metagRoot

F484604

General Info

Members	Datasets	Scaffolds	Average Seq Length
883	513	705	363

Family's Representative Sequence

Representative Sequence	3300048922\|Ga0496119_0028178\|Ga0496119_0028178_602_1867
Length	421
Sequence	MVRLPTAHVESAGPGCVARYPHNSCEIDASRPEPPISHESPGLDRRAHAYAGTMRVLAAMSGGVDSAVAAARAVEAGHDVVGVHLALSRQPGTLRTGARGCCTIEDSMDARRAATMLGIPFYVWDFSERFQLDVVDDFVAEYAAGRTPNPCLRCNERIKFAALLERALALGFDAVATGHYASIVTDQHGNRELHRAADWAKDQSYVLGVLTAEQLAHAMFPLGATPSKAEVRAEAAARGLTVAQKPDSHDICFIPDGDTRGWLAGRIEAEEGAILDQAGERIGTHAGAAAFTVXXRKGLSIGVPAPDGRPRFVLEVRPRSNEVVVGPREALAVAELAGSRISWAGIPPEDAAAGFACEVQVRAHGDPVPATAVLRDGELVIRPDAALDGVAPGQSAVLYRGTRVLGQCTIDRTVSAVPLPA

Samples

	Sample ID	Description	Type	Environment
1	2527291627	Frankia casuarinae Thr	Isolate	Nodule
2	2527291629	Frankia sp. BMG5.23	Isolate	Nodule
3	2546825537	Frankia sp. CcI6	Isolate	Rhizoplane
4	2554235227	Arthrobacter sp. PAO19	Isolate	Rhizosphere
5	2558860280	Kutzneria sp. 744	Isolate	Unclassified
6	2576861822	Frankia sp. CeD	Isolate	Nodule
7	2579778521	Frankia torreyi CpI1-S	Isolate	Unclassified
8	2582580736	Prauserella sp. Am3	Isolate	Unclassified
9	2585427649	Amycolatopsis japonica MG417-CF17, DSM 44213	Isolate	Unclassified
10	2585428094	Herbiconiux sp. YR403	Isolate	Rhizosphere
11	2585428157	Microbacterium sp. CF335	Isolate	Rhizosphere
12	2619618881	Frankia sp. ACN1ag	Isolate	Unclassified
13	2619619003	Frankia sp. CpI1-P	Isolate	Nodule
14	2626541554	Frankia sp. AvcI.1	Isolate	Nodule
15	2643221542	Microbacterium sp. Root1433D1	Isolate	Unclassified
16	2643221546	Microbacterium sp. Root53	Isolate	Unclassified
17	2643221553	Microbacterium sp. Root553	Isolate	Unclassified
18	2643221566	Microbacterium sp. Root166	Isolate	Unclassified
19	2643221572	Leifsonia sp. Root60	Isolate	Unclassified
20	2643221575	Microbacterium sp. Root61	Isolate	Unclassified
21	2643221597	Microbacterium sp. Root180	Isolate	Unclassified
22	2643221616	Leifsonia sp. Root227	Isolate	Unclassified
23	2643221630	Microbacterium sp. Root322	Isolate	Unclassified
24	2643221632	Leifsonia sp. Root112D2	Isolate	Unclassified
25	2643221635	Yonghaparkia sp. Root332	Isolate	Unclassified
26	2643221649	Leifsonia sp. Root4	Isolate	Unclassified
27	2643221669	Leifsonia sp. Root1293	Isolate	Unclassified
28	2643221724	Microbacterium sp. Root280D1	Isolate	Unclassified
29	2654587600	Glutamicibacter halophytocola KLBMP5180	Isolate	Unclassified
30	2671180195	Frankia sp. CcI49	Isolate	Nodule
31	2684623035	Frankia sp. NRRL B-16219	Isolate	Rhizosphere
32	2684623036	Frankia sp. CgIM4	Isolate	Nodule
33	2687453743	Frankia colletiae Cc1.17	Isolate	Nodule
34	2690315906	Arthrobacter sp. OY3WO11	Isolate	Unclassified
35	2710264753	Frankia sp. KB5	Isolate	Nodule
36	2728369276	Kineococcus rhizosphaerae DSM 19711	Isolate	Rhizosphere
37	2728369380	Microbacterium sp. 1.5R	Isolate	Rhizosphere
38	2739367653	Kocuria sp. OV113	Isolate	Unclassified
39	2747842429	Microbacterium sp. WCS2014-259	Isolate	Unclassified
40	2751185734	Saccharothrix sp. NRRL B-16314	Isolate	Rhizosphere
41	2751185788	Curtobacterium pusillum AA3	Isolate	Unclassified
42	2757320536	Microbacterium sp. NFIX05	Isolate	Unclassified
43	2773857758	Microbacterium chocolatum 1320	Isolate	Unclassified
44	2773857759	Microbacterium sp. 1294	Isolate	Unclassified
45	2773857763	Microbacterium sp. SAI-030	Isolate	Unclassified
46	2773857922	Frankia sp. CcI49	Isolate	Nodule
47	2773857924	Frankia sp. CgIS1	Isolate	Nodule
48	2775506735	Arthrobacter sp. S95 1704	Isolate	Unclassified
49	2775506925	Saccharopolyspora phatthalungensis NRRL B-24798	Isolate	Rhizosphere
50	2784132109	Dermacoccus sp. DS28 SAI-028	Isolate	Unclassified
51	2791354901	Actinophytocola xanthii 11-183	Isolate	Rhizosphere
52	2795385470	Labedaea rhizosphaerae DSM 45361	Isolate	Rhizosphere
53	2795385472	Herbihabitans rhizosphaerae DSM 101727	Isolate	Rhizosphere
54	2799112218	Motilibacter rhizosphaerae DSM 45622	Isolate	Rhizosphere
55	2808606306	Microbacterium sp. SLBN-146	Isolate	Unclassified
56	2808606357	Arthrobacter sp. SLBN-122	Isolate	Unclassified
57	2808606360	Arthrobacter sp. SLBN-112	Isolate	Unclassified
58	2808606366	Arthrobacter sp. SLBN-83	Isolate	Unclassified
59	2808606368	Microbacterium sp. SLBN-1	Isolate	Unclassified
60	2808606371	Arthrobacter sp. SLBN-53	Isolate	Unclassified
61	2808606372	Agromyces sp. 23-23	Isolate	Unclassified
62	2808606522	Amycolatopsis sp. BJA-103	Isolate	Unclassified
63	2808606700	Arthrobacter agilis UMCV2	Isolate	Rhizosphere
64	2811994871	Arthrobacter sp. SLBN-179	Isolate	Unclassified
65	2811994872	Microbacterium sp. MU4Y-5-1	Isolate	Unclassified
66	2816332305	Kocuria rhizophila FDAARGOS_302	Isolate	Rhizosphere
67	2818991318	Humibacillus xanthopallidus SLBN-155	Isolate	Unclassified
68	2821268502	Microbacterium sp. YT0620BN	Isolate	Unclassified
69	2833709550	Microbacterium sp. 3290	Isolate	Rhizosphere
70	2844841374	Leifsonia soli DSM 23871	Isolate	Rhizosphere
71	2844849076	Arthrobacter cupressi DSM 24664	Isolate	Rhizosphere
72	2852643534	Leifsonia sp. AK011	Isolate	Rhizosphere
73	2852646457	Microbacterium sp. AK031	Isolate	Rhizosphere
74	2852663356	Microbacterium sp. JAI119	Isolate	Rhizosphere
75	2857479173	Micrococcus sp. R-74225	Isolate	Unclassified
76	2857632687	Micrococcus sp. R-73081	Isolate	Unclassified
77	2857720070	Microbacterium sp. R-72113	Isolate	Unclassified
78	2857723135	Microbacterium sp. R-72356	Isolate	Unclassified
79	2857727296	Kocuria sp. R-72562	Isolate	Unclassified
80	2857729791	Plantibacter sp. R-72288	Isolate	Unclassified
81	2857733635	Salinibacterium sp. R-73062	Isolate	Unclassified
82	2857737099	Lysinimonas sp. R-73066	Isolate	Unclassified
83	2857740372	Paenarthrobacter sp. R-74611	Isolate	Unclassified
84	2862993130	Planctomonas deserti 13S1-3 v2	Isolate	Rhizosphere
85	2863067949	Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2)	Isolate	Rhizosphere
86	2866552031	Saccharopolyspora rhizosphaerae H219	Isolate	Unclassified
87	2866612099	Amycolatopsis suaedae 8-3EHSu	Isolate	Unclassified
88	2870622029	Conyzicola lurida DSM 105784	Isolate	Unclassified
89	2870628048	Microbacterium thalassium DSM 12511	Isolate	Rhizosphere
90	2870721527	Saccharothrix ecbatanensis DSM 45486	Isolate	Rhizosphere
91	2870801768	Micrococcus endophyticus DSM 17945	Isolate	Unclassified
92	2870804320	Micrococcus yunnanensis DSM 21948	Isolate	Unclassified
93	2883821847	Microlunatus elymi KUDC0627	Isolate	Rhizosphere
94	2884763398	Leifsonia sp. PS1209	Isolate	Stem Tuber
95	2891326441	Actinokineospora pegani TRM65233	Isolate	Unclassified
96	2895880812	Frankia sp. BMG5.11	Isolate	Unclassified
97	2897561785	Pseudoclavibacter endophyticus EGI 60007	Isolate	Unclassified
98	2899359706	Amycolatopsis anabasis EGI 650086	Isolate	Unclassified
99	2899370129	Amycolatopsis alkalitolerans SYSUP0005	Isolate	Stem Tuber
100	2904430863	Curtobacterium oceanosedimentum 1519	Isolate	Rhizosphere
101	2904497146	Arthrobacter sp. 1276	Isolate	Rhizosphere
102	2904501621	Curtobacterium sp. 1909	Isolate	Unclassified
103	2904509784	Microbacterium sp. 1676	Isolate	Rhizosphere
104	2904776348	Paenarthrobacter sp. 1092	Isolate	Rhizosphere
105	2905926851	Arthrobacter sedimenti MIC A30	Isolate	Rhizosphere
106	2906799679	Microbacterium karelineae TRM80801	Isolate	Unclassified
107	2908674828	Curtobacterium sp. 1517	Isolate	Rhizosphere
108	2908678064	Microbacterium sp. 1518	Isolate	Rhizosphere
109	2909074476	Curtobacterium sp. 1310	Isolate	Rhizosphere
110	2910809715	Paenarthrobacter sp. CM16	Isolate	Unclassified
111	2915768154	Amycolatopsis pittospori PIP199	Isolate	Unclassified
112	2917736166	Amycolatopsis dendrobii DR6-1	Isolate	Unclassified
113	2919034639	Paenarthrobacter nitroguajacolicus 247	Isolate	Rhizosphere
114	2919039151	Curtobacterium sp. 260	Isolate	Rhizosphere
115	2919042368	Curtobacterium sp. 320	Isolate	Rhizosphere
116	2919055335	Leifsonia sp. 1010	Isolate	Rhizosphere
117	2919059106	Arthrobacter sp. 1088	Isolate	Rhizosphere
118	2919069694	Microbacterium sp. 1154	Isolate	Unclassified
119	2919391150	Arthrobacter ipis 2973	Isolate	Unclassified
120	2919395869	Microbacterium resistens 2980	Isolate	Unclassified
121	2919443155	Agromyces sp. 3263	Isolate	Rhizosphere
122	2919523602	Leifsonia shinshuensis 3821	Isolate	Unclassified
123	2919538618	Paenarthrobacter nitroguajacolicus 3945	Isolate	Unclassified
124	2920879853	Kocuria salina CV6	Isolate	Unclassified
125	2928090899	Microbacterium sp. 1262	Isolate	Rhizosphere
126	2928104781	Curtobacterium sp. 1544	Isolate	Rhizosphere
127	2928121344	Plantibacter flavus 1756	Isolate	Rhizosphere
128	2928153084	Leifsonia sp. 563	Isolate	Unclassified
129	2928500415	Curtobacterium oceanosedimentum 1257	Isolate	Rhizosphere
130	2932426870	Paenarthrobacter sp. 4246	Isolate	Rhizosphere
131	2933418574	Jeotgalibacillus campisalis 4120	Isolate	Rhizosphere
132	2939598168	Arthrobacter sp. 754	Isolate	Rhizosphere
133	2939647034	Arthrobacter sp. 2762	Isolate	Rhizosphere
134	2939657138	Conyzicola nivalis 2857	Isolate	Rhizosphere
135	2939660829	Mycetocola sp. 2940	Isolate	Rhizosphere
136	2939674588	Arthrobacter bambusae 3552	Isolate	Rhizosphere
137	2945916053	Arthrobacter ulcerisalmonis W1I2	Isolate	Rhizosphere
138	2945920336	Pseudarthrobacter siccitolerans W1I3	Isolate	Rhizosphere
139	2945941187	Arthrobacter pascens W1I14	Isolate	Rhizosphere
140	2945968032	Microbacterium murale W2I7	Isolate	Rhizosphere
141	2946003308	Arthrobacter agilis W3I6	Isolate	Rhizosphere
142	2946024296	Arthrobacter woluwensis W4I2	Isolate	Rhizosphere
143	2946033335	Microbacterium sp. W4I4	Isolate	Rhizosphere
144	2946037020	Arthrobacter sp. W4I7	Isolate	Rhizosphere
145	2946041624	Microbacterium natoriense W4I9-1	Isolate	Rhizosphere
146	2946059875	Arthrobacter sp. SLBN-112	Isolate	Rhizosphere
147	2946080515	Microbacterium sp. W4I20	Isolate	Rhizosphere
148	2953998280	Pseudarthrobacter sp. W1I19	Isolate	Rhizosphere
149	2966924647	Frigoribacterium sp. 2355	Isolate	Rhizosphere
150	2974294766	Microbacterium proteolyticum SORGH_AS 209	Isolate	Unclassified
151	2974302888	Pseudarthrobacter sp. SORGH_AS 212	Isolate	Unclassified
152	2974324384	Microbacterium sp. SORGH_AS 344	Isolate	Unclassified
153	2977228692	Microbacterium sp. SORGH_AS 421	Isolate	Unclassified
154	2977236895	Microbacterium testaceum SORGH_AS 426	Isolate	Unclassified
155	2977251589	Microbacterium sp. SORGH_AS 505	Isolate	Unclassified
156	2977264416	Microbacterium testaceum SORGH_AS 594	Isolate	Unclassified
157	2984542743	Microbacterium sp. SORGH_AS454	Isolate	Aerial Root
158	2984551494	Curtobacterium sp. SORGH_AS776	Isolate	Aerial Root
159	2984580707	Microbacterium paludicola SORGH_AS919	Isolate	Aerial Root
160	2995726249	Leucobacter zeae CC-MF41	Isolate	Rhizosphere
161	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
162	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
163	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
164	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
165	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
166	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
167	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
168	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
169	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
170	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
171	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
172	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
173	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
174	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
175	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
176	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
177	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
178	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
179	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
180	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
181	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
182	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
183	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
184	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
185	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
186	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
187	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
188	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
189	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
190	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
191	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
192	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
193	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
194	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
195	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
196	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
197	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
198	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
199	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
200	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
201	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
202	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
203	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
204	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
205	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
206	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
207	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
208	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
209	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
210	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
211	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
212	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
213	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
214	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
215	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
216	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
217	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
218	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
219	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
220	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
221	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
222	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
223	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
224	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
225	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
226	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
227	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
228	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
229	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
230	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
231	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
232	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
233	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
234	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
235	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
236	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
237	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
238	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
239	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
240	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
241	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
242	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
243	3300013250	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05	Metagenome	Rhizosphere
244	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
245	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
246	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
247	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
248	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
249	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
250	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
251	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
252	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
253	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
254	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
255	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
256	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
257	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
258	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
259	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
260	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
261	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
262	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
263	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
264	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
265	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
266	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
267	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
268	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
269	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
270	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
320	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
324	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
325	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
326	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
327	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
328	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
329	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
330	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
331	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
332	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
333	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
334	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
335	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
336	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
337	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
338	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
339	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
340	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
341	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
342	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
343	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
344	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
345	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
346	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
347	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
348	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
349	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
350	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
351	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
352	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
353	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
354	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
355	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
356	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
357	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
358	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
359	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
360	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
361	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
362	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
363	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
364	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
365	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
366	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
367	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
368	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
369	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
370	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
371	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
372	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
373	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
374	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
375	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
376	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
377	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
378	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
379	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
380	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
381	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
382	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
383	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
384	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
385	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
386	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
387	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
388	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
389	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
390	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
391	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
392	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
393	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
394	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
395	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
396	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
397	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
398	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
399	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
400	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
401	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
402	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
403	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
404	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
405	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
406	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
407	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
408	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
409	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
410	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
411	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
412	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
413	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
414	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
415	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
416	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
417	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
418	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
419	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
420	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
421	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
422	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
423	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
424	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
425	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
426	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
427	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
428	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
429	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
430	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
431	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
432	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
433	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
434	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
435	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
436	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
437	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
438	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
439	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
440	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
441	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
442	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
443	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
444	3300049533	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
445	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
446	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
447	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
448	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
449	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
450	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
451	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
452	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
453	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
454	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
455	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
456	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
457	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
458	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
459	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
460	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
461	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
462	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
463	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
464	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
465	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
466	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
467	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
468	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
469	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
470	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
471	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
472	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
473	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
474	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
475	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
476	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
477	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
478	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
479	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
480	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
481	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
482	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
483	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
484	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
485	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
486	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
487	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
488	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
489	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
490	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
491	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
492	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
493	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
494	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
495	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
496	637000116	Frankia casuarinae CcI3	Isolate	Nodule
497	8002811521	Leucobacter chinensis NC76-1	Isolate	Rhizosphere
498	8003314358	Amycolatopsis sp. MtRt-6	Isolate	Unclassified
499	8004021418	Arthrobacter sp. SDTb3-6	Isolate	Rhizosphere
500	8004025490	Arthrobacter wenxiniae AETb3-4	Isolate	Rhizosphere
501	8004182704	Microbacterium paraoxydans ku-mp	Isolate	Unclassified
502	8016254467	Microbacterium sp. SLBN-111 (version 3)	Isolate	Rhizosphere
503	8045830549	Microbacterium yannicii DSM 23203	Isolate	Unclassified
504	8046352972	Agromyces mangrovi NBRC 112812	Isolate	Rhizosphere
505	8047710418	Umezawaea endophytica DSM 103496	Isolate	Unclassified
506	8054107350	Arthrobacter rhizosphaerae CCNWLXL 1-35	Isolate	Rhizosphere
507	8054472261	Pseudonocardia terrae RS11V-5	Isolate	Rhizosphere
508	8054913762	Frankia gtarii Agncl-10	Isolate	Nodule
509	8054920844	Frankia tisae Agncl-8	Isolate	Nodule
510	8055157932	Frankia umida Ag45/Mut15	Isolate	Nodule
511	8056037122	Herbiconiux gentiana CPCC 205716	Isolate	Rhizosphere
512	8056207758	Saccharopolyspora indica KCTC 29208	Isolate	Rhizosphere
513	8057345674	Herbiconiux aconitum CPCC 205763	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	78.82
Metatranscriptomes	1.02
Isolates	20.16

Biome Distribution

Category	Percentage (%)
Aerial Root	0.34
Bulb	0
Endosphere	8.95
Nodule	1.7
Rhizoplane	6.8
Rhizosphere	63.42
Stem	0
Stem Tuber	0.23
Unclassified	18.57

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24735J21928_10007406	3300002067	Bacteria	3581
2	JGI25154J39366_1002515	3300002738	Bacteria	4673
3	JGI25164J39214_1001093	3300002772	Bacteria	7831
4	JGI25152J39213_1000561	3300002773	Bacteria	20393
5	JGI25406J46586_10001347	3300003203	Bacteria	11559
6	JGI25165J46597_1000002	3300003214	Bacteria	765387
7	Ga0006562J51391_1026734	3300003578	Bacteria	6080
8	Ga0055539_1000058	3300003752	Bacteria	149354
9	Ga0055533_1000001	3300003756	Bacteria	1863437
10	Ga0055525_1000180	3300003759	Bacteria	78601
11	Ga0055527_1000012	3300003760	Bacteria	348744
12	Ga0055542_1000017	3300003762	Bacteria	348744
13	Ga0055529_1000023	3300003763	Bacteria	314383
14	Ga0055541_1002122	3300003841	Bacteria	4042
15	Ga0070658_10053724	3300005327	Bacteria	3270
16	Ga0070658_10113879	3300005327	Bacteria	2242
17	Ga0070676_10007958	3300005328	Bacteria	5699
18	Ga0070677_10006775	3300005333	Bacteria	3811
19	Ga0070680_100374637	3300005336	Bacteria	1212
20	Ga0070682_100155348	3300005337	Bacteria	1574
21	Ga0068868_100015955	3300005338	Bacteria	5568
22	Ga0068868_100016436	3300005338	Bacteria	5495
23	Ga0070660_100005496	3300005339	Bacteria	8779
24	Ga0070661_100083416	3300005344	Bacteria	2360
25	Ga0070661_100231596	3300005344	Bacteria	1420
26	Ga0070668_100001439	3300005347	Bacteria	17177
27	Ga0070668_100005704	3300005347	Bacteria	9229
28	Ga0070668_100080137	3300005347	Bacteria	2558
29	Ga0070668_100362468	3300005347	Bacteria	1229
30	Ga0070669_100027516	3300005353	Bacteria	4092
31	Ga0070671_100016467	3300005355	Bacteria	5977
32	Ga0070671_100023747	3300005355	Bacteria	5019
33	Ga0070671_100110976	3300005355	Bacteria	2304
34	Ga0070674_100058505	3300005356	Bacteria	2680
35	Ga0070674_100063844	3300005356	Bacteria	2579
36	Ga0070673_100241887	3300005364	Bacteria	1570
37	Ga0070659_100000149	3300005366	Bacteria	53509
38	Ga0070659_100100044	3300005366	Bacteria	2333
39	Ga0070667_100008397	3300005367	Bacteria	8564
40	Ga0070713_100340762	3300005436	Bacteria	1389
41	Ga0070711_100014460	3300005439	Bacteria	4972
42	Ga0070705_100011393	3300005440	Bacteria	4486
43	Ga0070694_100087058	3300005444	Bacteria	2184
44	Ga0070663_100004837	3300005455	Bacteria	7942
45	Ga0070678_100003526	3300005456	Bacteria	8730
46	Ga0070678_100057466	3300005456	Bacteria	2850
47	Ga0070678_100153988	3300005456	Bacteria	1855
48	Ga0070685_10051002	3300005466	Bacteria	2392
49	Ga0070698_100070725	3300005471	Bacteria	3501
50	Ga0068853_100089231	3300005539	Bacteria	2707
51	Ga0070686_100199674	3300005544	Bacteria	1433
52	Ga0070696_100030879	3300005546	Bacteria	3670
53	Ga0070696_100218327	3300005546	Bacteria	1430
54	Ga0070693_100026653	3300005547	Bacteria	3122
55	Ga0070665_100001075	3300005548	Bacteria	34026
56	Ga0070665_100051843	3300005548	Bacteria	4115
57	Ga0070665_100102322	3300005548	Bacteria	2868
58	Ga0070704_100073944	3300005549	Bacteria	2484
59	Ga0068855_100002405	3300005563	Bacteria	23088
60	Ga0068855_100049036	3300005563	Bacteria	4982
61	Ga0068857_100000219	3300005577	Bacteria	37769
62	Ga0068856_100090806	3300005614	Bacteria	3039
63	Ga0070702_100130096	3300005615	Bacteria	1588
64	Ga0068852_100005903	3300005616	Bacteria	8804
65	Ga0068864_100174866	3300005618	Bacteria	1959
66	Ga0068851_10000014	3300005834	Bacteria	151675
67	Ga0068863_100042934	3300005841	Bacteria	4295
68	Ga0068863_100061381	3300005841	Bacteria	3554
69	Ga0068858_100000002	3300005842	Bacteria	351633
70	Ga0068858_100000893	3300005842	Bacteria	30963
71	Ga0068860_100020176	3300005843	Bacteria	6459
72	Ga0081455_10000005	3300005937	Bacteria	327136
73	Ga0081455_10000023	3300005937	Bacteria	159570
74	Ga0081539_10000128	3300005985	Bacteria	179041
75	Ga0075365_10004965	3300006038	Bacteria	7120
76	Ga0075365_10006540	3300006038	Bacteria	6421
77	Ga0075364_10008626	3300006051	Bacteria	6097
78	Ga0075364_10050492	3300006051	Bacteria	2715
79	Ga0075364_10060805	3300006051	Bacteria	2477
80	Ga0075364_10181743	3300006051	Bacteria	1423
81	Ga0075432_10000483	3300006058	Bacteria	11870
82	Ga0070712_100014076	3300006175	Bacteria	5129
83	Ga0075369_10009529	3300006186	Bacteria	3776
84	Ga0075369_10046212	3300006186	Bacteria	1874
85	Ga0097621_100083271	3300006237	Bacteria	2665
86	Ga0075370_10052247	3300006353	Bacteria	2318
87	Ga0068871_100031845	3300006358	Bacteria	4161
88	Ga0075428_100495747	3300006844	Bacteria	1307
89	Ga0075431_100226072	3300006847	Bacteria	1908
90	Ga0075434_100184885	3300006871	Bacteria	2104
91	Ga0068865_100060382	3300006881	Bacteria	2654
92	Ga0075435_100180385	3300007076	Bacteria	1784
93	Ga0105251_10012295	3300009011	Bacteria	4849
94	Ga0105244_10008476	3300009036	Bacteria	6415
95	Ga0105244_10014121	3300009036	Bacteria	4633
96	Ga0105244_10020912	3300009036	Bacteria	3626
97	Ga0105244_10052160	3300009036	Bacteria	2083
98	Ga0105247_10000014	3300009101	Bacteria	285043
99	Ga0105247_10114872	3300009101	Bacteria	1737
100	Ga0105243_10098614	3300009148	Bacteria	2421
101	Ga0105243_10122710	3300009148	Bacteria	2193
102	Ga0105242_10052786	3300009176	Bacteria	3318
103	Ga0105248_10000681	3300009177	Bacteria	38440
104	Ga0105248_10001871	3300009177	Bacteria	23331
105	Ga0105248_10037378	3300009177	Bacteria	5432
106	Ga0105248_10120909	3300009177	Bacteria	2954
107	Ga0105237_10000133	3300009545	Bacteria	104324
108	Ga0105237_10081066	3300009545	Bacteria	3235
109	Ga0105238_10003000	3300009551	Bacteria	16857
110	Ga0105238_10016957	3300009551	Bacteria	7391
111	Ga0105249_10097516	3300009553	Bacteria	2760
112	Ga0105239_10023056	3300010375	Bacteria	6863
113	Ga0105239_10181596	3300010375	Bacteria	2354
114	Ga0105239_10271162	3300010375	Bacteria	1909
115	Ga0105246_10001582	3300011119	Bacteria	13546
116	Ga0105246_10008958	3300011119	Bacteria	6161
117	Ga0105246_10057405	3300011119	Bacteria	2693
118	Ga0157373_10015772	3300013100	Bacteria	5518
119	Ga0157370_10005788	3300013104	Bacteria	13815
120	Ga0157370_10033683	3300013104	Bacteria	4994
121	Ga0157370_10053252	3300013104	Bacteria	3859
122	Ga0157370_10318471	3300013104	Bacteria	1435
123	Ga0157369_10000618	3300013105	Bacteria	46223
124	Ga0157369_10002164	3300013105	Bacteria	23689
125	Ga0157369_10036863	3300013105	Bacteria	5356
126	Ga0157369_10050715	3300013105	Bacteria	4492
127	Ga0157369_10164210	3300013105	Bacteria	2342
128	Ga0157369_10427402	3300013105	Bacteria	1373
129	Ga0171462_1003	3300013250	Bacteria	853796
130	Ga0157374_10020795	3300013296	Bacteria	5827
131	Ga0163162_10018367	3300013306	Bacteria	6851
132	Ga0163162_10143982	3300013306	Bacteria	2498
133	Ga0163162_10209105	3300013306	Bacteria	2081
134	Ga0157372_10377560	3300013307	Bacteria	1652
135	Ga0157375_10031909	3300013308	Bacteria	4990
136	Ga0157375_10155904	3300013308	Bacteria	2422
137	Ga0157375_10411191	3300013308	Bacteria	1519
138	Ga0163163_10023231	3300014325	Bacteria	5883
139	Ga0163163_10028866	3300014325	Bacteria	5332
140	Ga0163163_10052633	3300014325	Bacteria	4017
141	Ga0157380_10003034	3300014326	Bacteria	11437
142	Ga0157380_10114056	3300014326	Bacteria	2277
143	Ga0157379_10000007	3300014968	Bacteria	142402
144	Ga0157379_10020432	3300014968	Bacteria	5856
145	Ga0157379_10031326	3300014968	Bacteria	4737
146	Ga0163161_10038744	3300017792	Bacteria	3420
147	Ga0163161_10094567	3300017792	Bacteria	2216
148	Ga0163161_10108795	3300017792	Bacteria	2070
149	Ga0206354_10095331	3300020081	Bacteria	1199
150	Ga0206354_10946747	3300020081	Bacteria	1338
151	Ga0206354_11247678	3300020081	Bacteria	5225
152	Ga0206354_11438617	3300020081	Bacteria	1594
153	Ga0206353_10879647	3300020082	Bacteria	1926
154	Ga0213875_10030738	3300021388	Bacteria	2541
155	Ga0224712_10026130	3300022467	Bacteria	2061
156	Ga0209566_100026	3300025225	Bacteria	367457
157	Ga0209674_100001	3300025226	Bacteria	4013750
158	Ga0209672_100003	3300025228	Bacteria	1560476
159	Ga0209147_100309	3300025229	Bacteria	38478
160	Ga0209563_100001	3300025230	Bacteria	4013775
161	Ga0209563_100320	3300025230	Bacteria	19012
162	Ga0207427_100089	3300025231	Bacteria	135504
163	Ga0209646_1000099	3300025246	Bacteria	180436
164	Ga0209677_100001	3300025253	Bacteria	4013787
165	Ga0209677_100375	3300025253	Bacteria	27361
166	Ga0209148_1000004	3300025254	Bacteria	1844481
167	Ga0209148_1001580	3300025254	Bacteria	10786
168	Ga0209148_1001633	3300025254	Bacteria	10288
169	Ga0209129_1000176	3300025258	Bacteria	93584
170	Ga0209233_1000001	3300025261	Bacteria	2992747
171	Ga0209455_1000022	3300025272	Bacteria	688910
172	Ga0209025_1000655	3300025294	Bacteria	60278
173	Ga0209051_1004052	3300025303	Bacteria	9244
174	Ga0209051_1010018	3300025303	Bacteria	4825
175	Ga0207697_10010844	3300025315	Bacteria	3876
176	Ga0207656_10000002	3300025321	Bacteria	792178
177	Ga0207655_1005595	3300025728	Bacteria	8507
178	Ga0207655_1005782	3300025728	Bacteria	8332
179	Ga0207655_1008672	3300025728	Bacteria	6417
180	Ga0207655_1019558	3300025728	Bacteria	3530
181	Ga0207713_1034198	3300025735	Bacteria	2210
182	Ga0207682_10034204	3300025893	Bacteria	2048
183	Ga0207692_10007187	3300025898	Bacteria	4550
184	Ga0207692_10072606	3300025898	Bacteria	1818
185	Ga0207710_10000031	3300025900	Bacteria	285157
186	Ga0207688_10034610	3300025901	Bacteria	2798
187	Ga0207680_10203119	3300025903	Bacteria	1351
188	Ga0207647_10053726	3300025904	Bacteria	2481
189	Ga0207647_10083155	3300025904	Bacteria	1917
190	Ga0207645_10010060	3300025907	Bacteria	6512
191	Ga0207705_10000213	3300025909	Bacteria	58174
192	Ga0207705_10266719	3300025909	Bacteria	1308
193	Ga0207654_10000001	3300025911	Bacteria	1816198
194	Ga0207654_10064828	3300025911	Bacteria	2149
195	Ga0207695_10002493	3300025913	Bacteria	27109
196	Ga0207671_10000002	3300025914	Bacteria	1144816
197	Ga0207671_10119231	3300025914	Bacteria	2015
198	Ga0207671_10135540	3300025914	Bacteria	1893
199	Ga0207693_10005632	3300025915	Bacteria	10415
200	Ga0207657_10010407	3300025919	Bacteria	9286
201	Ga0207681_10304022	3300025923	Bacteria	1263
202	Ga0207694_10000115	3300025924	Bacteria	84427
203	Ga0207659_10068989	3300025926	Bacteria	2573
204	Ga0207687_10050506	3300025927	Bacteria	2895
205	Ga0207700_10157890	3300025928	Bacteria	1881
206	Ga0207664_10005752	3300025929	Bacteria	8477
207	Ga0207664_10221773	3300025929	Bacteria	1640
208	Ga0207644_10009795	3300025931	Bacteria	6301
209	Ga0207644_10086396	3300025931	Bacteria	2329
210	Ga0207644_10108405	3300025931	Bacteria	2096
211	Ga0207690_10001356	3300025932	Bacteria	15362
212	Ga0207706_10109976	3300025933	Bacteria	2425
213	Ga0207686_10030576	3300025934	Bacteria	3189
214	Ga0207709_10008571	3300025935	Bacteria	5651
215	Ga0207704_10148957	3300025938	Bacteria	1648
216	Ga0207691_10005490	3300025940	Bacteria	12245
217	Ga0207691_10293928	3300025940	Bacteria	1397
218	Ga0207711_10000953	3300025941	Bacteria	27732
219	Ga0207711_10008565	3300025941	Bacteria	8556
220	Ga0207711_10011662	3300025941	Bacteria	7302
221	Ga0207689_10005198	3300025942	Bacteria	11683
222	Ga0207667_10000272	3300025949	Bacteria	71730
223	Ga0207667_10006016	3300025949	Bacteria	14767
224	Ga0207651_10009995	3300025960	Bacteria	5231
225	Ga0207712_10016957	3300025961	Bacteria	4724
226	Ga0207668_10027781	3300025972	Bacteria	3690
227	Ga0207668_10027822	3300025972	Bacteria	3687
228	Ga0207668_10128863	3300025972	Bacteria	1929
229	Ga0207640_10027453	3300025981	Bacteria	3468
230	Ga0207658_10004963	3300025986	Bacteria	9173
231	Ga0207677_10004632	3300026023	Bacteria	7400
232	Ga0207677_10010190	3300026023	Bacteria	5311
233	Ga0207703_10000001	3300026035	Bacteria	822925
234	Ga0207703_10000141	3300026035	Bacteria	86068
235	Ga0207639_10016442	3300026041	Bacteria	5235
236	Ga0207639_10173257	3300026041	Bacteria	1829
237	Ga0207678_10001813	3300026067	Bacteria	19572
238	Ga0207678_10004951	3300026067	Bacteria	11956
239	Ga0207678_10018717	3300026067	Bacteria	6082
240	Ga0207702_10277484	3300026078	Bacteria	1583
241	Ga0207641_10229620	3300026088	Bacteria	1724
242	Ga0207676_10172380	3300026095	Bacteria	1886
243	Ga0207674_10001774	3300026116	Bacteria	27546
244	Ga0207675_100095368	3300026118	Bacteria	2799
245	Ga0207683_10000870	3300026121	Bacteria	27682
246	Ga0207683_10009666	3300026121	Bacteria	8219
247	Ga0207683_10215523	3300026121	Bacteria	1748
248	Ga0207698_10000162	3300026142	Bacteria	42850
249	Ga0207698_10013856	3300026142	Bacteria	5337
250	Ga0207428_10016776	3300027907	Bacteria	6297
251	Ga0268266_10012495	3300028379	Bacteria	7339
252	Ga0268266_10238000	3300028379	Bacteria	1679
253	Ga0268265_10173875	3300028380	Bacteria	1844
254	Ga0268264_10031458	3300028381	Bacteria	4351
255	Ga0265334_10001822	3300028573	Bacteria	10149
256	Ga0307515_10187584	3300028794	Bacteria	1991
257	Ga0265338_10050889	3300028800	Bacteria	3738
258	Ga0307511_10004862	3300030521	Bacteria	13730
259	Ga0307512_10017828	3300030522	Bacteria	6500
260	Ga0316177_1008392	3300030731	Bacteria	3879
261	Ga0265325_10068437	3300031241	Bacteria	1787
262	Ga0265340_10011501	3300031247	Bacteria	4703
263	Ga0307513_10270395	3300031456	Bacteria	1483
264	Ga0307509_10158196	3300031507	Bacteria	2168
265	Ga0307408_100011795	3300031548	Bacteria	5781
266	Ga0307408_100013141	3300031548	Bacteria	5495
267	Ga0307408_100018644	3300031548	Bacteria	4662
268	Ga0307408_100030278	3300031548	Bacteria	3757
269	Ga0307408_100033039	3300031548	Bacteria	3611
270	Ga0307408_100212044	3300031548	Bacteria	1574
271	Ga0307408_100297947	3300031548	Bacteria	1349
272	Ga0307514_10002541	3300031649	Bacteria	18815
273	Ga0307514_10006062	3300031649	Bacteria	10625
274	Ga0316575_10004373	3300031665	Bacteria	4970
275	Ga0316575_10063046	3300031665	Bacteria	1483
276	Ga0316579_10036120	3300031691	Bacteria	2279
277	Ga0316576_10151539	3300031727	Bacteria	1747
278	Ga0316578_10079092	3300031728	Bacteria	1954
279	Ga0307405_10001127	3300031731	Bacteria	10955
280	Ga0307405_10008938	3300031731	Bacteria	5112
281	Ga0307405_10045954	3300031731	Bacteria	2679
282	Ga0307405_10066773	3300031731	Bacteria	2294
283	Ga0307405_10130541	3300031731	Bacteria	1735
284	Ga0307405_10187822	3300031731	Bacteria	1489
285	Ga0307413_10018508	3300031824	Bacteria	3657
286	Ga0307413_10019685	3300031824	Bacteria	3572
287	Ga0307413_10025166	3300031824	Bacteria	3258
288	Ga0307413_10037358	3300031824	Bacteria	2805
289	Ga0307413_10056652	3300031824	Bacteria	2392
290	Ga0307413_10057968	3300031824	Bacteria	2371
291	Ga0307413_10065994	3300031824	Bacteria	2256
292	Ga0307518_10000118	3300031838	Bacteria	55183
293	Ga0307518_10080176	3300031838	Bacteria	2357
294	Ga0307410_10000610	3300031852	Bacteria	14708
295	Ga0307410_10001507	3300031852	Bacteria	10575
296	Ga0307410_10003399	3300031852	Bacteria	7980
297	Ga0307410_10019750	3300031852	Bacteria	4106
298	Ga0307410_10028199	3300031852	Bacteria	3558
299	Ga0307410_10033487	3300031852	Bacteria	3317
300	Ga0307410_10041516	3300031852	Bacteria	3035
301	Ga0307406_10000291	3300031901	Bacteria	29442
302	Ga0307406_10001710	3300031901	Bacteria	12067
303	Ga0307406_10005882	3300031901	Bacteria	6730
304	Ga0307406_10025847	3300031901	Bacteria	3519
305	Ga0307406_10068620	3300031901	Bacteria	2315
306	Ga0307406_10103204	3300031901	Bacteria	1947
307	Ga0307406_10259178	3300031901	Bacteria	1314
308	Ga0307407_10012752	3300031903	Bacteria	4053
309	Ga0307407_10050488	3300031903	Bacteria	2380
310	Ga0307412_10006405	3300031911	Bacteria	6655
311	Ga0307412_10006617	3300031911	Bacteria	6565
312	Ga0307412_10011608	3300031911	Bacteria	5108
313	Ga0307412_10012060	3300031911	Bacteria	5024
314	Ga0307412_10016875	3300031911	Bacteria	4360
315	Ga0307409_100006720	3300031995	Bacteria	6803
316	Ga0307409_100090009	3300031995	Bacteria	2510
317	Ga0307409_100100292	3300031995	Bacteria	2400
318	Ga0307409_100121563	3300031995	Bacteria	2212
319	Ga0307409_100137491	3300031995	Bacteria	2099
320	Ga0307416_100001802	3300032002	Bacteria	11898
321	Ga0307416_100007638	3300032002	Bacteria	6898
322	Ga0307416_100014301	3300032002	Bacteria	5431
323	Ga0307416_100048949	3300032002	Bacteria	3357
324	Ga0307416_100076940	3300032002	Bacteria	2800
325	Ga0307416_100077765	3300032002	Bacteria	2788
326	Ga0307414_10003755	3300032004	Bacteria	8157
327	Ga0307414_10007660	3300032004	Bacteria	6079
328	Ga0307414_10066184	3300032004	Bacteria	2582
329	Ga0307414_10134507	3300032004	Bacteria	1925
330	Ga0307411_10001659	3300032005	Bacteria	9302
331	Ga0307411_10004841	3300032005	Bacteria	6531
332	Ga0307415_100059924	3300032126	Bacteria	2628
333	Ga0307415_100195372	3300032126	Bacteria	1600
334	Ga0307415_100200500	3300032126	Bacteria	1583
335	Ga0316583_10001286	3300032133	Bacteria	8297
336	Ga0316583_10026558	3300032133	Bacteria	2067
337	Ga0316580_10001184	3300032139	Bacteria	6637
338	Ga0307507_10007702	3300033179	Bacteria	15397
339	Ga0307507_10016334	3300033179	Bacteria	8641
340	Ga0373932_0012417	3300035112	Bacteria	2098
341	Ga0373960_0009369	3300035121	Bacteria	2371
342	Ga0373942_0013866	3300035207	Bacteria	1944
343	Ga0316574_0003636	3300035398	Bacteria	7974
344	Ga0316574_0007310	3300035398	Bacteria	6047
345	Ga0316582_0187447	3300036647	Bacteria	1408
346	Ga0316584_0001862	3300036712	Bacteria	13067
347	Ga0395899_0015808	3300037312	Bacteria	5754
348	Ga0395899_0069082	3300037312	Bacteria	2588
349	Ga0395900_0012427	3300037418	Bacteria	8706
350	Ga0395900_0157080	3300037418	Bacteria	2323
351	Ga0395900_0382528	3300037418	Bacteria	1375
352	Ga0395898_0000473	3300037466	Bacteria	80586
353	Ga0395898_0023859	3300037466	Bacteria	6174
354	Ga0395898_0048649	3300037466	Bacteria	4157
355	Ga0395898_0063943	3300037466	Bacteria	3570
356	Ga0395898_0156686	3300037466	Bacteria	2178
357	Ga0395905_0015372	3300037471	Bacteria	7275
358	Ga0316581_0000693	3300037588	Bacteria	6850
359	Ga0436364_1296832	3300037853	Bacteria	11797
360	Ga0395901_0005071	3300038443	Bacteria	13302
361	Ga0395901_0014138	3300038443	Bacteria	8126
362	Ga0395901_0015467	3300038443	Bacteria	7769
363	Ga0395901_0029013	3300038443	Bacteria	5692
364	Ga0395901_0035072	3300038443	Bacteria	5184
365	Ga0395901_0081883	3300038443	Bacteria	3371
366	Ga0395901_0165026	3300038443	Bacteria	2326
367	Ga0395901_0168535	3300038443	Bacteria	2298
368	Ga0439436_0001133	3300041404	Bacteria	7552
369	Ga0439436_0003953	3300041404	Bacteria	4542
370	Ga0439438_034365	3300041405	Bacteria	1336
371	Ga0439439_0001046	3300041406	Bacteria	5242
372	Ga0439461_0000851	3300041410	Bacteria	4512
373	Ga0439466_0000106	3300041411	Bacteria	31870
374	Ga0439466_0050298	3300041411	Bacteria	1367
375	Ga0439465_0020183	3300041413	Bacteria	2086
376	Ga0439433_0000182	3300041999	Bacteria	10020
377	Ga0439433_0001171	3300041999	Bacteria	5374
378	Ga0439433_0009700	3300041999	Bacteria	2101
379	Ga0439442_000001	3300042002	Bacteria	161142
380	Ga0439442_000094	3300042002	Bacteria	21387
381	Ga0439442_002050	3300042002	Bacteria	3961
382	Ga0439449_0000108	3300042007	Bacteria	26950
383	Ga0439449_0008787	3300042007	Bacteria	3832
384	Ga0439449_0020381	3300042007	Bacteria	2485
385	Ga0439449_0029441	3300042007	Bacteria	2047
386	Ga0439452_001202	3300042010	Bacteria	11115
387	Ga0439457_002900	3300042014	Bacteria	4779
388	Ga0439462_0001082	3300042015	Bacteria	5872
389	Ga0450919_000229	3300042121	Bacteria	6268
390	Ga0450920_000216	3300042122	Bacteria	8575
391	Ga0450907_000562	3300042146	Bacteria	10043
392	Ga0450907_005907	3300042146	Bacteria	2054
393	Ga0439434_0000056	3300042435	Bacteria	27697
394	Ga0439434_0004265	3300042435	Bacteria	4178
395	Ga0439434_0004328	3300042435	Bacteria	4151
396	Ga0450918_000178	3300042531	Bacteria	14220
397	Ga0466969_0008896	3300044656	Bacteria	5325
398	Ga0466972_0003731	3300044658	Bacteria	7576
399	Ga0466972_0014668	3300044658	Bacteria	3922
400	Ga0466972_0037196	3300044658	Bacteria	2379
401	Ga0466972_0076858	3300044658	Bacteria	1590
402	Ga0466965_0000009	3300044683	Bacteria	122488
403	Ga0466965_0010802	3300044683	Bacteria	4270
404	Ga0466965_0016108	3300044683	Bacteria	3552
405	Ga0466965_0049058	3300044683	Bacteria	2092
406	Ga0466961_0076601	3300044693	Bacteria	2119
407	Ga0466961_0118716	3300044693	Bacteria	1661
408	Ga0466968_0015933	3300044735	Bacteria	2986
409	Ga0466968_0029774	3300044735	Bacteria	2259
410	Ga0466968_0034654	3300044735	Bacteria	2108
411	Ga0466968_0100089	3300044735	Bacteria	1293
412	Ga0466970_0000106	3300044765	Bacteria	36774
413	Ga0466970_0012825	3300044765	Bacteria	4290
414	Ga0466970_0030132	3300044765	Bacteria	2860
415	Ga0466970_0033464	3300044765	Bacteria	2717
416	Ga0466970_0043247	3300044765	Bacteria	2397
417	Ga0466970_0094156	3300044765	Bacteria	1627
418	Ga0466970_0115063	3300044765	Bacteria	1470
419	Ga0466970_0118785	3300044765	Bacteria	1447
420	Ga0466970_0170579	3300044765	Bacteria	1206
421	Ga0466957_0183506	3300044842	Bacteria	1367
422	Ga0466957_0216416	3300044842	Bacteria	1263
423	Ga0466960_0002504	3300044901	Bacteria	6910
424	Ga0466960_0005117	3300044901	Bacteria	5186
425	Ga0466959_0009825	3300045049	Bacteria	6817
426	Ga0466959_0134577	3300045049	Bacteria	1750
427	Ga0466958_0039067	3300045836	Bacteria	2850
428	Ga0466967_0003086	3300045976	Bacteria	10709
429	Ga0495627_001253	3300046453	Bacteria	15714
430	Ga0495590_0000242	3300046457	Bacteria	29848
431	Ga0495653_0003116	3300046463	Bacteria	13285
432	Ga0495650_0001013	3300046471	Bacteria	31698
433	Ga0495582_0071401	3300046473	Bacteria	1921
434	Ga0495582_0110520	3300046473	Bacteria	1544
435	Ga0495664_0007200	3300046477	Bacteria	6169
436	Ga0495594_0008387	3300046499	Bacteria	5325
437	Ga0495630_0270040	3300046517	Bacteria	1299
438	Ga0495665_0026740	3300046531	Bacteria	3098
439	Ga0495586_0002562	3300046535	Bacteria	9835
440	Ga0495586_0009781	3300046535	Bacteria	5105
441	Ga0495586_0048587	3300046535	Bacteria	2293
442	Ga0495587_0002797	3300046536	Bacteria	11661
443	Ga0495645_0000572	3300046543	Bacteria	25208
444	Ga0495645_0002606	3300046543	Bacteria	12259
445	Ga0495667_0075201	3300046559	Bacteria	2198
446	Ga0495668_0103214	3300046616	Bacteria	1560
447	Ga0495588_0002007	3300046674	Bacteria	8700
448	Ga0495657_0011157	3300046675	Bacteria	6731
449	Ga0495600_0007923	3300046809	Bacteria	6509
450	Ga0495581_0014701	3300047315	Bacteria	4540
451	Ga0495581_0033760	3300047315	Bacteria	2961
452	Ga0495581_0036242	3300047315	Bacteria	2854
453	Ga0495581_0038937	3300047315	Bacteria	2752
454	Ga0495672_0005490	3300047320	Bacteria	10049
455	Ga0495672_0056671	3300047320	Bacteria	2278
456	Ga0495680_0046582	3300047322	Bacteria	3418
457	Ga0495684_0201912	3300047471	Bacteria	1465
458	Ga0495593_0013807	3300047673	Bacteria	4601
459	Ga0496100_0002695	3300048903	Bacteria	9062
460	Ga0496101_0015966	3300048904	Bacteria	5066
461	Ga0496101_0016204	3300048904	Bacteria	5030
462	Ga0496101_0111997	3300048904	Bacteria	2055
463	Ga0496102_0000408	3300048905	Bacteria	49838
464	Ga0496102_0034336	3300048905	Bacteria	4561
465	Ga0496102_0145371	3300048905	Bacteria	2225
466	Ga0496102_0298556	3300048905	Bacteria	1518
467	Ga0496102_0435702	3300048905	Bacteria	1230
468	Ga0496103_0000068	3300048906	Bacteria	121996
469	Ga0496103_0004736	3300048906	Bacteria	8229
470	Ga0496103_0013184	3300048906	Bacteria	4900
471	Ga0496103_0023370	3300048906	Bacteria	3727
472	Ga0496103_0024376	3300048906	Bacteria	3652
473	Ga0496103_0028748	3300048906	Bacteria	3376
474	Ga0496104_0011688	3300048907	Bacteria	7872
475	Ga0496104_0016669	3300048907	Bacteria	6677
476	Ga0496104_0028567	3300048907	Bacteria	5169
477	Ga0496104_0052147	3300048907	Bacteria	3863
478	Ga0496104_0062484	3300048907	Bacteria	3531
479	Ga0496104_0087946	3300048907	Bacteria	2968
480	Ga0496105_0006436	3300048908	Bacteria	9029
481	Ga0496105_0020633	3300048908	Bacteria	5325
482	Ga0496105_0044585	3300048908	Bacteria	3658
483	Ga0496105_0066439	3300048908	Bacteria	2977
484	Ga0496105_0094341	3300048908	Bacteria	2471
485	Ga0496105_0171492	3300048908	Bacteria	1778
486	Ga0496106_0075218	3300048909	Bacteria	2586
487	Ga0496107_0179601	3300048910	Bacteria	1571
488	Ga0496107_0190867	3300048910	Bacteria	1522
489	Ga0496108_0022373	3300048911	Bacteria	5196
490	Ga0496108_0084549	3300048911	Bacteria	2693
491	Ga0496108_0104157	3300048911	Bacteria	2421
492	Ga0496109_0035173	3300048912	Bacteria	4517
493	Ga0496109_0114365	3300048912	Bacteria	2510
494	Ga0496109_0114793	3300048912	Bacteria	2505
495	Ga0496109_0287151	3300048912	Bacteria	1551
496	Ga0496110_0023039	3300048913	Bacteria	5295
497	Ga0496110_0027910	3300048913	Bacteria	4842
498	Ga0496110_0034418	3300048913	Bacteria	4388
499	Ga0496110_0078495	3300048913	Bacteria	2939
500	Ga0496111_0023083	3300048914	Bacteria	4363
501	Ga0496111_0049922	3300048914	Bacteria	3016
502	Ga0496111_0203937	3300048914	Bacteria	1469
503	Ga0496112_0027934	3300048915	Bacteria	5443
504	Ga0496112_0030951	3300048915	Bacteria	5185
505	Ga0496112_0031814	3300048915	Bacteria	5119
506	Ga0496112_0090919	3300048915	Bacteria	3021
507	Ga0496113_0100028	3300048916	Bacteria	2246
508	Ga0496114_0008452	3300048917	Bacteria	8156
509	Ga0496114_0023869	3300048917	Bacteria	4990
510	Ga0496114_0039026	3300048917	Bacteria	3930
511	Ga0496114_0042044	3300048917	Bacteria	3787
512	Ga0496114_0151152	3300048917	Bacteria	2014
513	Ga0496114_0180069	3300048917	Bacteria	1845
514	Ga0496115_0011477	3300048918	Bacteria	6643
515	Ga0496115_0023496	3300048918	Bacteria	4784
516	Ga0496115_0033165	3300048918	Bacteria	4076
517	Ga0496115_0105723	3300048918	Bacteria	2310
518	Ga0496116_0000152	3300048919	Bacteria	141311
519	Ga0496116_0008426	3300048919	Bacteria	8947
520	Ga0496117_0000053	3300048920	Bacteria	279396
521	Ga0496117_0000615	3300048920	Bacteria	57676
522	Ga0496117_0000884	3300048920	Bacteria	46176
523	Ga0496117_0001576	3300048920	Bacteria	32370
524	Ga0496117_0005515	3300048920	Bacteria	13253
525	Ga0496117_0156462	3300048920	Bacteria	1341
526	Ga0496118_0001720	3300048921	Bacteria	31922
527	Ga0496118_0004019	3300048921	Bacteria	17890
528	Ga0496118_0080661	3300048921	Bacteria	2289
529	Ga0496118_0131884	3300048921	Bacteria	1603
530	Ga0496119_0002707	3300048922	Bacteria	19137
531	Ga0496119_0003914	3300048922	Bacteria	15123
532	Ga0496119_0004238	3300048922	Bacteria	14385
533	Ga0496119_0005861	3300048922	Bacteria	11600
534	Ga0496119_0015787	3300048922	Bacteria	5786
535	Ga0496119_0019313	3300048922	Bacteria	5026
536	Ga0496119_0019704	3300048922	Bacteria	4952
537	Ga0496119_0028178	3300048922	Bacteria	3840
538	Ga0496119_0044528	3300048922	Bacteria	2793
539	Ga0496119_0052140	3300048922	Bacteria	2508
540	Ga0496120_0000426	3300048923	Bacteria	66901
541	Ga0496120_0001117	3300048923	Bacteria	34800
542	Ga0496120_0002915	3300048923	Bacteria	16342
543	Ga0496120_0004892	3300048923	Bacteria	10910
544	Ga0496120_0010133	3300048923	Bacteria	6604
545	Ga0496120_0024234	3300048923	Bacteria	3787
546	Ga0496120_0032590	3300048923	Bacteria	3140
547	Ga0496120_0033662	3300048923	Bacteria	3077
548	Ga0496120_0043224	3300048923	Bacteria	2626
549	Ga0496120_0085748	3300048923	Bacteria	1694
550	Ga0496121_0000891	3300048924	Bacteria	53863
551	Ga0496121_0021970	3300048924	Bacteria	6218
552	Ga0496122_0000031	3300048925	Bacteria	329726
553	Ga0496122_0000194	3300048925	Bacteria	139191
554	Ga0496122_0014104	3300048925	Bacteria	7753
555	Ga0496122_0019167	3300048925	Bacteria	6267
556	Ga0496122_0031624	3300048925	Bacteria	4399
557	Ga0496123_0000013	3300048926	Bacteria	439694
558	Ga0496123_0000350	3300048926	Bacteria	86569
559	Ga0496123_0000681	3300048926	Bacteria	56018
560	Ga0496123_0062673	3300048926	Bacteria	2380
561	Ga0496123_0120583	3300048926	Bacteria	1476
562	Ga0496124_0003767	3300048927	Bacteria	18240
563	Ga0496124_0004053	3300048927	Bacteria	17370
564	Ga0496124_0008895	3300048927	Bacteria	10415
565	Ga0496124_0020624	3300048927	Bacteria	6083
566	Ga0496124_0022562	3300048927	Bacteria	5766
567	Ga0496124_0027130	3300048927	Bacteria	5147
568	Ga0496124_0071353	3300048927	Bacteria	2879
569	Ga0496125_0000077	3300048928	Bacteria	232629
570	Ga0496125_0017043	3300048928	Bacteria	6943
571	Ga0496125_0020810	3300048928	Bacteria	6144
572	Ga0496125_0022371	3300048928	Bacteria	5872
573	Ga0496125_0029221	3300048928	Bacteria	4958
574	Ga0496125_0045042	3300048928	Bacteria	3719
575	Ga0496125_0066821	3300048928	Bacteria	2838
576	Ga0496126_0001071	3300048929	Bacteria	46057
577	Ga0496126_0014786	3300048929	Bacteria	7873
578	Ga0496126_0015636	3300048929	Bacteria	7625
579	Ga0496126_0044891	3300048929	Bacteria	4066
580	Ga0496126_0046767	3300048929	Bacteria	3965
581	Ga0496126_0065144	3300048929	Bacteria	3261
582	Ga0496126_0125426	3300048929	Bacteria	2222
583	Ga0501317_004320	3300049533	Bacteria	1472
584	Ga0501031_0004368	3300049568	Bacteria	9155
585	Ga0501032_0000407	3300049569	Bacteria	35505
586	Ga0501032_0001556	3300049569	Bacteria	18312
587	Ga0501032_0044841	3300049569	Bacteria	2992
588	Ga0501033_0002659	3300049570	Bacteria	15010
589	Ga0501033_0003000	3300049570	Bacteria	14091
590	Ga0501033_0026246	3300049570	Bacteria	4385
591	Ga0501033_0218791	3300049570	Bacteria	1356
592	Ga0501033_0234027	3300049570	Bacteria	1304
593	Ga0501034_0000051	3300049571	Bacteria	210960
594	Ga0501034_0009471	3300049571	Bacteria	10195
595	Ga0501034_0012979	3300049571	Bacteria	8587
596	Ga0501034_0123262	3300049571	Bacteria	2577
597	Ga0501034_0125558	3300049571	Bacteria	2551
598	Ga0501034_0170959	3300049571	Bacteria	2140
599	Ga0501034_0192471	3300049571	Bacteria	2001
600	Ga0501034_0470729	3300049571	Bacteria	1172
601	Ga0501036_0001633	3300049572	Bacteria	17371
602	Ga0501036_0008562	3300049572	Bacteria	8389
603	Ga0501037_0002752	3300049573	Bacteria	12719
604	Ga0501038_0001166	3300049574	Bacteria	23863
605	Ga0501038_0011688	3300049574	Bacteria	8008
606	Ga0501038_0031268	3300049574	Bacteria	4705
607	Ga0501038_0037307	3300049574	Bacteria	4261
608	Ga0501038_0046616	3300049574	Bacteria	3758
609	Ga0501038_0067627	3300049574	Bacteria	3039
610	Ga0501038_0104621	3300049574	Bacteria	2352
611	Ga0501038_0119097	3300049574	Bacteria	2179
612	Ga0501039_0000287	3300049575	Bacteria	35995
613	Ga0501039_0030904	3300049575	Bacteria	4129
614	Ga0501039_0036106	3300049575	Bacteria	3813
615	Ga0501039_0036234	3300049575	Bacteria	3806
616	Ga0501039_0110768	3300049575	Bacteria	2146
617	Ga0501042_0111215	3300049578	Bacteria	1972
618	Ga0501043_0004673	3300049579	Bacteria	11100
619	Ga0501043_0024971	3300049579	Bacteria	4689
620	Ga0501043_0036081	3300049579	Bacteria	3889
621	Ga0501043_0040866	3300049579	Bacteria	3645
622	Ga0501043_0056599	3300049579	Bacteria	3080
623	Ga0501043_0059257	3300049579	Bacteria	3004
624	Ga0501043_0166676	3300049579	Bacteria	1720
625	Ga0501046_0001394	3300049580	Bacteria	23269
626	Ga0501046_0010495	3300049580	Bacteria	7950
627	Ga0501046_0013854	3300049580	Bacteria	6810
628	Ga0501047_0011806	3300049581	Bacteria	8261
629	Ga0501047_0042644	3300049581	Bacteria	4384
630	Ga0501047_0073102	3300049581	Bacteria	3301
631	Ga0501047_0103344	3300049581	Bacteria	2729
632	Ga0501048_0008296	3300049582	Bacteria	7859
633	Ga0501048_0225880	3300049582	Bacteria	1328
634	Ga0501068_0094082	3300049584	Bacteria	1852
635	Ga0501069_0031136	3300049585	Bacteria	2933
636	Ga0501070_0000100	3300049586	Bacteria	75001
637	Ga0501070_0003131	3300049586	Bacteria	14404
638	Ga0501070_0005309	3300049586	Bacteria	10990
639	Ga0501070_0006307	3300049586	Bacteria	10093
640	Ga0501070_0008918	3300049586	Bacteria	8477
641	Ga0501070_0122487	3300049586	Bacteria	2149
642	Ga0501071_0000167	3300049587	Bacteria	28392
643	Ga0501073_0000223	3300049589	Bacteria	37267
644	Ga0501073_0007116	3300049589	Bacteria	8333
645	Ga0501073_0018072	3300049589	Bacteria	5099
646	Ga0501080_0000083	3300049742	Bacteria	63863
647	Ga0501080_0134879	3300049742	Bacteria	2285
648	Ga0501083_0000031	3300049744	Bacteria	104819
649	Ga0501083_0016779	3300049744	Bacteria	5114
650	Ga0501035_0009248	3300049822	Bacteria	9162
651	Ga0501035_0020033	3300049822	Bacteria	6144
652	Ga0501044_0001905	3300049823	Bacteria	24138
653	Ga0501044_0005242	3300049823	Bacteria	14418
654	Ga0501044_0015200	3300049823	Bacteria	8291
655	Ga0501044_0197739	3300049823	Bacteria	1969
656	Ga0501044_0200763	3300049823	Bacteria	1952
657	nmdc:mga00v17_144755_c1	3300050491	Bacteria	1525
658	nmdc:mga00v17_203407_c1	3300050491	Bacteria	1280
659	nmdc:mga00v17_23464_c1	3300050491	Bacteria	3568
660	nmdc:mga00v17_24870_c1	3300050491	Bacteria	3476
661	nmdc:mga00v17_75373_c1	3300050491	Bacteria	2097
662	nmdc:mga0yw44_6157_c1	3300050492	Bacteria	5768
663	nmdc:mga0yw44_98172_c1	3300050492	Bacteria	1862
664	nmdc:mga06z11_47437_c1	3300050494	Bacteria	2182
665	nmdc:mga07m45_62837_c1	3300050496	Bacteria	2105
666	nmdc:mga09592_147895_c1	3300050508	Bacteria	2026
667	nmdc:mga06r32_464786_c1	3300050510	Bacteria	1244
668	nmdc:mga08x19_59847_c1	3300050514	Bacteria	2466
669	nmdc:mga0sz30_10818_c1	3300050516	Bacteria	2455
670	nmdc:mga0sz30_45661_c1	3300050516	Bacteria	1848
671	Ga0495601_0037212	3300053077	Bacteria	3042
672	Ga0500635_0000010	3300053080	Bacteria	147500
673	Ga0500635_0027739	3300053080	Bacteria	1802
674	Ga0495655_0004033	3300053083	Bacteria	2481
675	Ga0495619_0028662	3300053085	Bacteria	3593
676	Ga0500643_000072	3300053087	Bacteria	112810
677	Ga0500651_0000194	3300053093	Bacteria	38826
678	Ga0500650_0000328	3300053098	Bacteria	11421
679	Ga0500556_0000001	3300053104	Bacteria	1135060
680	Ga0500556_0000086	3300053104	Bacteria	87063
681	Ga0500562_000397	3300053108	Bacteria	10573
682	Ga0500562_005543	3300053108	Bacteria	3171
683	Ga0500593_005225	3300053117	Bacteria	5091
684	Ga0500652_103382	3300053131	Bacteria	1191
685	Ga0500655_002645	3300053133	Bacteria	3245
686	Ga0500559_0000063	3300053136	Bacteria	87005
687	Ga0500559_0003102	3300053136	Bacteria	8275
688	Ga0500559_0004023	3300053136	Bacteria	7060
689	Ga0500559_0010658	3300053136	Bacteria	3940
690	Ga0500559_0058052	3300053136	Bacteria	1720
691	Ga0500568_0000006	3300053139	Bacteria	522235
692	Ga0500568_0000028	3300053139	Bacteria	161589
693	Ga0500568_0000102	3300053139	Bacteria	78197
694	Ga0500568_0009694	3300053139	Bacteria	4560
695	Ga0500573_0000001	3300053140	Bacteria	436394
696	Ga0500573_0004401	3300053140	Bacteria	7415
697	Ga0500573_0037680	3300053140	Bacteria	2794
698	Ga0500573_0046834	3300053140	Bacteria	2491
699	Ga0500577_0076724	3300053142	Bacteria	1323
700	Ga0500590_032099	3300053148	Bacteria	2723
701	Ga0500616_0000078	3300053153	Bacteria	202009
702	Ga0500616_0000427	3300053153	Bacteria	56111
703	Ga0500620_000233	3300053155	Bacteria	11018
704	Ga0500645_028229	3300053730	Bacteria	1699
705	Ga0587072_003666	3300059643	Bacteria	2176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300020081	Ga0206354_10095331	Ga0206354_100953312	299
2	3300013105	Ga0157369_10000618	Ga0157369_1000061854	303
3	3300048922	Ga0496119_0044528	Ga0496119_0044528_49_987	304
4	3300048905	Ga0496102_0298556	Ga0496102_0298556_529_1464	309
5	3300049571	Ga0501034_0012979	Ga0501034_0012979_5614_6747	326
6	3300049579	Ga0501043_0036081	Ga0501043_0036081_1700_2833	326
7	3300049586	Ga0501070_0003131	Ga0501070_0003131_6618_7751	326
8	3300049587	Ga0501071_0000167	Ga0501071_0000167_2160_3293	326
9	3300009036	Ga0105244_10052160	Ga0105244_100521601	327
10	3300013308	Ga0157375_10155904	Ga0157375_101559042	327
11	3300017792	Ga0163161_10108795	Ga0163161_101087952	327
12	3300048917	Ga0496114_0180069	Ga0496114_0180069_524_1606	327
13	3300048920	Ga0496117_0001576	Ga0496117_0001576_15890_17038	327
14	3300031727	Ga0316576_10151539	Ga0316576_101515392	328
15	3300048920	Ga0496117_0000884	Ga0496117_0000884_40125_41222	329
16	3300048928	Ga0496125_0020810	Ga0496125_0020810_359_1456	329
17	3300048928	Ga0496125_0029221	Ga0496125_0029221_380_1459	329
18	3300049579	Ga0501043_0024971	Ga0501043_0024971_2988_4088	329
19	3300049585	Ga0501069_0031136	Ga0501069_0031136_121_1221	329
20	3300049586	Ga0501070_0005309	Ga0501070_0005309_318_1418	329
21	3300049589	Ga0501073_0007116	Ga0501073_0007116_366_1466	329
22	3300049742	Ga0501080_0000083	Ga0501080_0000083_35436_36536	329
23	3300006038	Ga0075365_10004965	Ga0075365_100049652	330
24	3300006051	Ga0075364_10060805	Ga0075364_100608052	330
25	3300006051	Ga0075364_10181743	Ga0075364_101817432	330
26	3300006186	Ga0075369_10046212	Ga0075369_100462122	330
27	3300006353	Ga0075370_10052247	Ga0075370_100522472	330
28	3300009148	Ga0105243_10122710	Ga0105243_101227102	330
29	3300020081	Ga0206354_11438617	Ga0206354_114386172	330
30	3300048920	Ga0496117_0156462	Ga0496117_0156462_16_1113	330
31	3300048929	Ga0496126_0046767	Ga0496126_0046767_1055_2152	330
32	3300050491	nmdc:mga00v17_144755_c1	nmdc:mga00v17_144755_c1_176_1255	330
33	3300050491	nmdc:mga00v17_75373_c1	nmdc:mga00v17_75373_c1_638_1735	330
34	3300050492	nmdc:mga0yw44_6157_c1	nmdc:mga0yw44_6157_c1_1338_2438	330
35	3300050494	nmdc:mga06z11_47437_c1	nmdc:mga06z11_47437_c1_712_1812	330
36	3300050496	nmdc:mga07m45_62837_c1	nmdc:mga07m45_62837_c1_389_1489	330
37	3300053131	Ga0500652_103382	Ga0500652_103382_66_1175	330
38	3300049571	Ga0501034_0192471	Ga0501034_0192471_548_1717	331
39	3300049579	Ga0501043_0040866	Ga0501043_0040866_1896_3077	331
40	3300053153	Ga0500616_0000427	Ga0500616_0000427_95_1225	331
41	3300005347	Ga0070668_100080137	Ga0070668_1000801372	332
42	3300005355	Ga0070671_100023747	Ga0070671_1000237471	332
43	3300005548	Ga0070665_100001075	Ga0070665_10000107532	332
44	3300005841	Ga0068863_100042934	Ga0068863_1000429342	332
45	3300005843	Ga0068860_100020176	Ga0068860_1000201764	332
46	3300025931	Ga0207644_10108405	Ga0207644_101084051	332
47	3300026088	Ga0207641_10229620	Ga0207641_102296202	332
48	3300028379	Ga0268266_10012495	Ga0268266_100124952	332
49	3300028381	Ga0268264_10031458	Ga0268264_100314584	332
50	3300044842	Ga0466957_0216416	Ga0466957_0216416_31_1107	332
51	3300049570	Ga0501033_0002659	Ga0501033_0002659_5180_6358	332
52	3300049571	Ga0501034_0125558	Ga0501034_0125558_691_1797	332
53	3300005937	Ga0081455_10000023	Ga0081455_1000002394	333
54	3300042007	Ga0439449_0020381	Ga0439449_0020381_695_1780	333
55	3300044658	Ga0466972_0003731	Ga0466972_0003731_2439_3515	333
56	3300044683	Ga0466965_0000009	Ga0466965_0000009_47974_49164	333
57	3300044683	Ga0466965_0016108	Ga0466965_0016108_2104_3180	333
58	3300044765	Ga0466970_0012825	Ga0466970_0012825_1975_3051	333
59	3300044901	Ga0466960_0005117	Ga0466960_0005117_50_1126	333
60	3300049570	Ga0501033_0218791	Ga0501033_0218791_86_1192	333
61	3300049574	Ga0501038_0104621	Ga0501038_0104621_1161_2267	333
62	3300005436	Ga0070713_100340762	Ga0070713_1003407621	334
63	3300025928	Ga0207700_10157890	Ga0207700_101578902	334
64	3300025929	Ga0207664_10005752	Ga0207664_100057522	334
65	3300053153	Ga0500616_0000078	Ga0500616_0000078_24025_25245	334
66	3300003203	JGI25406J46586_10001347	JGI25406J46586_100013475	335
67	3300005985	Ga0081539_10000128	Ga0081539_10000128103	335
68	3300030522	Ga0307512_10017828	Ga0307512_100178283	335
69	3300049584	Ga0501068_0094082	Ga0501068_0094082_679_1788	335
70	3300049589	Ga0501073_0018072	Ga0501073_0018072_510_1601	335
71	3300053080	Ga0500635_0000010	Ga0500635_0000010_64126_65226	335
72	3300025972	Ga0207668_10027781	Ga0207668_100277812	336
73	3300031456	Ga0307513_10270395	Ga0307513_102703952	336
74	3300048903	Ga0496100_0002695	Ga0496100_0002695_5852_6934	336
75	3300048904	Ga0496101_0016204	Ga0496101_0016204_3232_4314	336
76	3300048905	Ga0496102_0000408	Ga0496102_0000408_2130_3212	336
77	3300048906	Ga0496103_0000068	Ga0496103_0000068_9660_10742	336
78	3300048907	Ga0496104_0011688	Ga0496104_0011688_5754_6836	336
79	3300048908	Ga0496105_0094341	Ga0496105_0094341_576_1658	336
80	3300048911	Ga0496108_0084549	Ga0496108_0084549_1560_2642	336
81	3300048919	Ga0496116_0000152	Ga0496116_0000152_2713_3795	336
82	3300048920	Ga0496117_0000615	Ga0496117_0000615_2122_3204	336
83	3300048921	Ga0496118_0004019	Ga0496118_0004019_2141_3223	336
84	3300048922	Ga0496119_0002707	Ga0496119_0002707_15901_16983	336
85	3300048923	Ga0496120_0043224	Ga0496120_0043224_1417_2499	336
86	3300048924	Ga0496121_0021970	Ga0496121_0021970_4871_5953	336
87	3300048927	Ga0496124_0020624	Ga0496124_0020624_2152_3234	336
88	3300048929	Ga0496126_0001071	Ga0496126_0001071_2120_3202	336
89	3300049568	Ga0501031_0004368	Ga0501031_0004368_4146_5273	336
90	3300049569	Ga0501032_0001556	Ga0501032_0001556_11603_12730	336
91	3300049572	Ga0501036_0008562	Ga0501036_0008562_697_1824	336
92	3300049574	Ga0501038_0001166	Ga0501038_0001166_697_1824	336
93	3300049575	Ga0501039_0000287	Ga0501039_0000287_23339_24466	336
94	3300049579	Ga0501043_0004673	Ga0501043_0004673_7487_8614	336
95	3300049580	Ga0501046_0001394	Ga0501046_0001394_15223_16350	336
96	3300049581	Ga0501047_0011806	Ga0501047_0011806_6566_7693	336
97	3300049582	Ga0501048_0225880	Ga0501048_0225880_153_1280	336
98	3300049822	Ga0501035_0009248	Ga0501035_0009248_7339_8466	336
99	3300049823	Ga0501044_0005242	Ga0501044_0005242_12759_13886	336
100	3300053139	Ga0500568_0000028	Ga0500568_0000028_36309_37421	336
101	3300006186	Ga0075369_10009529	Ga0075369_100095293	337
102	3300050516	nmdc:mga0sz30_45661_c1	nmdc:mga0sz30_45661_c1_599_1705	337
103	3300044765	Ga0466970_0030132	Ga0466970_0030132_1351_2451	338
104	3300005842	Ga0068858_100000002	Ga0068858_100000002195	340
105	3300010375	Ga0105239_10271162	Ga0105239_102711622	340
106	3300014325	Ga0163163_10052633	Ga0163163_100526333	340
107	3300014326	Ga0157380_10114056	Ga0157380_101140562	340
108	3300014968	Ga0157379_10000007	Ga0157379_10000007121	340
109	3300025941	Ga0207711_10000953	Ga0207711_100009534	340
110	3300026035	Ga0207703_10000001	Ga0207703_10000001439	340
111	3300048913	Ga0496110_0078495	Ga0496110_0078495_1596_2681	340
112	3300048917	Ga0496114_0023869	Ga0496114_0023869_559_1644	340
113	3300006847	Ga0075431_100226072	Ga0075431_1002260722	341
114	3300009101	Ga0105247_10000014	Ga0105247_10000014225	341
115	3300009177	Ga0105248_10001871	Ga0105248_1000187114	341
116	3300014325	Ga0163163_10023231	Ga0163163_100232313	341
117	3300014968	Ga0157379_10020432	Ga0157379_100204322	341
118	3300025900	Ga0207710_10000031	Ga0207710_100000316	341
119	3300032004	Ga0307414_10066184	Ga0307414_100661842	341
120	3300048922	Ga0496119_0005861	Ga0496119_0005861_3797_4852	341
121	3300048923	Ga0496120_0002915	Ga0496120_0002915_11113_12168	341
122	3300050510	nmdc:mga06r32_464786_c1	nmdc:mga06r32_464786_c1_119_1204	341
123	3300053140	Ga0500573_0000001	Ga0500573_0000001_395586_396692	341
124	3300005471	Ga0070698_100070725	Ga0070698_1000707252	342
125	3300044765	Ga0466970_0170579	Ga0466970_0170579_117_1184	342
126	3300048920	Ga0496117_0000053	Ga0496117_0000053_143105_144202	342
127	3300048922	Ga0496119_0003914	Ga0496119_0003914_143_1240	342
128	3300048924	Ga0496121_0000891	Ga0496121_0000891_2589_3695	342
129	3300048925	Ga0496122_0019167	Ga0496122_0019167_2742_3839	342
130	3300048926	Ga0496123_0000681	Ga0496123_0000681_35780_36877	342
131	3300048927	Ga0496124_0003767	Ga0496124_0003767_11870_12967	342
132	3300048928	Ga0496125_0022371	Ga0496125_0022371_2723_3820	342
133	3300048929	Ga0496126_0044891	Ga0496126_0044891_2900_3997	342
134	iso_pu_bacteria	2527291627	2528202901	342
135	iso_pu_bacteria	2527291629	2528213422	342
136	iso_pu_bacteria	2546825537	2546947861	342
137	iso_pu_bacteria	2576861822	2579749523	342
138	iso_pu_bacteria	2579778521	2579855753	342
139	iso_pu_bacteria	2619618881	2619857529	342
140	iso_pu_bacteria	2619619003	2620353408	342
141	iso_pu_bacteria	2626541554	2626635223	342
142	iso_pu_bacteria	2671180195	2671839984	342
143	iso_pu_bacteria	2684623035	2686535399	342
144	iso_pu_bacteria	2684623036	2686542584	342
145	iso_pu_bacteria	2687453743	2689990728	342
146	iso_pu_bacteria	2710264753	2710602411	342
147	iso_pu_bacteria	2773857922	2774858140	342
148	iso_pu_bacteria	2773857924	2774864614	342
149	iso_pu_bacteria	2895880812	2895887081	342
150	iso_pu_bacteria	637000116	637880972	342
151	iso_pu_bacteria	8054913762	8054919773	342
152	iso_pu_bacteria	8054920844	8054925864	342
153	iso_pu_bacteria	8055157932	8055162946	342
154	3300053136	Ga0500559_0003102	Ga0500559_0003102_1115_2203	343
155	3300009551	Ga0105238_10016957	Ga0105238_100169576	345
156	3300030521	Ga0307511_10004862	Ga0307511_100048625	345
157	3300032002	Ga0307416_100076940	Ga0307416_1000769402	345
158	3300044656	Ga0466969_0008896	Ga0466969_0008896_4088_5158	345
159	3300045049	Ga0466959_0009825	Ga0466959_0009825_3347_4417	345
160	iso_pu_bacteria	2558860280	2559429475	345
161	iso_pu_bacteria	8054472261	8054476767	345
162	3300002738	JGI25154J39366_1002515	JGI25154J39366_10025153	347
163	3300013104	Ga0157370_10318471	Ga0157370_103184712	347
164	3300025246	Ga0209646_1000099	Ga0209646_1000099177	347
165	3300025898	Ga0207692_10007187	Ga0207692_100071873	347
166	3300030731	Ga0316177_1008392	Ga0316177_10083923	347
167	3300031507	Ga0307509_10158196	Ga0307509_101581962	347
168	3300031665	Ga0316575_10004373	Ga0316575_100043731	347
169	3300031824	Ga0307413_10018508	Ga0307413_100185082	347
170	3300032133	Ga0316583_10001286	Ga0316583_100012865	347
171	3300032139	Ga0316580_10001184	Ga0316580_100011845	347
172	3300035398	Ga0316574_0007310	Ga0316574_0007310_754_1857	347
173	3300036712	Ga0316584_0001862	Ga0316584_0001862_507_1610	347
174	3300037588	Ga0316581_0000693	Ga0316581_0000693_686_1789	347
175	3300044658	Ga0466972_0037196	Ga0466972_0037196_168_1250	347
176	3300044683	Ga0466965_0010802	Ga0466965_0010802_667_1749	347
177	3300044683	Ga0466965_0049058	Ga0466965_0049058_761_1843	347
178	3300044901	Ga0466960_0002504	Ga0466960_0002504_5721_6803	347
179	3300050508	nmdc:mga09592_147895_c1	nmdc:mga09592_147895_c1_308_1384	347
180	3300053087	Ga0500643_000072	Ga0500643_000072_34477_35595	347
181	iso_pu_bacteria	2751185734	2753070607	347
182	iso_pu_bacteria	2870721527	2870726834	347
183	iso_pu_bacteria	2899370129	2899372603	347
184	3300005336	Ga0070680_100374637	Ga0070680_1003746371	348
185	3300005337	Ga0070682_100155348	Ga0070682_1001553481	348
186	3300005338	Ga0068868_100015955	Ga0068868_1000159553	348
187	3300005339	Ga0070660_100005496	Ga0070660_1000054964	348
188	3300005344	Ga0070661_100231596	Ga0070661_1002315961	348
189	3300005347	Ga0070668_100001439	Ga0070668_1000014397	348
190	3300005356	Ga0070674_100058505	Ga0070674_1000585053	348
191	3300005364	Ga0070673_100241887	Ga0070673_1002418872	348
192	3300005439	Ga0070711_100014460	Ga0070711_1000144602	348
193	3300005444	Ga0070694_100087058	Ga0070694_1000870582	348
194	3300005456	Ga0070678_100057466	Ga0070678_1000574661	348
195	3300005539	Ga0068853_100089231	Ga0068853_1000892312	348
196	3300005544	Ga0070686_100199674	Ga0070686_1001996741	348
197	3300005546	Ga0070696_100030879	Ga0070696_1000308793	348
198	3300005547	Ga0070693_100026653	Ga0070693_1000266531	348
199	3300005548	Ga0070665_100102322	Ga0070665_1001023222	348
200	3300005549	Ga0070704_100073944	Ga0070704_1000739442	348
201	3300005563	Ga0068855_100049036	Ga0068855_1000490364	348
202	3300005615	Ga0070702_100130096	Ga0070702_1001300962	348
203	3300005618	Ga0068864_100174866	Ga0068864_1001748662	348
204	3300006175	Ga0070712_100014076	Ga0070712_1000140762	348
205	3300006237	Ga0097621_100083271	Ga0097621_1000832712	348
206	3300006358	Ga0068871_100031845	Ga0068871_1000318453	348
207	3300006871	Ga0075434_100184885	Ga0075434_1001848851	348
208	3300006881	Ga0068865_100060382	Ga0068865_1000603821	348
209	3300007076	Ga0075435_100180385	Ga0075435_1001803852	348
210	3300009101	Ga0105247_10114872	Ga0105247_101148722	348
211	3300009545	Ga0105237_10081066	Ga0105237_100810663	348
212	3300009553	Ga0105249_10097516	Ga0105249_100975162	348
213	3300010375	Ga0105239_10181596	Ga0105239_101815962	348
214	3300011119	Ga0105246_10008958	Ga0105246_100089585	348
215	3300013104	Ga0157370_10053252	Ga0157370_100532522	348
216	3300013105	Ga0157369_10050715	Ga0157369_100507154	348
217	3300013296	Ga0157374_10020795	Ga0157374_100207951	348
218	3300013306	Ga0163162_10018367	Ga0163162_100183672	348
219	3300013308	Ga0157375_10411191	Ga0157375_104111912	348
220	3300014325	Ga0163163_10028866	Ga0163163_100288663	348
221	3300014968	Ga0157379_10031326	Ga0157379_100313263	348
222	3300017792	Ga0163161_10038744	Ga0163161_100387443	348
223	3300025898	Ga0207692_10072606	Ga0207692_100726062	348
224	3300025901	Ga0207688_10034610	Ga0207688_100346101	348
225	3300025911	Ga0207654_10064828	Ga0207654_100648282	348
226	3300025914	Ga0207671_10135540	Ga0207671_101355402	348
227	3300025915	Ga0207693_10005632	Ga0207693_100056329	348
228	3300025919	Ga0207657_10010407	Ga0207657_100104075	348
229	3300025923	Ga0207681_10304022	Ga0207681_103040222	348
230	3300025927	Ga0207687_10050506	Ga0207687_100505062	348
231	3300025929	Ga0207664_10221773	Ga0207664_102217731	348
232	3300025933	Ga0207706_10109976	Ga0207706_101099762	348
233	3300025934	Ga0207686_10030576	Ga0207686_100305762	348
234	3300025935	Ga0207709_10008571	Ga0207709_100085714	348
235	3300025938	Ga0207704_10148957	Ga0207704_101489571	348
236	3300025940	Ga0207691_10293928	Ga0207691_102939282	348
237	3300025942	Ga0207689_10005198	Ga0207689_1000519812	348
238	3300025961	Ga0207712_10016957	Ga0207712_100169572	348
239	3300025981	Ga0207640_10027453	Ga0207640_100274532	348
240	3300026023	Ga0207677_10010190	Ga0207677_100101902	348
241	3300026041	Ga0207639_10173257	Ga0207639_101732572	348
242	3300026067	Ga0207678_10004951	Ga0207678_100049512	348
243	3300026078	Ga0207702_10277484	Ga0207702_102774842	348
244	3300026095	Ga0207676_10172380	Ga0207676_101723802	348
245	3300026121	Ga0207683_10009666	Ga0207683_100096667	348
246	3300028379	Ga0268266_10238000	Ga0268266_102380002	348
247	3300028380	Ga0268265_10173875	Ga0268265_101738752	348
248	3300031247	Ga0265340_10011501	Ga0265340_100115013	348
249	3300035112	Ga0373932_0012417	Ga0373932_0012417_519_1610	348
250	3300035121	Ga0373960_0009369	Ga0373960_0009369_657_1748	348
251	3300035207	Ga0373942_0013866	Ga0373942_0013866_547_1638	348
252	3300044765	Ga0466970_0033464	Ga0466970_0033464_1303_2400	348
253	3300048904	Ga0496101_0111997	Ga0496101_0111997_329_1402	348
254	3300048905	Ga0496102_0145371	Ga0496102_0145371_976_2067	348
255	3300048906	Ga0496103_0028748	Ga0496103_0028748_2141_3214	348
256	3300048907	Ga0496104_0028567	Ga0496104_0028567_3621_4694	348
257	3300048908	Ga0496105_0020633	Ga0496105_0020633_2473_3546	348
258	3300048911	Ga0496108_0022373	Ga0496108_0022373_2987_4060	348
259	3300048912	Ga0496109_0114365	Ga0496109_0114365_455_1546	348
260	3300048913	Ga0496110_0023039	Ga0496110_0023039_3042_4115	348
261	3300048914	Ga0496111_0023083	Ga0496111_0023083_1211_2284	348
262	3300048915	Ga0496112_0031814	Ga0496112_0031814_1219_2292	348
263	3300048916	Ga0496113_0100028	Ga0496113_0100028_16_1107	348
264	3300048917	Ga0496114_0042044	Ga0496114_0042044_2580_3653	348
265	3300048918	Ga0496115_0105723	Ga0496115_0105723_30_1103	348
266	3300050514	nmdc:mga08x19_59847_c1	nmdc:mga08x19_59847_c1_594_1667	348
267	iso_pu_bacteria	2799112218	2799185291	348
268	iso_pu_bacteria	2883821847	2883824866	348
269	3300005347	Ga0070668_100005704	Ga0070668_1000057045	349
270	3300005455	Ga0070663_100004837	Ga0070663_1000048373	349
271	3300005937	Ga0081455_10000005	Ga0081455_1000000525	349
272	3300013307	Ga0157372_10377560	Ga0157372_103775602	349
273	3300020081	Ga0206354_11247678	Ga0206354_112476782	349
274	3300020082	Ga0206353_10879647	Ga0206353_108796472	349
275	3300021388	Ga0213875_10030738	Ga0213875_100307382	349
276	3300025253	Ga0209677_100375	Ga0209677_10037523	349
277	3300025909	Ga0207705_10266719	Ga0207705_102667191	349
278	3300025972	Ga0207668_10027822	Ga0207668_100278223	349
279	3300026067	Ga0207678_10001813	Ga0207678_1000181314	349
280	3300028800	Ga0265338_10050889	Ga0265338_100508894	349
281	3300031241	Ga0265325_10068437	Ga0265325_100684372	349
282	3300031838	Ga0307518_10000118	Ga0307518_1000011828	349
283	3300031838	Ga0307518_10080176	Ga0307518_100801762	349
284	3300032005	Ga0307411_10001659	Ga0307411_100016594	349
285	3300033179	Ga0307507_10007702	Ga0307507_100077021	349
286	3300033179	Ga0307507_10016334	Ga0307507_100163343	349
287	3300037312	Ga0395899_0015808	Ga0395899_0015808_4385_5485	349
288	3300037418	Ga0395900_0382528	Ga0395900_0382528_40_1140	349
289	3300037853	Ga0436364_1296832	Ga0436364_1296832_576_1673	349
290	3300044658	Ga0466972_0014668	Ga0466972_0014668_658_1749	349
291	3300044735	Ga0466968_0034654	Ga0466968_0034654_942_2033	349
292	3300044765	Ga0466970_0115063	Ga0466970_0115063_237_1328	349
293	3300045976	Ga0466967_0003086	Ga0466967_0003086_1175_2245	349
294	3300050516	nmdc:mga0sz30_10818_c1	nmdc:mga0sz30_10818_c1_208_1308	349
295	3300053085	Ga0495619_0028662	Ga0495619_0028662_1085_2146	349
296	3300053108	Ga0500562_005543	Ga0500562_005543_248_1336	349
297	iso_pu_bacteria	2582580736	2583150313	349
298	iso_pu_bacteria	2585427649	2586058970	349
299	iso_pu_bacteria	2775506925	2776371507	349
300	iso_pu_bacteria	2791354901	2791910733	349
301	iso_pu_bacteria	2795385470	2795783634	349
302	iso_pu_bacteria	2808606522	2809592278	349
303	iso_pu_bacteria	2863067949	2863070929	349
304	iso_pu_bacteria	2866552031	2866552775	349
305	iso_pu_bacteria	2866612099	2866616516	349
306	iso_pu_bacteria	2891326441	2891326718	349
307	iso_pu_bacteria	2899359706	2899362138	349
308	iso_pu_bacteria	2915768154	2915769195	349
309	iso_pu_bacteria	2917736166	2917743458	349
310	iso_pu_bacteria	8003314358	8003316203	349
311	iso_pu_bacteria	8047710418	8047715479	349
312	iso_pu_bacteria	8056207758	8056211875	349
313	3300053077	Ga0495601_0037212	Ga0495601_0037212_1254_2378	350
314	iso_pu_bacteria	2795385472	2795794271	350
315	3300031665	Ga0316575_10063046	Ga0316575_100630462	351
316	3300031691	Ga0316579_10036120	Ga0316579_100361202	351
317	3300031728	Ga0316578_10079092	Ga0316578_100790921	351
318	3300035398	Ga0316574_0003636	Ga0316574_0003636_6781_7875	351
319	3300036647	Ga0316582_0187447	Ga0316582_0187447_216_1310	351
320	3300047320	Ga0495672_0005490	Ga0495672_0005490_7725_8867	351
321	3300009036	Ga0105244_10014121	Ga0105244_100141213	352
322	3300011119	Ga0105246_10001582	Ga0105246_100015823	352
323	3300025315	Ga0207697_10010844	Ga0207697_100108442	352
324	3300025728	Ga0207655_1019558	Ga0207655_10195581	352
325	3300037471	Ga0395905_0015372	Ga0395905_0015372_5922_7019	352
326	3300038443	Ga0395901_0035072	Ga0395901_0035072_2412_3509	352
327	3300048908	Ga0496105_0066439	Ga0496105_0066439_631_1713	352
328	3300048929	Ga0496126_0014786	Ga0496126_0014786_3919_4989	352
329	iso_pu_bacteria	2784132109	2784471734	352
330	3300005440	Ga0070705_100011393	Ga0070705_1000113932	353
331	3300005546	Ga0070696_100218327	Ga0070696_1002183272	353
332	3300009176	Ga0105242_10052786	Ga0105242_100527862	353
333	3300013308	Ga0157375_10031909	Ga0157375_100319093	353
334	3300017792	Ga0163161_10094567	Ga0163161_100945672	353
335	3300025972	Ga0207668_10128863	Ga0207668_101288631	353
336	3300031548	Ga0307408_100013141	Ga0307408_1000131414	353
337	3300031995	Ga0307409_100100292	Ga0307409_1001002922	353
338	3300037466	Ga0395898_0063943	Ga0395898_0063943_1285_2391	353
339	3300038443	Ga0395901_0005071	Ga0395901_0005071_8463_9569	353
340	3300048907	Ga0496104_0062484	Ga0496104_0062484_610_1716	353
341	3300048912	Ga0496109_0287151	Ga0496109_0287151_351_1457	353
342	iso_pu_bacteria	2643221553	2643785581	353
343	iso_pu_bacteria	2643221597	2643996040	353
344	iso_pu_bacteria	2643221724	2644679995	353
345	iso_pu_bacteria	2728369380	2730229493	353
346	iso_pu_bacteria	2739367653	2739602736	353
347	iso_pu_bacteria	2747842429	2747951843	353
348	iso_pu_bacteria	2757320536	2758225913	353
349	iso_pu_bacteria	2773857758	2774380223	353
350	iso_pu_bacteria	2773857763	2774399344	353
351	iso_pu_bacteria	2808606357	2808827709	353
352	iso_pu_bacteria	2808606360	2808853063	353
353	iso_pu_bacteria	2808606366	2808878435	353
354	iso_pu_bacteria	2808606371	2808897046	353
355	iso_pu_bacteria	2816332305	2817508765	353
356	iso_pu_bacteria	2818991318	2819426688	353
357	3300005328	Ga0070676_10007958	Ga0070676_100079583	354
358	3300005333	Ga0070677_10006775	Ga0070677_100067752	354
359	3300005347	Ga0070668_100362468	Ga0070668_1003624681	354
360	3300005353	Ga0070669_100027516	Ga0070669_1000275162	354
361	3300005355	Ga0070671_100016467	Ga0070671_1000164674	354
362	3300005356	Ga0070674_100063844	Ga0070674_1000638442	354
363	3300005456	Ga0070678_100003526	Ga0070678_1000035265	354
364	3300009011	Ga0105251_10012295	Ga0105251_100122952	354
365	3300009148	Ga0105243_10098614	Ga0105243_100986141	354
366	3300009177	Ga0105248_10120909	Ga0105248_101209092	354
367	3300013105	Ga0157369_10036863	Ga0157369_100368634	354
368	3300013306	Ga0163162_10143982	Ga0163162_101439822	354
369	3300025728	Ga0207655_1008672	Ga0207655_10086724	354
370	3300025735	Ga0207713_1034198	Ga0207713_10341982	354
371	3300025893	Ga0207682_10034204	Ga0207682_100342041	354
372	3300025903	Ga0207680_10203119	Ga0207680_102031191	354
373	3300025907	Ga0207645_10010060	Ga0207645_100100602	354
374	3300025926	Ga0207659_10068989	Ga0207659_100689892	354
375	3300025931	Ga0207644_10009795	Ga0207644_100097951	354
376	3300025940	Ga0207691_10005490	Ga0207691_100054903	354
377	3300025960	Ga0207651_10009995	Ga0207651_100099955	354
378	3300026121	Ga0207683_10000870	Ga0207683_1000087018	354
379	3300028573	Ga0265334_10001822	Ga0265334_100018225	354
380	3300046463	Ga0495653_0003116	Ga0495653_0003116_713_1807	354
381	3300046473	Ga0495582_0071401	Ga0495582_0071401_765_1877	354
382	3300046473	Ga0495582_0110520	Ga0495582_0110520_32_1126	354
383	3300046477	Ga0495664_0007200	Ga0495664_0007200_3783_4877	354
384	3300046499	Ga0495594_0008387	Ga0495594_0008387_1370_2464	354
385	3300046517	Ga0495630_0270040	Ga0495630_0270040_35_1129	354
386	3300046531	Ga0495665_0026740	Ga0495665_0026740_1178_2272	354
387	3300046535	Ga0495586_0002562	Ga0495586_0002562_7911_9005	354
388	3300046535	Ga0495586_0009781	Ga0495586_0009781_2292_3386	354
389	3300046536	Ga0495587_0002797	Ga0495587_0002797_9737_10831	354
390	3300046543	Ga0495645_0000572	Ga0495645_0000572_12717_13811	354
391	3300046559	Ga0495667_0075201	Ga0495667_0075201_275_1369	354
392	3300046616	Ga0495668_0103214	Ga0495668_0103214_327_1421	354
393	3300046674	Ga0495588_0002007	Ga0495588_0002007_3289_4401	354
394	3300046675	Ga0495657_0011157	Ga0495657_0011157_4848_5960	354
395	3300046809	Ga0495600_0007923	Ga0495600_0007923_510_1604	354
396	3300047315	Ga0495581_0014701	Ga0495581_0014701_1263_2375	354
397	3300047315	Ga0495581_0033760	Ga0495581_0033760_1282_2376	354
398	3300047315	Ga0495581_0036242	Ga0495581_0036242_994_2106	354
399	3300047315	Ga0495581_0038937	Ga0495581_0038937_216_1310	354
400	3300047322	Ga0495680_0046582	Ga0495680_0046582_2284_3378	354
401	3300047471	Ga0495684_0201912	Ga0495684_0201912_71_1165	354
402	3300047673	Ga0495593_0013807	Ga0495593_0013807_2410_3504	354
403	3300048904	Ga0496101_0015966	Ga0496101_0015966_1840_2952	354
404	3300048906	Ga0496103_0004736	Ga0496103_0004736_3572_4684	354
405	3300048906	Ga0496103_0023370	Ga0496103_0023370_452_1546	354
406	3300048909	Ga0496106_0075218	Ga0496106_0075218_1406_2500	354
407	3300048910	Ga0496107_0179601	Ga0496107_0179601_172_1266	354
408	3300048911	Ga0496108_0104157	Ga0496108_0104157_1178_2272	354
409	3300048912	Ga0496109_0114793	Ga0496109_0114793_410_1504	354
410	3300048913	Ga0496110_0027910	Ga0496110_0027910_2594_3706	354
411	3300048914	Ga0496111_0203937	Ga0496111_0203937_12_1124	354
412	3300048915	Ga0496112_0090919	Ga0496112_0090919_1859_2953	354
413	3300048922	Ga0496119_0052140	Ga0496119_0052140_51_1145	354
414	3300048927	Ga0496124_0022562	Ga0496124_0022562_4419_5513	354
415	iso_pu_bacteria	2728369276	2729908974	354
416	3300005367	Ga0070667_100008397	Ga0070667_1000083977	355
417	3300025986	Ga0207658_10004963	Ga0207658_100049633	355
418	3300032133	Ga0316583_10026558	Ga0316583_100265582	355
419	3300038443	Ga0395901_0165026	Ga0395901_0165026_876_1982	355
420	3300038443	Ga0395901_0168535	Ga0395901_0168535_633_1733	355
421	iso_pu_bacteria	2946024296	2946026423	355
422	3300013100	Ga0157373_10015772	Ga0157373_100157723	356
423	3300025254	Ga0209148_1001580	Ga0209148_10015805	356
424	3300031548	Ga0307408_100212044	Ga0307408_1002120441	356
425	3300031824	Ga0307413_10037358	Ga0307413_100373582	356
426	3300031911	Ga0307412_10011608	Ga0307412_100116085	356
427	3300037466	Ga0395898_0023859	Ga0395898_0023859_53_1180	356
428	3300037466	Ga0395898_0156686	Ga0395898_0156686_543_1685	356
429	3300038443	Ga0395901_0015467	Ga0395901_0015467_5054_6181	356
430	3300038443	Ga0395901_0081883	Ga0395901_0081883_2058_3200	356
431	3300044693	Ga0466961_0118716	Ga0466961_0118716_526_1635	356
432	3300044765	Ga0466970_0118785	Ga0466970_0118785_195_1298	356
433	iso_pu_bacteria	2643221572	2643875529	356
434	iso_pu_bacteria	2643221632	2644183097	356
435	iso_pu_bacteria	2643221635	2644198755	356
436	iso_pu_bacteria	2643221669	2644382584	356
437	iso_pu_bacteria	2751185788	2753301181	356
438	iso_pu_bacteria	2808606372	2808901811	356
439	iso_pu_bacteria	2939598168	2939598678	356
440	3300002773	JGI25152J39213_1000561	JGI25152J39213_10005615	357
441	3300006038	Ga0075365_10006540	Ga0075365_100065402	357
442	3300006051	Ga0075364_10008626	Ga0075364_100086264	357
443	3300006051	Ga0075364_10050492	Ga0075364_100504922	357
444	3300009036	Ga0105244_10008476	Ga0105244_100084762	357
445	3300009036	Ga0105244_10020912	Ga0105244_100209122	357
446	3300011119	Ga0105246_10057405	Ga0105246_100574052	357
447	3300013105	Ga0157369_10427402	Ga0157369_104274021	357
448	3300013250	Ga0171462_1003	Ga0171462_1003251	357
449	3300013306	Ga0163162_10209105	Ga0163162_102091052	357
450	3300020081	Ga0206354_10946747	Ga0206354_109467471	357
451	3300022467	Ga0224712_10026130	Ga0224712_100261302	357
452	3300025258	Ga0209129_1000176	Ga0209129_10001765	357
453	3300025294	Ga0209025_1000655	Ga0209025_10006557	357
454	3300025303	Ga0209051_1004052	Ga0209051_10040527	357
455	3300025303	Ga0209051_1010018	Ga0209051_10100183	357
456	3300025728	Ga0207655_1005595	Ga0207655_10055953	357
457	3300025728	Ga0207655_1005782	Ga0207655_10057822	357
458	3300027907	Ga0207428_10016776	Ga0207428_100167765	357
459	3300031548	Ga0307408_100018644	Ga0307408_1000186442	357
460	3300031548	Ga0307408_100033039	Ga0307408_1000330392	357
461	3300031548	Ga0307408_100297947	Ga0307408_1002979471	357
462	3300031731	Ga0307405_10001127	Ga0307405_1000112711	357
463	3300031731	Ga0307405_10008938	Ga0307405_100089384	357
464	3300031731	Ga0307405_10045954	Ga0307405_100459542	357
465	3300031731	Ga0307405_10066773	Ga0307405_100667732	357
466	3300031731	Ga0307405_10130541	Ga0307405_101305411	357
467	3300031731	Ga0307405_10187822	Ga0307405_101878222	357
468	3300031824	Ga0307413_10019685	Ga0307413_100196852	357
469	3300031824	Ga0307413_10025166	Ga0307413_100251662	357
470	3300031824	Ga0307413_10056652	Ga0307413_100566522	357
471	3300031824	Ga0307413_10057968	Ga0307413_100579682	357
472	3300031824	Ga0307413_10065994	Ga0307413_100659942	357
473	3300031852	Ga0307410_10000610	Ga0307410_1000061013	357
474	3300031852	Ga0307410_10001507	Ga0307410_100015077	357
475	3300031852	Ga0307410_10003399	Ga0307410_100033995	357
476	3300031852	Ga0307410_10028199	Ga0307410_100281991	357
477	3300031852	Ga0307410_10033487	Ga0307410_100334871	357
478	3300031901	Ga0307406_10000291	Ga0307406_100002912	357
479	3300031901	Ga0307406_10001710	Ga0307406_100017106	357
480	3300031901	Ga0307406_10005882	Ga0307406_100058821	357
481	3300031901	Ga0307406_10025847	Ga0307406_100258473	357
482	3300031901	Ga0307406_10103204	Ga0307406_101032041	357
483	3300031901	Ga0307406_10259178	Ga0307406_102591781	357
484	3300031903	Ga0307407_10012752	Ga0307407_100127522	357
485	3300031911	Ga0307412_10006405	Ga0307412_100064051	357
486	3300031911	Ga0307412_10006617	Ga0307412_100066172	357
487	3300031911	Ga0307412_10012060	Ga0307412_100120602	357
488	3300031911	Ga0307412_10016875	Ga0307412_100168752	357
489	3300031995	Ga0307409_100090009	Ga0307409_1000900092	357
490	3300031995	Ga0307409_100121563	Ga0307409_1001215632	357
491	3300031995	Ga0307409_100137491	Ga0307409_1001374912	357
492	3300032002	Ga0307416_100001802	Ga0307416_1000018022	357
493	3300032002	Ga0307416_100014301	Ga0307416_1000143015	357
494	3300032002	Ga0307416_100048949	Ga0307416_1000489492	357
495	3300032004	Ga0307414_10003755	Ga0307414_100037555	357
496	3300032004	Ga0307414_10007660	Ga0307414_100076603	357
497	3300032004	Ga0307414_10134507	Ga0307414_101345072	357
498	3300032005	Ga0307411_10004841	Ga0307411_100048412	357
499	3300032126	Ga0307415_100059924	Ga0307415_1000599242	357
500	3300032126	Ga0307415_100195372	Ga0307415_1001953721	357
501	3300037312	Ga0395899_0069082	Ga0395899_0069082_1250_2365	357
502	3300037418	Ga0395900_0012427	Ga0395900_0012427_3905_5026	357
503	3300037418	Ga0395900_0157080	Ga0395900_0157080_438_1535	357
504	3300037466	Ga0395898_0048649	Ga0395898_0048649_1498_2619	357
505	3300038443	Ga0395901_0014138	Ga0395901_0014138_3736_4857	357
506	3300038443	Ga0395901_0029013	Ga0395901_0029013_2403_3518	357
507	3300041404	Ga0439436_0001133	Ga0439436_0001133_4615_5733	357
508	3300041404	Ga0439436_0003953	Ga0439436_0003953_3377_4516	357
509	3300041405	Ga0439438_034365	Ga0439438_034365_63_1202	357
510	3300041406	Ga0439439_0001046	Ga0439439_0001046_2857_3996	357
511	3300041410	Ga0439461_0000851	Ga0439461_0000851_2758_3897	357
512	3300041411	Ga0439466_0000106	Ga0439466_0000106_393_1532	357
513	3300041411	Ga0439466_0050298	Ga0439466_0050298_88_1227	357
514	3300041413	Ga0439465_0020183	Ga0439465_0020183_646_1785	357
515	3300041999	Ga0439433_0000182	Ga0439433_0000182_522_1661	357
516	3300041999	Ga0439433_0001171	Ga0439433_0001171_3784_4923	357
517	3300041999	Ga0439433_0009700	Ga0439433_0009700_599_1717	357
518	3300042002	Ga0439442_000001	Ga0439442_000001_104452_105570	357
519	3300042002	Ga0439442_000094	Ga0439442_000094_1867_2997	357
520	3300042002	Ga0439442_002050	Ga0439442_002050_761_1900	357
521	3300042007	Ga0439449_0000108	Ga0439449_0000108_17891_19030	357
522	3300042007	Ga0439449_0029441	Ga0439449_0029441_337_1455	357
523	3300042010	Ga0439452_001202	Ga0439452_001202_3478_4617	357
524	3300042014	Ga0439457_002900	Ga0439457_002900_3630_4769	357
525	3300042015	Ga0439462_0001082	Ga0439462_0001082_1375_2514	357
526	3300042121	Ga0450919_000229	Ga0450919_000229_1248_2387	357
527	3300042122	Ga0450920_000216	Ga0450920_000216_7073_8191	357
528	3300042146	Ga0450907_000562	Ga0450907_000562_7557_8675	357
529	3300042146	Ga0450907_005907	Ga0450907_005907_797_1936	357
530	3300042435	Ga0439434_0000056	Ga0439434_0000056_9110_10228	357
531	3300042435	Ga0439434_0004265	Ga0439434_0004265_2857_3996	357
532	3300042435	Ga0439434_0004328	Ga0439434_0004328_946_2085	357
533	3300042531	Ga0450918_000178	Ga0450918_000178_10586_11725	357
534	3300044735	Ga0466968_0015933	Ga0466968_0015933_765_1862	357
535	3300044765	Ga0466970_0000106	Ga0466970_0000106_1008_2105	357
536	3300044765	Ga0466970_0043247	Ga0466970_0043247_518_1615	357
537	3300045836	Ga0466958_0039067	Ga0466958_0039067_1285_2382	357
538	3300046453	Ga0495627_001253	Ga0495627_001253_5083_6180	357
539	3300046457	Ga0495590_0000242	Ga0495590_0000242_28065_29198	357
540	3300046535	Ga0495586_0048587	Ga0495586_0048587_409_1524	357
541	3300046543	Ga0495645_0002606	Ga0495645_0002606_6124_7221	357
542	3300048905	Ga0496102_0435702	Ga0496102_0435702_63_1202	357
543	3300048906	Ga0496103_0013184	Ga0496103_0013184_2396_3493	357
544	3300048906	Ga0496103_0024376	Ga0496103_0024376_424_1545	357
545	3300048910	Ga0496107_0190867	Ga0496107_0190867_56_1177	357
546	3300048912	Ga0496109_0035173	Ga0496109_0035173_1109_2230	357
547	3300048914	Ga0496111_0049922	Ga0496111_0049922_632_1729	357
548	3300048915	Ga0496112_0027934	Ga0496112_0027934_2481_3596	357
549	3300048915	Ga0496112_0030951	Ga0496112_0030951_1878_2975	357
550	3300048917	Ga0496114_0039026	Ga0496114_0039026_1912_3009	357
551	3300048917	Ga0496114_0151152	Ga0496114_0151152_129_1226	357
552	3300048919	Ga0496116_0008426	Ga0496116_0008426_4231_5340	357
553	3300048920	Ga0496117_0005515	Ga0496117_0005515_7947_9044	357
554	3300048921	Ga0496118_0080661	Ga0496118_0080661_1118_2215	357
555	3300048922	Ga0496119_0004238	Ga0496119_0004238_8988_10085	357
556	3300048922	Ga0496119_0015787	Ga0496119_0015787_4103_5212	357
557	3300048923	Ga0496120_0001117	Ga0496120_0001117_20584_21693	357
558	3300048925	Ga0496122_0000031	Ga0496122_0000031_76893_78002	357
559	3300048925	Ga0496122_0031624	Ga0496122_0031624_1233_2312	357
560	3300048926	Ga0496123_0000013	Ga0496123_0000013_76903_78012	357
561	3300048926	Ga0496123_0120583	Ga0496123_0120583_200_1297	357
562	3300048927	Ga0496124_0027130	Ga0496124_0027130_1461_2570	357
563	3300048928	Ga0496125_0000077	Ga0496125_0000077_9231_10328	357
564	3300048928	Ga0496125_0045042	Ga0496125_0045042_147_1256	357
565	3300048928	Ga0496125_0066821	Ga0496125_0066821_735_1814	357
566	3300048929	Ga0496126_0015636	Ga0496126_0015636_283_1380	357
567	3300048929	Ga0496126_0065144	Ga0496126_0065144_577_1686	357
568	3300049569	Ga0501032_0000407	Ga0501032_0000407_10606_11727	357
569	3300049569	Ga0501032_0044841	Ga0501032_0044841_82_1200	357
570	3300049571	Ga0501034_0000051	Ga0501034_0000051_192195_193316	357
571	3300049571	Ga0501034_0009471	Ga0501034_0009471_5579_6676	357
572	3300049571	Ga0501034_0470729	Ga0501034_0470729_42_1139	357
573	3300049574	Ga0501038_0031268	Ga0501038_0031268_2631_3728	357
574	3300049574	Ga0501038_0037307	Ga0501038_0037307_736_1833	357
575	3300049574	Ga0501038_0046616	Ga0501038_0046616_424_1545	357
576	3300049574	Ga0501038_0067627	Ga0501038_0067627_878_1987	357
577	3300049574	Ga0501038_0119097	Ga0501038_0119097_149_1267	357
578	3300049575	Ga0501039_0030904	Ga0501039_0030904_2511_3629	357
579	3300049575	Ga0501039_0036234	Ga0501039_0036234_224_1342	357
580	3300049575	Ga0501039_0110768	Ga0501039_0110768_659_1756	357
581	3300049579	Ga0501043_0056599	Ga0501043_0056599_1532_2653	357
582	3300049586	Ga0501070_0008918	Ga0501070_0008918_325_1422	357
583	3300050491	nmdc:mga00v17_203407_c1	nmdc:mga00v17_203407_c1_17_1114	357
584	3300050491	nmdc:mga00v17_23464_c1	nmdc:mga00v17_23464_c1_1389_2486	357
585	3300050491	nmdc:mga00v17_24870_c1	nmdc:mga00v17_24870_c1_525_1622	357
586	3300050492	nmdc:mga0yw44_98172_c1	nmdc:mga0yw44_98172_c1_729_1826	357
587	3300053139	Ga0500568_0000102	Ga0500568_0000102_26593_27699	357
588	3300053730	Ga0500645_028229	Ga0500645_028229_236_1402	357
589	3300059643	Ga0587072_003666	Ga0587072_003666_1027_2148	357
590	iso_pu_bacteria	2585428157	2588108991	357
591	iso_pu_bacteria	2643221542	2643733823	357
592	iso_pu_bacteria	2643221546	2643753387	357
593	iso_pu_bacteria	2643221566	2643848547	357
594	iso_pu_bacteria	2643221575	2643885246	357
595	iso_pu_bacteria	2643221630	2644170404	357
596	iso_pu_bacteria	2690315906	2691514598	357
597	iso_pu_bacteria	2773857759	2774384320	357
598	iso_pu_bacteria	2775506735	2775655066	357
599	iso_pu_bacteria	2808606306	2808631056	357
600	iso_pu_bacteria	2808606368	2808885767	357
601	iso_pu_bacteria	2811994871	2812320528	357
602	iso_pu_bacteria	2811994872	2812323360	357
603	iso_pu_bacteria	2844849076	2844849551	357
604	iso_pu_bacteria	2852646457	2852647431	357
605	iso_pu_bacteria	2852663356	2852665111	357
606	iso_pu_bacteria	2857479173	2857481086	357
607	iso_pu_bacteria	2857632687	2857634595	357
608	iso_pu_bacteria	2857720070	2857720168	357
609	iso_pu_bacteria	2857723135	2857723633	357
610	iso_pu_bacteria	2857727296	2857727665	357
611	iso_pu_bacteria	2857740372	2857741322	357
612	iso_pu_bacteria	2870628048	2870630499	357
613	iso_pu_bacteria	2870801768	2870802160	357
614	iso_pu_bacteria	2870804320	2870806534	357
615	iso_pu_bacteria	2904497146	2904499797	357
616	iso_pu_bacteria	2904509784	2904511848	357
617	iso_pu_bacteria	2904776348	2904776638	357
618	iso_pu_bacteria	2906799679	2906800554	357
619	iso_pu_bacteria	2908678064	2908680765	357
620	iso_pu_bacteria	2910809715	2910814190	357
621	iso_pu_bacteria	2919034639	2919036193	357
622	iso_pu_bacteria	2919059106	2919061693	357
623	iso_pu_bacteria	2919069694	2919071686	357
624	iso_pu_bacteria	2919391150	2919391450	357
625	iso_pu_bacteria	2919395869	2919396476	357
626	iso_pu_bacteria	2919538618	2919542170	357
627	iso_pu_bacteria	2928090899	2928092001	357
628	iso_pu_bacteria	2932426870	2932429241	357
629	iso_pu_bacteria	2933418574	2933420723	357
630	iso_pu_bacteria	2939647034	2939648859	357
631	iso_pu_bacteria	2939674588	2939676062	357
632	iso_pu_bacteria	2945916053	2945918288	357
633	iso_pu_bacteria	2945920336	2945921426	357
634	iso_pu_bacteria	2945941187	2945942391	357
635	iso_pu_bacteria	2945968032	2945971943	357
636	iso_pu_bacteria	2946033335	2946033940	357
637	iso_pu_bacteria	2946037020	2946038334	357
638	iso_pu_bacteria	2946041624	2946044026	357
639	iso_pu_bacteria	2946059875	2946062141	357
640	iso_pu_bacteria	2946080515	2946081103	357
641	iso_pu_bacteria	2953998280	2953999609	357
642	iso_pu_bacteria	2974294766	2974297311	357
643	iso_pu_bacteria	2974302888	2974306320	357
644	iso_pu_bacteria	2974324384	2974326450	357
645	iso_pu_bacteria	2977228692	2977231561	357
646	iso_pu_bacteria	2977236895	2977236915	357
647	iso_pu_bacteria	2977251589	2977254093	357
648	iso_pu_bacteria	2977264416	2977266787	357
649	iso_pu_bacteria	2984542743	2984545295	357
650	iso_pu_bacteria	2984580707	2984581232	357
651	iso_pu_bacteria	2995726249	2995727730	357
652	iso_pu_bacteria	8004182704	8004185304	357
653	iso_pu_bacteria	8016254467	8016257400	357
654	iso_pu_bacteria	8045830549	8045831731	357
655	iso_pu_bacteria	8054107350	8054111028	357
656	3300005548	Ga0070665_100051843	Ga0070665_1000518433	358
657	3300006058	Ga0075432_10000483	Ga0075432_100004837	358
658	3300013104	Ga0157370_10033683	Ga0157370_100336832	358
659	3300031548	Ga0307408_100011795	Ga0307408_1000117956	358
660	3300031548	Ga0307408_100030278	Ga0307408_1000302782	358
661	3300031649	Ga0307514_10006062	Ga0307514_100060627	358
662	3300031852	Ga0307410_10019750	Ga0307410_100197502	358
663	3300031852	Ga0307410_10041516	Ga0307410_100415162	358
664	3300031901	Ga0307406_10068620	Ga0307406_100686202	358
665	3300031903	Ga0307407_10050488	Ga0307407_100504882	358
666	3300031995	Ga0307409_100006720	Ga0307409_1000067202	358
667	3300032002	Ga0307416_100007638	Ga0307416_1000076386	358
668	3300032002	Ga0307416_100077765	Ga0307416_1000777652	358
669	3300032126	Ga0307415_100200500	Ga0307415_1002005002	358
670	3300042007	Ga0439449_0008787	Ga0439449_0008787_2032_3156	358
671	3300048907	Ga0496104_0016669	Ga0496104_0016669_3571_4671	358
672	3300048913	Ga0496110_0034418	Ga0496110_0034418_2984_4084	358
673	3300048918	Ga0496115_0033165	Ga0496115_0033165_1905_3005	358
674	3300048922	Ga0496119_0019704	Ga0496119_0019704_765_1907	358
675	3300048923	Ga0496120_0010133	Ga0496120_0010133_4850_5992	358
676	3300048925	Ga0496122_0000194	Ga0496122_0000194_80506_81648	358
677	3300048925	Ga0496122_0014104	Ga0496122_0014104_5707_6843	358
678	3300048926	Ga0496123_0000350	Ga0496123_0000350_80494_81636	358
679	3300048926	Ga0496123_0062673	Ga0496123_0062673_813_1949	358
680	3300048927	Ga0496124_0008895	Ga0496124_0008895_4449_5591	358
681	3300048928	Ga0496125_0017043	Ga0496125_0017043_2591_3748	358
682	3300049533	Ga0501317_004320	Ga0501317_004320_13_1149	358
683	3300053083	Ga0495655_0004033	Ga0495655_0004033_1126_2262	358
684	3300053136	Ga0500559_0000063	Ga0500559_0000063_81496_82602	358
685	3300053136	Ga0500559_0058052	Ga0500559_0058052_241_1356	358
686	3300053139	Ga0500568_0009694	Ga0500568_0009694_3041_4174	358
687	3300053140	Ga0500573_0004401	Ga0500573_0004401_5999_7120	358
688	3300053140	Ga0500573_0046834	Ga0500573_0046834_891_2024	358
689	iso_pu_bacteria	2554235227	2555231377	358
690	iso_pu_bacteria	2654587600	2655033041	358
691	iso_pu_bacteria	2808606700	2810364225	358
692	iso_pu_bacteria	2821268502	2821270143	358
693	iso_pu_bacteria	2833709550	2833711107	358
694	iso_pu_bacteria	2852643534	2852645945	358
695	iso_pu_bacteria	2857733635	2857733908	358
696	iso_pu_bacteria	2897561785	2897564414	358
697	iso_pu_bacteria	2905926851	2905927750	358
698	iso_pu_bacteria	2946003308	2946005363	358
699	iso_pu_bacteria	8004021418	8004023469	358
700	iso_pu_bacteria	8004025490	8004026448	358
701	3300005366	Ga0070659_100100044	Ga0070659_1001000442	359
702	3300013104	Ga0157370_10005788	Ga0157370_100057884	359
703	3300013105	Ga0157369_10002164	Ga0157369_1000216415	359
704	3300025904	Ga0207647_10083155	Ga0207647_100831551	359
705	3300025909	Ga0207705_10000213	Ga0207705_1000021314	359
706	3300026067	Ga0207678_10018717	Ga0207678_100187175	359
707	3300031649	Ga0307514_10002541	Ga0307514_1000254112	359
708	3300047320	Ga0495672_0056671	Ga0495672_0056671_893_2044	359
709	3300048921	Ga0496118_0131884	Ga0496118_0131884_443_1543	359
710	3300049586	Ga0501070_0006307	Ga0501070_0006307_3989_5095	359
711	3300049589	Ga0501073_0000223	Ga0501073_0000223_35280_36386	359
712	3300049742	Ga0501080_0134879	Ga0501080_0134879_899_2002	359
713	3300053093	Ga0500651_0000194	Ga0500651_0000194_29785_30930	359
714	3300053104	Ga0500556_0000001	Ga0500556_0000001_678897_679997	359
715	3300053108	Ga0500562_000397	Ga0500562_000397_4322_5452	359
716	3300053136	Ga0500559_0004023	Ga0500559_0004023_2213_3322	359
717	3300053136	Ga0500559_0010658	Ga0500559_0010658_1966_3075	359
718	3300053139	Ga0500568_0000006	Ga0500568_0000006_14924_16024	359
719	3300053155	Ga0500620_000233	Ga0500620_000233_6800_7939	359
720	iso_pu_bacteria	2857729791	2857730115	359
721	iso_pu_bacteria	2920879853	2920882269	359
722	iso_pu_bacteria	2928121344	2928123339	359
723	iso_pu_bacteria	8002811521	8002811783	359
724	iso_pu_bacteria	8056037122	8056038954	359
725	3300002067	JGI24735J21928_10007406	JGI24735J21928_100074061	360
726	3300002772	JGI25164J39214_1001093	JGI25164J39214_10010931	360
727	3300003214	JGI25165J46597_1000002	JGI25165J46597_1000002428	360
728	3300003578	Ga0006562J51391_1026734	Ga0006562J51391_10267343	360
729	3300003752	Ga0055539_1000058	Ga0055539_100005894	360
730	3300003756	Ga0055533_1000001	Ga0055533_1000001487	360
731	3300003759	Ga0055525_1000180	Ga0055525_100018020	360
732	3300003760	Ga0055527_1000012	Ga0055527_1000012301	360
733	3300003762	Ga0055542_1000017	Ga0055542_1000017301	360
734	3300003763	Ga0055529_1000023	Ga0055529_1000023268	360
735	3300003841	Ga0055541_1002122	Ga0055541_10021223	360
736	3300005327	Ga0070658_10053724	Ga0070658_100537243	360
737	3300005327	Ga0070658_10113879	Ga0070658_101138791	360
738	3300005338	Ga0068868_100016436	Ga0068868_1000164362	360
739	3300005344	Ga0070661_100083416	Ga0070661_1000834162	360
740	3300005355	Ga0070671_100110976	Ga0070671_1001109761	360
741	3300005366	Ga0070659_100000149	Ga0070659_10000014924	360
742	3300005456	Ga0070678_100153988	Ga0070678_1001539882	360
743	3300005466	Ga0070685_10051002	Ga0070685_100510023	360
744	3300005563	Ga0068855_100002405	Ga0068855_10000240523	360
745	3300005577	Ga0068857_100000219	Ga0068857_10000021936	360
746	3300005614	Ga0068856_100090806	Ga0068856_1000908063	360
747	3300005616	Ga0068852_100005903	Ga0068852_1000059034	360
748	3300005834	Ga0068851_10000014	Ga0068851_10000014145	360
749	3300005841	Ga0068863_100061381	Ga0068863_1000613813	360
750	3300005842	Ga0068858_100000893	Ga0068858_10000089315	360
751	3300006844	Ga0075428_100495747	Ga0075428_1004957471	360
752	3300009177	Ga0105248_10000681	Ga0105248_1000068133	360
753	3300009177	Ga0105248_10037378	Ga0105248_100373782	360
754	3300009545	Ga0105237_10000133	Ga0105237_10000133104	360
755	3300009551	Ga0105238_10003000	Ga0105238_100030004	360
756	3300010375	Ga0105239_10023056	Ga0105239_100230563	360
757	3300013105	Ga0157369_10164210	Ga0157369_101642102	360
758	3300014326	Ga0157380_10003034	Ga0157380_100030347	360
759	3300025225	Ga0209566_100026	Ga0209566_100026236	360
760	3300025226	Ga0209674_100001	Ga0209674_100001488	360
761	3300025228	Ga0209672_100003	Ga0209672_10000345	360
762	3300025229	Ga0209147_100309	Ga0209147_1003098	360
763	3300025230	Ga0209563_100001	Ga0209563_100001488	360
764	3300025230	Ga0209563_100320	Ga0209563_1003203	360
765	3300025231	Ga0207427_100089	Ga0207427_10008983	360
766	3300025253	Ga0209677_100001	Ga0209677_100001488	360
767	3300025254	Ga0209148_1000004	Ga0209148_1000004340	360
768	3300025254	Ga0209148_1001633	Ga0209148_10016335	360
769	3300025261	Ga0209233_1000001	Ga0209233_10000012378	360
770	3300025272	Ga0209455_1000022	Ga0209455_1000022644	360
771	3300025321	Ga0207656_10000002	Ga0207656_10000002410	360
772	3300025904	Ga0207647_10053726	Ga0207647_100537262	360
773	3300025911	Ga0207654_10000001	Ga0207654_100000011456	360
774	3300025913	Ga0207695_10002493	Ga0207695_1000249320	360
775	3300025914	Ga0207671_10000002	Ga0207671_10000002704	360
776	3300025914	Ga0207671_10119231	Ga0207671_101192312	360
777	3300025924	Ga0207694_10000115	Ga0207694_1000011514	360
778	3300025931	Ga0207644_10086396	Ga0207644_100863961	360
779	3300025932	Ga0207690_10001356	Ga0207690_1000135611	360
780	3300025941	Ga0207711_10008565	Ga0207711_100085654	360
781	3300025941	Ga0207711_10011662	Ga0207711_100116624	360
782	3300025949	Ga0207667_10000272	Ga0207667_1000027229	360
783	3300025949	Ga0207667_10006016	Ga0207667_100060165	360
784	3300026023	Ga0207677_10004632	Ga0207677_100046324	360
785	3300026035	Ga0207703_10000141	Ga0207703_1000014176	360
786	3300026041	Ga0207639_10016442	Ga0207639_100164425	360
787	3300026116	Ga0207674_10001774	Ga0207674_1000177418	360
788	3300026118	Ga0207675_100095368	Ga0207675_1000953682	360
789	3300026121	Ga0207683_10215523	Ga0207683_102155231	360
790	3300026142	Ga0207698_10000162	Ga0207698_1000016234	360
791	3300026142	Ga0207698_10013856	Ga0207698_100138563	360
792	3300028794	Ga0307515_10187584	Ga0307515_101875842	360
793	3300037466	Ga0395898_0000473	Ga0395898_0000473_33764_34846	360
794	3300044658	Ga0466972_0076858	Ga0466972_0076858_50_1150	360
795	3300044693	Ga0466961_0076601	Ga0466961_0076601_950_2032	360
796	3300044735	Ga0466968_0029774	Ga0466968_0029774_520_1620	360
797	3300044735	Ga0466968_0100089	Ga0466968_0100089_99_1181	360
798	3300044765	Ga0466970_0094156	Ga0466970_0094156_101_1210	360
799	3300044842	Ga0466957_0183506	Ga0466957_0183506_211_1293	360
800	3300045049	Ga0466959_0134577	Ga0466959_0134577_16_1098	360
801	3300046471	Ga0495650_0001013	Ga0495650_0001013_11527_12678	360
802	3300048905	Ga0496102_0034336	Ga0496102_0034336_2056_3138	360
803	3300048907	Ga0496104_0052147	Ga0496104_0052147_503_1585	360
804	3300048907	Ga0496104_0087946	Ga0496104_0087946_794_1894	360
805	3300048908	Ga0496105_0006436	Ga0496105_0006436_6851_7951	360
806	3300048908	Ga0496105_0044585	Ga0496105_0044585_586_1668	360
807	3300048908	Ga0496105_0171492	Ga0496105_0171492_421_1521	360
808	3300048917	Ga0496114_0008452	Ga0496114_0008452_3277_4359	360
809	3300048918	Ga0496115_0011477	Ga0496115_0011477_3766_4866	360
810	3300048918	Ga0496115_0023496	Ga0496115_0023496_3584_4666	360
811	3300048921	Ga0496118_0001720	Ga0496118_0001720_10555_11655	360
812	3300048922	Ga0496119_0019313	Ga0496119_0019313_3620_4702	360
813	3300048922	Ga0496119_0028178	Ga0496119_0028178_602_1867	360
814	3300048923	Ga0496120_0000426	Ga0496120_0000426_10629_11762	360
815	3300048923	Ga0496120_0004892	Ga0496120_0004892_1856_2977	360
816	3300048923	Ga0496120_0024234	Ga0496120_0024234_2092_3174	360
817	3300048923	Ga0496120_0032590	Ga0496120_0032590_1891_2997	360
818	3300048923	Ga0496120_0033662	Ga0496120_0033662_1779_2900	360
819	3300048923	Ga0496120_0085748	Ga0496120_0085748_132_1397	360
820	3300048927	Ga0496124_0004053	Ga0496124_0004053_6523_7629	360
821	3300048927	Ga0496124_0071353	Ga0496124_0071353_582_1688	360
822	3300048929	Ga0496126_0125426	Ga0496126_0125426_82_1164	360
823	3300049570	Ga0501033_0003000	Ga0501033_0003000_12238_13344	360
824	3300049570	Ga0501033_0026246	Ga0501033_0026246_651_1757	360
825	3300049570	Ga0501033_0234027	Ga0501033_0234027_34_1134	360
826	3300049571	Ga0501034_0123262	Ga0501034_0123262_1107_2213	360
827	3300049571	Ga0501034_0170959	Ga0501034_0170959_841_1947	360
828	3300049572	Ga0501036_0001633	Ga0501036_0001633_13813_14919	360
829	3300049573	Ga0501037_0002752	Ga0501037_0002752_2631_3755	360
830	3300049574	Ga0501038_0011688	Ga0501038_0011688_5463_6569	360
831	3300049575	Ga0501039_0036106	Ga0501039_0036106_2510_3616	360
832	3300049578	Ga0501042_0111215	Ga0501042_0111215_572_1678	360
833	3300049579	Ga0501043_0059257	Ga0501043_0059257_89_1195	360
834	3300049579	Ga0501043_0166676	Ga0501043_0166676_93_1193	360
835	3300049580	Ga0501046_0010495	Ga0501046_0010495_4880_5986	360
836	3300049580	Ga0501046_0013854	Ga0501046_0013854_2854_3954	360
837	3300049581	Ga0501047_0042644	Ga0501047_0042644_832_1938	360
838	3300049581	Ga0501047_0073102	Ga0501047_0073102_961_2061	360
839	3300049581	Ga0501047_0103344	Ga0501047_0103344_1093_2199	360
840	3300049582	Ga0501048_0008296	Ga0501048_0008296_4693_5799	360
841	3300049586	Ga0501070_0000100	Ga0501070_0000100_34933_36018	360
842	3300049586	Ga0501070_0122487	Ga0501070_0122487_71_1177	360
843	3300049744	Ga0501083_0000031	Ga0501083_0000031_11034_12140	360
844	3300049744	Ga0501083_0016779	Ga0501083_0016779_3745_4857	360
845	3300049822	Ga0501035_0020033	Ga0501035_0020033_631_1737	360
846	3300049823	Ga0501044_0001905	Ga0501044_0001905_20535_21659	360
847	3300049823	Ga0501044_0015200	Ga0501044_0015200_923_2023	360
848	3300049823	Ga0501044_0197739	Ga0501044_0197739_154_1260	360
849	3300049823	Ga0501044_0200763	Ga0501044_0200763_134_1240	360
850	3300053080	Ga0500635_0027739	Ga0500635_0027739_46_1137	360
851	3300053098	Ga0500650_0000328	Ga0500650_0000328_8264_9382	360
852	3300053104	Ga0500556_0000086	Ga0500556_0000086_38021_39127	360
853	3300053117	Ga0500593_005225	Ga0500593_005225_160_1266	360
854	3300053133	Ga0500655_002645	Ga0500655_002645_2117_3223	360
855	3300053140	Ga0500573_0037680	Ga0500573_0037680_962_2080	360
856	3300053142	Ga0500577_0076724	Ga0500577_0076724_101_1219	360
857	3300053148	Ga0500590_032099	Ga0500590_032099_31_1146	360
858	iso_pu_bacteria	2585428094	2587863330	360
859	iso_pu_bacteria	2643221616	2644095777	360
860	iso_pu_bacteria	2643221649	2644277073	360
861	iso_pu_bacteria	2844841374	2844842150	360
862	iso_pu_bacteria	2857737099	2857737832	360
863	iso_pu_bacteria	2862993130	2862995059	360
864	iso_pu_bacteria	2870622029	2870624200	360
865	iso_pu_bacteria	2884763398	2884765140	360
866	iso_pu_bacteria	2904430863	2904430910	360
867	iso_pu_bacteria	2904501621	2904503569	360
868	iso_pu_bacteria	2908674828	2908675216	360
869	iso_pu_bacteria	2909074476	2909075467	360
870	iso_pu_bacteria	2919039151	2919039895	360
871	iso_pu_bacteria	2919042368	2919045157	360
872	iso_pu_bacteria	2919055335	2919057796	360
873	iso_pu_bacteria	2919443155	2919446458	360
874	iso_pu_bacteria	2919523602	2919524197	360
875	iso_pu_bacteria	2928104781	2928108413	360
876	iso_pu_bacteria	2928153084	2928155635	360
877	iso_pu_bacteria	2928500415	2928501237	360
878	iso_pu_bacteria	2939657138	2939658677	360
879	iso_pu_bacteria	2939660829	2939662632	360
880	iso_pu_bacteria	2966924647	2966925815	360
881	iso_pu_bacteria	2984551494	2984553358	360
882	iso_pu_bacteria	8046352972	8046353103	360
883	iso_pu_bacteria	8057345674	8057347864	360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03054

tRNA_Me_trans

tRNA methyl transferase HUP domain

54

256

0.98 PF20259

tRNA_Me_trans_M

tRNA methyl transferase PRC-barrel domain

260

327

0.96 PF20258

tRNA_Me_trans_C

Aminomethyltransferase beta-barrel domain

333

410

0.93 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2hma-assembly1.cif.gz_A-2	the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae	0.8821	1	359
2der-assembly1.cif.gz_A	cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state	0.8745	1	360
2der-assembly1.cif.gz_A	cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state	0.8558	1	360
2hma-assembly1.cif.gz_A-2	the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae	0.8523	1	359
2deu-assembly2.cif.gz_B	cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state	0.8477	1	360

ID	Description	Score	Start	End	Superfamily
af_P9WJS5_208_272_2.30.30.280	Mainly Beta;Roll;SH3 type barrels.;Adenine nucleotide alpha hydrolases-like domains	0.9453	210	269	2.30.30.280
af_O13947_324_410_2.40.30.10	Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors	0.9412	272	355	2.40.30.10
af_P9WJS5_1_205_3.40.50.620	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.9382	1	204	3.40.50.620
2derA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs	0.9212	1	182	3.40.50.620
af_O75648_300_387_2.40.30.10	Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors	0.9137	272	355	2.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-I0R128-F1-model_v4	tRNA-uridine 2-sulfurtransferase (EC 2.8.1.13)	0.9735	49	358	GO:0000049 GO:0002143 GO:0005524 GO:0103016
AF-A0A4R9AZP6-F1-model_v4	tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13)	0.9654	1	360	GO:0000049 GO:0002143 GO:0005524 GO:0005737 GO:0103016
AF-A0A4R9AZP6-F1-model_v4	tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13)	0.9628	1	360	GO:0000049 GO:0002143 GO:0005524 GO:0005737 GO:0103016
AF-J7LWG0-F1-model_v4	deleted	0.9605	1	354
AF-I0R128-F1-model_v4	tRNA-uridine 2-sulfurtransferase (EC 2.8.1.13)	0.9583	49	358	GO:0000049 GO:0002143 GO:0005524 GO:0103016

Feature Viewer

pLDDT	pTM	Quality
90.73	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F484604

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03054

tRNA_Me_trans

tRNA methyl transferase HUP domain

54

256

0.98

PF20259

tRNA_Me_trans_M

tRNA methyl transferase PRC-barrel domain

260

327

0.96

PF20258

tRNA_Me_trans_C

Aminomethyltransferase beta-barrel domain

333

410

0.93

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map