126322 150
741 3300025909 Ga0207705_10678893 Ga0207705_106788932 150
742 3300025911 Ga0207654_10000719 Ga0207654_100007192 150
743 3300025911 Ga0207654_10005416 Ga0207654_100054167 150
744 3300025911 Ga0207654_10213287 Ga0207654_102132872 150
745 3300025912 Ga0207707_10000064 Ga0207707_1000006434 150
746 3300025912 Ga0207707_10006315 Ga0207707_100063159 150
747 3300025912 Ga0207707_10094005 Ga0207707_100940051 150
748 3300025913 Ga0207695_10002529 Ga0207695_100025292 150
749 3300025913 Ga0207695_10003607 Ga0207695_1000360717 150
750 3300025913 Ga0207695_10056422 Ga0207695_100564224 150
751 3300025913 Ga0207695_10103753 Ga0207695_101037532 150
752 3300025913 Ga0207695_10544900 Ga0207695_105449002 150
753 3300025914 Ga0207671_10013618 Ga0207671_100136185 150
754 3300025917 Ga0207660_10001372 Ga0207660_100013725 150
755 3300025917 Ga0207660_10001813 Ga0207660_100018138 150
756 3300025917 Ga0207660_10003444 Ga0207660_100034445 150
757 3300025919 Ga0207657_10002836 Ga0207657_100028369 150
758 3300025919 Ga0207657_10029335 Ga0207657_100293353 150
759 3300025919 Ga0207657_10029430 Ga0207657_100294305 150
760 3300025920 Ga0207649_10001382 Ga0207649_1000138211 150
761 3300025920 Ga0207649_10010845 Ga0207649_100108453 150
762 3300025921 Ga0207652_10000019 Ga0207652_10000019119 150
763 3300025921 Ga0207652_10000801 Ga0207652_1000080117 150
764 3300025921 Ga0207652_10008959 Ga0207652_100089592 150
765 3300025921 Ga0207652_10333672 Ga0207652_103336722 150
766 3300025924 Ga0207694_10048048 Ga0207694_100480485 150
767 3300025924 Ga0207694_10520874 Ga0207694_105208742 150
768 3300025927 Ga0207687_10218969 Ga0207687_102189692 150
769 3300025931 Ga0207644_10735062 Ga0207644_107350622 150
770 3300025932 Ga0207690_10011845 Ga0207690_100118455 150
771 3300025932 Ga0207690_10068857 Ga0207690_100688572 150
772 3300025933 Ga0207706_10133414 Ga0207706_101334143 150
773 3300025941 Ga0207711_10001918 Ga0207711_1000191811 150
774 3300025944 Ga0207661_10036981 Ga0207661_100369815 150
775 3300025944 Ga0207661_10448781 Ga0207661_104487812 150
776 3300025945 Ga0207679_10054898 Ga0207679_100548984 150
777 3300025949 Ga0207667_10000574 Ga0207667_1000057414 150
778 3300025949 Ga0207667_10002469 Ga0207667_100024695 150
779 3300025949 Ga0207667_10007024 Ga0207667_100070248 150
780 3300025949 Ga0207667_10204493 Ga0207667_102044932 150
781 3300025961 Ga0207712_10000140 Ga0207712_1000014056 150
782 3300025981 Ga0207640_10000495 Ga0207640_100004955 150
783 3300025981 Ga0207640_10001128 Ga0207640_100011289 150
784 3300025981 Ga0207640_10037290 Ga0207640_100372902 150
785 3300025986 Ga0207658_10000997 Ga0207658_1000099714 150
786 3300025986 Ga0207658_10302291 Ga0207658_103022912 150
787 3300026035 Ga0207703_10415415 Ga0207703_104154152 150
788 3300026041 Ga0207639_10002487 Ga0207639_100024879 150
789 3300026041 Ga0207639_10049181 Ga0207639_100491815 150
790 3300026041 Ga0207639_10441995 Ga0207639_104419952 150
791 3300026041 Ga0207639_11168568 Ga0207639_111685682 150
792 3300026067 Ga0207678_10002665 Ga0207678_100026659 150
793 3300026067 Ga0207678_10026967 Ga0207678_100269675 150
794 3300026067 Ga0207678_10027074 Ga0207678_100270745 150
795 3300026067 Ga0207678_10345286 Ga0207678_103452862 150
796 3300026078 Ga0207702_10013397 Ga0207702_100133976 150
797 3300026078 Ga0207702_10054245 Ga0207702_100542452 150
798 3300026078 Ga0207702_10439479 Ga0207702_104394792 150
799 3300026088 Ga0207641_10025217 Ga0207641_100252172 150
800 3300026095 Ga0207676_10038682 Ga0207676_100386824 150
801 3300026116 Ga0207674_10002886 Ga0207674_1000288619 150
802 3300026116 Ga0207674_10039493 Ga0207674_100394933 150
803 3300026116 Ga0207674_10046326 Ga0207674_100463265 150
804 3300026142 Ga0207698_10000491 Ga0207698_1000049121 150
805 3300026142 Ga0207698_10006628 Ga0207698_100066289 150
806 3300026142 Ga0207698_10021688 Ga0207698_100216882 150
807 3300026142 Ga0207698_12006094 Ga0207698_120060941 150
808 3300028381 Ga0268264_10003031 Ga0268264_1000303112 150
809 3300028381 Ga0268264_10386309 Ga0268264_103863092 150
810 3300031507 Ga0307509_10399468 Ga0307509_103994682 150
811 3300031616 Ga0307508_10226554 Ga0307508_102265542 150
812 3300031824 Ga0307413_10477018 Ga0307413_104770182 150
813 3300031911 Ga0307412_11252999 Ga0307412_112529992 150
814 3300032004 Ga0307414_10094121 Ga0307414_100941212 150
815 3300032004 Ga0307414_10423568 Ga0307414_104235682 150
816 3300032005 Ga0307411_10259112 Ga0307411_102591122 150
817 3300032005 Ga0307411_11110105 Ga0307411_111101051 150
818 3300033179 Ga0307507_10102026 Ga0307507_101020262 150
819 3300037418 Ga0395900_0102529 Ga0395900_0102529_1649_2101 150
820 3300037418 Ga0395900_0471806 Ga0395900_0471806_45_497 150
821 3300037466 Ga0395898_0097752 Ga0395898_0097752_1890_2342 150
822 3300038443 Ga0395901_0371738 Ga0395901_0371738_898_1350 150
823 3300041456 Ga0451795_0773849 Ga0451795_0773849_314_769 150
824 3300046519 Ga0495632_0000010 Ga0495632_0000010_218021_218473 150
825 3300047472 Ga0495686_0011281 Ga0495686_0011281_3175_3639 150
826 3300048906 Ga0496103_0026448 Ga0496103_0026448_216_677 150
827 3300048920 Ga0496117_0029156 Ga0496117_0029156_1981_2445 150
828 3300048920 Ga0496117_0103448 Ga0496117_0103448_1049_1513 150
829 3300048921 Ga0496118_0001472 Ga0496118_0001472_33868_34332 150
830 3300048921 Ga0496118_0008697 Ga0496118_0008697_4459_4920 150
831 3300048924 Ga0496121_0630530 Ga0496121_0630530_70_534 150
832 3300048925 Ga0496122_0001358 Ga0496122_0001358_4927_5391 150
833 3300048926 Ga0496123_0004978 Ga0496123_0004978_7658_8122 150
834 3300048929 Ga0496126_0442509 Ga0496126_0442509_16_480 150
835 3300049571 Ga0501034_0006620 Ga0501034_0006620_5135_5599 150
836 3300049572 Ga0501036_0394918 Ga0501036_0394918_664_1128 150
837 3300049573 Ga0501037_0152969 Ga0501037_0152969_948_1412 150
838 3300049574 Ga0501038_0015538 Ga0501038_0015538_3215_3679 150
839 3300049575 Ga0501039_0120244 Ga0501039_0120244_89_553 150
840 3300049579 Ga0501043_0196194 Ga0501043_0196194_692_1156 150
841 3300049579 Ga0501043_0255343 Ga0501043_0255343_419_883 150
842 3300049580 Ga0501046_0234302 Ga0501046_0234302_330_794 150
843 3300049581 Ga0501047_0002093 Ga0501047_0002093_11147_11611 150
844 3300049581 Ga0501047_0003063 Ga0501047_0003063_1516_1980 150
845 3300049581 Ga0501047_0059989 Ga0501047_0059989_486_950 150
846 3300049581 Ga0501047_0060899 Ga0501047_0060899_537_989 150
847 3300049582 Ga0501048_0111141 Ga0501048_0111141_406_870 150
848 3300049583 Ga0501067_0000583 Ga0501067_0000583_11991_12455 150
849 3300049584 Ga0501068_0184873 Ga0501068_0184873_564_1028 150
850 3300049585 Ga0501069_0002178 Ga0501069_0002178_8351_8815 150
851 3300049585 Ga0501069_0026323 Ga0501069_0026323_1145_1597 150
852 3300049585 Ga0501069_0066946 Ga0501069_0066946_1327_1791 150
853 3300049586 Ga0501070_0004139 Ga0501070_0004139_9363_9815 150
854 3300049586 Ga0501070_0004257 Ga0501070_0004257_6662_7114 150
855 3300049586 Ga0501070_0061919 Ga0501070_0061919_256_720 150
856 3300049586 Ga0501070_0146981 Ga0501070_0146981_748_1200 150
857 3300049586 Ga0501070_0458335 Ga0501070_0458335_80_544 150
858 3300049588 Ga0501072_0002507 Ga0501072_0002507_12428_12892 150
859 3300049589 Ga0501073_0015945 Ga0501073_0015945_256_720 150
860 3300049589 Ga0501073_0159283 Ga0501073_0159283_709_1173 150
861 3300049589 Ga0501073_0209089 Ga0501073_0209089_455_919 150
862 3300049589 Ga0501073_0284279 Ga0501073_0284279_206_658 150
863 3300049590 Ga0501074_0003986 Ga0501074_0003986_8258_8710 150
864 3300049590 Ga0501074_0025883 Ga0501074_0025883_117_569 150
865 3300049590 Ga0501074_0062333 Ga0501074_0062333_1556_2020 150
866 3300049590 Ga0501074_0065446 Ga0501074_0065446_2137_2601 150
867 3300049590 Ga0501074_1063612 Ga0501074_1063612_26_478 150
868 3300049741 Ga0501079_0026319 Ga0501079_0026319_2840_3304 150
869 3300049741 Ga0501079_0173661 Ga0501079_0173661_776_1240 150
870 3300049742 Ga0501080_0000256 Ga0501080_0000256_13842_14306 150
871 3300049742 Ga0501080_0001893 Ga0501080_0001893_9905_10369 150
872 3300049742 Ga0501080_0003974 Ga0501080_0003974_5454_5906 150
873 3300049742 Ga0501080_0097338 Ga0501080_0097338_235_690 150
874 3300049744 Ga0501083_0001929 Ga0501083_0001929_3293_3757 150
875 3300049822 Ga0501035_0030885 Ga0501035_0030885_1119_1571 150
876 3300049823 Ga0501044_0003272 Ga0501044_0003272_10731_11195 150
877 3300049823 Ga0501044_0007113 Ga0501044_0007113_454_906 150
878 3300049823 Ga0501044_0114409 Ga0501044_0114409_1598_2062 150
879 3300053087 Ga0500643_008323 Ga0500643_008323_2096_2560 150
880 3300053120 Ga0500597_000016 Ga0500597_000016_5212_5676 150
881 3300054114 Ga0501084_0291415 Ga0501084_0291415_441_905 150
882 3300060353 Ga0501082_0201301 Ga0501082_0201301_45_509 150
883 3300060353 Ga0501082_0287069 Ga0501082_0287069_535_999 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

14

134

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9666 12 147
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9529 12 147
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.9471 11 147
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.934 11 147
5lm7-assembly2.cif.gz_D crystal structure of the lambda n-nus factor complex 0.9107 15 144
ID Description Score Start End Superfamily
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9643 10 147 1.10.940.10
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9508 10 147 1.10.940.10
5lm7D00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9107 15 144 1.10.940.10
af_Q2FY45_1_129_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9007 16 139 1.10.940.10
af_Q2FZ67_2_133_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9007 18 139 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A836PN20-F1-model_v4 Transcription antitermination factor NusB 0.9922 55 149 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A368HI50-F1-model_v4 Transcription antitermination factor NusB 0.9879 52 145 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A831Z5G0-F1-model_v4 Transcription antitermination factor NusB 0.9854 59 149 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A7X5U9W7-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9833 8 150 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A7J6JU36-F1-model_v4 deleted 0.9829 50 147

Feature Viewer

pLDDT pTM Quality
88.7 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map