F484571
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 883 | 430 | 797 | 540 |
Family's Representative Sequence
| Representative Sequence | 3300001979|JGI24740J21852_10006521|JGI24740J21852_100065211 |
| Length | 567 |
| Sequence | MLVSRLAIRTRRARTVHPTIEESCTMDAVTAVPTPANEPVKGYAPGSGERASLEAKLKELTAAGAIDLTCTIGGEQKLGGGAPIEVVQPHRHAHVLGTLGNATEADGKAAVNAALAAAPSWRSLSFDDRAAIFLKAADLLAGPWRDTLNAATMLGQSKTIQQAEIDAACELIDFLRFNVAFARQIVSDQPISSPGVWNRVDYRPLEGFVYAITPFNFTAIAGNLPTAPALMGNTVVWKPSPTQQFAAHWTMRLFEAAGLPAGVINLVTGDGIDVSKAALTHPDLAGIHFTGSTKTFQSLWGAVGANIASYKTYPRLVGETGGKDFILAHPSADPAVLKTAMVRGAFEYQGQKCSAASRAYVARSVWDRIRDDLVAETEAITMGDVTDLSNFIGAVIDDRAFAKHKAALDRAAATDAIQVVAGGTYDDSEGYFVRPTLLVSDDPADEIFSTEYFGPILGVHVYDDADYDSVLKGMEHSAPYGLTGAVIAQDRHAVAAASEYLRFAAGNFYINDKPTGAVVGQQPFGGARASGTNDKAGSMWNLIRWASPRSMKETFAPPTDYRYPHQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 4 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 5 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 6 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 7 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 8 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 9 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 10 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 11 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 12 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 13 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 14 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 15 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 16 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 17 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 18 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 19 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 20 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 21 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 22 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 23 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 24 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 25 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 26 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 27 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 28 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 29 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 30 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 31 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 32 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 33 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 34 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 35 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 36 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 37 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 38 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 39 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 40 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 41 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 42 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 43 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 44 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 45 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 46 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 47 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 48 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 49 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 50 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 51 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 52 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 53 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 54 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 55 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 56 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 57 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 58 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 59 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 60 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 61 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 62 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 63 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 64 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 65 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 66 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 67 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 68 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 69 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 70 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 71 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 77 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 80 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 82 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 109 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 111 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 112 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 113 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 116 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 117 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 118 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 119 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 120 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 126 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 127 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 128 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 129 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 131 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 132 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 135 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 136 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 137 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 138 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 139 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 140 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 141 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 142 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 143 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 145 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 160 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 177 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 178 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 180 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 241 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 243 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 244 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 245 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 246 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 247 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 248 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 254 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 256 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 257 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 258 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 260 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 261 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 262 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 265 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 266 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 267 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 268 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 269 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 270 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 271 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 275 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 276 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 286 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 287 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 293 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 294 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 295 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 296 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 297 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 298 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 299 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 300 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 301 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 302 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 303 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 304 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 307 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 308 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 309 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 310 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 311 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 312 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 313 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 314 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 363 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 364 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 365 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 366 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 367 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 368 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 371 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 372 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 373 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 374 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 375 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 376 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 377 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 378 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 379 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 380 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 381 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 382 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 383 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 408 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 411 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 412 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 413 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 414 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 415 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 416 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 417 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 418 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 419 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 420 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 421 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 422 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 423 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 424 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 425 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 426 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 427 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 428 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 429 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 430 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.24 |
| Metatranscriptomes | 1.02 |
| Isolates | 9.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.59 |
| Nodule | 0.79 |
| Rhizoplane | 5.21 |
| Rhizosphere | 82.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10006521 | 3300001979 | Bacteria | 4822 |
| 2 | JGI24739J22299_10010192 | 3300001989 | Bacteria | 3491 |
| 3 | JGI25406J46586_10003320 | 3300003203 | Bacteria | 7575 |
| 4 | JGI25404J52841_10001280 | 3300003659 | Bacteria | 4366 |
| 5 | Ga0070658_10006030 | 3300005327 | Bacteria | 9834 |
| 6 | Ga0070658_10016387 | 3300005327 | Bacteria | 5929 |
| 7 | Ga0070658_10028400 | 3300005327 | Bacteria | 4490 |
| 8 | Ga0070658_10061570 | 3300005327 | Bacteria | 3058 |
| 9 | Ga0070683_100000236 | 3300005329 | Bacteria | 37800 |
| 10 | Ga0070683_100063537 | 3300005329 | Bacteria | 3434 |
| 11 | Ga0070683_100079203 | 3300005329 | Bacteria | 3075 |
| 12 | Ga0070690_100046565 | 3300005330 | Bacteria | 2757 |
| 13 | Ga0068869_100003606 | 3300005334 | Bacteria | 9499 |
| 14 | Ga0068869_100015454 | 3300005334 | Bacteria | 5121 |
| 15 | Ga0068869_100020213 | 3300005334 | Bacteria | 4563 |
| 16 | Ga0068869_100040886 | 3300005334 | Bacteria | 3317 |
| 17 | Ga0070680_100009200 | 3300005336 | Bacteria | 7577 |
| 18 | Ga0070680_100023060 | 3300005336 | Bacteria | 4961 |
| 19 | Ga0070680_100074535 | 3300005336 | Bacteria | 2793 |
| 20 | Ga0070680_100119905 | 3300005336 | Bacteria | 2195 |
| 21 | Ga0070682_100021149 | 3300005337 | Bacteria | 3834 |
| 22 | Ga0070682_100082961 | 3300005337 | Bacteria | 2079 |
| 23 | Ga0068868_100004884 | 3300005338 | Bacteria | 9410 |
| 24 | Ga0068868_100010826 | 3300005338 | Bacteria | 6617 |
| 25 | Ga0068868_100050355 | 3300005338 | Bacteria | 3270 |
| 26 | Ga0068868_100117720 | 3300005338 | Bacteria | 2164 |
| 27 | Ga0070660_100045836 | 3300005339 | Bacteria | 3349 |
| 28 | Ga0070689_100098133 | 3300005340 | Bacteria | 2317 |
| 29 | Ga0070692_10015787 | 3300005345 | Bacteria | 3579 |
| 30 | Ga0070692_10031558 | 3300005345 | Bacteria | 2657 |
| 31 | Ga0070668_100169871 | 3300005347 | Bacteria | 1775 |
| 32 | Ga0070675_100000474 | 3300005354 | Bacteria | 27485 |
| 33 | Ga0070675_100017552 | 3300005354 | Bacteria | 5688 |
| 34 | Ga0070671_100010047 | 3300005355 | Bacteria | 7602 |
| 35 | Ga0070674_100034076 | 3300005356 | Bacteria | 3397 |
| 36 | Ga0070674_100063498 | 3300005356 | Bacteria | 2585 |
| 37 | Ga0070659_100000157 | 3300005366 | Bacteria | 52408 |
| 38 | Ga0070659_100021357 | 3300005366 | Bacteria | 4930 |
| 39 | Ga0070659_100023208 | 3300005366 | Bacteria | 4745 |
| 40 | Ga0070659_100074678 | 3300005366 | Bacteria | 2701 |
| 41 | Ga0070667_100000109 | 3300005367 | Bacteria | 105260 |
| 42 | Ga0070667_100060409 | 3300005367 | Bacteria | 3207 |
| 43 | Ga0070703_10017981 | 3300005406 | Bacteria | 2040 |
| 44 | Ga0070714_100000748 | 3300005435 | Bacteria | 23002 |
| 45 | Ga0070714_100007010 | 3300005435 | Bacteria | 8738 |
| 46 | Ga0070714_100064771 | 3300005435 | Bacteria | 3147 |
| 47 | Ga0070710_10000038 | 3300005437 | Bacteria | 60347 |
| 48 | Ga0070710_10043749 | 3300005437 | Bacteria | 2482 |
| 49 | Ga0070711_100029451 | 3300005439 | Bacteria | 3623 |
| 50 | Ga0070700_100009712 | 3300005441 | Bacteria | 5287 |
| 51 | Ga0070700_100021673 | 3300005441 | Bacteria | 3738 |
| 52 | Ga0070708_100001458 | 3300005445 | Bacteria | 18061 |
| 53 | Ga0070663_100005762 | 3300005455 | Bacteria | 7390 |
| 54 | Ga0070663_100012822 | 3300005455 | Bacteria | 5318 |
| 55 | Ga0070663_100035486 | 3300005455 | Bacteria | 3461 |
| 56 | Ga0070678_100035483 | 3300005456 | Bacteria | 3482 |
| 57 | Ga0070681_10000017 | 3300005458 | Bacteria | 125537 |
| 58 | Ga0070681_10012788 | 3300005458 | Bacteria | 8331 |
| 59 | Ga0070681_10022796 | 3300005458 | Bacteria | 6293 |
| 60 | Ga0070681_10075668 | 3300005458 | Bacteria | 3326 |
| 61 | Ga0070681_10183072 | 3300005458 | Bacteria | 2016 |
| 62 | Ga0070706_100000040 | 3300005467 | Bacteria | 149660 |
| 63 | Ga0070706_100003339 | 3300005467 | Bacteria | 15831 |
| 64 | Ga0070706_100005462 | 3300005467 | Bacteria | 12106 |
| 65 | Ga0070706_100016803 | 3300005467 | Bacteria | 6760 |
| 66 | Ga0070706_100039173 | 3300005467 | Bacteria | 4375 |
| 67 | Ga0070706_100085797 | 3300005467 | Bacteria | 2917 |
| 68 | Ga0070707_100005483 | 3300005468 | Bacteria | 11863 |
| 69 | Ga0070707_100007802 | 3300005468 | Bacteria | 9941 |
| 70 | Ga0070707_100017512 | 3300005468 | Bacteria | 6738 |
| 71 | Ga0070707_100025820 | 3300005468 | Bacteria | 5576 |
| 72 | Ga0070707_100155008 | 3300005468 | Bacteria | 2231 |
| 73 | Ga0070698_100000882 | 3300005471 | Bacteria | 32972 |
| 74 | Ga0070698_100000926 | 3300005471 | Bacteria | 32043 |
| 75 | Ga0070698_100003756 | 3300005471 | Bacteria | 16696 |
| 76 | Ga0070698_100157754 | 3300005471 | Bacteria | 2214 |
| 77 | Ga0070679_100000009 | 3300005530 | Bacteria | 191579 |
| 78 | Ga0070679_100022803 | 3300005530 | Bacteria | 6122 |
| 79 | Ga0070679_100055772 | 3300005530 | Bacteria | 3936 |
| 80 | Ga0070679_100142805 | 3300005530 | Bacteria | 2373 |
| 81 | Ga0070679_100182353 | 3300005530 | Bacteria | 2071 |
| 82 | Ga0070684_100011504 | 3300005535 | Bacteria | 7047 |
| 83 | Ga0070684_100014776 | 3300005535 | Bacteria | 6335 |
| 84 | Ga0070697_100004326 | 3300005536 | Bacteria | 10897 |
| 85 | Ga0070672_100069484 | 3300005543 | Bacteria | 2796 |
| 86 | Ga0070686_100030018 | 3300005544 | Bacteria | 3313 |
| 87 | Ga0070693_100000306 | 3300005547 | Bacteria | 22765 |
| 88 | Ga0070693_100018379 | 3300005547 | Bacteria | 3650 |
| 89 | Ga0070693_100067367 | 3300005547 | Bacteria | 2098 |
| 90 | Ga0070665_100009637 | 3300005548 | Bacteria | 9766 |
| 91 | Ga0070665_100010761 | 3300005548 | Bacteria | 9256 |
| 92 | Ga0070665_100036664 | 3300005548 | Bacteria | 4931 |
| 93 | Ga0068855_100006327 | 3300005563 | Bacteria | 14432 |
| 94 | Ga0068855_100008986 | 3300005563 | Bacteria | 12071 |
| 95 | Ga0068855_100032330 | 3300005563 | Bacteria | 6248 |
| 96 | Ga0070664_100002642 | 3300005564 | Bacteria | 14460 |
| 97 | Ga0070664_100022108 | 3300005564 | Bacteria | 5245 |
| 98 | Ga0068857_100020839 | 3300005577 | Bacteria | 5766 |
| 99 | Ga0068857_100195580 | 3300005577 | Bacteria | 1842 |
| 100 | Ga0068854_100010227 | 3300005578 | Bacteria | 6079 |
| 101 | Ga0068856_100056201 | 3300005614 | Bacteria | 3883 |
| 102 | Ga0070702_100000311 | 3300005615 | Bacteria | 16805 |
| 103 | Ga0068852_100001272 | 3300005616 | Bacteria | 16837 |
| 104 | Ga0068852_100020490 | 3300005616 | Bacteria | 5260 |
| 105 | Ga0068859_100003399 | 3300005617 | Bacteria | 16192 |
| 106 | Ga0068859_100090513 | 3300005617 | Bacteria | 3111 |
| 107 | Ga0068864_100005592 | 3300005618 | Bacteria | 10308 |
| 108 | Ga0068864_100020948 | 3300005618 | Bacteria | 5474 |
| 109 | Ga0068864_100120732 | 3300005618 | Bacteria | 2343 |
| 110 | Ga0068864_100158555 | 3300005618 | Bacteria | 2056 |
| 111 | Ga0068866_10018583 | 3300005718 | Bacteria | 3147 |
| 112 | Ga0068861_100051607 | 3300005719 | Bacteria | 3123 |
| 113 | Ga0068861_100150778 | 3300005719 | Bacteria | 1907 |
| 114 | Ga0068851_10007201 | 3300005834 | Bacteria | 5098 |
| 115 | Ga0068870_10012656 | 3300005840 | Bacteria | 3947 |
| 116 | Ga0068863_100000123 | 3300005841 | Bacteria | 80999 |
| 117 | Ga0068863_100003223 | 3300005841 | Bacteria | 16160 |
| 118 | Ga0068863_100006850 | 3300005841 | Bacteria | 11173 |
| 119 | Ga0068863_100069921 | 3300005841 | Bacteria | 3319 |
| 120 | Ga0068863_100073859 | 3300005841 | Bacteria | 3226 |
| 121 | Ga0068858_100003925 | 3300005842 | Bacteria | 14688 |
| 122 | Ga0068858_100007354 | 3300005842 | Bacteria | 10657 |
| 123 | Ga0068858_100028675 | 3300005842 | Bacteria | 5169 |
| 124 | Ga0068858_100052493 | 3300005842 | Bacteria | 3772 |
| 125 | Ga0068860_100000175 | 3300005843 | Bacteria | 105260 |
| 126 | Ga0068860_100008669 | 3300005843 | Bacteria | 10129 |
| 127 | Ga0068860_100074495 | 3300005843 | Bacteria | 3228 |
| 128 | Ga0068862_100000091 | 3300005844 | Bacteria | 107015 |
| 129 | Ga0081455_10000852 | 3300005937 | Bacteria | 39298 |
| 130 | Ga0081455_10002204 | 3300005937 | Bacteria | 23198 |
| 131 | Ga0081455_10004392 | 3300005937 | Bacteria | 15866 |
| 132 | Ga0081455_10030104 | 3300005937 | Bacteria | 4938 |
| 133 | Ga0081455_10048327 | 3300005937 | Bacteria | 3677 |
| 134 | Ga0081455_10059855 | 3300005937 | Bacteria | 3214 |
| 135 | Ga0081455_10070056 | 3300005937 | Bacteria | 2913 |
| 136 | Ga0081455_10078910 | 3300005937 | Bacteria | 2705 |
| 137 | Ga0081455_10081204 | 3300005937 | Bacteria | 2656 |
| 138 | Ga0081538_10000072 | 3300005981 | Bacteria | 95247 |
| 139 | Ga0081538_10000147 | 3300005981 | Bacteria | 73397 |
| 140 | Ga0081538_10002418 | 3300005981 | Bacteria | 18302 |
| 141 | Ga0081538_10021992 | 3300005981 | Bacteria | 4634 |
| 142 | Ga0081540_1000299 | 3300005983 | Bacteria | 51428 |
| 143 | Ga0081540_1009660 | 3300005983 | Bacteria | 6630 |
| 144 | Ga0081540_1015600 | 3300005983 | Bacteria | 4802 |
| 145 | Ga0081539_10000111 | 3300005985 | Bacteria | 190245 |
| 146 | Ga0081539_10001764 | 3300005985 | Bacteria | 34465 |
| 147 | Ga0081539_10002494 | 3300005985 | Bacteria | 25836 |
| 148 | Ga0081539_10002579 | 3300005985 | Bacteria | 25009 |
| 149 | Ga0081539_10010149 | 3300005985 | Bacteria | 7720 |
| 150 | Ga0070717_10000229 | 3300006028 | Bacteria | 38720 |
| 151 | Ga0070717_10029695 | 3300006028 | Bacteria | 4389 |
| 152 | Ga0070717_10080161 | 3300006028 | Bacteria | 2738 |
| 153 | Ga0075365_10061294 | 3300006038 | Bacteria | 2512 |
| 154 | Ga0075432_10000174 | 3300006058 | Bacteria | 16071 |
| 155 | Ga0075432_10000252 | 3300006058 | Bacteria | 14581 |
| 156 | Ga0070716_100024720 | 3300006173 | Bacteria | 3199 |
| 157 | Ga0097621_100036803 | 3300006237 | Bacteria | 3917 |
| 158 | Ga0068871_100036569 | 3300006358 | Bacteria | 3911 |
| 159 | Ga0075428_100003332 | 3300006844 | Bacteria | 17575 |
| 160 | Ga0075428_100012968 | 3300006844 | Bacteria | 9268 |
| 161 | Ga0075428_100025098 | 3300006844 | Bacteria | 6594 |
| 162 | Ga0075428_100029471 | 3300006844 | Bacteria | 6073 |
| 163 | Ga0075428_100033371 | 3300006844 | Bacteria | 5684 |
| 164 | Ga0075428_100067164 | 3300006844 | Bacteria | 3926 |
| 165 | Ga0075428_100099808 | 3300006844 | Bacteria | 3165 |
| 166 | Ga0075428_100117637 | 3300006844 | Bacteria | 2895 |
| 167 | Ga0075430_100000718 | 3300006846 | Bacteria | 25302 |
| 168 | Ga0075430_100010462 | 3300006846 | Bacteria | 7855 |
| 169 | Ga0075431_100000952 | 3300006847 | Bacteria | 25594 |
| 170 | Ga0075431_100001854 | 3300006847 | Bacteria | 20025 |
| 171 | Ga0075431_100006192 | 3300006847 | Bacteria | 11876 |
| 172 | Ga0075431_100079027 | 3300006847 | Bacteria | 3396 |
| 173 | Ga0075433_10130506 | 3300006852 | Bacteria | 2232 |
| 174 | Ga0075434_100001116 | 3300006871 | Bacteria | 22050 |
| 175 | Ga0075434_100005314 | 3300006871 | Bacteria | 11712 |
| 176 | Ga0075434_100010717 | 3300006871 | Bacteria | 8608 |
| 177 | Ga0075434_100015391 | 3300006871 | Bacteria | 7330 |
| 178 | Ga0075434_100179563 | 3300006871 | Bacteria | 2137 |
| 179 | Ga0075429_100010863 | 3300006880 | Bacteria | 7874 |
| 180 | Ga0075429_100012176 | 3300006880 | Bacteria | 7457 |
| 181 | Ga0068865_100111050 | 3300006881 | Bacteria | 2023 |
| 182 | Ga0075436_100000994 | 3300006914 | Bacteria | 19032 |
| 183 | Ga0075436_100002418 | 3300006914 | Bacteria | 12868 |
| 184 | Ga0075436_100024658 | 3300006914 | Bacteria | 4136 |
| 185 | Ga0097620_100003399 | 3300006931 | Bacteria | 16192 |
| 186 | Ga0097620_100090512 | 3300006931 | Bacteria | 3111 |
| 187 | Ga0075435_100000791 | 3300007076 | Bacteria | 19662 |
| 188 | Ga0075435_100003771 | 3300007076 | Bacteria | 10333 |
| 189 | Ga0075435_100007304 | 3300007076 | Bacteria | 7867 |
| 190 | Ga0105251_10010563 | 3300009011 | Bacteria | 5347 |
| 191 | Ga0105240_10015717 | 3300009093 | Bacteria | 10272 |
| 192 | Ga0111539_10000480 | 3300009094 | Bacteria | 50456 |
| 193 | Ga0111539_10001534 | 3300009094 | Bacteria | 30747 |
| 194 | Ga0111539_10013207 | 3300009094 | Bacteria | 10325 |
| 195 | Ga0111539_10014298 | 3300009094 | Bacteria | 9913 |
| 196 | Ga0111539_10159356 | 3300009094 | Bacteria | 2640 |
| 197 | Ga0111539_10209500 | 3300009094 | Bacteria | 2271 |
| 198 | Ga0105245_10014154 | 3300009098 | Bacteria | 6953 |
| 199 | Ga0105245_10030380 | 3300009098 | Bacteria | 4777 |
| 200 | Ga0105245_10050453 | 3300009098 | Bacteria | 3729 |
| 201 | Ga0105245_10083181 | 3300009098 | Bacteria | 2930 |
| 202 | Ga0105245_10117054 | 3300009098 | Bacteria | 2485 |
| 203 | Ga0105247_10000070 | 3300009101 | Bacteria | 115098 |
| 204 | Ga0105247_10044249 | 3300009101 | Bacteria | 2730 |
| 205 | Ga0114129_10000074 | 3300009147 | Bacteria | 92340 |
| 206 | Ga0114129_10000812 | 3300009147 | Bacteria | 40197 |
| 207 | Ga0114129_10000860 | 3300009147 | Bacteria | 39443 |
| 208 | Ga0114129_10036542 | 3300009147 | Bacteria | 6935 |
| 209 | Ga0114129_10045654 | 3300009147 | Bacteria | 6158 |
| 210 | Ga0114129_10078900 | 3300009147 | Bacteria | 4579 |
| 211 | Ga0114129_10210742 | 3300009147 | Bacteria | 2627 |
| 212 | Ga0105243_10004905 | 3300009148 | Bacteria | 10490 |
| 213 | Ga0105243_10107299 | 3300009148 | Bacteria | 2329 |
| 214 | Ga0105241_10007577 | 3300009174 | Bacteria | 7980 |
| 215 | Ga0105248_10000331 | 3300009177 | Bacteria | 55929 |
| 216 | Ga0105248_10011203 | 3300009177 | Bacteria | 9890 |
| 217 | Ga0105248_10030258 | 3300009177 | Bacteria | 6045 |
| 218 | Ga0105248_10040543 | 3300009177 | Bacteria | 5220 |
| 219 | Ga0105237_10006790 | 3300009545 | Bacteria | 12621 |
| 220 | Ga0105238_10046069 | 3300009551 | Bacteria | 4403 |
| 221 | Ga0105249_10009464 | 3300009553 | Bacteria | 8532 |
| 222 | Ga0105239_10026716 | 3300010375 | Bacteria | 6354 |
| 223 | Ga0105239_10195041 | 3300010375 | Bacteria | 2268 |
| 224 | Ga0105246_10000477 | 3300011119 | Bacteria | 21587 |
| 225 | Ga0105246_10041874 | 3300011119 | Bacteria | 3098 |
| 226 | Ga0157342_1001244 | 3300012507 | Bacteria | 1833 |
| 227 | Ga0157373_10017538 | 3300013100 | Bacteria | 5214 |
| 228 | Ga0157373_10066593 | 3300013100 | Bacteria | 2548 |
| 229 | Ga0157370_10001921 | 3300013104 | Bacteria | 25558 |
| 230 | Ga0157369_10003572 | 3300013105 | Bacteria | 18478 |
| 231 | Ga0157369_10004005 | 3300013105 | Bacteria | 17476 |
| 232 | Ga0157369_10006696 | 3300013105 | Bacteria | 13309 |
| 233 | Ga0157369_10010650 | 3300013105 | Bacteria | 10468 |
| 234 | Ga0157378_10044901 | 3300013297 | Bacteria | 3925 |
| 235 | Ga0163162_10045520 | 3300013306 | Bacteria | 4396 |
| 236 | Ga0157372_10000031 | 3300013307 | Bacteria | 178827 |
| 237 | Ga0157372_10070789 | 3300013307 | Bacteria | 3925 |
| 238 | Ga0157372_10135749 | 3300013307 | Bacteria | 2833 |
| 239 | Ga0157372_10146315 | 3300013307 | Bacteria | 2725 |
| 240 | Ga0157375_10018586 | 3300013308 | Bacteria | 6305 |
| 241 | Ga0157375_10050697 | 3300013308 | Bacteria | 4072 |
| 242 | Ga0157375_10057277 | 3300013308 | Bacteria | 3851 |
| 243 | Ga0163163_10022605 | 3300014325 | Bacteria | 5960 |
| 244 | Ga0163163_10057192 | 3300014325 | Bacteria | 3855 |
| 245 | Ga0157377_10005188 | 3300014745 | Bacteria | 6093 |
| 246 | Ga0157377_10045163 | 3300014745 | Bacteria | 2460 |
| 247 | Ga0157379_10028196 | 3300014968 | Bacteria | 4998 |
| 248 | Ga0163161_10008009 | 3300017792 | Bacteria | 7308 |
| 249 | Ga0197907_10475933 | 3300020069 | Bacteria | 3081 |
| 250 | Ga0206356_10233614 | 3300020070 | Bacteria | 2392 |
| 251 | Ga0206356_11006926 | 3300020070 | Bacteria | 3105 |
| 252 | Ga0206352_10520446 | 3300020078 | Bacteria | 2048 |
| 253 | Ga0206350_10547176 | 3300020080 | Bacteria | 2285 |
| 254 | Ga0206353_10598622 | 3300020082 | Bacteria | 3375 |
| 255 | Ga0213876_10007156 | 3300021384 | Bacteria | 6082 |
| 256 | Ga0213875_10001853 | 3300021388 | Bacteria | 13141 |
| 257 | Ga0213875_10012012 | 3300021388 | Bacteria | 4290 |
| 258 | Ga0213875_10013610 | 3300021388 | Bacteria | 3987 |
| 259 | Ga0224712_10001181 | 3300022467 | Bacteria | 5856 |
| 260 | Ga0224712_10001326 | 3300022467 | Bacteria | 5638 |
| 261 | Ga0224712_10017876 | 3300022467 | Bacteria | 2359 |
| 262 | Ga0224572_1001334 | 3300024225 | Bacteria | 3596 |
| 263 | Ga0209673_1019981 | 3300025273 | Bacteria | 2388 |
| 264 | Ga0209051_1000582 | 3300025303 | Bacteria | 43455 |
| 265 | Ga0209051_1003521 | 3300025303 | Bacteria | 10221 |
| 266 | Ga0209051_1006409 | 3300025303 | Bacteria | 6633 |
| 267 | Ga0207656_10008362 | 3300025321 | Bacteria | 3805 |
| 268 | Ga0207653_10003687 | 3300025885 | Bacteria | 4816 |
| 269 | Ga0207692_10017135 | 3300025898 | Bacteria | 3224 |
| 270 | Ga0207692_10033123 | 3300025898 | Bacteria | 2489 |
| 271 | Ga0207642_10018397 | 3300025899 | Bacteria | 2680 |
| 272 | Ga0207710_10000010 | 3300025900 | Bacteria | 482087 |
| 273 | Ga0207688_10002120 | 3300025901 | Bacteria | 10657 |
| 274 | Ga0207688_10005833 | 3300025901 | Bacteria | 6702 |
| 275 | Ga0207685_10029334 | 3300025905 | Bacteria | 1947 |
| 276 | Ga0207699_10013452 | 3300025906 | Bacteria | 4189 |
| 277 | Ga0207699_10018875 | 3300025906 | Bacteria | 3663 |
| 278 | Ga0207699_10027577 | 3300025906 | Bacteria | 3146 |
| 279 | Ga0207643_10001058 | 3300025908 | Bacteria | 16263 |
| 280 | Ga0207705_10003565 | 3300025909 | Bacteria | 11852 |
| 281 | Ga0207705_10009940 | 3300025909 | Bacteria | 6927 |
| 282 | Ga0207684_10000012 | 3300025910 | Bacteria | 478666 |
| 283 | Ga0207684_10013409 | 3300025910 | Bacteria | 7092 |
| 284 | Ga0207684_10014711 | 3300025910 | Bacteria | 6740 |
| 285 | Ga0207684_10032957 | 3300025910 | Bacteria | 4406 |
| 286 | Ga0207707_10000227 | 3300025912 | Bacteria | 60493 |
| 287 | Ga0207707_10121776 | 3300025912 | Bacteria | 2281 |
| 288 | Ga0207695_10014951 | 3300025913 | Bacteria | 9160 |
| 289 | Ga0207695_10019917 | 3300025913 | Bacteria | 7707 |
| 290 | Ga0207693_10006407 | 3300025915 | Bacteria | 9755 |
| 291 | Ga0207693_10094019 | 3300025915 | Bacteria | 2350 |
| 292 | Ga0207660_10006706 | 3300025917 | Bacteria | 7457 |
| 293 | Ga0207660_10020746 | 3300025917 | Bacteria | 4415 |
| 294 | Ga0207660_10115754 | 3300025917 | Bacteria | 2024 |
| 295 | Ga0207657_10002605 | 3300025919 | Bacteria | 19502 |
| 296 | Ga0207649_10003412 | 3300025920 | Bacteria | 8686 |
| 297 | Ga0207652_10000124 | 3300025921 | Bacteria | 82835 |
| 298 | Ga0207652_10004799 | 3300025921 | Bacteria | 10947 |
| 299 | Ga0207652_10007974 | 3300025921 | Bacteria | 8500 |
| 300 | Ga0207646_10002067 | 3300025922 | Bacteria | 24077 |
| 301 | Ga0207646_10005754 | 3300025922 | Bacteria | 12991 |
| 302 | Ga0207646_10013787 | 3300025922 | Bacteria | 7711 |
| 303 | Ga0207681_10002083 | 3300025923 | Bacteria | 12820 |
| 304 | Ga0207650_10003121 | 3300025925 | Bacteria | 11414 |
| 305 | Ga0207659_10039758 | 3300025926 | Bacteria | 3284 |
| 306 | Ga0207659_10066567 | 3300025926 | Bacteria | 2615 |
| 307 | Ga0207687_10014753 | 3300025927 | Bacteria | 5116 |
| 308 | Ga0207687_10040111 | 3300025927 | Bacteria | 3208 |
| 309 | Ga0207687_10089070 | 3300025927 | Bacteria | 2246 |
| 310 | Ga0207687_10125959 | 3300025927 | Bacteria | 1923 |
| 311 | Ga0207700_10019277 | 3300025928 | Bacteria | 4605 |
| 312 | Ga0207700_10031111 | 3300025928 | Bacteria | 3787 |
| 313 | Ga0207700_10035607 | 3300025928 | Bacteria | 3587 |
| 314 | Ga0207664_10004984 | 3300025929 | Bacteria | 9027 |
| 315 | Ga0207664_10017678 | 3300025929 | Bacteria | 5234 |
| 316 | Ga0207664_10051507 | 3300025929 | Bacteria | 3251 |
| 317 | Ga0207690_10006425 | 3300025932 | Bacteria | 6965 |
| 318 | Ga0207690_10006654 | 3300025932 | Bacteria | 6847 |
| 319 | Ga0207706_10010254 | 3300025933 | Bacteria | 8569 |
| 320 | Ga0207706_10024674 | 3300025933 | Bacteria | 5389 |
| 321 | Ga0207709_10036325 | 3300025935 | Bacteria | 2919 |
| 322 | Ga0207709_10056786 | 3300025935 | Bacteria | 2424 |
| 323 | Ga0207670_10114304 | 3300025936 | Bacteria | 1951 |
| 324 | Ga0207669_10038735 | 3300025937 | Bacteria | 2748 |
| 325 | Ga0207704_10083497 | 3300025938 | Bacteria | 2073 |
| 326 | Ga0207665_10000684 | 3300025939 | Bacteria | 22908 |
| 327 | Ga0207665_10027979 | 3300025939 | Bacteria | 3724 |
| 328 | Ga0207691_10021953 | 3300025940 | Bacteria | 6023 |
| 329 | Ga0207711_10000522 | 3300025941 | Bacteria | 39517 |
| 330 | Ga0207711_10039479 | 3300025941 | Bacteria | 4016 |
| 331 | Ga0207711_10143220 | 3300025941 | Bacteria | 2152 |
| 332 | Ga0207689_10002005 | 3300025942 | Bacteria | 19226 |
| 333 | Ga0207689_10003674 | 3300025942 | Bacteria | 13990 |
| 334 | Ga0207689_10017358 | 3300025942 | Bacteria | 6090 |
| 335 | Ga0207661_10004182 | 3300025944 | Bacteria | 10100 |
| 336 | Ga0207661_10018102 | 3300025944 | Bacteria | 5231 |
| 337 | Ga0207679_10005249 | 3300025945 | Bacteria | 8119 |
| 338 | Ga0207667_10017359 | 3300025949 | Bacteria | 8101 |
| 339 | Ga0207667_10128573 | 3300025949 | Bacteria | 2609 |
| 340 | Ga0207651_10018497 | 3300025960 | Bacteria | 4149 |
| 341 | Ga0207651_10056984 | 3300025960 | Bacteria | 2692 |
| 342 | Ga0207712_10000010 | 3300025961 | Bacteria | 455972 |
| 343 | Ga0207712_10065729 | 3300025961 | Bacteria | 2590 |
| 344 | Ga0207668_10001275 | 3300025972 | Bacteria | 15019 |
| 345 | Ga0207640_10041468 | 3300025981 | Bacteria | 2928 |
| 346 | Ga0207658_10000257 | 3300025986 | Bacteria | 55345 |
| 347 | Ga0207658_10039275 | 3300025986 | Bacteria | 3415 |
| 348 | Ga0207677_10121688 | 3300026023 | Bacteria | 1964 |
| 349 | Ga0207703_10005951 | 3300026035 | Bacteria | 9770 |
| 350 | Ga0207703_10027684 | 3300026035 | Bacteria | 4463 |
| 351 | Ga0207678_10000891 | 3300026067 | Bacteria | 27453 |
| 352 | Ga0207678_10001928 | 3300026067 | Bacteria | 18920 |
| 353 | Ga0207678_10054311 | 3300026067 | Bacteria | 3450 |
| 354 | Ga0207708_10000029 | 3300026075 | Bacteria | 161861 |
| 355 | Ga0207708_10003482 | 3300026075 | Bacteria | 11610 |
| 356 | Ga0207702_10000901 | 3300026078 | Bacteria | 30858 |
| 357 | Ga0207702_10033797 | 3300026078 | Bacteria | 4273 |
| 358 | Ga0207702_10068199 | 3300026078 | Bacteria | 3055 |
| 359 | Ga0207641_10001365 | 3300026088 | Bacteria | 24147 |
| 360 | Ga0207641_10016995 | 3300026088 | Bacteria | 5956 |
| 361 | Ga0207641_10018373 | 3300026088 | Bacteria | 5732 |
| 362 | Ga0207641_10127024 | 3300026088 | Bacteria | 2284 |
| 363 | Ga0207676_10000683 | 3300026095 | Bacteria | 26944 |
| 364 | Ga0207676_10066474 | 3300026095 | Bacteria | 2876 |
| 365 | Ga0207674_10021848 | 3300026116 | Bacteria | 6885 |
| 366 | Ga0207674_10039302 | 3300026116 | Bacteria | 4905 |
| 367 | Ga0207674_10054800 | 3300026116 | Bacteria | 4058 |
| 368 | Ga0207674_10112258 | 3300026116 | Bacteria | 2699 |
| 369 | Ga0207675_100006727 | 3300026118 | Bacteria | 10871 |
| 370 | Ga0207675_100012015 | 3300026118 | Bacteria | 8093 |
| 371 | Ga0207675_100103572 | 3300026118 | Bacteria | 2682 |
| 372 | Ga0207683_10003187 | 3300026121 | Bacteria | 14313 |
| 373 | Ga0207683_10012621 | 3300026121 | Bacteria | 7207 |
| 374 | Ga0207698_10003187 | 3300026142 | Bacteria | 9844 |
| 375 | Ga0207698_10007832 | 3300026142 | Bacteria | 6718 |
| 376 | Ga0207698_10020661 | 3300026142 | Bacteria | 4537 |
| 377 | Ga0207428_10000246 | 3300027907 | Bacteria | 73697 |
| 378 | Ga0207428_10000414 | 3300027907 | Bacteria | 53083 |
| 379 | Ga0207428_10002279 | 3300027907 | Bacteria | 19254 |
| 380 | Ga0207428_10005349 | 3300027907 | Bacteria | 11972 |
| 381 | Ga0207428_10012320 | 3300027907 | Bacteria | 7516 |
| 382 | Ga0268266_10008723 | 3300028379 | Bacteria | 8987 |
| 383 | Ga0268266_10013700 | 3300028379 | Bacteria | 6983 |
| 384 | Ga0268265_10000105 | 3300028380 | Bacteria | 105463 |
| 385 | Ga0268265_10030238 | 3300028380 | Bacteria | 3898 |
| 386 | Ga0268264_10000237 | 3300028381 | Bacteria | 105274 |
| 387 | Ga0268264_10029148 | 3300028381 | Bacteria | 4520 |
| 388 | Ga0307515_10000205 | 3300028794 | Bacteria | 144874 |
| 389 | Ga0307515_10037515 | 3300028794 | Bacteria | 7791 |
| 390 | Ga0307515_10119249 | 3300028794 | Bacteria | 3003 |
| 391 | Ga0265338_10001802 | 3300028800 | Bacteria | 33701 |
| 392 | Ga0265338_10144101 | 3300028800 | Bacteria | 1861 |
| 393 | Ga0307511_10001476 | 3300030521 | Bacteria | 24879 |
| 394 | Ga0307512_10012399 | 3300030522 | Bacteria | 8043 |
| 395 | Ga0307512_10029964 | 3300030522 | Bacteria | 4741 |
| 396 | Ga0316177_1136358 | 3300030731 | Bacteria | 2998 |
| 397 | Ga0316176_1130375 | 3300030732 | Bacteria | 3284 |
| 398 | Ga0265325_10000179 | 3300031241 | Bacteria | 45049 |
| 399 | Ga0265340_10000074 | 3300031247 | Bacteria | 47646 |
| 400 | Ga0265340_10003776 | 3300031247 | Bacteria | 8530 |
| 401 | Ga0265340_10015933 | 3300031247 | Bacteria | 3899 |
| 402 | Ga0265339_10003512 | 3300031249 | Bacteria | 10954 |
| 403 | Ga0265327_10000329 | 3300031251 | Bacteria | 90292 |
| 404 | Ga0265327_10005907 | 3300031251 | Bacteria | 10001 |
| 405 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 406 | Ga0307513_10047087 | 3300031456 | Bacteria | 4693 |
| 407 | Ga0307408_100005281 | 3300031548 | Bacteria | 8655 |
| 408 | Ga0307408_100035813 | 3300031548 | Bacteria | 3485 |
| 409 | Ga0265313_10007457 | 3300031595 | Bacteria | 7476 |
| 410 | Ga0307508_10006175 | 3300031616 | Bacteria | 11304 |
| 411 | Ga0307508_10015004 | 3300031616 | Bacteria | 7063 |
| 412 | Ga0307508_10015558 | 3300031616 | Bacteria | 6931 |
| 413 | Ga0307508_10026785 | 3300031616 | Bacteria | 5224 |
| 414 | Ga0265314_10008167 | 3300031711 | Bacteria | 9004 |
| 415 | Ga0316576_10011969 | 3300031727 | Bacteria | 5709 |
| 416 | Ga0316578_10035876 | 3300031728 | Bacteria | 2852 |
| 417 | Ga0307516_10009973 | 3300031730 | Bacteria | 10519 |
| 418 | Ga0307516_10021531 | 3300031730 | Bacteria | 6630 |
| 419 | Ga0307516_10023643 | 3300031730 | Bacteria | 6291 |
| 420 | Ga0307405_10002680 | 3300031731 | Bacteria | 7933 |
| 421 | Ga0307405_10010307 | 3300031731 | Bacteria | 4833 |
| 422 | Ga0307405_10021984 | 3300031731 | Bacteria | 3597 |
| 423 | Ga0307405_10041159 | 3300031731 | Bacteria | 2803 |
| 424 | Ga0307413_10001422 | 3300031824 | Bacteria | 9050 |
| 425 | Ga0307413_10001727 | 3300031824 | Bacteria | 8534 |
| 426 | Ga0307413_10003080 | 3300031824 | Bacteria | 6933 |
| 427 | Ga0307413_10003652 | 3300031824 | Bacteria | 6533 |
| 428 | Ga0307413_10010654 | 3300031824 | Bacteria | 4474 |
| 429 | Ga0307413_10041105 | 3300031824 | Bacteria | 2705 |
| 430 | Ga0307410_10000378 | 3300031852 | Bacteria | 17425 |
| 431 | Ga0307410_10000601 | 3300031852 | Bacteria | 14792 |
| 432 | Ga0307410_10002667 | 3300031852 | Bacteria | 8698 |
| 433 | Ga0307410_10013287 | 3300031852 | Bacteria | 4798 |
| 434 | Ga0307410_10056788 | 3300031852 | Bacteria | 2663 |
| 435 | Ga0307406_10000477 | 3300031901 | Bacteria | 23095 |
| 436 | Ga0307406_10000809 | 3300031901 | Bacteria | 17581 |
| 437 | Ga0307406_10001755 | 3300031901 | Bacteria | 11878 |
| 438 | Ga0307406_10002775 | 3300031901 | Bacteria | 9562 |
| 439 | Ga0307406_10013284 | 3300031901 | Bacteria | 4714 |
| 440 | Ga0307406_10043646 | 3300031901 | Bacteria | 2805 |
| 441 | Ga0307406_10057879 | 3300031901 | Bacteria | 2488 |
| 442 | Ga0307406_10062849 | 3300031901 | Bacteria | 2403 |
| 443 | Ga0307407_10001972 | 3300031903 | Bacteria | 7792 |
| 444 | Ga0307407_10008233 | 3300031903 | Bacteria | 4774 |
| 445 | Ga0307407_10009714 | 3300031903 | Bacteria | 4497 |
| 446 | Ga0307407_10029876 | 3300031903 | Bacteria | 2932 |
| 447 | Ga0307412_10020393 | 3300031911 | Bacteria | 4033 |
| 448 | Ga0307412_10023607 | 3300031911 | Bacteria | 3787 |
| 449 | Ga0307409_100000009 | 3300031995 | Bacteria | 68887 |
| 450 | Ga0307409_100000116 | 3300031995 | Bacteria | 29619 |
| 451 | Ga0307409_100001123 | 3300031995 | Bacteria | 12683 |
| 452 | Ga0307409_100001784 | 3300031995 | Bacteria | 10874 |
| 453 | Ga0307409_100046794 | 3300031995 | Bacteria | 3277 |
| 454 | Ga0307409_100142561 | 3300031995 | Bacteria | 2067 |
| 455 | Ga0307416_100000281 | 3300032002 | Bacteria | 27004 |
| 456 | Ga0307416_100002435 | 3300032002 | Bacteria | 10686 |
| 457 | Ga0307416_100015531 | 3300032002 | Bacteria | 5262 |
| 458 | Ga0307416_100022312 | 3300032002 | Bacteria | 4567 |
| 459 | Ga0307416_100039238 | 3300032002 | Bacteria | 3663 |
| 460 | Ga0307416_100062171 | 3300032002 | Bacteria | 3052 |
| 461 | Ga0307414_10005883 | 3300032004 | Bacteria | 6787 |
| 462 | Ga0307414_10038554 | 3300032004 | Bacteria | 3210 |
| 463 | Ga0307414_10166373 | 3300032004 | Bacteria | 1758 |
| 464 | Ga0307411_10001178 | 3300032005 | Bacteria | 10300 |
| 465 | Ga0307411_10006244 | 3300032005 | Bacteria | 5942 |
| 466 | Ga0307411_10026159 | 3300032005 | Bacteria | 3509 |
| 467 | Ga0307415_100000071 | 3300032126 | Bacteria | 42220 |
| 468 | Ga0307415_100006514 | 3300032126 | Bacteria | 6309 |
| 469 | Ga0307415_100006570 | 3300032126 | Bacteria | 6286 |
| 470 | Ga0307415_100014981 | 3300032126 | Bacteria | 4576 |
| 471 | Ga0307415_100020756 | 3300032126 | Bacteria | 4019 |
| 472 | Ga0307415_100077718 | 3300032126 | Bacteria | 2357 |
| 473 | Ga0307507_10058009 | 3300033179 | Bacteria | 3639 |
| 474 | Ga0373926_0001496 | 3300035083 | Bacteria | 7142 |
| 475 | Ga0373926_0011010 | 3300035083 | Bacteria | 3038 |
| 476 | Ga0373934_0013329 | 3300035086 | Bacteria | 3107 |
| 477 | Ga0373949_0007250 | 3300035090 | Bacteria | 2428 |
| 478 | Ga0373951_0000536 | 3300035091 | Bacteria | 10697 |
| 479 | Ga0373936_0025152 | 3300035113 | Bacteria | 2326 |
| 480 | Ga0373936_0042142 | 3300035113 | Bacteria | 1832 |
| 481 | Ga0373939_0011035 | 3300035114 | Bacteria | 2272 |
| 482 | Ga0373945_0009189 | 3300035116 | Bacteria | 3234 |
| 483 | Ga0373953_0005549 | 3300035117 | Bacteria | 4103 |
| 484 | Ga0373953_0050988 | 3300035117 | Bacteria | 1672 |
| 485 | Ga0373954_0015989 | 3300035118 | Bacteria | 3355 |
| 486 | Ga0373956_0019918 | 3300035119 | Bacteria | 2849 |
| 487 | Ga0373943_0003061 | 3300035170 | Bacteria | 7596 |
| 488 | Ga0373946_0001422 | 3300035171 | Bacteria | 8309 |
| 489 | Ga0373946_0006321 | 3300035171 | Bacteria | 4293 |
| 490 | Ga0373946_0024436 | 3300035171 | Bacteria | 2368 |
| 491 | Ga0373955_0014889 | 3300035172 | Bacteria | 3795 |
| 492 | Ga0373942_0000505 | 3300035207 | Bacteria | 10996 |
| 493 | Ga0373942_0001543 | 3300035207 | Bacteria | 5911 |
| 494 | Ga0373935_0000034 | 3300035692 | Bacteria | 52185 |
| 495 | Ga0373935_0030511 | 3300035692 | Bacteria | 3341 |
| 496 | Ga0373927_0008513 | 3300035695 | Bacteria | 6900 |
| 497 | Ga0373927_0065454 | 3300035695 | Bacteria | 2351 |
| 498 | Ga0373947_0000008 | 3300035725 | Bacteria | 182094 |
| 499 | Ga0373947_0001252 | 3300035725 | Bacteria | 15617 |
| 500 | Ga0373947_0030034 | 3300035725 | Bacteria | 3191 |
| 501 | Ga0373937_0002052 | 3300036401 | Bacteria | 16837 |
| 502 | Ga0373925_0002220 | 3300037068 | Bacteria | 15749 |
| 503 | Ga0373925_0003761 | 3300037068 | Bacteria | 11659 |
| 504 | Ga0395899_0003664 | 3300037312 | Bacteria | 12162 |
| 505 | Ga0395899_0038909 | 3300037312 | Bacteria | 3561 |
| 506 | Ga0395900_0002497 | 3300037418 | Bacteria | 20218 |
| 507 | Ga0395900_0149439 | 3300037418 | Bacteria | 2387 |
| 508 | Ga0395900_0195053 | 3300037418 | Bacteria | 2052 |
| 509 | Ga0395898_0001600 | 3300037466 | Bacteria | 30893 |
| 510 | Ga0395898_0047920 | 3300037466 | Bacteria | 4191 |
| 511 | Ga0395898_0063063 | 3300037466 | Bacteria | 3597 |
| 512 | Ga0395905_0002372 | 3300037471 | Bacteria | 20988 |
| 513 | Ga0395905_0115113 | 3300037471 | Bacteria | 2527 |
| 514 | Ga0436364_0077046 | 3300037853 | Bacteria | 111992 |
| 515 | Ga0436364_0505858 | 3300037853 | Bacteria | 16204 |
| 516 | Ga0436364_1086439 | 3300037853 | Bacteria | 32387 |
| 517 | Ga0395901_0005296 | 3300038443 | Bacteria | 13039 |
| 518 | Ga0395901_0009518 | 3300038443 | Bacteria | 9858 |
| 519 | Ga0395901_0012435 | 3300038443 | Bacteria | 8636 |
| 520 | Ga0395901_0028604 | 3300038443 | Bacteria | 5732 |
| 521 | Ga0395901_0126351 | 3300038443 | Bacteria | 2687 |
| 522 | Ga0436365_1789266 | 3300039437 | Bacteria | 32563 |
| 523 | Ga0436363_0110923 | 3300039450 | Bacteria | 3613 |
| 524 | Ga0439439_0009397 | 3300041406 | Bacteria | 2324 |
| 525 | Ga0439433_0012465 | 3300041999 | Bacteria | 1865 |
| 526 | Ga0439448_0011003 | 3300042005 | Bacteria | 2691 |
| 527 | Ga0439457_000249 | 3300042014 | Bacteria | 14611 |
| 528 | Ga0439440_0000641 | 3300042993 | Bacteria | 5964 |
| 529 | Ga0466969_0000322 | 3300044656 | Bacteria | 26451 |
| 530 | Ga0466969_0001204 | 3300044656 | Bacteria | 13989 |
| 531 | Ga0466969_0003369 | 3300044656 | Bacteria | 8512 |
| 532 | Ga0466969_0005509 | 3300044656 | Bacteria | 6728 |
| 533 | Ga0466969_0024959 | 3300044656 | Bacteria | 3074 |
| 534 | Ga0466965_0008335 | 3300044683 | Bacteria | 4793 |
| 535 | Ga0466965_0039781 | 3300044683 | Bacteria | 2312 |
| 536 | Ga0466966_0022754 | 3300044684 | Bacteria | 4109 |
| 537 | Ga0466961_0002172 | 3300044693 | Bacteria | 12206 |
| 538 | Ga0466961_0002620 | 3300044693 | Bacteria | 11178 |
| 539 | Ga0466961_0006591 | 3300044693 | Bacteria | 7380 |
| 540 | Ga0466961_0018404 | 3300044693 | Bacteria | 4493 |
| 541 | Ga0466961_0051690 | 3300044693 | Bacteria | 2624 |
| 542 | Ga0466963_0000881 | 3300044694 | Bacteria | 15241 |
| 543 | Ga0466963_0016351 | 3300044694 | Bacteria | 4613 |
| 544 | Ga0466963_0017505 | 3300044694 | Bacteria | 4467 |
| 545 | Ga0466971_0003815 | 3300044719 | Bacteria | 6450 |
| 546 | Ga0466971_0033923 | 3300044719 | Bacteria | 2287 |
| 547 | Ga0466970_0011138 | 3300044765 | Bacteria | 4580 |
| 548 | Ga0466970_0066157 | 3300044765 | Bacteria | 1940 |
| 549 | Ga0466957_0047954 | 3300044842 | Bacteria | 2596 |
| 550 | Ga0466960_0001544 | 3300044901 | Bacteria | 8412 |
| 551 | Ga0466960_0013456 | 3300044901 | Bacteria | 3477 |
| 552 | Ga0466959_0003872 | 3300045049 | Bacteria | 9931 |
| 553 | Ga0466959_0008070 | 3300045049 | Bacteria | 7421 |
| 554 | Ga0466959_0079481 | 3300045049 | Bacteria | 2364 |
| 555 | Ga0466958_0013335 | 3300045836 | Bacteria | 4677 |
| 556 | Ga0466958_0042659 | 3300045836 | Bacteria | 2732 |
| 557 | Ga0466967_0003468 | 3300045976 | Bacteria | 10295 |
| 558 | Ga0466967_0003723 | 3300045976 | Bacteria | 10047 |
| 559 | Ga0466967_0008345 | 3300045976 | Bacteria | 7580 |
| 560 | Ga0466967_0013375 | 3300045976 | Bacteria | 6337 |
| 561 | Ga0495592_0039481 | 3300046454 | Bacteria | 3545 |
| 562 | Ga0495592_0039813 | 3300046454 | Bacteria | 3529 |
| 563 | Ga0495603_0016248 | 3300046455 | Bacteria | 4503 |
| 564 | Ga0495629_0099540 | 3300046459 | Bacteria | 2029 |
| 565 | Ga0495629_0157995 | 3300046459 | Bacteria | 1575 |
| 566 | Ga0495641_0017707 | 3300046461 | Bacteria | 3701 |
| 567 | Ga0495651_0001770 | 3300046462 | Bacteria | 16686 |
| 568 | Ga0495651_0001980 | 3300046462 | Bacteria | 15873 |
| 569 | Ga0495651_0014869 | 3300046462 | Bacteria | 6018 |
| 570 | Ga0495651_0015452 | 3300046462 | Bacteria | 5905 |
| 571 | Ga0495651_0126738 | 3300046462 | Bacteria | 1869 |
| 572 | Ga0495653_0004030 | 3300046463 | Bacteria | 11861 |
| 573 | Ga0495653_0004155 | 3300046463 | Bacteria | 11715 |
| 574 | Ga0495580_0013333 | 3300046472 | Bacteria | 6279 |
| 575 | Ga0495580_0035662 | 3300046472 | Bacteria | 3576 |
| 576 | Ga0495580_0041306 | 3300046472 | Bacteria | 3289 |
| 577 | Ga0495639_0003366 | 3300046475 | Bacteria | 6934 |
| 578 | Ga0495662_0001980 | 3300046476 | Bacteria | 10273 |
| 579 | Ga0495662_0014989 | 3300046476 | Bacteria | 3765 |
| 580 | Ga0495662_0027154 | 3300046476 | Bacteria | 2766 |
| 581 | Ga0495664_0001629 | 3300046477 | Bacteria | 11927 |
| 582 | Ga0495664_0002361 | 3300046477 | Bacteria | 10113 |
| 583 | Ga0495608_0001337 | 3300046511 | Bacteria | 17572 |
| 584 | Ga0495608_0002887 | 3300046511 | Bacteria | 12311 |
| 585 | Ga0495608_0003847 | 3300046511 | Bacteria | 10788 |
| 586 | Ga0495608_0040310 | 3300046511 | Bacteria | 3129 |
| 587 | Ga0495608_0053593 | 3300046511 | Bacteria | 2668 |
| 588 | Ga0495618_0001099 | 3300046514 | Bacteria | 18333 |
| 589 | Ga0495618_0030895 | 3300046514 | Bacteria | 3348 |
| 590 | Ga0495618_0100279 | 3300046514 | Bacteria | 1853 |
| 591 | Ga0495620_0043774 | 3300046515 | Bacteria | 1949 |
| 592 | Ga0495628_0004294 | 3300046516 | Bacteria | 12675 |
| 593 | Ga0495628_0007279 | 3300046516 | Bacteria | 9589 |
| 594 | Ga0495628_0139892 | 3300046516 | Bacteria | 1847 |
| 595 | Ga0495630_0002313 | 3300046517 | Bacteria | 13242 |
| 596 | Ga0495630_0013048 | 3300046517 | Bacteria | 6038 |
| 597 | Ga0495632_0013488 | 3300046519 | Bacteria | 4662 |
| 598 | Ga0495648_0058770 | 3300046524 | Bacteria | 2297 |
| 599 | Ga0495666_0017129 | 3300046526 | Bacteria | 3608 |
| 600 | Ga0495652_0002781 | 3300046529 | Bacteria | 17682 |
| 601 | Ga0495652_0041313 | 3300046529 | Bacteria | 3981 |
| 602 | Ga0495665_0000174 | 3300046531 | Bacteria | 32581 |
| 603 | Ga0495665_0003579 | 3300046531 | Bacteria | 8434 |
| 604 | Ga0495640_0007894 | 3300046533 | Bacteria | 8366 |
| 605 | Ga0495640_0016533 | 3300046533 | Bacteria | 5517 |
| 606 | Ga0495640_0018426 | 3300046533 | Bacteria | 5175 |
| 607 | Ga0495640_0027410 | 3300046533 | Bacteria | 4109 |
| 608 | Ga0495586_0006408 | 3300046535 | Bacteria | 6287 |
| 609 | Ga0495587_0002902 | 3300046536 | Bacteria | 11483 |
| 610 | Ga0495587_0004437 | 3300046536 | Bacteria | 9246 |
| 611 | Ga0495587_0012446 | 3300046536 | Bacteria | 5354 |
| 612 | Ga0495587_0022064 | 3300046536 | Bacteria | 3922 |
| 613 | Ga0495645_0004178 | 3300046543 | Bacteria | 9871 |
| 614 | Ga0495645_0010202 | 3300046543 | Bacteria | 6581 |
| 615 | Ga0495645_0017837 | 3300046543 | Bacteria | 5092 |
| 616 | Ga0495645_0020551 | 3300046543 | Bacteria | 4766 |
| 617 | Ga0495667_0000283 | 3300046559 | Bacteria | 32986 |
| 618 | Ga0495667_0008113 | 3300046559 | Bacteria | 7128 |
| 619 | Ga0495667_0031190 | 3300046559 | Bacteria | 3578 |
| 620 | Ga0495667_0040952 | 3300046559 | Bacteria | 3073 |
| 621 | Ga0495667_0045109 | 3300046559 | Bacteria | 2919 |
| 622 | Ga0495667_0055081 | 3300046559 | Bacteria | 2615 |
| 623 | Ga0495634_0002199 | 3300046642 | Bacteria | 16376 |
| 624 | Ga0495634_0021824 | 3300046642 | Bacteria | 4518 |
| 625 | Ga0495634_0077517 | 3300046642 | Bacteria | 2179 |
| 626 | Ga0495635_0002142 | 3300046663 | Bacteria | 13400 |
| 627 | Ga0495635_0004779 | 3300046663 | Bacteria | 9415 |
| 628 | Ga0495635_0011633 | 3300046663 | Bacteria | 6166 |
| 629 | Ga0495635_0023067 | 3300046663 | Bacteria | 4337 |
| 630 | Ga0495635_0057545 | 3300046663 | Bacteria | 2674 |
| 631 | Ga0495657_0002522 | 3300046675 | Bacteria | 15375 |
| 632 | Ga0495657_0012926 | 3300046675 | Bacteria | 6182 |
| 633 | Ga0495657_0035385 | 3300046675 | Bacteria | 3461 |
| 634 | Ga0495657_0052599 | 3300046675 | Bacteria | 2729 |
| 635 | Ga0495599_0019886 | 3300046678 | Bacteria | 4182 |
| 636 | Ga0495599_0026206 | 3300046678 | Bacteria | 3652 |
| 637 | Ga0495623_0057261 | 3300046679 | Bacteria | 2452 |
| 638 | Ga0495646_0007368 | 3300046680 | Bacteria | 6989 |
| 639 | Ga0495646_0026554 | 3300046680 | Bacteria | 3635 |
| 640 | Ga0495613_0002951 | 3300046689 | Bacteria | 12721 |
| 641 | Ga0495613_0003990 | 3300046689 | Bacteria | 11040 |
| 642 | Ga0495613_0008683 | 3300046689 | Bacteria | 7533 |
| 643 | Ga0495624_0027916 | 3300046690 | Bacteria | 3690 |
| 644 | Ga0495624_0038002 | 3300046690 | Bacteria | 3095 |
| 645 | Ga0495624_0067028 | 3300046690 | Bacteria | 2240 |
| 646 | Ga0495600_0031126 | 3300046809 | Bacteria | 3456 |
| 647 | Ga0495600_0033828 | 3300046809 | Bacteria | 3318 |
| 648 | Ga0495581_0007278 | 3300047315 | Bacteria | 6402 |
| 649 | Ga0495604_0000604 | 3300047317 | Bacteria | 30967 |
| 650 | Ga0495604_0003292 | 3300047317 | Bacteria | 12896 |
| 651 | Ga0495604_0015836 | 3300047317 | Bacteria | 6018 |
| 652 | Ga0495604_0046744 | 3300047317 | Bacteria | 3374 |
| 653 | Ga0495604_0053249 | 3300047317 | Bacteria | 3129 |
| 654 | Ga0495674_0008198 | 3300047319 | Bacteria | 9969 |
| 655 | Ga0495674_0009350 | 3300047319 | Bacteria | 9318 |
| 656 | Ga0495674_0028189 | 3300047319 | Bacteria | 5125 |
| 657 | Ga0495676_0006159 | 3300047321 | Bacteria | 11039 |
| 658 | Ga0495676_0012188 | 3300047321 | Bacteria | 7755 |
| 659 | Ga0495680_0003391 | 3300047322 | Bacteria | 15721 |
| 660 | Ga0495680_0003581 | 3300047322 | Bacteria | 15207 |
| 661 | Ga0495680_0035463 | 3300047322 | Bacteria | 4018 |
| 662 | Ga0495675_0013608 | 3300047444 | Bacteria | 5140 |
| 663 | Ga0495675_0044083 | 3300047444 | Bacteria | 2841 |
| 664 | Ga0495675_0047123 | 3300047444 | Bacteria | 2742 |
| 665 | Ga0495685_013392 | 3300047447 | Bacteria | 2784 |
| 666 | Ga0495684_0016747 | 3300047471 | Bacteria | 5647 |
| 667 | Ga0495684_0043897 | 3300047471 | Bacteria | 3422 |
| 668 | Ga0495684_0044672 | 3300047471 | Bacteria | 3391 |
| 669 | Ga0495686_0010656 | 3300047472 | Bacteria | 6527 |
| 670 | Ga0495593_0010466 | 3300047673 | Bacteria | 5355 |
| 671 | Ga0495602_0004230 | 3300048088 | Bacteria | 14936 |
| 672 | Ga0495602_0032335 | 3300048088 | Bacteria | 4926 |
| 673 | Ga0495614_0007604 | 3300048089 | Bacteria | 4818 |
| 674 | Ga0496100_0011113 | 3300048903 | Bacteria | 5112 |
| 675 | Ga0496100_0011219 | 3300048903 | Bacteria | 5095 |
| 676 | Ga0496100_0032636 | 3300048903 | Bacteria | 3249 |
| 677 | Ga0496101_0028662 | 3300048904 | Bacteria | 3889 |
| 678 | Ga0496102_0000985 | 3300048905 | Bacteria | 26750 |
| 679 | Ga0496102_0003380 | 3300048905 | Bacteria | 13528 |
| 680 | Ga0496102_0006065 | 3300048905 | Bacteria | 10304 |
| 681 | Ga0496102_0082240 | 3300048905 | Bacteria | 2970 |
| 682 | Ga0496102_0113141 | 3300048905 | Bacteria | 2532 |
| 683 | Ga0496103_0100816 | 3300048906 | Bacteria | 1827 |
| 684 | Ga0496104_0001600 | 3300048907 | Bacteria | 19488 |
| 685 | Ga0496104_0003435 | 3300048907 | Bacteria | 13659 |
| 686 | Ga0496104_0020237 | 3300048907 | Bacteria | 6097 |
| 687 | Ga0496104_0149180 | 3300048907 | Bacteria | 2245 |
| 688 | Ga0496105_0000206 | 3300048908 | Bacteria | 39356 |
| 689 | Ga0496105_0005190 | 3300048908 | Bacteria | 9868 |
| 690 | Ga0496105_0060471 | 3300048908 | Bacteria | 3126 |
| 691 | Ga0496105_0145204 | 3300048908 | Bacteria | 1951 |
| 692 | Ga0496106_0032172 | 3300048909 | Bacteria | 3910 |
| 693 | Ga0496106_0082221 | 3300048909 | Bacteria | 2475 |
| 694 | Ga0496107_0006136 | 3300048910 | Bacteria | 8253 |
| 695 | Ga0496107_0087015 | 3300048910 | Bacteria | 2281 |
| 696 | Ga0496108_0000117 | 3300048911 | Bacteria | 78204 |
| 697 | Ga0496108_0003488 | 3300048911 | Bacteria | 12601 |
| 698 | Ga0496108_0004350 | 3300048911 | Bacteria | 11388 |
| 699 | Ga0496108_0005676 | 3300048911 | Bacteria | 10102 |
| 700 | Ga0496108_0050234 | 3300048911 | Bacteria | 3490 |
| 701 | Ga0496108_0097547 | 3300048911 | Bacteria | 2504 |
| 702 | Ga0496109_0002466 | 3300048912 | Bacteria | 15507 |
| 703 | Ga0496109_0057813 | 3300048912 | Bacteria | 3542 |
| 704 | Ga0496110_0016417 | 3300048913 | Bacteria | 6181 |
| 705 | Ga0496110_0058650 | 3300048913 | Bacteria | 3390 |
| 706 | Ga0496111_0001418 | 3300048914 | Bacteria | 13642 |
| 707 | Ga0496111_0005769 | 3300048914 | Bacteria | 7990 |
| 708 | Ga0496111_0082019 | 3300048914 | Bacteria | 2354 |
| 709 | Ga0496112_0000167 | 3300048915 | Bacteria | 41911 |
| 710 | Ga0496112_0009573 | 3300048915 | Bacteria | 8739 |
| 711 | Ga0496112_0039622 | 3300048915 | Bacteria | 4605 |
| 712 | Ga0496112_0142446 | 3300048915 | Bacteria | 2366 |
| 713 | Ga0496113_0000858 | 3300048916 | Bacteria | 15902 |
| 714 | Ga0496113_0002915 | 3300048916 | Bacteria | 10094 |
| 715 | Ga0496113_0021355 | 3300048916 | Bacteria | 4565 |
| 716 | Ga0496114_0173068 | 3300048917 | Bacteria | 1882 |
| 717 | Ga0496115_0001834 | 3300048918 | Bacteria | 15214 |
| 718 | Ga0496115_0002241 | 3300048918 | Bacteria | 13851 |
| 719 | Ga0496115_0112789 | 3300048918 | Bacteria | 2234 |
| 720 | Ga0496116_0066186 | 3300048919 | Bacteria | 2313 |
| 721 | Ga0496117_0010689 | 3300048920 | Bacteria | 8307 |
| 722 | Ga0496118_0002176 | 3300048921 | Bacteria | 27275 |
| 723 | Ga0496119_0002943 | 3300048922 | Bacteria | 18110 |
| 724 | Ga0496120_0017026 | 3300048923 | Bacteria | 4728 |
| 725 | Ga0496121_0018715 | 3300048924 | Bacteria | 6969 |
| 726 | Ga0496121_0091943 | 3300048924 | Bacteria | 2366 |
| 727 | Ga0496126_0001999 | 3300048929 | Bacteria | 28832 |
| 728 | Ga0496126_0059268 | 3300048929 | Bacteria | 3447 |
| 729 | Ga0501034_0001474 | 3300049571 | Bacteria | 31125 |
| 730 | Ga0501034_0028145 | 3300049571 | Bacteria | 5717 |
| 731 | Ga0501036_0000822 | 3300049572 | Bacteria | 23006 |
| 732 | Ga0501036_0001670 | 3300049572 | Bacteria | 17200 |
| 733 | Ga0501036_0091059 | 3300049572 | Bacteria | 2576 |
| 734 | Ga0501037_0013233 | 3300049573 | Bacteria | 6079 |
| 735 | Ga0501037_0017137 | 3300049573 | Bacteria | 5331 |
| 736 | Ga0501038_0016685 | 3300049574 | Bacteria | 6654 |
| 737 | Ga0501043_0006890 | 3300049579 | Bacteria | 9068 |
| 738 | Ga0501043_0007797 | 3300049579 | Bacteria | 8461 |
| 739 | Ga0501047_0000794 | 3300049581 | Bacteria | 33018 |
| 740 | Ga0501047_0134945 | 3300049581 | Bacteria | 2348 |
| 741 | Ga0501048_0004267 | 3300049582 | Bacteria | 10891 |
| 742 | Ga0501048_0005373 | 3300049582 | Bacteria | 9739 |
| 743 | Ga0501068_0069334 | 3300049584 | Bacteria | 2150 |
| 744 | Ga0501070_0039493 | 3300049586 | Bacteria | 3937 |
| 745 | Ga0501074_0002857 | 3300049590 | Bacteria | 12086 |
| 746 | Ga0501074_0004099 | 3300049590 | Bacteria | 10395 |
| 747 | Ga0501076_0037096 | 3300049592 | Bacteria | 3821 |
| 748 | Ga0501080_0090596 | 3300049742 | Bacteria | 2841 |
| 749 | Ga0501044_0006420 | 3300049823 | Bacteria | 12994 |
| 750 | Ga0501044_0022489 | 3300049823 | Bacteria | 6717 |
| 751 | nmdc:mga05p37_201033_c1 | 3300050507 | Bacteria | 2414 |
| 752 | nmdc:mga05p37_351952_c1 | 3300050507 | Bacteria | 1734 |
| 753 | nmdc:mga05p37_448_c1 | 3300050507 | Bacteria | 44738 |
| 754 | nmdc:mga05p37_6983_c1 | 3300050507 | Bacteria | 13307 |
| 755 | nmdc:mga09592_1369_c1 | 3300050508 | Bacteria | 19525 |
| 756 | nmdc:mga09592_13_c1 | 3300050508 | Bacteria | 101979 |
| 757 | nmdc:mga09592_38118_c1 | 3300050508 | Bacteria | 4034 |
| 758 | nmdc:mga0qj67_1037_c1 | 3300050509 | Bacteria | 19212 |
| 759 | nmdc:mga0qj67_266_c1 | 3300050509 | Bacteria | 35948 |
| 760 | nmdc:mga0qj67_46855_c1 | 3300050509 | Bacteria | 3414 |
| 761 | nmdc:mga06r32_1775_c1 | 3300050510 | Bacteria | 19383 |
| 762 | nmdc:mga06r32_20856_c1 | 3300050510 | Bacteria | 6039 |
| 763 | nmdc:mga06r32_24_c1 | 3300050510 | Bacteria | 92238 |
| 764 | nmdc:mga06r32_7360_c1 | 3300050510 | Bacteria | 9908 |
| 765 | nmdc:mga08y16_25119_c2 | 3300050511 | Bacteria | 4131 |
| 766 | nmdc:mga08y16_35213_c1 | 3300050511 | Bacteria | 5259 |
| 767 | nmdc:mga08y16_66931_c1 | 3300050511 | Bacteria | 3749 |
| 768 | nmdc:mga08y16_8358_c1 | 3300050511 | Bacteria | 10829 |
| 769 | nmdc:mga0n895_1307_c1 | 3300050512 | Bacteria | 18433 |
| 770 | nmdc:mga0n895_1353_c1 | 3300050512 | Bacteria | 18195 |
| 771 | nmdc:mga0n895_181713_c1 | 3300050512 | Bacteria | 2135 |
| 772 | nmdc:mga0n895_3095_c1 | 3300050512 | Bacteria | 13246 |
| 773 | nmdc:mga0n895_67018_c1 | 3300050512 | Bacteria | 3555 |
| 774 | nmdc:mga0n895_68042_c1 | 3300050512 | Bacteria | 3528 |
| 775 | nmdc:mga0rr50_15311_c1 | 3300050513 | Bacteria | 5060 |
| 776 | nmdc:mga0rr50_2031_c1 | 3300050513 | Bacteria | 11280 |
| 777 | nmdc:mga0rr50_41038_c1 | 3300050513 | Bacteria | 3369 |
| 778 | nmdc:mga0rr50_53749_c1 | 3300050513 | Bacteria | 2997 |
| 779 | nmdc:mga08x19_15613_c1 | 3300050514 | Bacteria | 4621 |
| 780 | nmdc:mga08x19_16520_c1 | 3300050514 | Bacteria | 4503 |
| 781 | nmdc:mga0a205_11806_c1 | 3300050515 | Bacteria | 8062 |
| 782 | nmdc:mga0a205_36276_c1 | 3300050515 | Bacteria | 4737 |
| 783 | Ga0495601_0003722 | 3300053077 | Bacteria | 8774 |
| 784 | Ga0495612_0002601 | 3300053078 | Bacteria | 7446 |
| 785 | Ga0500610_0010927 | 3300053079 | Bacteria | 4109 |
| 786 | Ga0495619_0002016 | 3300053085 | Bacteria | 13496 |
| 787 | Ga0495619_0039614 | 3300053085 | Bacteria | 3077 |
| 788 | Ga0500644_0007540 | 3300053088 | Bacteria | 2836 |
| 789 | Ga0500559_0002853 | 3300053136 | Bacteria | 8732 |
| 790 | Ga0500568_0002143 | 3300053139 | Bacteria | 11908 |
| 791 | Ga0500573_0035428 | 3300053140 | Bacteria | 2880 |
| 792 | Ga0500579_073466 | 3300053143 | Bacteria | 1959 |
| 793 | Ga0500588_0000330 | 3300053146 | Bacteria | 7153 |
| 794 | Ga0500600_0055525 | 3300053149 | Bacteria | 2229 |
| 795 | Ga0500627_0004224 | 3300053158 | Bacteria | 4574 |
| 796 | Ga0466962_0000098 | 3300061719 | Bacteria | 35205 |
| 797 | Ga0466962_0031991 | 3300061719 | Bacteria | 2519 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2551306166 | 2552110368 | 463 |
| 2 | 3300049574 | Ga0501038_0016685 | Ga0501038_0016685_5208_6629 | 473 |
| 3 | 3300037418 | Ga0395900_0149439 | Ga0395900_0149439_12_1487 | 478 |
| 4 | 3300044693 | Ga0466961_0051690 | Ga0466961_0051690_1130_2581 | 482 |
| 5 | 3300006844 | Ga0075428_100029471 | Ga0075428_1000294715 | 491 |
| 6 | 3300005937 | Ga0081455_10048327 | Ga0081455_100483274 | 497 |
| 7 | 3300035117 | Ga0373953_0050988 | Ga0373953_0050988_13_1512 | 498 |
| 8 | 3300035114 | Ga0373939_0011035 | Ga0373939_0011035_701_2236 | 506 |
| 9 | 3300048907 | Ga0496104_0149180 | Ga0496104_0149180_17_1543 | 506 |
| 10 | 3300046459 | Ga0495629_0157995 | Ga0495629_0157995_19_1545 | 507 |
| 11 | 3300026078 | Ga0207702_10068199 | Ga0207702_100681993 | 509 |
| 12 | 3300031731 | Ga0307405_10010307 | Ga0307405_100103075 | 513 |
| 13 | 3300031852 | Ga0307410_10056788 | Ga0307410_100567882 | 513 |
| 14 | 3300031911 | Ga0307412_10023607 | Ga0307412_100236071 | 513 |
| 15 | 3300031995 | Ga0307409_100001123 | Ga0307409_1000011236 | 513 |
| 16 | 3300032002 | Ga0307416_100002435 | Ga0307416_1000024356 | 513 |
| 17 | 3300032126 | Ga0307415_100000071 | Ga0307415_10000007136 | 513 |
| 18 | 3300005467 | Ga0070706_100085797 | Ga0070706_1000857972 | 515 |
| 19 | 3300021388 | Ga0213875_10001853 | Ga0213875_1000185311 | 516 |
| 20 | 3300037853 | Ga0436364_0077046 | Ga0436364_0077046_31869_33497 | 516 |
| 21 | 3300048907 | Ga0496104_0003435 | Ga0496104_0003435_3729_5357 | 519 |
| 22 | 3300005338 | Ga0068868_100050355 | Ga0068868_1000503553 | 521 |
| 23 | 3300005719 | Ga0068861_100051607 | Ga0068861_1000516073 | 521 |
| 24 | 3300006058 | Ga0075432_10000252 | Ga0075432_1000025213 | 521 |
| 25 | 3300006844 | Ga0075428_100033371 | Ga0075428_1000333712 | 521 |
| 26 | 3300006871 | Ga0075434_100015391 | Ga0075434_1000153913 | 521 |
| 27 | 3300006914 | Ga0075436_100024658 | Ga0075436_1000246583 | 521 |
| 28 | 3300009094 | Ga0111539_10001534 | Ga0111539_1000153424 | 521 |
| 29 | 3300009098 | Ga0105245_10014154 | Ga0105245_100141543 | 521 |
| 30 | 3300009147 | Ga0114129_10000812 | Ga0114129_1000081214 | 521 |
| 31 | 3300009148 | Ga0105243_10107299 | Ga0105243_101072992 | 521 |
| 32 | 3300009553 | Ga0105249_10009464 | Ga0105249_100094643 | 521 |
| 33 | 3300013306 | Ga0163162_10045520 | Ga0163162_100455203 | 521 |
| 34 | 3300013307 | Ga0157372_10146315 | Ga0157372_101463152 | 521 |
| 35 | 3300017792 | Ga0163161_10008009 | Ga0163161_100080093 | 521 |
| 36 | 3300025927 | Ga0207687_10125959 | Ga0207687_101259591 | 521 |
| 37 | 3300025961 | Ga0207712_10065729 | Ga0207712_100657291 | 521 |
| 38 | 3300027907 | Ga0207428_10000246 | Ga0207428_1000024614 | 521 |
| 39 | 3300033179 | Ga0307507_10058009 | Ga0307507_100580093 | 521 |
| 40 | 3300050511 | nmdc:mga08y16_66931_c1 | nmdc:mga08y16_66931_c1_728_2347 | 521 |
| 41 | 3300050512 | nmdc:mga0n895_1307_c1 | nmdc:mga0n895_1307_c1_13387_15006 | 521 |
| 42 | 3300050513 | nmdc:mga0rr50_53749_c1 | nmdc:mga0rr50_53749_c1_1159_2778 | 521 |
| 43 | 3300050515 | nmdc:mga0a205_36276_c1 | nmdc:mga0a205_36276_c1_963_2582 | 521 |
| 44 | 3300005347 | Ga0070668_100169871 | Ga0070668_1001698711 | 522 |
| 45 | 3300005467 | Ga0070706_100016803 | Ga0070706_1000168033 | 522 |
| 46 | 3300005468 | Ga0070707_100005483 | Ga0070707_1000054836 | 522 |
| 47 | 3300005842 | Ga0068858_100007354 | Ga0068858_1000073544 | 522 |
| 48 | 3300005843 | Ga0068860_100008669 | Ga0068860_1000086698 | 522 |
| 49 | 3300025922 | Ga0207646_10005754 | Ga0207646_100057548 | 522 |
| 50 | 3300028380 | Ga0268265_10030238 | Ga0268265_100302382 | 522 |
| 51 | 3300028381 | Ga0268264_10029148 | Ga0268264_100291482 | 522 |
| 52 | 3300005616 | Ga0068852_100001272 | Ga0068852_1000012726 | 523 |
| 53 | 3300005985 | Ga0081539_10002579 | Ga0081539_100025791 | 523 |
| 54 | 3300026142 | Ga0207698_10003187 | Ga0207698_100031876 | 523 |
| 55 | 3300042005 | Ga0439448_0011003 | Ga0439448_0011003_550_2178 | 523 |
| 56 | 3300042993 | Ga0439440_0000641 | Ga0439440_0000641_1100_2728 | 523 |
| 57 | 3300006847 | Ga0075431_100079027 | Ga0075431_1000790272 | 524 |
| 58 | 3300005437 | Ga0070710_10043749 | Ga0070710_100437492 | 526 |
| 59 | 3300005439 | Ga0070711_100029451 | Ga0070711_1000294513 | 526 |
| 60 | 3300005614 | Ga0068856_100056201 | Ga0068856_1000562012 | 526 |
| 61 | 3300025898 | Ga0207692_10017135 | Ga0207692_100171352 | 526 |
| 62 | 3300025906 | Ga0207699_10018875 | Ga0207699_100188753 | 526 |
| 63 | 3300025928 | Ga0207700_10035607 | Ga0207700_100356072 | 526 |
| 64 | 3300025939 | Ga0207665_10000684 | Ga0207665_1000068413 | 526 |
| 65 | 3300031616 | Ga0307508_10026785 | Ga0307508_100267854 | 526 |
| 66 | 3300048905 | Ga0496102_0082240 | Ga0496102_0082240_471_2099 | 526 |
| 67 | 3300048908 | Ga0496105_0000206 | Ga0496105_0000206_2197_3825 | 526 |
| 68 | 3300048915 | Ga0496112_0000167 | Ga0496112_0000167_33233_34861 | 526 |
| 69 | 3300048916 | Ga0496113_0000858 | Ga0496113_0000858_6427_8055 | 526 |
| 70 | 3300005841 | Ga0068863_100006850 | Ga0068863_1000068506 | 527 |
| 71 | 3300006844 | Ga0075428_100067164 | Ga0075428_1000671642 | 527 |
| 72 | 3300009177 | Ga0105248_10011203 | Ga0105248_100112034 | 527 |
| 73 | 3300013308 | Ga0157375_10050697 | Ga0157375_100506973 | 527 |
| 74 | 3300022467 | Ga0224712_10001181 | Ga0224712_100011815 | 527 |
| 75 | 3300025915 | Ga0207693_10006407 | Ga0207693_1000640710 | 527 |
| 76 | 3300028379 | Ga0268266_10013700 | Ga0268266_100137005 | 527 |
| 77 | 3300035207 | Ga0373942_0000505 | Ga0373942_0000505_1113_2744 | 527 |
| 78 | 3300046459 | Ga0495629_0099540 | Ga0495629_0099540_56_1690 | 527 |
| 79 | 3300048915 | Ga0496112_0039622 | Ga0496112_0039622_1910_3538 | 527 |
| 80 | 3300053146 | Ga0500588_0000330 | Ga0500588_0000330_4617_6245 | 528 |
| 81 | 3300005985 | Ga0081539_10002494 | Ga0081539_1000249418 | 529 |
| 82 | 3300009098 | Ga0105245_10030380 | Ga0105245_100303803 | 529 |
| 83 | 3300025927 | Ga0207687_10014753 | Ga0207687_100147533 | 529 |
| 84 | 3300046462 | Ga0495651_0014869 | Ga0495651_0014869_3429_5048 | 529 |
| 85 | 3300046472 | Ga0495580_0035662 | Ga0495580_0035662_1147_2766 | 529 |
| 86 | 3300046476 | Ga0495662_0001980 | Ga0495662_0001980_1801_3420 | 529 |
| 87 | 3300046511 | Ga0495608_0003847 | Ga0495608_0003847_3685_5304 | 529 |
| 88 | 3300046516 | Ga0495628_0004294 | Ga0495628_0004294_2682_4301 | 529 |
| 89 | 3300046526 | Ga0495666_0017129 | Ga0495666_0017129_1527_3146 | 529 |
| 90 | 3300046529 | Ga0495652_0041313 | Ga0495652_0041313_1071_2690 | 529 |
| 91 | 3300046533 | Ga0495640_0027410 | Ga0495640_0027410_1071_2690 | 529 |
| 92 | 3300046536 | Ga0495587_0022064 | Ga0495587_0022064_1443_3062 | 529 |
| 93 | 3300046543 | Ga0495645_0020551 | Ga0495645_0020551_1071_2690 | 529 |
| 94 | 3300046559 | Ga0495667_0055081 | Ga0495667_0055081_463_2082 | 529 |
| 95 | 3300046642 | Ga0495634_0021824 | Ga0495634_0021824_2039_3658 | 529 |
| 96 | 3300046663 | Ga0495635_0011633 | Ga0495635_0011633_1119_2738 | 529 |
| 97 | 3300046675 | Ga0495657_0012926 | Ga0495657_0012926_2525_4144 | 529 |
| 98 | 3300046678 | Ga0495599_0026206 | Ga0495599_0026206_591_2210 | 529 |
| 99 | 3300046680 | Ga0495646_0007368 | Ga0495646_0007368_3294_4913 | 529 |
| 100 | 3300046689 | Ga0495613_0003990 | Ga0495613_0003990_3546_5165 | 529 |
| 101 | 3300047315 | Ga0495581_0007278 | Ga0495581_0007278_2387_4006 | 529 |
| 102 | 3300047317 | Ga0495604_0015836 | Ga0495604_0015836_3429_5048 | 529 |
| 103 | 3300047444 | Ga0495675_0047123 | Ga0495675_0047123_53_1672 | 529 |
| 104 | 3300047471 | Ga0495684_0043897 | Ga0495684_0043897_733_2352 | 529 |
| 105 | 3300048088 | Ga0495602_0032335 | Ga0495602_0032335_1269_2888 | 529 |
| 106 | 3300006844 | Ga0075428_100025098 | Ga0075428_1000250981 | 530 |
| 107 | 3300006847 | Ga0075431_100000952 | Ga0075431_10000095218 | 530 |
| 108 | 3300006880 | Ga0075429_100012176 | Ga0075429_1000121764 | 530 |
| 109 | 3300009147 | Ga0114129_10000074 | Ga0114129_1000007480 | 530 |
| 110 | 3300031727 | Ga0316576_10011969 | Ga0316576_100119694 | 530 |
| 111 | 3300031728 | Ga0316578_10035876 | Ga0316578_100358763 | 530 |
| 112 | 3300044656 | Ga0466969_0000322 | Ga0466969_0000322_7412_9067 | 530 |
| 113 | 3300044684 | Ga0466966_0022754 | Ga0466966_0022754_89_1744 | 530 |
| 114 | 3300044693 | Ga0466961_0002172 | Ga0466961_0002172_4912_6567 | 530 |
| 115 | 3300044719 | Ga0466971_0003815 | Ga0466971_0003815_4606_6261 | 530 |
| 116 | 3300045049 | Ga0466959_0003872 | Ga0466959_0003872_5322_6977 | 530 |
| 117 | 3300050507 | nmdc:mga05p37_448_c1 | nmdc:mga05p37_448_c1_27940_29568 | 530 |
| 118 | 3300050508 | nmdc:mga09592_13_c1 | nmdc:mga09592_13_c1_38186_39814 | 530 |
| 119 | 3300050509 | nmdc:mga0qj67_1037_c1 | nmdc:mga0qj67_1037_c1_958_2586 | 530 |
| 120 | 3300050510 | nmdc:mga06r32_24_c1 | nmdc:mga06r32_24_c1_38204_39832 | 530 |
| 121 | 3300061719 | Ga0466962_0000098 | Ga0466962_0000098_4781_6436 | 530 |
| 122 | 3300028794 | Ga0307515_10000205 | Ga0307515_1000020532 | 531 |
| 123 | 3300035171 | Ga0373946_0024436 | Ga0373946_0024436_718_2316 | 531 |
| 124 | 3300035695 | Ga0373927_0065454 | Ga0373927_0065454_369_1967 | 531 |
| 125 | 3300035725 | Ga0373947_0030034 | Ga0373947_0030034_1247_2845 | 531 |
| 126 | 3300031616 | Ga0307508_10006175 | Ga0307508_100061752 | 532 |
| 127 | 3300031730 | Ga0307516_10023643 | Ga0307516_100236435 | 532 |
| 128 | 3300035207 | Ga0373942_0001543 | Ga0373942_0001543_3217_4845 | 532 |
| 129 | 3300005334 | Ga0068869_100040886 | Ga0068869_1000408862 | 533 |
| 130 | 3300005338 | Ga0068868_100117720 | Ga0068868_1001177201 | 533 |
| 131 | 3300005435 | Ga0070714_100064771 | Ga0070714_1000647712 | 533 |
| 132 | 3300025927 | Ga0207687_10089070 | Ga0207687_100890701 | 533 |
| 133 | 3300046536 | Ga0495587_0012446 | Ga0495587_0012446_650_2266 | 533 |
| 134 | 3300047471 | Ga0495684_0044672 | Ga0495684_0044672_686_2302 | 533 |
| 135 | 3300045049 | Ga0466959_0079481 | Ga0466959_0079481_629_2275 | 534 |
| 136 | 3300005327 | Ga0070658_10028400 | Ga0070658_100284002 | 535 |
| 137 | 3300005937 | Ga0081455_10081204 | Ga0081455_100812043 | 535 |
| 138 | 3300031824 | Ga0307413_10003652 | Ga0307413_100036522 | 535 |
| 139 | 3300031901 | Ga0307406_10002775 | Ga0307406_100027758 | 535 |
| 140 | 3300032004 | Ga0307414_10166373 | Ga0307414_101663731 | 535 |
| 141 | iso_pu_bacteria | 2687453737 | 2689961372 | 535 |
| 142 | iso_pu_bacteria | 2547132424 | 2548698711 | 536 |
| 143 | iso_pu_bacteria | 2675903060 | 2676487719 | 536 |
| 144 | iso_pu_bacteria | 2856741275 | 2856743824 | 536 |
| 145 | iso_pu_bacteria | 2873314349 | 2873320607 | 536 |
| 146 | iso_pu_bacteria | 2884693830 | 2884697757 | 536 |
| 147 | iso_pu_bacteria | 2891395885 | 2891402832 | 536 |
| 148 | iso_pu_bacteria | 2891562705 | 2891564741 | 536 |
| 149 | iso_pu_bacteria | 2895427314 | 2895431848 | 536 |
| 150 | iso_pu_bacteria | 2895442618 | 2895444858 | 536 |
| 151 | iso_pu_bacteria | 2919713450 | 2919719396 | 536 |
| 152 | iso_pu_bacteria | 8055172936 | 8055178521 | 536 |
| 153 | iso_pu_bacteria | 8056054917 | 8056056993 | 536 |
| 154 | 3300005471 | Ga0070698_100003756 | Ga0070698_1000037566 | 537 |
| 155 | iso_pu_bacteria | 2501939600 | 2501944661 | 537 |
| 156 | iso_pu_bacteria | 2515154088 | 2515493664 | 537 |
| 157 | iso_pu_bacteria | 2515154137 | 2515759583 | 537 |
| 158 | iso_pu_bacteria | 2515154155 | 2515855615 | 537 |
| 159 | iso_pu_bacteria | 2515154203 | 2516087804 | 537 |
| 160 | iso_pu_bacteria | 2558860280 | 2559429097 | 537 |
| 161 | iso_pu_bacteria | 2582580736 | 2583151264 | 537 |
| 162 | iso_pu_bacteria | 2622736605 | 2623499588 | 537 |
| 163 | iso_pu_bacteria | 2622736626 | 2623586784 | 537 |
| 164 | iso_pu_bacteria | 2643221601 | 2644017908 | 537 |
| 165 | iso_pu_bacteria | 2643221631 | 2644180804 | 537 |
| 166 | iso_pu_bacteria | 2675903058 | 2676473409 | 537 |
| 167 | iso_pu_bacteria | 2675903059 | 2676480440 | 537 |
| 168 | iso_pu_bacteria | 2728369276 | 2729909163 | 537 |
| 169 | iso_pu_bacteria | 2751185782 | 2753263540 | 537 |
| 170 | iso_pu_bacteria | 2772190715 | 2772646232 | 537 |
| 171 | iso_pu_bacteria | 2791354901 | 2791910369 | 537 |
| 172 | iso_pu_bacteria | 2818991472 | 2819740132 | 537 |
| 173 | iso_pu_bacteria | 2827628540 | 2827631919 | 537 |
| 174 | iso_pu_bacteria | 2831935698 | 2831938655 | 537 |
| 175 | iso_pu_bacteria | 2832004796 | 2832006397 | 537 |
| 176 | iso_pu_bacteria | 2855670206 | 2855671426 | 537 |
| 177 | iso_pu_bacteria | 2855676851 | 2855680673 | 537 |
| 178 | iso_pu_bacteria | 2855683550 | 2855684816 | 537 |
| 179 | iso_pu_bacteria | 2856858025 | 2856860694 | 537 |
| 180 | iso_pu_bacteria | 2857288857 | 2857292122 | 537 |
| 181 | iso_pu_bacteria | 2858848962 | 2858850917 | 537 |
| 182 | iso_pu_bacteria | 2858868258 | 2858870798 | 537 |
| 183 | iso_pu_bacteria | 2858882152 | 2858883722 | 537 |
| 184 | iso_pu_bacteria | 2858888857 | 2858894198 | 537 |
| 185 | iso_pu_bacteria | 2858895516 | 2858901068 | 537 |
| 186 | iso_pu_bacteria | 2858902515 | 2858903470 | 537 |
| 187 | iso_pu_bacteria | 2861520306 | 2861527883 | 537 |
| 188 | iso_pu_bacteria | 2866065130 | 2866067243 | 537 |
| 189 | iso_pu_bacteria | 2866612099 | 2866613477 | 537 |
| 190 | iso_pu_bacteria | 2867302475 | 2867306547 | 537 |
| 191 | iso_pu_bacteria | 2867312974 | 2867313035 | 537 |
| 192 | iso_pu_bacteria | 2867319477 | 2867325059 | 537 |
| 193 | iso_pu_bacteria | 2867507094 | 2867509634 | 537 |
| 194 | iso_pu_bacteria | 2869048445 | 2869052197 | 537 |
| 195 | iso_pu_bacteria | 2869061728 | 2869068065 | 537 |
| 196 | iso_pu_bacteria | 2869068681 | 2869070793 | 537 |
| 197 | iso_pu_bacteria | 2880489317 | 2880493422 | 537 |
| 198 | iso_pu_bacteria | 2880495981 | 2880498885 | 537 |
| 199 | iso_pu_bacteria | 2887478801 | 2887483933 | 537 |
| 200 | iso_pu_bacteria | 2891326441 | 2891330181 | 537 |
| 201 | iso_pu_bacteria | 2891554331 | 2891560306 | 537 |
| 202 | iso_pu_bacteria | 2902582711 | 2902585560 | 537 |
| 203 | iso_pu_bacteria | 2929219909 | 2929220891 | 537 |
| 204 | iso_pu_bacteria | 2929226422 | 2929227477 | 537 |
| 205 | iso_pu_bacteria | 2996221748 | 2996225734 | 537 |
| 206 | iso_pu_bacteria | 3002998708 | 3003007673 | 537 |
| 207 | iso_pu_bacteria | 649633069 | 649811429 | 537 |
| 208 | iso_pu_bacteria | 8001781756 | 8001783706 | 537 |
| 209 | iso_pu_bacteria | 8001781756 | 8001784826 | 537 |
| 210 | iso_pu_bacteria | 8003830390 | 8003830789 | 537 |
| 211 | iso_pu_bacteria | 8003856774 | 8003860032 | 537 |
| 212 | iso_pu_bacteria | 8003870546 | 8003871434 | 537 |
| 213 | iso_pu_bacteria | 8053945823 | 8053949036 | 537 |
| 214 | iso_pu_bacteria | 8054704163 | 8054710878 | 537 |
| 215 | iso_pu_bacteria | 8054727385 | 8054727530 | 537 |
| 216 | iso_pu_bacteria | 8054734606 | 8054734976 | 537 |
| 217 | iso_pu_bacteria | 8055412473 | 8055413707 | 537 |
| 218 | 3300005366 | Ga0070659_100023208 | Ga0070659_1000232083 | 538 |
| 219 | 3300005441 | Ga0070700_100009712 | Ga0070700_1000097122 | 538 |
| 220 | 3300005981 | Ga0081538_10000147 | Ga0081538_1000014751 | 538 |
| 221 | 3300009094 | Ga0111539_10014298 | Ga0111539_100142981 | 538 |
| 222 | 3300009094 | Ga0111539_10159356 | Ga0111539_101593563 | 538 |
| 223 | 3300009147 | Ga0114129_10036542 | Ga0114129_100365424 | 538 |
| 224 | 3300009147 | Ga0114129_10210742 | Ga0114129_102107422 | 538 |
| 225 | 3300025926 | Ga0207659_10066567 | Ga0207659_100665672 | 538 |
| 226 | 3300027907 | Ga0207428_10002279 | Ga0207428_100022797 | 538 |
| 227 | 3300046543 | Ga0495645_0004178 | Ga0495645_0004178_2566_4185 | 538 |
| 228 | 3300047444 | Ga0495675_0044083 | Ga0495675_0044083_42_1661 | 538 |
| 229 | iso_pu_bacteria | 2643221601 | 2644013592 | 538 |
| 230 | iso_pu_bacteria | 2643221631 | 2644179227 | 538 |
| 231 | iso_pu_bacteria | 2816332119 | 2816423930 | 538 |
| 232 | iso_pu_bacteria | 2818991472 | 2819742529 | 538 |
| 233 | iso_pu_bacteria | 2995463766 | 2995464913 | 538 |
| 234 | 3300031456 | Ga0307513_10047087 | Ga0307513_100470876 | 539 |
| 235 | 3300031730 | Ga0307516_10021531 | Ga0307516_100215313 | 539 |
| 236 | iso_pu_bacteria | 2902837492 | 2902843865 | 539 |
| 237 | iso_pu_bacteria | 8056207758 | 8056207973 | 539 |
| 238 | 3300005329 | Ga0070683_100000236 | Ga0070683_10000023614 | 540 |
| 239 | 3300005336 | Ga0070680_100119905 | Ga0070680_1001199051 | 540 |
| 240 | 3300005458 | Ga0070681_10022796 | Ga0070681_100227966 | 540 |
| 241 | 3300005467 | Ga0070706_100000040 | Ga0070706_100000040112 | 540 |
| 242 | 3300005467 | Ga0070706_100039173 | Ga0070706_1000391732 | 540 |
| 243 | 3300005468 | Ga0070707_100025820 | Ga0070707_1000258202 | 540 |
| 244 | 3300005471 | Ga0070698_100157754 | Ga0070698_1001577542 | 540 |
| 245 | 3300005530 | Ga0070679_100182353 | Ga0070679_1001823531 | 540 |
| 246 | 3300005535 | Ga0070684_100011504 | Ga0070684_1000115045 | 540 |
| 247 | 3300005547 | Ga0070693_100067367 | Ga0070693_1000673671 | 540 |
| 248 | 3300005578 | Ga0068854_100010227 | Ga0068854_1000102278 | 540 |
| 249 | 3300006028 | Ga0070717_10000229 | Ga0070717_1000022919 | 540 |
| 250 | 3300006871 | Ga0075434_100179563 | Ga0075434_1001795632 | 540 |
| 251 | 3300006914 | Ga0075436_100002418 | Ga0075436_1000024182 | 540 |
| 252 | 3300007076 | Ga0075435_100007304 | Ga0075435_1000073044 | 540 |
| 253 | 3300009093 | Ga0105240_10015717 | Ga0105240_100157175 | 540 |
| 254 | 3300010375 | Ga0105239_10195041 | Ga0105239_101950412 | 540 |
| 255 | 3300025910 | Ga0207684_10000012 | Ga0207684_10000012326 | 540 |
| 256 | 3300025913 | Ga0207695_10014951 | Ga0207695_100149513 | 540 |
| 257 | 3300025915 | Ga0207693_10094019 | Ga0207693_100940192 | 540 |
| 258 | 3300025917 | Ga0207660_10020746 | Ga0207660_100207464 | 540 |
| 259 | 3300025921 | Ga0207652_10007974 | Ga0207652_100079747 | 540 |
| 260 | 3300025922 | Ga0207646_10002067 | Ga0207646_1000206722 | 540 |
| 261 | 3300025935 | Ga0207709_10036325 | Ga0207709_100363252 | 540 |
| 262 | 3300025944 | Ga0207661_10004182 | Ga0207661_100041828 | 540 |
| 263 | 3300025981 | Ga0207640_10041468 | Ga0207640_100414682 | 540 |
| 264 | 3300026075 | Ga0207708_10000029 | Ga0207708_10000029127 | 540 |
| 265 | 3300026095 | Ga0207676_10066474 | Ga0207676_100664743 | 540 |
| 266 | 3300026116 | Ga0207674_10112258 | Ga0207674_101122582 | 540 |
| 267 | 3300028800 | Ga0265338_10144101 | Ga0265338_101441012 | 540 |
| 268 | 3300031251 | Ga0265327_10000329 | Ga0265327_1000032972 | 540 |
| 269 | 3300031251 | Ga0265327_10005907 | Ga0265327_100059076 | 540 |
| 270 | 3300031456 | Ga0307513_10000001 | Ga0307513_10000001500 | 540 |
| 271 | 3300031595 | Ga0265313_10007457 | Ga0265313_100074573 | 540 |
| 272 | 3300041406 | Ga0439439_0009397 | Ga0439439_0009397_451_2076 | 540 |
| 273 | 3300041999 | Ga0439433_0012465 | Ga0439433_0012465_13_1638 | 540 |
| 274 | 3300042014 | Ga0439457_000249 | Ga0439457_000249_9702_11327 | 540 |
| 275 | 3300044656 | Ga0466969_0024959 | Ga0466969_0024959_767_2392 | 540 |
| 276 | 3300044694 | Ga0466963_0000881 | Ga0466963_0000881_1557_3188 | 540 |
| 277 | 3300044694 | Ga0466963_0017505 | Ga0466963_0017505_1708_3339 | 540 |
| 278 | 3300044842 | Ga0466957_0047954 | Ga0466957_0047954_750_2381 | 540 |
| 279 | 3300045836 | Ga0466958_0013335 | Ga0466958_0013335_2076_3707 | 540 |
| 280 | 3300045976 | Ga0466967_0003468 | Ga0466967_0003468_3686_5317 | 540 |
| 281 | 3300045976 | Ga0466967_0003723 | Ga0466967_0003723_1110_2741 | 540 |
| 282 | 3300045976 | Ga0466967_0008345 | Ga0466967_0008345_5697_7328 | 540 |
| 283 | 3300045976 | Ga0466967_0013375 | Ga0466967_0013375_4202_5833 | 540 |
| 284 | 3300046454 | Ga0495592_0039813 | Ga0495592_0039813_32_1657 | 540 |
| 285 | 3300046472 | Ga0495580_0013333 | Ga0495580_0013333_3582_5207 | 540 |
| 286 | 3300046476 | Ga0495662_0014989 | Ga0495662_0014989_1873_3498 | 540 |
| 287 | 3300046477 | Ga0495664_0002361 | Ga0495664_0002361_5169_6794 | 540 |
| 288 | 3300046511 | Ga0495608_0001337 | Ga0495608_0001337_5801_7426 | 540 |
| 289 | 3300046514 | Ga0495618_0030895 | Ga0495618_0030895_469_2094 | 540 |
| 290 | 3300046514 | Ga0495618_0100279 | Ga0495618_0100279_105_1730 | 540 |
| 291 | 3300046516 | Ga0495628_0007279 | Ga0495628_0007279_2657_4282 | 540 |
| 292 | 3300046531 | Ga0495665_0000174 | Ga0495665_0000174_8864_10489 | 540 |
| 293 | 3300046533 | Ga0495640_0018426 | Ga0495640_0018426_268_1893 | 540 |
| 294 | 3300046535 | Ga0495586_0006408 | Ga0495586_0006408_4114_5739 | 540 |
| 295 | 3300046543 | Ga0495645_0017837 | Ga0495645_0017837_2517_4142 | 540 |
| 296 | 3300046559 | Ga0495667_0040952 | Ga0495667_0040952_1031_2656 | 540 |
| 297 | 3300046663 | Ga0495635_0057545 | Ga0495635_0057545_985_2610 | 540 |
| 298 | 3300046675 | Ga0495657_0035385 | Ga0495657_0035385_806_2431 | 540 |
| 299 | 3300046680 | Ga0495646_0026554 | Ga0495646_0026554_1332_2957 | 540 |
| 300 | 3300046689 | Ga0495613_0002951 | Ga0495613_0002951_5928_7553 | 540 |
| 301 | 3300047317 | Ga0495604_0000604 | Ga0495604_0000604_23198_24823 | 540 |
| 302 | 3300047673 | Ga0495593_0010466 | Ga0495593_0010466_2968_4593 | 540 |
| 303 | 3300048903 | Ga0496100_0011219 | Ga0496100_0011219_3256_4887 | 540 |
| 304 | 3300048904 | Ga0496101_0028662 | Ga0496101_0028662_1739_3370 | 540 |
| 305 | 3300048908 | Ga0496105_0060471 | Ga0496105_0060471_551_2182 | 540 |
| 306 | 3300048909 | Ga0496106_0032172 | Ga0496106_0032172_2227_3858 | 540 |
| 307 | 3300048911 | Ga0496108_0003488 | Ga0496108_0003488_7396_9027 | 540 |
| 308 | 3300048912 | Ga0496109_0002466 | Ga0496109_0002466_6907_8538 | 540 |
| 309 | 3300048913 | Ga0496110_0058650 | Ga0496110_0058650_1463_3094 | 540 |
| 310 | 3300048915 | Ga0496112_0009573 | Ga0496112_0009573_2784_4415 | 540 |
| 311 | 3300048918 | Ga0496115_0001834 | Ga0496115_0001834_8101_9732 | 540 |
| 312 | 3300048918 | Ga0496115_0112789 | Ga0496115_0112789_209_1840 | 540 |
| 313 | 3300049586 | Ga0501070_0039493 | Ga0501070_0039493_1134_2759 | 540 |
| 314 | 3300049742 | Ga0501080_0090596 | Ga0501080_0090596_171_1796 | 540 |
| 315 | 3300050512 | nmdc:mga0n895_181713_c1 | nmdc:mga0n895_181713_c1_295_1926 | 540 |
| 316 | 3300050512 | nmdc:mga0n895_68042_c1 | nmdc:mga0n895_68042_c1_1121_2752 | 540 |
| 317 | 3300050513 | nmdc:mga0rr50_15311_c1 | nmdc:mga0rr50_15311_c1_1363_2994 | 540 |
| 318 | 3300050514 | nmdc:mga08x19_15613_c1 | nmdc:mga08x19_15613_c1_1829_3460 | 540 |
| 319 | 3300053077 | Ga0495601_0003722 | Ga0495601_0003722_605_2230 | 540 |
| 320 | 3300053140 | Ga0500573_0035428 | Ga0500573_0035428_359_1984 | 540 |
| 321 | 3300053143 | Ga0500579_073466 | Ga0500579_073466_255_1880 | 540 |
| 322 | 3300053149 | Ga0500600_0055525 | Ga0500600_0055525_206_1831 | 540 |
| 323 | iso_pu_bacteria | 2643221687 | 2644490989 | 540 |
| 324 | 3300003203 | JGI25406J46586_10003320 | JGI25406J46586_100033205 | 541 |
| 325 | 3300003659 | JGI25404J52841_10001280 | JGI25404J52841_100012802 | 541 |
| 326 | 3300005327 | Ga0070658_10016387 | Ga0070658_100163872 | 541 |
| 327 | 3300005327 | Ga0070658_10061570 | Ga0070658_100615702 | 541 |
| 328 | 3300005329 | Ga0070683_100063537 | Ga0070683_1000635373 | 541 |
| 329 | 3300005330 | Ga0070690_100046565 | Ga0070690_1000465652 | 541 |
| 330 | 3300005334 | Ga0068869_100003606 | Ga0068869_1000036066 | 541 |
| 331 | 3300005334 | Ga0068869_100015454 | Ga0068869_1000154546 | 541 |
| 332 | 3300005334 | Ga0068869_100020213 | Ga0068869_1000202132 | 541 |
| 333 | 3300005336 | Ga0070680_100023060 | Ga0070680_1000230603 | 541 |
| 334 | 3300005336 | Ga0070680_100074535 | Ga0070680_1000745352 | 541 |
| 335 | 3300005337 | Ga0070682_100021149 | Ga0070682_1000211495 | 541 |
| 336 | 3300005337 | Ga0070682_100082961 | Ga0070682_1000829611 | 541 |
| 337 | 3300005338 | Ga0068868_100004884 | Ga0068868_1000048843 | 541 |
| 338 | 3300005338 | Ga0068868_100010826 | Ga0068868_1000108266 | 541 |
| 339 | 3300005339 | Ga0070660_100045836 | Ga0070660_1000458363 | 541 |
| 340 | 3300005340 | Ga0070689_100098133 | Ga0070689_1000981332 | 541 |
| 341 | 3300005345 | Ga0070692_10015787 | Ga0070692_100157872 | 541 |
| 342 | 3300005345 | Ga0070692_10031558 | Ga0070692_100315582 | 541 |
| 343 | 3300005354 | Ga0070675_100000474 | Ga0070675_10000047414 | 541 |
| 344 | 3300005354 | Ga0070675_100017552 | Ga0070675_1000175523 | 541 |
| 345 | 3300005355 | Ga0070671_100010047 | Ga0070671_1000100472 | 541 |
| 346 | 3300005356 | Ga0070674_100034076 | Ga0070674_1000340762 | 541 |
| 347 | 3300005356 | Ga0070674_100063498 | Ga0070674_1000634981 | 541 |
| 348 | 3300005366 | Ga0070659_100074678 | Ga0070659_1000746782 | 541 |
| 349 | 3300005367 | Ga0070667_100060409 | Ga0070667_1000604093 | 541 |
| 350 | 3300005406 | Ga0070703_10017981 | Ga0070703_100179812 | 541 |
| 351 | 3300005435 | Ga0070714_100000748 | Ga0070714_1000007487 | 541 |
| 352 | 3300005435 | Ga0070714_100007010 | Ga0070714_1000070105 | 541 |
| 353 | 3300005437 | Ga0070710_10000038 | Ga0070710_1000003833 | 541 |
| 354 | 3300005441 | Ga0070700_100021673 | Ga0070700_1000216732 | 541 |
| 355 | 3300005445 | Ga0070708_100001458 | Ga0070708_1000014588 | 541 |
| 356 | 3300005455 | Ga0070663_100005762 | Ga0070663_1000057622 | 541 |
| 357 | 3300005455 | Ga0070663_100012822 | Ga0070663_1000128223 | 541 |
| 358 | 3300005455 | Ga0070663_100035486 | Ga0070663_1000354862 | 541 |
| 359 | 3300005456 | Ga0070678_100035483 | Ga0070678_1000354832 | 541 |
| 360 | 3300005458 | Ga0070681_10012788 | Ga0070681_100127884 | 541 |
| 361 | 3300005458 | Ga0070681_10075668 | Ga0070681_100756682 | 541 |
| 362 | 3300005458 | Ga0070681_10183072 | Ga0070681_101830721 | 541 |
| 363 | 3300005467 | Ga0070706_100005462 | Ga0070706_1000054626 | 541 |
| 364 | 3300005468 | Ga0070707_100017512 | Ga0070707_1000175123 | 541 |
| 365 | 3300005471 | Ga0070698_100000882 | Ga0070698_1000008829 | 541 |
| 366 | 3300005530 | Ga0070679_100022803 | Ga0070679_1000228032 | 541 |
| 367 | 3300005530 | Ga0070679_100055772 | Ga0070679_1000557722 | 541 |
| 368 | 3300005530 | Ga0070679_100142805 | Ga0070679_1001428051 | 541 |
| 369 | 3300005535 | Ga0070684_100014776 | Ga0070684_1000147766 | 541 |
| 370 | 3300005536 | Ga0070697_100004326 | Ga0070697_1000043266 | 541 |
| 371 | 3300005543 | Ga0070672_100069484 | Ga0070672_1000694843 | 541 |
| 372 | 3300005544 | Ga0070686_100030018 | Ga0070686_1000300182 | 541 |
| 373 | 3300005547 | Ga0070693_100000306 | Ga0070693_1000003064 | 541 |
| 374 | 3300005547 | Ga0070693_100018379 | Ga0070693_1000183793 | 541 |
| 375 | 3300005548 | Ga0070665_100009637 | Ga0070665_1000096373 | 541 |
| 376 | 3300005548 | Ga0070665_100036664 | Ga0070665_1000366645 | 541 |
| 377 | 3300005563 | Ga0068855_100008986 | Ga0068855_1000089866 | 541 |
| 378 | 3300005564 | Ga0070664_100002642 | Ga0070664_1000026429 | 541 |
| 379 | 3300005564 | Ga0070664_100022108 | Ga0070664_1000221084 | 541 |
| 380 | 3300005577 | Ga0068857_100020839 | Ga0068857_1000208393 | 541 |
| 381 | 3300005577 | Ga0068857_100195580 | Ga0068857_1001955801 | 541 |
| 382 | 3300005615 | Ga0070702_100000311 | Ga0070702_1000003112 | 541 |
| 383 | 3300005616 | Ga0068852_100020490 | Ga0068852_1000204904 | 541 |
| 384 | 3300005617 | Ga0068859_100090513 | Ga0068859_1000905133 | 541 |
| 385 | 3300005618 | Ga0068864_100005592 | Ga0068864_1000055922 | 541 |
| 386 | 3300005618 | Ga0068864_100020948 | Ga0068864_1000209483 | 541 |
| 387 | 3300005618 | Ga0068864_100120732 | Ga0068864_1001207322 | 541 |
| 388 | 3300005718 | Ga0068866_10018583 | Ga0068866_100185832 | 541 |
| 389 | 3300005719 | Ga0068861_100150778 | Ga0068861_1001507781 | 541 |
| 390 | 3300005834 | Ga0068851_10007201 | Ga0068851_100072012 | 541 |
| 391 | 3300005840 | Ga0068870_10012656 | Ga0068870_100126565 | 541 |
| 392 | 3300005841 | Ga0068863_100003223 | Ga0068863_1000032236 | 541 |
| 393 | 3300005841 | Ga0068863_100069921 | Ga0068863_1000699212 | 541 |
| 394 | 3300005841 | Ga0068863_100073859 | Ga0068863_1000738591 | 541 |
| 395 | 3300005842 | Ga0068858_100028675 | Ga0068858_1000286752 | 541 |
| 396 | 3300005842 | Ga0068858_100052493 | Ga0068858_1000524932 | 541 |
| 397 | 3300005843 | Ga0068860_100074495 | Ga0068860_1000744954 | 541 |
| 398 | 3300005937 | Ga0081455_10000852 | Ga0081455_1000085216 | 541 |
| 399 | 3300005937 | Ga0081455_10002204 | Ga0081455_1000220410 | 541 |
| 400 | 3300005937 | Ga0081455_10004392 | Ga0081455_1000439211 | 541 |
| 401 | 3300005937 | Ga0081455_10059855 | Ga0081455_100598553 | 541 |
| 402 | 3300005937 | Ga0081455_10070056 | Ga0081455_100700562 | 541 |
| 403 | 3300005937 | Ga0081455_10078910 | Ga0081455_100789102 | 541 |
| 404 | 3300005981 | Ga0081538_10000072 | Ga0081538_1000007278 | 541 |
| 405 | 3300005981 | Ga0081538_10021992 | Ga0081538_100219923 | 541 |
| 406 | 3300005983 | Ga0081540_1000299 | Ga0081540_100029943 | 541 |
| 407 | 3300005983 | Ga0081540_1009660 | Ga0081540_10096602 | 541 |
| 408 | 3300005983 | Ga0081540_1015600 | Ga0081540_10156004 | 541 |
| 409 | 3300005985 | Ga0081539_10000111 | Ga0081539_1000011168 | 541 |
| 410 | 3300005985 | Ga0081539_10001764 | Ga0081539_1000176427 | 541 |
| 411 | 3300005985 | Ga0081539_10010149 | Ga0081539_100101495 | 541 |
| 412 | 3300006028 | Ga0070717_10029695 | Ga0070717_100296953 | 541 |
| 413 | 3300006028 | Ga0070717_10080161 | Ga0070717_100801611 | 541 |
| 414 | 3300006038 | Ga0075365_10061294 | Ga0075365_100612942 | 541 |
| 415 | 3300006058 | Ga0075432_10000174 | Ga0075432_100001748 | 541 |
| 416 | 3300006173 | Ga0070716_100024720 | Ga0070716_1000247201 | 541 |
| 417 | 3300006237 | Ga0097621_100036803 | Ga0097621_1000368032 | 541 |
| 418 | 3300006358 | Ga0068871_100036569 | Ga0068871_1000365692 | 541 |
| 419 | 3300006844 | Ga0075428_100003332 | Ga0075428_1000033324 | 541 |
| 420 | 3300006844 | Ga0075428_100012968 | Ga0075428_1000129685 | 541 |
| 421 | 3300006844 | Ga0075428_100099808 | Ga0075428_1000998081 | 541 |
| 422 | 3300006844 | Ga0075428_100117637 | Ga0075428_1001176372 | 541 |
| 423 | 3300006846 | Ga0075430_100000718 | Ga0075430_10000071817 | 541 |
| 424 | 3300006846 | Ga0075430_100010462 | Ga0075430_1000104623 | 541 |
| 425 | 3300006847 | Ga0075431_100001854 | Ga0075431_1000018542 | 541 |
| 426 | 3300006847 | Ga0075431_100006192 | Ga0075431_1000061924 | 541 |
| 427 | 3300006852 | Ga0075433_10130506 | Ga0075433_101305062 | 541 |
| 428 | 3300006871 | Ga0075434_100001116 | Ga0075434_1000011169 | 541 |
| 429 | 3300006871 | Ga0075434_100005314 | Ga0075434_1000053145 | 541 |
| 430 | 3300006880 | Ga0075429_100010863 | Ga0075429_1000108636 | 541 |
| 431 | 3300006881 | Ga0068865_100111050 | Ga0068865_1001110502 | 541 |
| 432 | 3300006914 | Ga0075436_100000994 | Ga0075436_10000099416 | 541 |
| 433 | 3300006931 | Ga0097620_100090512 | Ga0097620_1000905123 | 541 |
| 434 | 3300007076 | Ga0075435_100000791 | Ga0075435_10000079111 | 541 |
| 435 | 3300007076 | Ga0075435_100003771 | Ga0075435_1000037716 | 541 |
| 436 | 3300009011 | Ga0105251_10010563 | Ga0105251_100105634 | 541 |
| 437 | 3300009094 | Ga0111539_10000480 | Ga0111539_1000048032 | 541 |
| 438 | 3300009094 | Ga0111539_10013207 | Ga0111539_100132073 | 541 |
| 439 | 3300009094 | Ga0111539_10209500 | Ga0111539_102095001 | 541 |
| 440 | 3300009098 | Ga0105245_10050453 | Ga0105245_100504533 | 541 |
| 441 | 3300009098 | Ga0105245_10083181 | Ga0105245_100831812 | 541 |
| 442 | 3300009098 | Ga0105245_10117054 | Ga0105245_101170542 | 541 |
| 443 | 3300009101 | Ga0105247_10044249 | Ga0105247_100442493 | 541 |
| 444 | 3300009147 | Ga0114129_10000860 | Ga0114129_1000086011 | 541 |
| 445 | 3300009147 | Ga0114129_10078900 | Ga0114129_100789003 | 541 |
| 446 | 3300009148 | Ga0105243_10004905 | Ga0105243_1000490511 | 541 |
| 447 | 3300009177 | Ga0105248_10030258 | Ga0105248_100302586 | 541 |
| 448 | 3300009177 | Ga0105248_10040543 | Ga0105248_100405435 | 541 |
| 449 | 3300009545 | Ga0105237_10006790 | Ga0105237_1000679012 | 541 |
| 450 | 3300009551 | Ga0105238_10046069 | Ga0105238_100460692 | 541 |
| 451 | 3300011119 | Ga0105246_10000477 | Ga0105246_100004772 | 541 |
| 452 | 3300011119 | Ga0105246_10041874 | Ga0105246_100418742 | 541 |
| 453 | 3300012507 | Ga0157342_1001244 | Ga0157342_10012442 | 541 |
| 454 | 3300013100 | Ga0157373_10066593 | Ga0157373_100665932 | 541 |
| 455 | 3300013297 | Ga0157378_10044901 | Ga0157378_100449012 | 541 |
| 456 | 3300013307 | Ga0157372_10000031 | Ga0157372_1000003130 | 541 |
| 457 | 3300013307 | Ga0157372_10070789 | Ga0157372_100707894 | 541 |
| 458 | 3300013307 | Ga0157372_10135749 | Ga0157372_101357491 | 541 |
| 459 | 3300013308 | Ga0157375_10057277 | Ga0157375_100572772 | 541 |
| 460 | 3300014325 | Ga0163163_10022605 | Ga0163163_100226057 | 541 |
| 461 | 3300014325 | Ga0163163_10057192 | Ga0163163_100571923 | 541 |
| 462 | 3300014745 | Ga0157377_10045163 | Ga0157377_100451632 | 541 |
| 463 | 3300014968 | Ga0157379_10028196 | Ga0157379_100281964 | 541 |
| 464 | 3300020070 | Ga0206356_10233614 | Ga0206356_102336141 | 541 |
| 465 | 3300020070 | Ga0206356_11006926 | Ga0206356_110069263 | 541 |
| 466 | 3300020078 | Ga0206352_10520446 | Ga0206352_105204461 | 541 |
| 467 | 3300020080 | Ga0206350_10547176 | Ga0206350_105471761 | 541 |
| 468 | 3300020082 | Ga0206353_10598622 | Ga0206353_105986222 | 541 |
| 469 | 3300021384 | Ga0213876_10007156 | Ga0213876_100071563 | 541 |
| 470 | 3300021388 | Ga0213875_10012012 | Ga0213875_100120124 | 541 |
| 471 | 3300022467 | Ga0224712_10001326 | Ga0224712_100013261 | 541 |
| 472 | 3300022467 | Ga0224712_10017876 | Ga0224712_100178762 | 541 |
| 473 | 3300025321 | Ga0207656_10008362 | Ga0207656_100083622 | 541 |
| 474 | 3300025885 | Ga0207653_10003687 | Ga0207653_100036873 | 541 |
| 475 | 3300025898 | Ga0207692_10033123 | Ga0207692_100331232 | 541 |
| 476 | 3300025899 | Ga0207642_10018397 | Ga0207642_100183971 | 541 |
| 477 | 3300025901 | Ga0207688_10002120 | Ga0207688_100021202 | 541 |
| 478 | 3300025901 | Ga0207688_10005833 | Ga0207688_100058334 | 541 |
| 479 | 3300025905 | Ga0207685_10029334 | Ga0207685_100293342 | 541 |
| 480 | 3300025906 | Ga0207699_10013452 | Ga0207699_100134522 | 541 |
| 481 | 3300025906 | Ga0207699_10027577 | Ga0207699_100275772 | 541 |
| 482 | 3300025908 | Ga0207643_10001058 | Ga0207643_100010589 | 541 |
| 483 | 3300025909 | Ga0207705_10003565 | Ga0207705_100035659 | 541 |
| 484 | 3300025910 | Ga0207684_10014711 | Ga0207684_100147113 | 541 |
| 485 | 3300025912 | Ga0207707_10121776 | Ga0207707_101217763 | 541 |
| 486 | 3300025917 | Ga0207660_10115754 | Ga0207660_101157542 | 541 |
| 487 | 3300025919 | Ga0207657_10002605 | Ga0207657_100026059 | 541 |
| 488 | 3300025920 | Ga0207649_10003412 | Ga0207649_100034129 | 541 |
| 489 | 3300025921 | Ga0207652_10004799 | Ga0207652_100047992 | 541 |
| 490 | 3300025922 | Ga0207646_10013787 | Ga0207646_100137875 | 541 |
| 491 | 3300025925 | Ga0207650_10003121 | Ga0207650_100031218 | 541 |
| 492 | 3300025926 | Ga0207659_10039758 | Ga0207659_100397583 | 541 |
| 493 | 3300025927 | Ga0207687_10040111 | Ga0207687_100401112 | 541 |
| 494 | 3300025928 | Ga0207700_10019277 | Ga0207700_100192774 | 541 |
| 495 | 3300025928 | Ga0207700_10031111 | Ga0207700_100311113 | 541 |
| 496 | 3300025929 | Ga0207664_10004984 | Ga0207664_100049846 | 541 |
| 497 | 3300025929 | Ga0207664_10017678 | Ga0207664_100176783 | 541 |
| 498 | 3300025929 | Ga0207664_10051507 | Ga0207664_100515072 | 541 |
| 499 | 3300025933 | Ga0207706_10010254 | Ga0207706_100102545 | 541 |
| 500 | 3300025933 | Ga0207706_10024674 | Ga0207706_100246744 | 541 |
| 501 | 3300025935 | Ga0207709_10056786 | Ga0207709_100567862 | 541 |
| 502 | 3300025936 | Ga0207670_10114304 | Ga0207670_101143042 | 541 |
| 503 | 3300025937 | Ga0207669_10038735 | Ga0207669_100387352 | 541 |
| 504 | 3300025938 | Ga0207704_10083497 | Ga0207704_100834972 | 541 |
| 505 | 3300025939 | Ga0207665_10027979 | Ga0207665_100279793 | 541 |
| 506 | 3300025940 | Ga0207691_10021953 | Ga0207691_100219534 | 541 |
| 507 | 3300025941 | Ga0207711_10039479 | Ga0207711_100394793 | 541 |
| 508 | 3300025941 | Ga0207711_10143220 | Ga0207711_101432202 | 541 |
| 509 | 3300025942 | Ga0207689_10002005 | Ga0207689_1000200521 | 541 |
| 510 | 3300025942 | Ga0207689_10003674 | Ga0207689_100036743 | 541 |
| 511 | 3300025942 | Ga0207689_10017358 | Ga0207689_100173582 | 541 |
| 512 | 3300025944 | Ga0207661_10018102 | Ga0207661_100181025 | 541 |
| 513 | 3300025945 | Ga0207679_10005249 | Ga0207679_100052492 | 541 |
| 514 | 3300025949 | Ga0207667_10128573 | Ga0207667_101285732 | 541 |
| 515 | 3300025960 | Ga0207651_10018497 | Ga0207651_100184972 | 541 |
| 516 | 3300025960 | Ga0207651_10056984 | Ga0207651_100569843 | 541 |
| 517 | 3300025972 | Ga0207668_10001275 | Ga0207668_100012752 | 541 |
| 518 | 3300025986 | Ga0207658_10039275 | Ga0207658_100392752 | 541 |
| 519 | 3300026023 | Ga0207677_10121688 | Ga0207677_101216882 | 541 |
| 520 | 3300026035 | Ga0207703_10027684 | Ga0207703_100276842 | 541 |
| 521 | 3300026067 | Ga0207678_10000891 | Ga0207678_100008918 | 541 |
| 522 | 3300026067 | Ga0207678_10001928 | Ga0207678_100019285 | 541 |
| 523 | 3300026075 | Ga0207708_10003482 | Ga0207708_100034822 | 541 |
| 524 | 3300026078 | Ga0207702_10000901 | Ga0207702_1000090121 | 541 |
| 525 | 3300026078 | Ga0207702_10033797 | Ga0207702_100337974 | 541 |
| 526 | 3300026088 | Ga0207641_10016995 | Ga0207641_100169954 | 541 |
| 527 | 3300026088 | Ga0207641_10018373 | Ga0207641_100183731 | 541 |
| 528 | 3300026088 | Ga0207641_10127024 | Ga0207641_101270242 | 541 |
| 529 | 3300026095 | Ga0207676_10000683 | Ga0207676_1000068319 | 541 |
| 530 | 3300026116 | Ga0207674_10021848 | Ga0207674_100218484 | 541 |
| 531 | 3300026116 | Ga0207674_10039302 | Ga0207674_100393025 | 541 |
| 532 | 3300026116 | Ga0207674_10054800 | Ga0207674_100548002 | 541 |
| 533 | 3300026118 | Ga0207675_100006727 | Ga0207675_1000067272 | 541 |
| 534 | 3300026118 | Ga0207675_100012015 | Ga0207675_1000120154 | 541 |
| 535 | 3300026118 | Ga0207675_100103572 | Ga0207675_1001035722 | 541 |
| 536 | 3300026121 | Ga0207683_10003187 | Ga0207683_100031875 | 541 |
| 537 | 3300026121 | Ga0207683_10012621 | Ga0207683_100126216 | 541 |
| 538 | 3300026142 | Ga0207698_10007832 | Ga0207698_100078327 | 541 |
| 539 | 3300026142 | Ga0207698_10020661 | Ga0207698_100206615 | 541 |
| 540 | 3300027907 | Ga0207428_10000414 | Ga0207428_1000041410 | 541 |
| 541 | 3300027907 | Ga0207428_10005349 | Ga0207428_100053492 | 541 |
| 542 | 3300027907 | Ga0207428_10012320 | Ga0207428_100123204 | 541 |
| 543 | 3300028794 | Ga0307515_10037515 | Ga0307515_100375154 | 541 |
| 544 | 3300028794 | Ga0307515_10119249 | Ga0307515_101192492 | 541 |
| 545 | 3300028800 | Ga0265338_10001802 | Ga0265338_100018027 | 541 |
| 546 | 3300030521 | Ga0307511_10001476 | Ga0307511_1000147619 | 541 |
| 547 | 3300030522 | Ga0307512_10012399 | Ga0307512_100123994 | 541 |
| 548 | 3300030522 | Ga0307512_10029964 | Ga0307512_100299646 | 541 |
| 549 | 3300030731 | Ga0316177_1136358 | Ga0316177_11363584 | 541 |
| 550 | 3300030732 | Ga0316176_1130375 | Ga0316176_11303753 | 541 |
| 551 | 3300031241 | Ga0265325_10000179 | Ga0265325_1000017932 | 541 |
| 552 | 3300031247 | Ga0265340_10000074 | Ga0265340_100000749 | 541 |
| 553 | 3300031247 | Ga0265340_10003776 | Ga0265340_100037762 | 541 |
| 554 | 3300031247 | Ga0265340_10015933 | Ga0265340_100159332 | 541 |
| 555 | 3300031249 | Ga0265339_10003512 | Ga0265339_100035125 | 541 |
| 556 | 3300031548 | Ga0307408_100005281 | Ga0307408_1000052813 | 541 |
| 557 | 3300031548 | Ga0307408_100035813 | Ga0307408_1000358132 | 541 |
| 558 | 3300031616 | Ga0307508_10015004 | Ga0307508_100150041 | 541 |
| 559 | 3300031616 | Ga0307508_10015558 | Ga0307508_100155583 | 541 |
| 560 | 3300031711 | Ga0265314_10008167 | Ga0265314_100081673 | 541 |
| 561 | 3300031730 | Ga0307516_10009973 | Ga0307516_100099734 | 541 |
| 562 | 3300031731 | Ga0307405_10002680 | Ga0307405_100026802 | 541 |
| 563 | 3300031731 | Ga0307405_10021984 | Ga0307405_100219844 | 541 |
| 564 | 3300031731 | Ga0307405_10041159 | Ga0307405_100411592 | 541 |
| 565 | 3300031824 | Ga0307413_10001422 | Ga0307413_100014222 | 541 |
| 566 | 3300031824 | Ga0307413_10003080 | Ga0307413_100030802 | 541 |
| 567 | 3300031824 | Ga0307413_10010654 | Ga0307413_100106544 | 541 |
| 568 | 3300031824 | Ga0307413_10041105 | Ga0307413_100411052 | 541 |
| 569 | 3300031852 | Ga0307410_10000378 | Ga0307410_100003785 | 541 |
| 570 | 3300031852 | Ga0307410_10000601 | Ga0307410_100006012 | 541 |
| 571 | 3300031852 | Ga0307410_10013287 | Ga0307410_100132873 | 541 |
| 572 | 3300031901 | Ga0307406_10000809 | Ga0307406_100008092 | 541 |
| 573 | 3300031901 | Ga0307406_10001755 | Ga0307406_100017557 | 541 |
| 574 | 3300031901 | Ga0307406_10013284 | Ga0307406_100132844 | 541 |
| 575 | 3300031901 | Ga0307406_10043646 | Ga0307406_100436462 | 541 |
| 576 | 3300031901 | Ga0307406_10057879 | Ga0307406_100578791 | 541 |
| 577 | 3300031903 | Ga0307407_10001972 | Ga0307407_100019724 | 541 |
| 578 | 3300031903 | Ga0307407_10009714 | Ga0307407_100097146 | 541 |
| 579 | 3300031903 | Ga0307407_10029876 | Ga0307407_100298762 | 541 |
| 580 | 3300031911 | Ga0307412_10020393 | Ga0307412_100203931 | 541 |
| 581 | 3300031995 | Ga0307409_100000116 | Ga0307409_10000011619 | 541 |
| 582 | 3300031995 | Ga0307409_100001784 | Ga0307409_1000017844 | 541 |
| 583 | 3300031995 | Ga0307409_100046794 | Ga0307409_1000467942 | 541 |
| 584 | 3300031995 | Ga0307409_100142561 | Ga0307409_1001425612 | 541 |
| 585 | 3300032002 | Ga0307416_100015531 | Ga0307416_1000155313 | 541 |
| 586 | 3300032002 | Ga0307416_100022312 | Ga0307416_1000223125 | 541 |
| 587 | 3300032002 | Ga0307416_100039238 | Ga0307416_1000392382 | 541 |
| 588 | 3300032002 | Ga0307416_100062171 | Ga0307416_1000621712 | 541 |
| 589 | 3300032004 | Ga0307414_10005883 | Ga0307414_100058834 | 541 |
| 590 | 3300032004 | Ga0307414_10038554 | Ga0307414_100385543 | 541 |
| 591 | 3300032005 | Ga0307411_10001178 | Ga0307411_100011782 | 541 |
| 592 | 3300032005 | Ga0307411_10006244 | Ga0307411_100062444 | 541 |
| 593 | 3300032005 | Ga0307411_10026159 | Ga0307411_100261592 | 541 |
| 594 | 3300032126 | Ga0307415_100006570 | Ga0307415_1000065705 | 541 |
| 595 | 3300032126 | Ga0307415_100014981 | Ga0307415_1000149813 | 541 |
| 596 | 3300032126 | Ga0307415_100020756 | Ga0307415_1000207563 | 541 |
| 597 | 3300032126 | Ga0307415_100077718 | Ga0307415_1000777182 | 541 |
| 598 | 3300035083 | Ga0373926_0011010 | Ga0373926_0011010_1250_2878 | 541 |
| 599 | 3300035086 | Ga0373934_0013329 | Ga0373934_0013329_793_2421 | 541 |
| 600 | 3300035090 | Ga0373949_0007250 | Ga0373949_0007250_333_1961 | 541 |
| 601 | 3300035091 | Ga0373951_0000536 | Ga0373951_0000536_7611_9239 | 541 |
| 602 | 3300035113 | Ga0373936_0025152 | Ga0373936_0025152_211_1839 | 541 |
| 603 | 3300035113 | Ga0373936_0042142 | Ga0373936_0042142_171_1799 | 541 |
| 604 | 3300035116 | Ga0373945_0009189 | Ga0373945_0009189_709_2337 | 541 |
| 605 | 3300035117 | Ga0373953_0005549 | Ga0373953_0005549_1599_3227 | 541 |
| 606 | 3300035118 | Ga0373954_0015989 | Ga0373954_0015989_1673_3301 | 541 |
| 607 | 3300035119 | Ga0373956_0019918 | Ga0373956_0019918_742_2370 | 541 |
| 608 | 3300035170 | Ga0373943_0003061 | Ga0373943_0003061_959_2587 | 541 |
| 609 | 3300035171 | Ga0373946_0001422 | Ga0373946_0001422_1450_3078 | 541 |
| 610 | 3300035172 | Ga0373955_0014889 | Ga0373955_0014889_2009_3637 | 541 |
| 611 | 3300035692 | Ga0373935_0030511 | Ga0373935_0030511_877_2505 | 541 |
| 612 | 3300035695 | Ga0373927_0008513 | Ga0373927_0008513_1039_2667 | 541 |
| 613 | 3300035725 | Ga0373947_0001252 | Ga0373947_0001252_13180_14808 | 541 |
| 614 | 3300037068 | Ga0373925_0002220 | Ga0373925_0002220_2780_4408 | 541 |
| 615 | 3300037068 | Ga0373925_0003761 | Ga0373925_0003761_1423_3051 | 541 |
| 616 | 3300037312 | Ga0395899_0003664 | Ga0395899_0003664_620_2245 | 541 |
| 617 | 3300037312 | Ga0395899_0038909 | Ga0395899_0038909_530_2158 | 541 |
| 618 | 3300037418 | Ga0395900_0002497 | Ga0395900_0002497_3572_5200 | 541 |
| 619 | 3300037466 | Ga0395898_0001600 | Ga0395898_0001600_7239_8867 | 541 |
| 620 | 3300037466 | Ga0395898_0063063 | Ga0395898_0063063_1139_2776 | 541 |
| 621 | 3300037471 | Ga0395905_0002372 | Ga0395905_0002372_10864_12492 | 541 |
| 622 | 3300037853 | Ga0436364_1086439 | Ga0436364_1086439_4404_6032 | 541 |
| 623 | 3300038443 | Ga0395901_0005296 | Ga0395901_0005296_8476_10104 | 541 |
| 624 | 3300038443 | Ga0395901_0009518 | Ga0395901_0009518_5253_6881 | 541 |
| 625 | 3300038443 | Ga0395901_0012435 | Ga0395901_0012435_2411_4048 | 541 |
| 626 | 3300039437 | Ga0436365_1789266 | Ga0436365_1789266_16204_17832 | 541 |
| 627 | 3300039450 | Ga0436363_0110923 | Ga0436363_0110923_1001_2629 | 541 |
| 628 | 3300044656 | Ga0466969_0001204 | Ga0466969_0001204_729_2354 | 541 |
| 629 | 3300044656 | Ga0466969_0003369 | Ga0466969_0003369_6100_7728 | 541 |
| 630 | 3300044683 | Ga0466965_0008335 | Ga0466965_0008335_1704_3332 | 541 |
| 631 | 3300044683 | Ga0466965_0039781 | Ga0466965_0039781_525_2153 | 541 |
| 632 | 3300044693 | Ga0466961_0002620 | Ga0466961_0002620_732_2360 | 541 |
| 633 | 3300044693 | Ga0466961_0018404 | Ga0466961_0018404_2454_4079 | 541 |
| 634 | 3300044694 | Ga0466963_0016351 | Ga0466963_0016351_1494_3134 | 541 |
| 635 | 3300044719 | Ga0466971_0033923 | Ga0466971_0033923_388_2013 | 541 |
| 636 | 3300044765 | Ga0466970_0011138 | Ga0466970_0011138_2322_3950 | 541 |
| 637 | 3300044765 | Ga0466970_0066157 | Ga0466970_0066157_186_1817 | 541 |
| 638 | 3300044901 | Ga0466960_0001544 | Ga0466960_0001544_5584_7212 | 541 |
| 639 | 3300045049 | Ga0466959_0008070 | Ga0466959_0008070_4092_5720 | 541 |
| 640 | 3300045836 | Ga0466958_0042659 | Ga0466958_0042659_796_2436 | 541 |
| 641 | 3300046455 | Ga0495603_0016248 | Ga0495603_0016248_1891_3519 | 541 |
| 642 | 3300046461 | Ga0495641_0017707 | Ga0495641_0017707_159_1787 | 541 |
| 643 | 3300046462 | Ga0495651_0001770 | Ga0495651_0001770_7716_9341 | 541 |
| 644 | 3300046462 | Ga0495651_0015452 | Ga0495651_0015452_3390_5018 | 541 |
| 645 | 3300046462 | Ga0495651_0126738 | Ga0495651_0126738_190_1818 | 541 |
| 646 | 3300046463 | Ga0495653_0004030 | Ga0495653_0004030_3378_5006 | 541 |
| 647 | 3300046472 | Ga0495580_0041306 | Ga0495580_0041306_990_2618 | 541 |
| 648 | 3300046475 | Ga0495639_0003366 | Ga0495639_0003366_148_1776 | 541 |
| 649 | 3300046476 | Ga0495662_0027154 | Ga0495662_0027154_91_1719 | 541 |
| 650 | 3300046477 | Ga0495664_0001629 | Ga0495664_0001629_4902_6530 | 541 |
| 651 | 3300046511 | Ga0495608_0040310 | Ga0495608_0040310_584_2224 | 541 |
| 652 | 3300046511 | Ga0495608_0053593 | Ga0495608_0053593_491_2119 | 541 |
| 653 | 3300046514 | Ga0495618_0001099 | Ga0495618_0001099_10785_12413 | 541 |
| 654 | 3300046515 | Ga0495620_0043774 | Ga0495620_0043774_233_1861 | 541 |
| 655 | 3300046517 | Ga0495630_0002313 | Ga0495630_0002313_5929_7557 | 541 |
| 656 | 3300046517 | Ga0495630_0013048 | Ga0495630_0013048_4047_5675 | 541 |
| 657 | 3300046519 | Ga0495632_0013488 | Ga0495632_0013488_1311_2939 | 541 |
| 658 | 3300046524 | Ga0495648_0058770 | Ga0495648_0058770_237_1880 | 541 |
| 659 | 3300046531 | Ga0495665_0003579 | Ga0495665_0003579_2270_3898 | 541 |
| 660 | 3300046533 | Ga0495640_0007894 | Ga0495640_0007894_1915_3543 | 541 |
| 661 | 3300046536 | Ga0495587_0004437 | Ga0495587_0004437_4717_6345 | 541 |
| 662 | 3300046543 | Ga0495645_0010202 | Ga0495645_0010202_3087_4715 | 541 |
| 663 | 3300046559 | Ga0495667_0008113 | Ga0495667_0008113_4932_6560 | 541 |
| 664 | 3300046559 | Ga0495667_0031190 | Ga0495667_0031190_1449_3077 | 541 |
| 665 | 3300046559 | Ga0495667_0045109 | Ga0495667_0045109_241_1881 | 541 |
| 666 | 3300046642 | Ga0495634_0002199 | Ga0495634_0002199_12688_14316 | 541 |
| 667 | 3300046642 | Ga0495634_0077517 | Ga0495634_0077517_51_1679 | 541 |
| 668 | 3300046663 | Ga0495635_0002142 | Ga0495635_0002142_5344_6969 | 541 |
| 669 | 3300046663 | Ga0495635_0004779 | Ga0495635_0004779_2319_3947 | 541 |
| 670 | 3300046675 | Ga0495657_0052599 | Ga0495657_0052599_672_2300 | 541 |
| 671 | 3300046689 | Ga0495613_0008683 | Ga0495613_0008683_610_2238 | 541 |
| 672 | 3300046690 | Ga0495624_0027916 | Ga0495624_0027916_1915_3543 | 541 |
| 673 | 3300046690 | Ga0495624_0038002 | Ga0495624_0038002_700_2328 | 541 |
| 674 | 3300046690 | Ga0495624_0067028 | Ga0495624_0067028_515_2143 | 541 |
| 675 | 3300046809 | Ga0495600_0031126 | Ga0495600_0031126_1454_3082 | 541 |
| 676 | 3300047317 | Ga0495604_0003292 | Ga0495604_0003292_3666_5294 | 541 |
| 677 | 3300047317 | Ga0495604_0046744 | Ga0495604_0046744_1237_2865 | 541 |
| 678 | 3300047319 | Ga0495674_0008198 | Ga0495674_0008198_4899_6527 | 541 |
| 679 | 3300047319 | Ga0495674_0028189 | Ga0495674_0028189_296_1924 | 541 |
| 680 | 3300047321 | Ga0495676_0006159 | Ga0495676_0006159_8029_9657 | 541 |
| 681 | 3300047321 | Ga0495676_0012188 | Ga0495676_0012188_979_2607 | 541 |
| 682 | 3300047322 | Ga0495680_0003581 | Ga0495680_0003581_10901_12529 | 541 |
| 683 | 3300047322 | Ga0495680_0035463 | Ga0495680_0035463_510_2138 | 541 |
| 684 | 3300047444 | Ga0495675_0013608 | Ga0495675_0013608_2876_4504 | 541 |
| 685 | 3300047471 | Ga0495684_0016747 | Ga0495684_0016747_2897_4525 | 541 |
| 686 | 3300048089 | Ga0495614_0007604 | Ga0495614_0007604_1283_2911 | 541 |
| 687 | 3300048903 | Ga0496100_0032636 | Ga0496100_0032636_748_2376 | 541 |
| 688 | 3300048905 | Ga0496102_0003380 | Ga0496102_0003380_62_1690 | 541 |
| 689 | 3300048905 | Ga0496102_0006065 | Ga0496102_0006065_1606_3234 | 541 |
| 690 | 3300048905 | Ga0496102_0113141 | Ga0496102_0113141_294_1922 | 541 |
| 691 | 3300048906 | Ga0496103_0100816 | Ga0496103_0100816_101_1729 | 541 |
| 692 | 3300048907 | Ga0496104_0001600 | Ga0496104_0001600_1610_3238 | 541 |
| 693 | 3300048907 | Ga0496104_0020237 | Ga0496104_0020237_1130_2758 | 541 |
| 694 | 3300048908 | Ga0496105_0005190 | Ga0496105_0005190_7468_9096 | 541 |
| 695 | 3300048909 | Ga0496106_0082221 | Ga0496106_0082221_155_1786 | 541 |
| 696 | 3300048910 | Ga0496107_0006136 | Ga0496107_0006136_2618_4246 | 541 |
| 697 | 3300048910 | Ga0496107_0087015 | Ga0496107_0087015_641_2269 | 541 |
| 698 | 3300048911 | Ga0496108_0000117 | Ga0496108_0000117_19483_21114 | 541 |
| 699 | 3300048911 | Ga0496108_0004350 | Ga0496108_0004350_3182_4810 | 541 |
| 700 | 3300048911 | Ga0496108_0005676 | Ga0496108_0005676_2067_3695 | 541 |
| 701 | 3300048911 | Ga0496108_0050234 | Ga0496108_0050234_686_2314 | 541 |
| 702 | 3300048911 | Ga0496108_0097547 | Ga0496108_0097547_409_2037 | 541 |
| 703 | 3300048912 | Ga0496109_0057813 | Ga0496109_0057813_1259_2887 | 541 |
| 704 | 3300048913 | Ga0496110_0016417 | Ga0496110_0016417_329_1957 | 541 |
| 705 | 3300048914 | Ga0496111_0001418 | Ga0496111_0001418_5919_7547 | 541 |
| 706 | 3300048914 | Ga0496111_0005769 | Ga0496111_0005769_4810_6438 | 541 |
| 707 | 3300048915 | Ga0496112_0142446 | Ga0496112_0142446_140_1768 | 541 |
| 708 | 3300048916 | Ga0496113_0002915 | Ga0496113_0002915_4672_6300 | 541 |
| 709 | 3300048916 | Ga0496113_0021355 | Ga0496113_0021355_406_2034 | 541 |
| 710 | 3300048917 | Ga0496114_0173068 | Ga0496114_0173068_204_1832 | 541 |
| 711 | 3300048918 | Ga0496115_0002241 | Ga0496115_0002241_12150_13781 | 541 |
| 712 | 3300048924 | Ga0496121_0018715 | Ga0496121_0018715_3230_4861 | 541 |
| 713 | 3300048929 | Ga0496126_0001999 | Ga0496126_0001999_7514_9145 | 541 |
| 714 | 3300049571 | Ga0501034_0001474 | Ga0501034_0001474_26991_28619 | 541 |
| 715 | 3300049571 | Ga0501034_0028145 | Ga0501034_0028145_1543_3168 | 541 |
| 716 | 3300049572 | Ga0501036_0000822 | Ga0501036_0000822_13498_15126 | 541 |
| 717 | 3300049572 | Ga0501036_0001670 | Ga0501036_0001670_9231_10856 | 541 |
| 718 | 3300049572 | Ga0501036_0091059 | Ga0501036_0091059_357_1982 | 541 |
| 719 | 3300049573 | Ga0501037_0013233 | Ga0501037_0013233_1553_3178 | 541 |
| 720 | 3300049573 | Ga0501037_0017137 | Ga0501037_0017137_1175_2803 | 541 |
| 721 | 3300049579 | Ga0501043_0006890 | Ga0501043_0006890_373_2001 | 541 |
| 722 | 3300049579 | Ga0501043_0007797 | Ga0501043_0007797_2762_4387 | 541 |
| 723 | 3300049581 | Ga0501047_0000794 | Ga0501047_0000794_6497_8122 | 541 |
| 724 | 3300049581 | Ga0501047_0134945 | Ga0501047_0134945_146_1774 | 541 |
| 725 | 3300049582 | Ga0501048_0004267 | Ga0501048_0004267_3821_5446 | 541 |
| 726 | 3300049582 | Ga0501048_0005373 | Ga0501048_0005373_403_2031 | 541 |
| 727 | 3300049584 | Ga0501068_0069334 | Ga0501068_0069334_14_1642 | 541 |
| 728 | 3300049590 | Ga0501074_0002857 | Ga0501074_0002857_5080_6705 | 541 |
| 729 | 3300049590 | Ga0501074_0004099 | Ga0501074_0004099_7881_9509 | 541 |
| 730 | 3300049592 | Ga0501076_0037096 | Ga0501076_0037096_1264_2889 | 541 |
| 731 | 3300049823 | Ga0501044_0006420 | Ga0501044_0006420_1615_3240 | 541 |
| 732 | 3300049823 | Ga0501044_0022489 | Ga0501044_0022489_2828_4459 | 541 |
| 733 | 3300050507 | nmdc:mga05p37_351952_c1 | nmdc:mga05p37_351952_c1_10_1638 | 541 |
| 734 | 3300050507 | nmdc:mga05p37_6983_c1 | nmdc:mga05p37_6983_c1_4148_5776 | 541 |
| 735 | 3300050508 | nmdc:mga09592_1369_c1 | nmdc:mga09592_1369_c1_11945_13573 | 541 |
| 736 | 3300050509 | nmdc:mga0qj67_266_c1 | nmdc:mga0qj67_266_c1_26794_28422 | 541 |
| 737 | 3300050510 | nmdc:mga06r32_1775_c1 | nmdc:mga06r32_1775_c1_16717_18345 | 541 |
| 738 | 3300050510 | nmdc:mga06r32_20856_c1 | nmdc:mga06r32_20856_c1_261_1889 | 541 |
| 739 | 3300050511 | nmdc:mga08y16_25119_c2 | nmdc:mga08y16_25119_c2_2251_3879 | 541 |
| 740 | 3300050511 | nmdc:mga08y16_35213_c1 | nmdc:mga08y16_35213_c1_2642_4270 | 541 |
| 741 | 3300050511 | nmdc:mga08y16_8358_c1 | nmdc:mga08y16_8358_c1_2230_3858 | 541 |
| 742 | 3300050512 | nmdc:mga0n895_1353_c1 | nmdc:mga0n895_1353_c1_10268_11896 | 541 |
| 743 | 3300050512 | nmdc:mga0n895_3095_c1 | nmdc:mga0n895_3095_c1_7641_9269 | 541 |
| 744 | 3300050513 | nmdc:mga0rr50_2031_c1 | nmdc:mga0rr50_2031_c1_2613_4241 | 541 |
| 745 | 3300050513 | nmdc:mga0rr50_41038_c1 | nmdc:mga0rr50_41038_c1_316_1944 | 541 |
| 746 | 3300050514 | nmdc:mga08x19_16520_c1 | nmdc:mga08x19_16520_c1_2522_4150 | 541 |
| 747 | 3300050515 | nmdc:mga0a205_11806_c1 | nmdc:mga0a205_11806_c1_5970_7598 | 541 |
| 748 | 3300053078 | Ga0495612_0002601 | Ga0495612_0002601_5701_7329 | 541 |
| 749 | 3300053079 | Ga0500610_0010927 | Ga0500610_0010927_801_2429 | 541 |
| 750 | 3300053085 | Ga0495619_0002016 | Ga0495619_0002016_4027_5655 | 541 |
| 751 | 3300053088 | Ga0500644_0007540 | Ga0500644_0007540_273_1901 | 541 |
| 752 | 3300053136 | Ga0500559_0002853 | Ga0500559_0002853_17_1645 | 541 |
| 753 | 3300053139 | Ga0500568_0002143 | Ga0500568_0002143_4119_5747 | 541 |
| 754 | 3300053158 | Ga0500627_0004224 | Ga0500627_0004224_1274_2905 | 541 |
| 755 | 3300061719 | Ga0466962_0031991 | Ga0466962_0031991_635_2260 | 541 |
| 756 | 3300005327 | Ga0070658_10006030 | Ga0070658_100060303 | 542 |
| 757 | 3300005329 | Ga0070683_100079203 | Ga0070683_1000792033 | 542 |
| 758 | 3300005336 | Ga0070680_100009200 | Ga0070680_1000092001 | 542 |
| 759 | 3300005366 | Ga0070659_100000157 | Ga0070659_1000001575 | 542 |
| 760 | 3300005458 | Ga0070681_10000017 | Ga0070681_10000017101 | 542 |
| 761 | 3300005468 | Ga0070707_100007802 | Ga0070707_1000078027 | 542 |
| 762 | 3300005468 | Ga0070707_100155008 | Ga0070707_1001550082 | 542 |
| 763 | 3300005530 | Ga0070679_100000009 | Ga0070679_10000000915 | 542 |
| 764 | 3300005563 | Ga0068855_100006327 | Ga0068855_1000063272 | 542 |
| 765 | 3300005937 | Ga0081455_10030104 | Ga0081455_100301043 | 542 |
| 766 | 3300005981 | Ga0081538_10002418 | Ga0081538_100024187 | 542 |
| 767 | 3300006871 | Ga0075434_100010717 | Ga0075434_1000107172 | 542 |
| 768 | 3300013104 | Ga0157370_10001921 | Ga0157370_1000192114 | 542 |
| 769 | 3300013105 | Ga0157369_10003572 | Ga0157369_100035724 | 542 |
| 770 | 3300013105 | Ga0157369_10004005 | Ga0157369_1000400516 | 542 |
| 771 | 3300013105 | Ga0157369_10010650 | Ga0157369_1001065010 | 542 |
| 772 | 3300020069 | Ga0197907_10475933 | Ga0197907_104759331 | 542 |
| 773 | 3300024225 | Ga0224572_1001334 | Ga0224572_10013343 | 542 |
| 774 | 3300025909 | Ga0207705_10009940 | Ga0207705_100099407 | 542 |
| 775 | 3300025910 | Ga0207684_10013409 | Ga0207684_100134094 | 542 |
| 776 | 3300025912 | Ga0207707_10000227 | Ga0207707_1000022738 | 542 |
| 777 | 3300025913 | Ga0207695_10019917 | Ga0207695_100199173 | 542 |
| 778 | 3300025917 | Ga0207660_10006706 | Ga0207660_100067062 | 542 |
| 779 | 3300025921 | Ga0207652_10000124 | Ga0207652_1000012459 | 542 |
| 780 | 3300025932 | Ga0207690_10006654 | Ga0207690_100066544 | 542 |
| 781 | 3300025949 | Ga0207667_10017359 | Ga0207667_100173595 | 542 |
| 782 | 3300031824 | Ga0307413_10001727 | Ga0307413_100017274 | 542 |
| 783 | 3300031852 | Ga0307410_10002667 | Ga0307410_100026674 | 542 |
| 784 | 3300031901 | Ga0307406_10000477 | Ga0307406_1000047716 | 542 |
| 785 | 3300031901 | Ga0307406_10062849 | Ga0307406_100628492 | 542 |
| 786 | 3300031903 | Ga0307407_10008233 | Ga0307407_100082332 | 542 |
| 787 | 3300031995 | Ga0307409_100000009 | Ga0307409_10000000983 | 542 |
| 788 | 3300032002 | Ga0307416_100000281 | Ga0307416_10000028113 | 542 |
| 789 | 3300032126 | Ga0307415_100006514 | Ga0307415_1000065144 | 542 |
| 790 | 3300035083 | Ga0373926_0001496 | Ga0373926_0001496_2344_3975 | 542 |
| 791 | 3300035171 | Ga0373946_0006321 | Ga0373946_0006321_1497_3128 | 542 |
| 792 | 3300035692 | Ga0373935_0000034 | Ga0373935_0000034_13652_15283 | 542 |
| 793 | 3300035725 | Ga0373947_0000008 | Ga0373947_0000008_42491_44122 | 542 |
| 794 | 3300037418 | Ga0395900_0195053 | Ga0395900_0195053_95_1744 | 542 |
| 795 | 3300037466 | Ga0395898_0047920 | Ga0395898_0047920_934_2583 | 542 |
| 796 | 3300038443 | Ga0395901_0028604 | Ga0395901_0028604_3589_5238 | 542 |
| 797 | 3300044901 | Ga0466960_0013456 | Ga0466960_0013456_1476_3104 | 542 |
| 798 | 3300046678 | Ga0495599_0019886 | Ga0495599_0019886_131_1798 | 542 |
| 799 | 3300047447 | Ga0495685_013392 | Ga0495685_013392_732_2363 | 542 |
| 800 | 3300050512 | nmdc:mga0n895_67018_c1 | nmdc:mga0n895_67018_c1_1793_3421 | 542 |
| 801 | 3300005367 | Ga0070667_100000109 | Ga0070667_10000010990 | 543 |
| 802 | 3300005548 | Ga0070665_100010761 | Ga0070665_1000107612 | 543 |
| 803 | 3300005617 | Ga0068859_100003399 | Ga0068859_10000339914 | 543 |
| 804 | 3300005841 | Ga0068863_100000123 | Ga0068863_10000012321 | 543 |
| 805 | 3300005842 | Ga0068858_100003925 | Ga0068858_1000039258 | 543 |
| 806 | 3300005843 | Ga0068860_100000175 | Ga0068860_10000017530 | 543 |
| 807 | 3300005844 | Ga0068862_100000091 | Ga0068862_10000009192 | 543 |
| 808 | 3300006931 | Ga0097620_100003399 | Ga0097620_1000033993 | 543 |
| 809 | 3300009101 | Ga0105247_10000070 | Ga0105247_1000007029 | 543 |
| 810 | 3300009177 | Ga0105248_10000331 | Ga0105248_1000033131 | 543 |
| 811 | 3300025303 | Ga0209051_1000582 | Ga0209051_100058235 | 543 |
| 812 | 3300025900 | Ga0207710_10000010 | Ga0207710_10000010365 | 543 |
| 813 | 3300025923 | Ga0207681_10002083 | Ga0207681_100020837 | 543 |
| 814 | 3300025941 | Ga0207711_10000522 | Ga0207711_1000052212 | 543 |
| 815 | 3300025961 | Ga0207712_10000010 | Ga0207712_1000001029 | 543 |
| 816 | 3300025986 | Ga0207658_10000257 | Ga0207658_1000025713 | 543 |
| 817 | 3300026035 | Ga0207703_10005951 | Ga0207703_100059513 | 543 |
| 818 | 3300026088 | Ga0207641_10001365 | Ga0207641_1000136521 | 543 |
| 819 | 3300028379 | Ga0268266_10008723 | Ga0268266_100087237 | 543 |
| 820 | 3300028380 | Ga0268265_10000105 | Ga0268265_1000010529 | 543 |
| 821 | 3300028381 | Ga0268264_10000237 | Ga0268264_1000023789 | 543 |
| 822 | 3300048903 | Ga0496100_0011113 | Ga0496100_0011113_3192_4832 | 543 |
| 823 | 3300048905 | Ga0496102_0000985 | Ga0496102_0000985_19704_21344 | 543 |
| 824 | 3300048919 | Ga0496116_0066186 | Ga0496116_0066186_370_2010 | 543 |
| 825 | 3300048920 | Ga0496117_0010689 | Ga0496117_0010689_1261_2901 | 543 |
| 826 | 3300048921 | Ga0496118_0002176 | Ga0496118_0002176_2595_4235 | 543 |
| 827 | 3300048922 | Ga0496119_0002943 | Ga0496119_0002943_7551_9191 | 543 |
| 828 | 3300048923 | Ga0496120_0017026 | Ga0496120_0017026_3055_4695 | 543 |
| 829 | 3300048924 | Ga0496121_0091943 | Ga0496121_0091943_107_1747 | 543 |
| 830 | 3300048929 | Ga0496126_0059268 | Ga0496126_0059268_1659_3299 | 543 |
| 831 | 3300005467 | Ga0070706_100003339 | Ga0070706_10000333913 | 544 |
| 832 | 3300005471 | Ga0070698_100000926 | Ga0070698_10000092616 | 544 |
| 833 | 3300005618 | Ga0068864_100158555 | Ga0068864_1001585552 | 544 |
| 834 | 3300013308 | Ga0157375_10018586 | Ga0157375_100185866 | 544 |
| 835 | 3300025273 | Ga0209673_1019981 | Ga0209673_10199812 | 544 |
| 836 | 3300025303 | Ga0209051_1003521 | Ga0209051_10035212 | 544 |
| 837 | 3300025303 | Ga0209051_1006409 | Ga0209051_10064094 | 544 |
| 838 | 3300025910 | Ga0207684_10032957 | Ga0207684_100329573 | 544 |
| 839 | 3300026067 | Ga0207678_10054311 | Ga0207678_100543111 | 544 |
| 840 | 3300037853 | Ga0436364_0505858 | Ga0436364_0505858_3440_5077 | 544 |
| 841 | 3300047472 | Ga0495686_0010656 | Ga0495686_0010656_636_2276 | 544 |
| 842 | 3300048908 | Ga0496105_0145204 | Ga0496105_0145204_173_1807 | 544 |
| 843 | 3300048914 | Ga0496111_0082019 | Ga0496111_0082019_574_2208 | 544 |
| 844 | 3300005366 | Ga0070659_100021357 | Ga0070659_1000213573 | 545 |
| 845 | 3300025932 | Ga0207690_10006425 | Ga0207690_100064253 | 545 |
| 846 | 3300037471 | Ga0395905_0115113 | Ga0395905_0115113_368_2044 | 545 |
| 847 | 3300038443 | Ga0395901_0126351 | Ga0395901_0126351_875_2551 | 545 |
| 848 | 3300005563 | Ga0068855_100032330 | Ga0068855_1000323306 | 546 |
| 849 | 3300044693 | Ga0466961_0006591 | Ga0466961_0006591_278_1930 | 547 |
| 850 | 3300021388 | Ga0213875_10013610 | Ga0213875_100136104 | 550 |
| 851 | 3300044656 | Ga0466969_0005509 | Ga0466969_0005509_1757_3475 | 550 |
| 852 | 3300013105 | Ga0157369_10006696 | Ga0157369_100066963 | 552 |
| 853 | iso_pu_bacteria | 2995463766 | 2995466206 | 552 |
| 854 | 3300036401 | Ga0373937_0002052 | Ga0373937_0002052_10168_11835 | 554 |
| 855 | 3300046454 | Ga0495592_0039481 | Ga0495592_0039481_1669_3336 | 554 |
| 856 | 3300046462 | Ga0495651_0001980 | Ga0495651_0001980_6762_8429 | 554 |
| 857 | 3300046463 | Ga0495653_0004155 | Ga0495653_0004155_3277_4944 | 554 |
| 858 | 3300046511 | Ga0495608_0002887 | Ga0495608_0002887_6939_8606 | 554 |
| 859 | 3300046516 | Ga0495628_0139892 | Ga0495628_0139892_11_1678 | 554 |
| 860 | 3300046529 | Ga0495652_0002781 | Ga0495652_0002781_15387_17054 | 554 |
| 861 | 3300046533 | Ga0495640_0016533 | Ga0495640_0016533_442_2109 | 554 |
| 862 | 3300046536 | Ga0495587_0002902 | Ga0495587_0002902_6470_8137 | 554 |
| 863 | 3300046559 | Ga0495667_0000283 | Ga0495667_0000283_9498_11165 | 554 |
| 864 | 3300046663 | Ga0495635_0023067 | Ga0495635_0023067_48_1715 | 554 |
| 865 | 3300046675 | Ga0495657_0002522 | Ga0495657_0002522_12210_13877 | 554 |
| 866 | 3300046679 | Ga0495623_0057261 | Ga0495623_0057261_710_2377 | 554 |
| 867 | 3300046809 | Ga0495600_0033828 | Ga0495600_0033828_896_2563 | 554 |
| 868 | 3300047317 | Ga0495604_0053249 | Ga0495604_0053249_634_2301 | 554 |
| 869 | 3300047319 | Ga0495674_0009350 | Ga0495674_0009350_5670_7337 | 554 |
| 870 | 3300047322 | Ga0495680_0003391 | Ga0495680_0003391_1320_2987 | 554 |
| 871 | 3300048088 | Ga0495602_0004230 | Ga0495602_0004230_3726_5393 | 554 |
| 872 | 3300053085 | Ga0495619_0039614 | Ga0495619_0039614_1303_2970 | 554 |
| 873 | 3300009147 | Ga0114129_10045654 | Ga0114129_100456542 | 557 |
| 874 | 3300050507 | nmdc:mga05p37_201033_c1 | nmdc:mga05p37_201033_c1_515_2191 | 557 |
| 875 | 3300050508 | nmdc:mga09592_38118_c1 | nmdc:mga09592_38118_c1_538_2214 | 557 |
| 876 | 3300050509 | nmdc:mga0qj67_46855_c1 | nmdc:mga0qj67_46855_c1_840_2516 | 557 |
| 877 | 3300050510 | nmdc:mga06r32_7360_c1 | nmdc:mga06r32_7360_c1_1993_3669 | 557 |
| 878 | 3300009174 | Ga0105241_10007577 | Ga0105241_100075772 | 565 |
| 879 | 3300010375 | Ga0105239_10026716 | Ga0105239_100267163 | 565 |
| 880 | 3300013100 | Ga0157373_10017538 | Ga0157373_100175382 | 565 |
| 881 | 3300014745 | Ga0157377_10005188 | Ga0157377_100051884 | 565 |
| 882 | 3300001979 | JGI24740J21852_10006521 | JGI24740J21852_100065211 | 567 |
| 883 | 3300001989 | JGI24739J22299_10010192 | JGI24739J22299_100101924 | 567 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4idm-assembly1.cif.gz_A | crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis | 0.9812 | 26 | 567 |
| 4jdc-assembly1.cif.gz_A | crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis | 0.981 | 26 | 567 |
| 4ihi-assembly1.cif.gz_A | crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis bound with nad | 0.9804 | 26 | 567 |
| 4ns3-assembly1.cif.gz_E | crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis bound with nad and cobalamin | 0.9785 | 26 | 567 |
| 4ihi-assembly1.cif.gz_A | crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis bound with nad | 0.9768 | 26 | 567 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3v9gA02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9796 | 321 | 518 | 3.40.309.10 |
| af_P07275_43_316_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9748 | 53 | 318 | 3.40.605.10 |
| 4ns3E02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9721 | 321 | 517 | 3.40.309.10 |
| 3v9gA02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9699 | 321 | 518 | 3.40.309.10 |
| 4ns3E02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9669 | 321 | 517 | 3.40.309.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z9PYL7-F1-model_v4 | Aldehyde dehydrogenase family protein | 0.9802 | 25 | 297 |
GO:0003842
GO:0009898 GO:0010133 |
| AF-A0A7Y5KH56-F1-model_v4 | Aldehyde dehydrogenase family protein | 0.9755 | 26 | 199 |
GO:0003842
GO:0009898 GO:0010133 |
| AF-A0A383ZJQ1-F1-model_v4 | Multifunctional fusion protein [Includes: Delta-1-pyrroline-5-carboxylate dehydrogenase (P5C dehydrogenase) (L-glutamate gamma-semialdehyde dehydrogenase); L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88)] | 0.974 | 31 | 567 |
GO:0003842
GO:0005759 GO:0010133 |
| AF-A0A7L1NPU6-F1-model_v4 | AL4A1 protein | 0.9726 | 30 | 318 |
GO:0003842
|
| AF-A0A849FXS4-F1-model_v4 | Aldehyde dehydrogenase family protein | 0.9724 | 27 | 188 |
GO:0003842
GO:0009898 GO:0010133 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar