F484571

General Info

Members Datasets Scaffolds Average Seq Length
883 430 797 540

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10006521|JGI24740J21852_100065211
Length 567
Sequence MLVSRLAIRTRRARTVHPTIEESCTMDAVTAVPTPANEPVKGYAPGSGERASLEAKLKELTAAGAIDLTCTIGGEQKLGGGAPIEVVQPHRHAHVLGTLGNATEADGKAAVNAALAAAPSWRSLSFDDRAAIFLKAADLLAGPWRDTLNAATMLGQSKTIQQAEIDAACELIDFLRFNVAFARQIVSDQPISSPGVWNRVDYRPLEGFVYAITPFNFTAIAGNLPTAPALMGNTVVWKPSPTQQFAAHWTMRLFEAAGLPAGVINLVTGDGIDVSKAALTHPDLAGIHFTGSTKTFQSLWGAVGANIASYKTYPRLVGETGGKDFILAHPSADPAVLKTAMVRGAFEYQGQKCSAASRAYVARSVWDRIRDDLVAETEAITMGDVTDLSNFIGAVIDDRAFAKHKAALDRAAATDAIQVVAGGTYDDSEGYFVRPTLLVSDDPADEIFSTEYFGPILGVHVYDDADYDSVLKGMEHSAPYGLTGAVIAQDRHAVAAASEYLRFAAGNFYINDKPTGAVVGQQPFGGARASGTNDKAGSMWNLIRWASPRSMKETFAPPTDYRYPHQG

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
5 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
6 2547132424 Nocardia nova SH22a Isolate Unclassified
7 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
8 2558860280 Kutzneria sp. 744 Isolate Unclassified
9 2582580736 Prauserella sp. Am3 Isolate Unclassified
10 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
11 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
12 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
13 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
14 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
15 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
16 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
17 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
18 2687453737 Frankia sp. BMG5.36 Isolate Nodule
19 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
20 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
21 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
22 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
23 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
24 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
25 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
26 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
27 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
28 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
29 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
30 2855683550 Micromonospora sp. RP3T Isolate Unclassified
31 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
32 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
33 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
34 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
35 2858868258 Micromonospora sp. MH33 Isolate Unclassified
36 2858882152 Micromonospora noduli MED15 Isolate Nodule
37 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
38 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
39 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
40 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
41 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
42 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
43 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
44 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
45 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
46 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
47 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
48 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
49 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
50 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
51 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
52 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
53 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
54 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
55 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
56 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
57 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
58 2891562705 Microbispora tritici MT50 Isolate Unclassified
59 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
60 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
61 2902582711 Micromonospora sp. AP08 Isolate Unclassified
62 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
63 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
64 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
65 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
66 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
67 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
68 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
69 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
70 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
71 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
74 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
75 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
76 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
77 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
82 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
83 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
84 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
90 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
91 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
92 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
93 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
94 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
99 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
100 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
101 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
102 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
103 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
104 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
105 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
106 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
107 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
110 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
111 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
117 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
118 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
119 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
120 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
126 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
127 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
128 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
129 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
130 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
131 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
132 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
135 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
136 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
137 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
138 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
139 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
140 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
141 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
142 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
143 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
145 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
160 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
168 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
177 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
178 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
180 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
241 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
242 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
243 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
244 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
245 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
246 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
247 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
248 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
249 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
250 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
253 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
254 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
255 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
256 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
257 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
258 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
259 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
260 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
261 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
262 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
269 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
270 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
273 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
274 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
275 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
276 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
277 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
281 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
296 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
297 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
298 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
299 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
300 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
301 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
302 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
303 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
304 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
307 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
308 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
309 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
310 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
316 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
317 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
318 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
319 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
320 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
321 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
322 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
323 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
330 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
331 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
332 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
333 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
334 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
335 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
336 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
337 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
338 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
339 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
342 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
348 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
349 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
355 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
356 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
357 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
358 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
359 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
360 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
361 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
362 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
363 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
364 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
365 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
366 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
367 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
368 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
369 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
370 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
371 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
372 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
373 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
374 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
375 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
376 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
377 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
380 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
381 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
391 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
394 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
395 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
396 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
397 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
398 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
399 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
400 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
401 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
402 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
403 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
404 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
405 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
406 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
407 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
408 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
409 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
410 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
411 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
412 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
413 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
414 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
415 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
416 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
417 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
418 649633069 Micromonospora sp. L5 Isolate Unclassified
419 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
420 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
421 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
422 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
423 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
424 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
425 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
426 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
427 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
428 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
429 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
430 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.24
Metatranscriptomes 1.02
Isolates 9.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0.79
Rhizoplane 5.21
Rhizosphere 82.79
Stem 0
Stem Tuber 0
Unclassified 9.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006521 3300001979 Bacteria 4822
2 JGI24739J22299_10010192 3300001989 Bacteria 3491
3 JGI25406J46586_10003320 3300003203 Bacteria 7575
4 JGI25404J52841_10001280 3300003659 Bacteria 4366
5 Ga0070658_10006030 3300005327 Bacteria 9834
6 Ga0070658_10016387 3300005327 Bacteria 5929
7 Ga0070658_10028400 3300005327 Bacteria 4490
8 Ga0070658_10061570 3300005327 Bacteria 3058
9 Ga0070683_100000236 3300005329 Bacteria 37800
10 Ga0070683_100063537 3300005329 Bacteria 3434
11 Ga0070683_100079203 3300005329 Bacteria 3075
12 Ga0070690_100046565 3300005330 Bacteria 2757
13 Ga0068869_100003606 3300005334 Bacteria 9499
14 Ga0068869_100015454 3300005334 Bacteria 5121
15 Ga0068869_100020213 3300005334 Bacteria 4563
16 Ga0068869_100040886 3300005334 Bacteria 3317
17 Ga0070680_100009200 3300005336 Bacteria 7577
18 Ga0070680_100023060 3300005336 Bacteria 4961
19 Ga0070680_100074535 3300005336 Bacteria 2793
20 Ga0070680_100119905 3300005336 Bacteria 2195
21 Ga0070682_100021149 3300005337 Bacteria 3834
22 Ga0070682_100082961 3300005337 Bacteria 2079
23 Ga0068868_100004884 3300005338 Bacteria 9410
24 Ga0068868_100010826 3300005338 Bacteria 6617
25 Ga0068868_100050355 3300005338 Bacteria 3270
26 Ga0068868_100117720 3300005338 Bacteria 2164
27 Ga0070660_100045836 3300005339 Bacteria 3349
28 Ga0070689_100098133 3300005340 Bacteria 2317
29 Ga0070692_10015787 3300005345 Bacteria 3579
30 Ga0070692_10031558 3300005345 Bacteria 2657
31 Ga0070668_100169871 3300005347 Bacteria 1775
32 Ga0070675_100000474 3300005354 Bacteria 27485
33 Ga0070675_100017552 3300005354 Bacteria 5688
34 Ga0070671_100010047 3300005355 Bacteria 7602
35 Ga0070674_100034076 3300005356 Bacteria 3397
36 Ga0070674_100063498 3300005356 Bacteria 2585
37 Ga0070659_100000157 3300005366 Bacteria 52408
38 Ga0070659_100021357 3300005366 Bacteria 4930
39 Ga0070659_100023208 3300005366 Bacteria 4745
40 Ga0070659_100074678 3300005366 Bacteria 2701
41 Ga0070667_100000109 3300005367 Bacteria 105260
42 Ga0070667_100060409 3300005367 Bacteria 3207
43 Ga0070703_10017981 3300005406 Bacteria 2040
44 Ga0070714_100000748 3300005435 Bacteria 23002
45 Ga0070714_100007010 3300005435 Bacteria 8738
46 Ga0070714_100064771 3300005435 Bacteria 3147
47 Ga0070710_10000038 3300005437 Bacteria 60347
48 Ga0070710_10043749 3300005437 Bacteria 2482
49 Ga0070711_100029451 3300005439 Bacteria 3623
50 Ga0070700_100009712 3300005441 Bacteria 5287
51 Ga0070700_100021673 3300005441 Bacteria 3738
52 Ga0070708_100001458 3300005445 Bacteria 18061
53 Ga0070663_100005762 3300005455 Bacteria 7390
54 Ga0070663_100012822 3300005455 Bacteria 5318
55 Ga0070663_100035486 3300005455 Bacteria 3461
56 Ga0070678_100035483 3300005456 Bacteria 3482
57 Ga0070681_10000017 3300005458 Bacteria 125537
58 Ga0070681_10012788 3300005458 Bacteria 8331
59 Ga0070681_10022796 3300005458 Bacteria 6293
60 Ga0070681_10075668 3300005458 Bacteria 3326
61 Ga0070681_10183072 3300005458 Bacteria 2016
62 Ga0070706_100000040 3300005467 Bacteria 149660
63 Ga0070706_100003339 3300005467 Bacteria 15831
64 Ga0070706_100005462 3300005467 Bacteria 12106
65 Ga0070706_100016803 3300005467 Bacteria 6760
66 Ga0070706_100039173 3300005467 Bacteria 4375
67 Ga0070706_100085797 3300005467 Bacteria 2917
68 Ga0070707_100005483 3300005468 Bacteria 11863
69 Ga0070707_100007802 3300005468 Bacteria 9941
70 Ga0070707_100017512 3300005468 Bacteria 6738
71 Ga0070707_100025820 3300005468 Bacteria 5576
72 Ga0070707_100155008 3300005468 Bacteria 2231
73 Ga0070698_100000882 3300005471 Bacteria 32972
74 Ga0070698_100000926 3300005471 Bacteria 32043
75 Ga0070698_100003756 3300005471 Bacteria 16696
76 Ga0070698_100157754 3300005471 Bacteria 2214
77 Ga0070679_100000009 3300005530 Bacteria 191579
78 Ga0070679_100022803 3300005530 Bacteria 6122
79 Ga0070679_100055772 3300005530 Bacteria 3936
80 Ga0070679_100142805 3300005530 Bacteria 2373
81 Ga0070679_100182353 3300005530 Bacteria 2071
82 Ga0070684_100011504 3300005535 Bacteria 7047
83 Ga0070684_100014776 3300005535 Bacteria 6335
84 Ga0070697_100004326 3300005536 Bacteria 10897
85 Ga0070672_100069484 3300005543 Bacteria 2796
86 Ga0070686_100030018 3300005544 Bacteria 3313
87 Ga0070693_100000306 3300005547 Bacteria 22765
88 Ga0070693_100018379 3300005547 Bacteria 3650
89 Ga0070693_100067367 3300005547 Bacteria 2098
90 Ga0070665_100009637 3300005548 Bacteria 9766
91 Ga0070665_100010761 3300005548 Bacteria 9256
92 Ga0070665_100036664 3300005548 Bacteria 4931
93 Ga0068855_100006327 3300005563 Bacteria 14432
94 Ga0068855_100008986 3300005563 Bacteria 12071
95 Ga0068855_100032330 3300005563 Bacteria 6248
96 Ga0070664_100002642 3300005564 Bacteria 14460
97 Ga0070664_100022108 3300005564 Bacteria 5245
98 Ga0068857_100020839 3300005577 Bacteria 5766
99 Ga0068857_100195580 3300005577 Bacteria 1842
100 Ga0068854_100010227 3300005578 Bacteria 6079
101 Ga0068856_100056201 3300005614 Bacteria 3883
102 Ga0070702_100000311 3300005615 Bacteria 16805
103 Ga0068852_100001272 3300005616 Bacteria 16837
104 Ga0068852_100020490 3300005616 Bacteria 5260
105 Ga0068859_100003399 3300005617 Bacteria 16192
106 Ga0068859_100090513 3300005617 Bacteria 3111
107 Ga0068864_100005592 3300005618 Bacteria 10308
108 Ga0068864_100020948 3300005618 Bacteria 5474
109 Ga0068864_100120732 3300005618 Bacteria 2343
110 Ga0068864_100158555 3300005618 Bacteria 2056
111 Ga0068866_10018583 3300005718 Bacteria 3147
112 Ga0068861_100051607 3300005719 Bacteria 3123
113 Ga0068861_100150778 3300005719 Bacteria 1907
114 Ga0068851_10007201 3300005834 Bacteria 5098
115 Ga0068870_10012656 3300005840 Bacteria 3947
116 Ga0068863_100000123 3300005841 Bacteria 80999
117 Ga0068863_100003223 3300005841 Bacteria 16160
118 Ga0068863_100006850 3300005841 Bacteria 11173
119 Ga0068863_100069921 3300005841 Bacteria 3319
120 Ga0068863_100073859 3300005841 Bacteria 3226
121 Ga0068858_100003925 3300005842 Bacteria 14688
122 Ga0068858_100007354 3300005842 Bacteria 10657
123 Ga0068858_100028675 3300005842 Bacteria 5169
124 Ga0068858_100052493 3300005842 Bacteria 3772
125 Ga0068860_100000175 3300005843 Bacteria 105260
126 Ga0068860_100008669 3300005843 Bacteria 10129
127 Ga0068860_100074495 3300005843 Bacteria 3228
128 Ga0068862_100000091 3300005844 Bacteria 107015
129 Ga0081455_10000852 3300005937 Bacteria 39298
130 Ga0081455_10002204 3300005937 Bacteria 23198
131 Ga0081455_10004392 3300005937 Bacteria 15866
132 Ga0081455_10030104 3300005937 Bacteria 4938
133 Ga0081455_10048327 3300005937 Bacteria 3677
134 Ga0081455_10059855 3300005937 Bacteria 3214
135 Ga0081455_10070056 3300005937 Bacteria 2913
136 Ga0081455_10078910 3300005937 Bacteria 2705
137 Ga0081455_10081204 3300005937 Bacteria 2656
138 Ga0081538_10000072 3300005981 Bacteria 95247
139 Ga0081538_10000147 3300005981 Bacteria 73397
140 Ga0081538_10002418 3300005981 Bacteria 18302
141 Ga0081538_10021992 3300005981 Bacteria 4634
142 Ga0081540_1000299 3300005983 Bacteria 51428
143 Ga0081540_1009660 3300005983 Bacteria 6630
144 Ga0081540_1015600 3300005983 Bacteria 4802
145 Ga0081539_10000111 3300005985 Bacteria 190245
146 Ga0081539_10001764 3300005985 Bacteria 34465
147 Ga0081539_10002494 3300005985 Bacteria 25836
148 Ga0081539_10002579 3300005985 Bacteria 25009
149 Ga0081539_10010149 3300005985 Bacteria 7720
150 Ga0070717_10000229 3300006028 Bacteria 38720
151 Ga0070717_10029695 3300006028 Bacteria 4389
152 Ga0070717_10080161 3300006028 Bacteria 2738
153 Ga0075365_10061294 3300006038 Bacteria 2512
154 Ga0075432_10000174 3300006058 Bacteria 16071
155 Ga0075432_10000252 3300006058 Bacteria 14581
156 Ga0070716_100024720 3300006173 Bacteria 3199
157 Ga0097621_100036803 3300006237 Bacteria 3917
158 Ga0068871_100036569 3300006358 Bacteria 3911
159 Ga0075428_100003332 3300006844 Bacteria 17575
160 Ga0075428_100012968 3300006844 Bacteria 9268
161 Ga0075428_100025098 3300006844 Bacteria 6594
162 Ga0075428_100029471 3300006844 Bacteria 6073
163 Ga0075428_100033371 3300006844 Bacteria 5684
164 Ga0075428_100067164 3300006844 Bacteria 3926
165 Ga0075428_100099808 3300006844 Bacteria 3165
166 Ga0075428_100117637 3300006844 Bacteria 2895
167 Ga0075430_100000718 3300006846 Bacteria 25302
168 Ga0075430_100010462 3300006846 Bacteria 7855
169 Ga0075431_100000952 3300006847 Bacteria 25594
170 Ga0075431_100001854 3300006847 Bacteria 20025
171 Ga0075431_100006192 3300006847 Bacteria 11876
172 Ga0075431_100079027 3300006847 Bacteria 3396
173 Ga0075433_10130506 3300006852 Bacteria 2232
174 Ga0075434_100001116 3300006871 Bacteria 22050
175 Ga0075434_100005314 3300006871 Bacteria 11712
176 Ga0075434_100010717 3300006871 Bacteria 8608
177 Ga0075434_100015391 3300006871 Bacteria 7330
178 Ga0075434_100179563 3300006871 Bacteria 2137
179 Ga0075429_100010863 3300006880 Bacteria 7874
180 Ga0075429_100012176 3300006880 Bacteria 7457
181 Ga0068865_100111050 3300006881 Bacteria 2023
182 Ga0075436_100000994 3300006914 Bacteria 19032
183 Ga0075436_100002418 3300006914 Bacteria 12868
184 Ga0075436_100024658 3300006914 Bacteria 4136
185 Ga0097620_100003399 3300006931 Bacteria 16192
186 Ga0097620_100090512 3300006931 Bacteria 3111
187 Ga0075435_100000791 3300007076 Bacteria 19662
188 Ga0075435_100003771 3300007076 Bacteria 10333
189 Ga0075435_100007304 3300007076 Bacteria 7867
190 Ga0105251_10010563 3300009011 Bacteria 5347
191 Ga0105240_10015717 3300009093 Bacteria 10272
192 Ga0111539_10000480 3300009094 Bacteria 50456
193 Ga0111539_10001534 3300009094 Bacteria 30747
194 Ga0111539_10013207 3300009094 Bacteria 10325
195 Ga0111539_10014298 3300009094 Bacteria 9913
196 Ga0111539_10159356 3300009094 Bacteria 2640
197 Ga0111539_10209500 3300009094 Bacteria 2271
198 Ga0105245_10014154 3300009098 Bacteria 6953
199 Ga0105245_10030380 3300009098 Bacteria 4777
200 Ga0105245_10050453 3300009098 Bacteria 3729
201 Ga0105245_10083181 3300009098 Bacteria 2930
202 Ga0105245_10117054 3300009098 Bacteria 2485
203 Ga0105247_10000070 3300009101 Bacteria 115098
204 Ga0105247_10044249 3300009101 Bacteria 2730
205 Ga0114129_10000074 3300009147 Bacteria 92340
206 Ga0114129_10000812 3300009147 Bacteria 40197
207 Ga0114129_10000860 3300009147 Bacteria 39443
208 Ga0114129_10036542 3300009147 Bacteria 6935
209 Ga0114129_10045654 3300009147 Bacteria 6158
210 Ga0114129_10078900 3300009147 Bacteria 4579
211 Ga0114129_10210742 3300009147 Bacteria 2627
212 Ga0105243_10004905 3300009148 Bacteria 10490
213 Ga0105243_10107299 3300009148 Bacteria 2329
214 Ga0105241_10007577 3300009174 Bacteria 7980
215 Ga0105248_10000331 3300009177 Bacteria 55929
216 Ga0105248_10011203 3300009177 Bacteria 9890
217 Ga0105248_10030258 3300009177 Bacteria 6045
218 Ga0105248_10040543 3300009177 Bacteria 5220
219 Ga0105237_10006790 3300009545 Bacteria 12621
220 Ga0105238_10046069 3300009551 Bacteria 4403
221 Ga0105249_10009464 3300009553 Bacteria 8532
222 Ga0105239_10026716 3300010375 Bacteria 6354
223 Ga0105239_10195041 3300010375 Bacteria 2268
224 Ga0105246_10000477 3300011119 Bacteria 21587
225 Ga0105246_10041874 3300011119 Bacteria 3098
226 Ga0157342_1001244 3300012507 Bacteria 1833
227 Ga0157373_10017538 3300013100 Bacteria 5214
228 Ga0157373_10066593 3300013100 Bacteria 2548
229 Ga0157370_10001921 3300013104 Bacteria 25558
230 Ga0157369_10003572 3300013105 Bacteria 18478
231 Ga0157369_10004005 3300013105 Bacteria 17476
232 Ga0157369_10006696 3300013105 Bacteria 13309
233 Ga0157369_10010650 3300013105 Bacteria 10468
234 Ga0157378_10044901 3300013297 Bacteria 3925
235 Ga0163162_10045520 3300013306 Bacteria 4396
236 Ga0157372_10000031 3300013307 Bacteria 178827
237 Ga0157372_10070789 3300013307 Bacteria 3925
238 Ga0157372_10135749 3300013307 Bacteria 2833
239 Ga0157372_10146315 3300013307 Bacteria 2725
240 Ga0157375_10018586 3300013308 Bacteria 6305
241 Ga0157375_10050697 3300013308 Bacteria 4072
242 Ga0157375_10057277 3300013308 Bacteria 3851
243 Ga0163163_10022605 3300014325 Bacteria 5960
244 Ga0163163_10057192 3300014325 Bacteria 3855
245 Ga0157377_10005188 3300014745 Bacteria 6093
246 Ga0157377_10045163 3300014745 Bacteria 2460
247 Ga0157379_10028196 3300014968 Bacteria 4998
248 Ga0163161_10008009 3300017792 Bacteria 7308
249 Ga0197907_10475933 3300020069 Bacteria 3081
250 Ga0206356_10233614 3300020070 Bacteria 2392
251 Ga0206356_11006926 3300020070 Bacteria 3105
252 Ga0206352_10520446 3300020078 Bacteria 2048
253 Ga0206350_10547176 3300020080 Bacteria 2285
254 Ga0206353_10598622 3300020082 Bacteria 3375
255 Ga0213876_10007156 3300021384 Bacteria 6082
256 Ga0213875_10001853 3300021388 Bacteria 13141
257 Ga0213875_10012012 3300021388 Bacteria 4290
258 Ga0213875_10013610 3300021388 Bacteria 3987
259 Ga0224712_10001181 3300022467 Bacteria 5856
260 Ga0224712_10001326 3300022467 Bacteria 5638
261 Ga0224712_10017876 3300022467 Bacteria 2359
262 Ga0224572_1001334 3300024225 Bacteria 3596
263 Ga0209673_1019981 3300025273 Bacteria 2388
264 Ga0209051_1000582 3300025303 Bacteria 43455
265 Ga0209051_1003521 3300025303 Bacteria 10221
266 Ga0209051_1006409 3300025303 Bacteria 6633
267 Ga0207656_10008362 3300025321 Bacteria 3805
268 Ga0207653_10003687 3300025885 Bacteria 4816
269 Ga0207692_10017135 3300025898 Bacteria 3224
270 Ga0207692_10033123 3300025898 Bacteria 2489
271 Ga0207642_10018397 3300025899 Bacteria 2680
272 Ga0207710_10000010 3300025900 Bacteria 482087
273 Ga0207688_10002120 3300025901 Bacteria 10657
274 Ga0207688_10005833 3300025901 Bacteria 6702
275 Ga0207685_10029334 3300025905 Bacteria 1947
276 Ga0207699_10013452 3300025906 Bacteria 4189
277 Ga0207699_10018875 3300025906 Bacteria 3663
278 Ga0207699_10027577 3300025906 Bacteria 3146
279 Ga0207643_10001058 3300025908 Bacteria 16263
280 Ga0207705_10003565 3300025909 Bacteria 11852
281 Ga0207705_10009940 3300025909 Bacteria 6927
282 Ga0207684_10000012 3300025910 Bacteria 478666
283 Ga0207684_10013409 3300025910 Bacteria 7092
284 Ga0207684_10014711 3300025910 Bacteria 6740
285 Ga0207684_10032957 3300025910 Bacteria 4406
286 Ga0207707_10000227 3300025912 Bacteria 60493
287 Ga0207707_10121776 3300025912 Bacteria 2281
288 Ga0207695_10014951 3300025913 Bacteria 9160
289 Ga0207695_10019917 3300025913 Bacteria 7707
290 Ga0207693_10006407 3300025915 Bacteria 9755
291 Ga0207693_10094019 3300025915 Bacteria 2350
292 Ga0207660_10006706 3300025917 Bacteria 7457
293 Ga0207660_10020746 3300025917 Bacteria 4415
294 Ga0207660_10115754 3300025917 Bacteria 2024
295 Ga0207657_10002605 3300025919 Bacteria 19502
296 Ga0207649_10003412 3300025920 Bacteria 8686
297 Ga0207652_10000124 3300025921 Bacteria 82835
298 Ga0207652_10004799 3300025921 Bacteria 10947
299 Ga0207652_10007974 3300025921 Bacteria 8500
300 Ga0207646_10002067 3300025922 Bacteria 24077
301 Ga0207646_10005754 3300025922 Bacteria 12991
302 Ga0207646_10013787 3300025922 Bacteria 7711
303 Ga0207681_10002083 3300025923 Bacteria 12820
304 Ga0207650_10003121 3300025925 Bacteria 11414
305 Ga0207659_10039758 3300025926 Bacteria 3284
306 Ga0207659_10066567 3300025926 Bacteria 2615
307 Ga0207687_10014753 3300025927 Bacteria 5116
308 Ga0207687_10040111 3300025927 Bacteria 3208
309 Ga0207687_10089070 3300025927 Bacteria 2246
310 Ga0207687_10125959 3300025927 Bacteria 1923
311 Ga0207700_10019277 3300025928 Bacteria 4605
312 Ga0207700_10031111 3300025928 Bacteria 3787
313 Ga0207700_10035607 3300025928 Bacteria 3587
314 Ga0207664_10004984 3300025929 Bacteria 9027
315 Ga0207664_10017678 3300025929 Bacteria 5234
316 Ga0207664_10051507 3300025929 Bacteria 3251
317 Ga0207690_10006425 3300025932 Bacteria 6965
318 Ga0207690_10006654 3300025932 Bacteria 6847
319 Ga0207706_10010254 3300025933 Bacteria 8569
320 Ga0207706_10024674 3300025933 Bacteria 5389
321 Ga0207709_10036325 3300025935 Bacteria 2919
322 Ga0207709_10056786 3300025935 Bacteria 2424
323 Ga0207670_10114304 3300025936 Bacteria 1951
324 Ga0207669_10038735 3300025937 Bacteria 2748
325 Ga0207704_10083497 3300025938 Bacteria 2073
326 Ga0207665_10000684 3300025939 Bacteria 22908
327 Ga0207665_10027979 3300025939 Bacteria 3724
328 Ga0207691_10021953 3300025940 Bacteria 6023
329 Ga0207711_10000522 3300025941 Bacteria 39517
330 Ga0207711_10039479 3300025941 Bacteria 4016
331 Ga0207711_10143220 3300025941 Bacteria 2152
332 Ga0207689_10002005 3300025942 Bacteria 19226
333 Ga0207689_10003674 3300025942 Bacteria 13990
334 Ga0207689_10017358 3300025942 Bacteria 6090
335 Ga0207661_10004182 3300025944 Bacteria 10100
336 Ga0207661_10018102 3300025944 Bacteria 5231
337 Ga0207679_10005249 3300025945 Bacteria 8119
338 Ga0207667_10017359 3300025949 Bacteria 8101
339 Ga0207667_10128573 3300025949 Bacteria 2609
340 Ga0207651_10018497 3300025960 Bacteria 4149
341 Ga0207651_10056984 3300025960 Bacteria 2692
342 Ga0207712_10000010 3300025961 Bacteria 455972
343 Ga0207712_10065729 3300025961 Bacteria 2590
344 Ga0207668_10001275 3300025972 Bacteria 15019
345 Ga0207640_10041468 3300025981 Bacteria 2928
346 Ga0207658_10000257 3300025986 Bacteria 55345
347 Ga0207658_10039275 3300025986 Bacteria 3415
348 Ga0207677_10121688 3300026023 Bacteria 1964
349 Ga0207703_10005951 3300026035 Bacteria 9770
350 Ga0207703_10027684 3300026035 Bacteria 4463
351 Ga0207678_10000891 3300026067 Bacteria 27453
352 Ga0207678_10001928 3300026067 Bacteria 18920
353 Ga0207678_10054311 3300026067 Bacteria 3450
354 Ga0207708_10000029 3300026075 Bacteria 161861
355 Ga0207708_10003482 3300026075 Bacteria 11610
356 Ga0207702_10000901 3300026078 Bacteria 30858
357 Ga0207702_10033797 3300026078 Bacteria 4273
358 Ga0207702_10068199 3300026078 Bacteria 3055
359 Ga0207641_10001365 3300026088 Bacteria 24147
360 Ga0207641_10016995 3300026088 Bacteria 5956
361 Ga0207641_10018373 3300026088 Bacteria 5732
362 Ga0207641_10127024 3300026088 Bacteria 2284
363 Ga0207676_10000683 3300026095 Bacteria 26944
364 Ga0207676_10066474 3300026095 Bacteria 2876
365 Ga0207674_10021848 3300026116 Bacteria 6885
366 Ga0207674_10039302 3300026116 Bacteria 4905
367 Ga0207674_10054800 3300026116 Bacteria 4058
368 Ga0207674_10112258 3300026116 Bacteria 2699
369 Ga0207675_100006727 3300026118 Bacteria 10871
370 Ga0207675_100012015 3300026118 Bacteria 8093
371 Ga0207675_100103572 3300026118 Bacteria 2682
372 Ga0207683_10003187 3300026121 Bacteria 14313
373 Ga0207683_10012621 3300026121 Bacteria 7207
374 Ga0207698_10003187 3300026142 Bacteria 9844
375 Ga0207698_10007832 3300026142 Bacteria 6718
376 Ga0207698_10020661 3300026142 Bacteria 4537
377 Ga0207428_10000246 3300027907 Bacteria 73697
378 Ga0207428_10000414 3300027907 Bacteria 53083
379 Ga0207428_10002279 3300027907 Bacteria 19254
380 Ga0207428_10005349 3300027907 Bacteria 11972
381 Ga0207428_10012320 3300027907 Bacteria 7516
382 Ga0268266_10008723 3300028379 Bacteria 8987
383 Ga0268266_10013700 3300028379 Bacteria 6983
384 Ga0268265_10000105 3300028380 Bacteria 105463
385 Ga0268265_10030238 3300028380 Bacteria 3898
386 Ga0268264_10000237 3300028381 Bacteria 105274
387 Ga0268264_10029148 3300028381 Bacteria 4520
388 Ga0307515_10000205 3300028794 Bacteria 144874
389 Ga0307515_10037515 3300028794 Bacteria 7791
390 Ga0307515_10119249 3300028794 Bacteria 3003
391 Ga0265338_10001802 3300028800 Bacteria 33701
392 Ga0265338_10144101 3300028800 Bacteria 1861
393 Ga0307511_10001476 3300030521 Bacteria 24879
394 Ga0307512_10012399 3300030522 Bacteria 8043
395 Ga0307512_10029964 3300030522 Bacteria 4741
396 Ga0316177_1136358 3300030731 Bacteria 2998
397 Ga0316176_1130375 3300030732 Bacteria 3284
398 Ga0265325_10000179 3300031241 Bacteria 45049
399 Ga0265340_10000074 3300031247 Bacteria 47646
400 Ga0265340_10003776 3300031247 Bacteria 8530
401 Ga0265340_10015933 3300031247 Bacteria 3899
402 Ga0265339_10003512 3300031249 Bacteria 10954
403 Ga0265327_10000329 3300031251 Bacteria 90292
404 Ga0265327_10005907 3300031251 Bacteria 10001
405 Ga0307513_10000001 3300031456 Bacteria 1660464
406 Ga0307513_10047087 3300031456 Bacteria 4693
407 Ga0307408_100005281 3300031548 Bacteria 8655
408 Ga0307408_100035813 3300031548 Bacteria 3485
409 Ga0265313_10007457 3300031595 Bacteria 7476
410 Ga0307508_10006175 3300031616 Bacteria 11304
411 Ga0307508_10015004 3300031616 Bacteria 7063
412 Ga0307508_10015558 3300031616 Bacteria 6931
413 Ga0307508_10026785 3300031616 Bacteria 5224
414 Ga0265314_10008167 3300031711 Bacteria 9004
415 Ga0316576_10011969 3300031727 Bacteria 5709
416 Ga0316578_10035876 3300031728 Bacteria 2852
417 Ga0307516_10009973 3300031730 Bacteria 10519
418 Ga0307516_10021531 3300031730 Bacteria 6630
419 Ga0307516_10023643 3300031730 Bacteria 6291
420 Ga0307405_10002680 3300031731 Bacteria 7933
421 Ga0307405_10010307 3300031731 Bacteria 4833
422 Ga0307405_10021984 3300031731 Bacteria 3597
423 Ga0307405_10041159 3300031731 Bacteria 2803
424 Ga0307413_10001422 3300031824 Bacteria 9050
425 Ga0307413_10001727 3300031824 Bacteria 8534
426 Ga0307413_10003080 3300031824 Bacteria 6933
427 Ga0307413_10003652 3300031824 Bacteria 6533
428 Ga0307413_10010654 3300031824 Bacteria 4474
429 Ga0307413_10041105 3300031824 Bacteria 2705
430 Ga0307410_10000378 3300031852 Bacteria 17425
431 Ga0307410_10000601 3300031852 Bacteria 14792
432 Ga0307410_10002667 3300031852 Bacteria 8698
433 Ga0307410_10013287 3300031852 Bacteria 4798
434 Ga0307410_10056788 3300031852 Bacteria 2663
435 Ga0307406_10000477 3300031901 Bacteria 23095
436 Ga0307406_10000809 3300031901 Bacteria 17581
437 Ga0307406_10001755 3300031901 Bacteria 11878
438 Ga0307406_10002775 3300031901 Bacteria 9562
439 Ga0307406_10013284 3300031901 Bacteria 4714
440 Ga0307406_10043646 3300031901 Bacteria 2805
441 Ga0307406_10057879 3300031901 Bacteria 2488
442 Ga0307406_10062849 3300031901 Bacteria 2403
443 Ga0307407_10001972 3300031903 Bacteria 7792
444 Ga0307407_10008233 3300031903 Bacteria 4774
445 Ga0307407_10009714 3300031903 Bacteria 4497
446 Ga0307407_10029876 3300031903 Bacteria 2932
447 Ga0307412_10020393 3300031911 Bacteria 4033
448 Ga0307412_10023607 3300031911 Bacteria 3787
449 Ga0307409_100000009 3300031995 Bacteria 68887
450 Ga0307409_100000116 3300031995 Bacteria 29619
451 Ga0307409_100001123 3300031995 Bacteria 12683
452 Ga0307409_100001784 3300031995 Bacteria 10874
453 Ga0307409_100046794 3300031995 Bacteria 3277
454 Ga0307409_100142561 3300031995 Bacteria 2067
455 Ga0307416_100000281 3300032002 Bacteria 27004
456 Ga0307416_100002435 3300032002 Bacteria 10686
457 Ga0307416_100015531 3300032002 Bacteria 5262
458 Ga0307416_100022312 3300032002 Bacteria 4567
459 Ga0307416_100039238 3300032002 Bacteria 3663
460 Ga0307416_100062171 3300032002 Bacteria 3052
461 Ga0307414_10005883 3300032004 Bacteria 6787
462 Ga0307414_10038554 3300032004 Bacteria 3210
463 Ga0307414_10166373 3300032004 Bacteria 1758
464 Ga0307411_10001178 3300032005 Bacteria 10300
465 Ga0307411_10006244 3300032005 Bacteria 5942
466 Ga0307411_10026159 3300032005 Bacteria 3509
467 Ga0307415_100000071 3300032126 Bacteria 42220
468 Ga0307415_100006514 3300032126 Bacteria 6309
469 Ga0307415_100006570 3300032126 Bacteria 6286
470 Ga0307415_100014981 3300032126 Bacteria 4576
471 Ga0307415_100020756 3300032126 Bacteria 4019
472 Ga0307415_100077718 3300032126 Bacteria 2357
473 Ga0307507_10058009 3300033179 Bacteria 3639
474 Ga0373926_0001496 3300035083 Bacteria 7142
475 Ga0373926_0011010 3300035083 Bacteria 3038
476 Ga0373934_0013329 3300035086 Bacteria 3107
477 Ga0373949_0007250 3300035090 Bacteria 2428
478 Ga0373951_0000536 3300035091 Bacteria 10697
479 Ga0373936_0025152 3300035113 Bacteria 2326
480 Ga0373936_0042142 3300035113 Bacteria 1832
481 Ga0373939_0011035 3300035114 Bacteria 2272
482 Ga0373945_0009189 3300035116 Bacteria 3234
483 Ga0373953_0005549 3300035117 Bacteria 4103
484 Ga0373953_0050988 3300035117 Bacteria 1672
485 Ga0373954_0015989 3300035118 Bacteria 3355
486 Ga0373956_0019918 3300035119 Bacteria 2849
487 Ga0373943_0003061 3300035170 Bacteria 7596
488 Ga0373946_0001422 3300035171 Bacteria 8309
489 Ga0373946_0006321 3300035171 Bacteria 4293
490 Ga0373946_0024436 3300035171 Bacteria 2368
491 Ga0373955_0014889 3300035172 Bacteria 3795
492 Ga0373942_0000505 3300035207 Bacteria 10996
493 Ga0373942_0001543 3300035207 Bacteria 5911
494 Ga0373935_0000034 3300035692 Bacteria 52185
495 Ga0373935_0030511 3300035692 Bacteria 3341
496 Ga0373927_0008513 3300035695 Bacteria 6900
497 Ga0373927_0065454 3300035695 Bacteria 2351
498 Ga0373947_0000008 3300035725 Bacteria 182094
499 Ga0373947_0001252 3300035725 Bacteria 15617
500 Ga0373947_0030034 3300035725 Bacteria 3191
501 Ga0373937_0002052 3300036401 Bacteria 16837
502 Ga0373925_0002220 3300037068 Bacteria 15749
503 Ga0373925_0003761 3300037068 Bacteria 11659
504 Ga0395899_0003664 3300037312 Bacteria 12162
505 Ga0395899_0038909 3300037312 Bacteria 3561
506 Ga0395900_0002497 3300037418 Bacteria 20218
507 Ga0395900_0149439 3300037418 Bacteria 2387
508 Ga0395900_0195053 3300037418 Bacteria 2052
509 Ga0395898_0001600 3300037466 Bacteria 30893
510 Ga0395898_0047920 3300037466 Bacteria 4191
511 Ga0395898_0063063 3300037466 Bacteria 3597
512 Ga0395905_0002372 3300037471 Bacteria 20988
513 Ga0395905_0115113 3300037471 Bacteria 2527
514 Ga0436364_0077046 3300037853 Bacteria 111992
515 Ga0436364_0505858 3300037853 Bacteria 16204
516 Ga0436364_1086439 3300037853 Bacteria 32387
517 Ga0395901_0005296 3300038443 Bacteria 13039
518 Ga0395901_0009518 3300038443 Bacteria 9858
519 Ga0395901_0012435 3300038443 Bacteria 8636
520 Ga0395901_0028604 3300038443 Bacteria 5732
521 Ga0395901_0126351 3300038443 Bacteria 2687
522 Ga0436365_1789266 3300039437 Bacteria 32563
523 Ga0436363_0110923 3300039450 Bacteria 3613
524 Ga0439439_0009397 3300041406 Bacteria 2324
525 Ga0439433_0012465 3300041999 Bacteria 1865
526 Ga0439448_0011003 3300042005 Bacteria 2691
527 Ga0439457_000249 3300042014 Bacteria 14611
528 Ga0439440_0000641 3300042993 Bacteria 5964
529 Ga0466969_0000322 3300044656 Bacteria 26451
530 Ga0466969_0001204 3300044656 Bacteria 13989
531 Ga0466969_0003369 3300044656 Bacteria 8512
532 Ga0466969_0005509 3300044656 Bacteria 6728
533 Ga0466969_0024959 3300044656 Bacteria 3074
534 Ga0466965_0008335 3300044683 Bacteria 4793
535 Ga0466965_0039781 3300044683 Bacteria 2312
536 Ga0466966_0022754 3300044684 Bacteria 4109
537 Ga0466961_0002172 3300044693 Bacteria 12206
538 Ga0466961_0002620 3300044693 Bacteria 11178
539 Ga0466961_0006591 3300044693 Bacteria 7380
540 Ga0466961_0018404 3300044693 Bacteria 4493
541 Ga0466961_0051690 3300044693 Bacteria 2624
542 Ga0466963_0000881 3300044694 Bacteria 15241
543 Ga0466963_0016351 3300044694 Bacteria 4613
544 Ga0466963_0017505 3300044694 Bacteria 4467
545 Ga0466971_0003815 3300044719 Bacteria 6450
546 Ga0466971_0033923 3300044719 Bacteria 2287
547 Ga0466970_0011138 3300044765 Bacteria 4580
548 Ga0466970_0066157 3300044765 Bacteria 1940
549 Ga0466957_0047954 3300044842 Bacteria 2596
550 Ga0466960_0001544 3300044901 Bacteria 8412
551 Ga0466960_0013456 3300044901 Bacteria 3477
552 Ga0466959_0003872 3300045049 Bacteria 9931
553 Ga0466959_0008070 3300045049 Bacteria 7421
554 Ga0466959_0079481 3300045049 Bacteria 2364
555 Ga0466958_0013335 3300045836 Bacteria 4677
556 Ga0466958_0042659 3300045836 Bacteria 2732
557 Ga0466967_0003468 3300045976 Bacteria 10295
558 Ga0466967_0003723 3300045976 Bacteria 10047
559 Ga0466967_0008345 3300045976 Bacteria 7580
560 Ga0466967_0013375 3300045976 Bacteria 6337
561 Ga0495592_0039481 3300046454 Bacteria 3545
562 Ga0495592_0039813 3300046454 Bacteria 3529
563 Ga0495603_0016248 3300046455 Bacteria 4503
564 Ga0495629_0099540 3300046459 Bacteria 2029
565 Ga0495629_0157995 3300046459 Bacteria 1575
566 Ga0495641_0017707 3300046461 Bacteria 3701
567 Ga0495651_0001770 3300046462 Bacteria 16686
568 Ga0495651_0001980 3300046462 Bacteria 15873
569 Ga0495651_0014869 3300046462 Bacteria 6018
570 Ga0495651_0015452 3300046462 Bacteria 5905
571 Ga0495651_0126738 3300046462 Bacteria 1869
572 Ga0495653_0004030 3300046463 Bacteria 11861
573 Ga0495653_0004155 3300046463 Bacteria 11715
574 Ga0495580_0013333 3300046472 Bacteria 6279
575 Ga0495580_0035662 3300046472 Bacteria 3576
576 Ga0495580_0041306 3300046472 Bacteria 3289
577 Ga0495639_0003366 3300046475 Bacteria 6934
578 Ga0495662_0001980 3300046476 Bacteria 10273
579 Ga0495662_0014989 3300046476 Bacteria 3765
580 Ga0495662_0027154 3300046476 Bacteria 2766
581 Ga0495664_0001629 3300046477 Bacteria 11927
582 Ga0495664_0002361 3300046477 Bacteria 10113
583 Ga0495608_0001337 3300046511 Bacteria 17572
584 Ga0495608_0002887 3300046511 Bacteria 12311
585 Ga0495608_0003847 3300046511 Bacteria 10788
586 Ga0495608_0040310 3300046511 Bacteria 3129
587 Ga0495608_0053593 3300046511 Bacteria 2668
588 Ga0495618_0001099 3300046514 Bacteria 18333
589 Ga0495618_0030895 3300046514 Bacteria 3348
590 Ga0495618_0100279 3300046514 Bacteria 1853
591 Ga0495620_0043774 3300046515 Bacteria 1949
592 Ga0495628_0004294 3300046516 Bacteria 12675
593 Ga0495628_0007279 3300046516 Bacteria 9589
594 Ga0495628_0139892 3300046516 Bacteria 1847
595 Ga0495630_0002313 3300046517 Bacteria 13242
596 Ga0495630_0013048 3300046517 Bacteria 6038
597 Ga0495632_0013488 3300046519 Bacteria 4662
598 Ga0495648_0058770 3300046524 Bacteria 2297
599 Ga0495666_0017129 3300046526 Bacteria 3608
600 Ga0495652_0002781 3300046529 Bacteria 17682
601 Ga0495652_0041313 3300046529 Bacteria 3981
602 Ga0495665_0000174 3300046531 Bacteria 32581
603 Ga0495665_0003579 3300046531 Bacteria 8434
604 Ga0495640_0007894 3300046533 Bacteria 8366
605 Ga0495640_0016533 3300046533 Bacteria 5517
606 Ga0495640_0018426 3300046533 Bacteria 5175
607 Ga0495640_0027410 3300046533 Bacteria 4109
608 Ga0495586_0006408 3300046535 Bacteria 6287
609 Ga0495587_0002902 3300046536 Bacteria 11483
610 Ga0495587_0004437 3300046536 Bacteria 9246
611 Ga0495587_0012446 3300046536 Bacteria 5354
612 Ga0495587_0022064 3300046536 Bacteria 3922
613 Ga0495645_0004178 3300046543 Bacteria 9871
614 Ga0495645_0010202 3300046543 Bacteria 6581
615 Ga0495645_0017837 3300046543 Bacteria 5092
616 Ga0495645_0020551 3300046543 Bacteria 4766
617 Ga0495667_0000283 3300046559 Bacteria 32986
618 Ga0495667_0008113 3300046559 Bacteria 7128
619 Ga0495667_0031190 3300046559 Bacteria 3578
620 Ga0495667_0040952 3300046559 Bacteria 3073
621 Ga0495667_0045109 3300046559 Bacteria 2919
622 Ga0495667_0055081 3300046559 Bacteria 2615
623 Ga0495634_0002199 3300046642 Bacteria 16376
624 Ga0495634_0021824 3300046642 Bacteria 4518
625 Ga0495634_0077517 3300046642 Bacteria 2179
626 Ga0495635_0002142 3300046663 Bacteria 13400
627 Ga0495635_0004779 3300046663 Bacteria 9415
628 Ga0495635_0011633 3300046663 Bacteria 6166
629 Ga0495635_0023067 3300046663 Bacteria 4337
630 Ga0495635_0057545 3300046663 Bacteria 2674
631 Ga0495657_0002522 3300046675 Bacteria 15375
632 Ga0495657_0012926 3300046675 Bacteria 6182
633 Ga0495657_0035385 3300046675 Bacteria 3461
634 Ga0495657_0052599 3300046675 Bacteria 2729
635 Ga0495599_0019886 3300046678 Bacteria 4182
636 Ga0495599_0026206 3300046678 Bacteria 3652
637 Ga0495623_0057261 3300046679 Bacteria 2452
638 Ga0495646_0007368 3300046680 Bacteria 6989
639 Ga0495646_0026554 3300046680 Bacteria 3635
640 Ga0495613_0002951 3300046689 Bacteria 12721
641 Ga0495613_0003990 3300046689 Bacteria 11040
642 Ga0495613_0008683 3300046689 Bacteria 7533
643 Ga0495624_0027916 3300046690 Bacteria 3690
644 Ga0495624_0038002 3300046690 Bacteria 3095
645 Ga0495624_0067028 3300046690 Bacteria 2240
646 Ga0495600_0031126 3300046809 Bacteria 3456
647 Ga0495600_0033828 3300046809 Bacteria 3318
648 Ga0495581_0007278 3300047315 Bacteria 6402
649 Ga0495604_0000604 3300047317 Bacteria 30967
650 Ga0495604_0003292 3300047317 Bacteria 12896
651 Ga0495604_0015836 3300047317 Bacteria 6018
652 Ga0495604_0046744 3300047317 Bacteria 3374
653 Ga0495604_0053249 3300047317 Bacteria 3129
654 Ga0495674_0008198 3300047319 Bacteria 9969
655 Ga0495674_0009350 3300047319 Bacteria 9318
656 Ga0495674_0028189 3300047319 Bacteria 5125
657 Ga0495676_0006159 3300047321 Bacteria 11039
658 Ga0495676_0012188 3300047321 Bacteria 7755
659 Ga0495680_0003391 3300047322 Bacteria 15721
660 Ga0495680_0003581 3300047322 Bacteria 15207
661 Ga0495680_0035463 3300047322 Bacteria 4018
662 Ga0495675_0013608 3300047444 Bacteria 5140
663 Ga0495675_0044083 3300047444 Bacteria 2841
664 Ga0495675_0047123 3300047444 Bacteria 2742
665 Ga0495685_013392 3300047447 Bacteria 2784
666 Ga0495684_0016747 3300047471 Bacteria 5647
667 Ga0495684_0043897 3300047471 Bacteria 3422
668 Ga0495684_0044672 3300047471 Bacteria 3391
669 Ga0495686_0010656 3300047472 Bacteria 6527
670 Ga0495593_0010466 3300047673 Bacteria 5355
671 Ga0495602_0004230 3300048088 Bacteria 14936
672 Ga0495602_0032335 3300048088 Bacteria 4926
673 Ga0495614_0007604 3300048089 Bacteria 4818
674 Ga0496100_0011113 3300048903 Bacteria 5112
675 Ga0496100_0011219 3300048903 Bacteria 5095
676 Ga0496100_0032636 3300048903 Bacteria 3249
677 Ga0496101_0028662 3300048904 Bacteria 3889
678 Ga0496102_0000985 3300048905 Bacteria 26750
679 Ga0496102_0003380 3300048905 Bacteria 13528
680 Ga0496102_0006065 3300048905 Bacteria 10304
681 Ga0496102_0082240 3300048905 Bacteria 2970
682 Ga0496102_0113141 3300048905 Bacteria 2532
683 Ga0496103_0100816 3300048906 Bacteria 1827
684 Ga0496104_0001600 3300048907 Bacteria 19488
685 Ga0496104_0003435 3300048907 Bacteria 13659
686 Ga0496104_0020237 3300048907 Bacteria 6097
687 Ga0496104_0149180 3300048907 Bacteria 2245
688 Ga0496105_0000206 3300048908 Bacteria 39356
689 Ga0496105_0005190 3300048908 Bacteria 9868
690 Ga0496105_0060471 3300048908 Bacteria 3126
691 Ga0496105_0145204 3300048908 Bacteria 1951
692 Ga0496106_0032172 3300048909 Bacteria 3910
693 Ga0496106_0082221 3300048909 Bacteria 2475
694 Ga0496107_0006136 3300048910 Bacteria 8253
695 Ga0496107_0087015 3300048910 Bacteria 2281
696 Ga0496108_0000117 3300048911 Bacteria 78204
697 Ga0496108_0003488 3300048911 Bacteria 12601
698 Ga0496108_0004350 3300048911 Bacteria 11388
699 Ga0496108_0005676 3300048911 Bacteria 10102
700 Ga0496108_0050234 3300048911 Bacteria 3490
701 Ga0496108_0097547 3300048911 Bacteria 2504
702 Ga0496109_0002466 3300048912 Bacteria 15507
703 Ga0496109_0057813 3300048912 Bacteria 3542
704 Ga0496110_0016417 3300048913 Bacteria 6181
705 Ga0496110_0058650 3300048913 Bacteria 3390
706 Ga0496111_0001418 3300048914 Bacteria 13642
707 Ga0496111_0005769 3300048914 Bacteria 7990
708 Ga0496111_0082019 3300048914 Bacteria 2354
709 Ga0496112_0000167 3300048915 Bacteria 41911
710 Ga0496112_0009573 3300048915 Bacteria 8739
711 Ga0496112_0039622 3300048915 Bacteria 4605
712 Ga0496112_0142446 3300048915 Bacteria 2366
713 Ga0496113_0000858 3300048916 Bacteria 15902
714 Ga0496113_0002915 3300048916 Bacteria 10094
715 Ga0496113_0021355 3300048916 Bacteria 4565
716 Ga0496114_0173068 3300048917 Bacteria 1882
717 Ga0496115_0001834 3300048918 Bacteria 15214
718 Ga0496115_0002241 3300048918 Bacteria 13851
719 Ga0496115_0112789 3300048918 Bacteria 2234
720 Ga0496116_0066186 3300048919 Bacteria 2313
721 Ga0496117_0010689 3300048920 Bacteria 8307
722 Ga0496118_0002176 3300048921 Bacteria 27275
723 Ga0496119_0002943 3300048922 Bacteria 18110
724 Ga0496120_0017026 3300048923 Bacteria 4728
725 Ga0496121_0018715 3300048924 Bacteria 6969
726 Ga0496121_0091943 3300048924 Bacteria 2366
727 Ga0496126_0001999 3300048929 Bacteria 28832
728 Ga0496126_0059268 3300048929 Bacteria 3447
729 Ga0501034_0001474 3300049571 Bacteria 31125
730 Ga0501034_0028145 3300049571 Bacteria 5717
731 Ga0501036_0000822 3300049572 Bacteria 23006
732 Ga0501036_0001670 3300049572 Bacteria 17200
733 Ga0501036_0091059 3300049572 Bacteria 2576
734 Ga0501037_0013233 3300049573 Bacteria 6079
735 Ga0501037_0017137 3300049573 Bacteria 5331
736 Ga0501038_0016685 3300049574 Bacteria 6654
737 Ga0501043_0006890 3300049579 Bacteria 9068
738 Ga0501043_0007797 3300049579 Bacteria 8461
739 Ga0501047_0000794 3300049581 Bacteria 33018
740 Ga0501047_0134945 3300049581 Bacteria 2348
741 Ga0501048_0004267 3300049582 Bacteria 10891
742 Ga0501048_0005373 3300049582 Bacteria 9739
743 Ga0501068_0069334 3300049584 Bacteria 2150
744 Ga0501070_0039493 3300049586 Bacteria 3937
745 Ga0501074_0002857 3300049590 Bacteria 12086
746 Ga0501074_0004099 3300049590 Bacteria 10395
747 Ga0501076_0037096 3300049592 Bacteria 3821
748 Ga0501080_0090596 3300049742 Bacteria 2841
749 Ga0501044_0006420 3300049823 Bacteria 12994
750 Ga0501044_0022489 3300049823 Bacteria 6717
751 nmdc:mga05p37_201033_c1 3300050507 Bacteria 2414
752 nmdc:mga05p37_351952_c1 3300050507 Bacteria 1734
753 nmdc:mga05p37_448_c1 3300050507 Bacteria 44738
754 nmdc:mga05p37_6983_c1 3300050507 Bacteria 13307
755 nmdc:mga09592_1369_c1 3300050508 Bacteria 19525
756 nmdc:mga09592_13_c1 3300050508 Bacteria 101979
757 nmdc:mga09592_38118_c1 3300050508 Bacteria 4034
758 nmdc:mga0qj67_1037_c1 3300050509 Bacteria 19212
759 nmdc:mga0qj67_266_c1 3300050509 Bacteria 35948
760 nmdc:mga0qj67_46855_c1 3300050509 Bacteria 3414
761 nmdc:mga06r32_1775_c1 3300050510 Bacteria 19383
762 nmdc:mga06r32_20856_c1 3300050510 Bacteria 6039
763 nmdc:mga06r32_24_c1 3300050510 Bacteria 92238
764 nmdc:mga06r32_7360_c1 3300050510 Bacteria 9908
765 nmdc:mga08y16_25119_c2 3300050511 Bacteria 4131
766 nmdc:mga08y16_35213_c1 3300050511 Bacteria 5259
767 nmdc:mga08y16_66931_c1 3300050511 Bacteria 3749
768 nmdc:mga08y16_8358_c1 3300050511 Bacteria 10829
769 nmdc:mga0n895_1307_c1 3300050512 Bacteria 18433
770 nmdc:mga0n895_1353_c1 3300050512 Bacteria 18195
771 nmdc:mga0n895_181713_c1 3300050512 Bacteria 2135
772 nmdc:mga0n895_3095_c1 3300050512 Bacteria 13246
773 nmdc:mga0n895_67018_c1 3300050512 Bacteria 3555
774 nmdc:mga0n895_68042_c1 3300050512 Bacteria 3528
775 nmdc:mga0rr50_15311_c1 3300050513 Bacteria 5060
776 nmdc:mga0rr50_2031_c1 3300050513 Bacteria 11280
777 nmdc:mga0rr50_41038_c1 3300050513 Bacteria 3369
778 nmdc:mga0rr50_53749_c1 3300050513 Bacteria 2997
779 nmdc:mga08x19_15613_c1 3300050514 Bacteria 4621
780 nmdc:mga08x19_16520_c1 3300050514 Bacteria 4503
781 nmdc:mga0a205_11806_c1 3300050515 Bacteria 8062
782 nmdc:mga0a205_36276_c1 3300050515 Bacteria 4737
783 Ga0495601_0003722 3300053077 Bacteria 8774
784 Ga0495612_0002601 3300053078 Bacteria 7446
785 Ga0500610_0010927 3300053079 Bacteria 4109
786 Ga0495619_0002016 3300053085 Bacteria 13496
787 Ga0495619_0039614 3300053085 Bacteria 3077
788 Ga0500644_0007540 3300053088 Bacteria 2836
789 Ga0500559_0002853 3300053136 Bacteria 8732
790 Ga0500568_0002143 3300053139 Bacteria 11908
791 Ga0500573_0035428 3300053140 Bacteria 2880
792 Ga0500579_073466 3300053143 Bacteria 1959
793 Ga0500588_0000330 3300053146 Bacteria 7153
794 Ga0500600_0055525 3300053149 Bacteria 2229
795 Ga0500627_0004224 3300053158 Bacteria 4574
796 Ga0466962_0000098 3300061719 Bacteria 35205
797 Ga0466962_0031991 3300061719 Bacteria 2519

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2551306166 2552110368 463
2 3300049574 Ga0501038_0016685 Ga0501038_0016685_5208_6629 473
3 3300037418 Ga0395900_0149439 Ga0395900_0149439_12_1487 478
4 3300044693 Ga0466961_0051690 Ga0466961_0051690_1130_2581 482
5 3300006844 Ga0075428_100029471 Ga0075428_1000294715 491
6 3300005937 Ga0081455_10048327 Ga0081455_100483274 497
7 3300035117 Ga0373953_0050988 Ga0373953_0050988_13_1512 498
8 3300035114 Ga0373939_0011035 Ga0373939_0011035_701_2236 506
9 3300048907 Ga0496104_0149180 Ga0496104_0149180_17_1543 506
10 3300046459 Ga0495629_0157995 Ga0495629_0157995_19_1545 507
11 3300026078 Ga0207702_10068199 Ga0207702_100681993 509
12 3300031731 Ga0307405_10010307 Ga0307405_100103075 513
13 3300031852 Ga0307410_10056788 Ga0307410_100567882 513
14 3300031911 Ga0307412_10023607 Ga0307412_100236071 513
15 3300031995 Ga0307409_100001123 Ga0307409_1000011236 513
16 3300032002 Ga0307416_100002435 Ga0307416_1000024356 513
17 3300032126 Ga0307415_100000071 Ga0307415_10000007136 513
18 3300005467 Ga0070706_100085797 Ga0070706_1000857972 515
19 3300021388 Ga0213875_10001853 Ga0213875_1000185311 516
20 3300037853 Ga0436364_0077046 Ga0436364_0077046_31869_33497 516
21 3300048907 Ga0496104_0003435 Ga0496104_0003435_3729_5357 519
22 3300005338 Ga0068868_100050355 Ga0068868_1000503553 521
23 3300005719 Ga0068861_100051607 Ga0068861_1000516073 521
24 3300006058 Ga0075432_10000252 Ga0075432_1000025213 521
25 3300006844 Ga0075428_100033371 Ga0075428_1000333712 521
26 3300006871 Ga0075434_100015391 Ga0075434_1000153913 521
27 3300006914 Ga0075436_100024658 Ga0075436_1000246583 521
28 3300009094 Ga0111539_10001534 Ga0111539_1000153424 521
29 3300009098 Ga0105245_10014154 Ga0105245_100141543 521
30 3300009147 Ga0114129_10000812 Ga0114129_1000081214 521
31 3300009148 Ga0105243_10107299 Ga0105243_101072992 521
32 3300009553 Ga0105249_10009464 Ga0105249_100094643 521
33 3300013306 Ga0163162_10045520 Ga0163162_100455203 521
34 3300013307 Ga0157372_10146315 Ga0157372_101463152 521
35 3300017792 Ga0163161_10008009 Ga0163161_100080093 521
36 3300025927 Ga0207687_10125959 Ga0207687_101259591 521
37 3300025961 Ga0207712_10065729 Ga0207712_100657291 521
38 3300027907 Ga0207428_10000246 Ga0207428_1000024614 521
39 3300033179 Ga0307507_10058009 Ga0307507_100580093 521
40 3300050511 nmdc:mga08y16_66931_c1 nmdc:mga08y16_66931_c1_728_2347 521
41 3300050512 nmdc:mga0n895_1307_c1 nmdc:mga0n895_1307_c1_13387_15006 521
42 3300050513 nmdc:mga0rr50_53749_c1 nmdc:mga0rr50_53749_c1_1159_2778 521
43 3300050515 nmdc:mga0a205_36276_c1 nmdc:mga0a205_36276_c1_963_2582 521
44 3300005347 Ga0070668_100169871 Ga0070668_1001698711 522
45 3300005467 Ga0070706_100016803 Ga0070706_1000168033 522
46 3300005468 Ga0070707_100005483 Ga0070707_1000054836 522
47 3300005842 Ga0068858_100007354 Ga0068858_1000073544 522
48 3300005843 Ga0068860_100008669 Ga0068860_1000086698 522
49 3300025922 Ga0207646_10005754 Ga0207646_100057548 522
50 3300028380 Ga0268265_10030238 Ga0268265_100302382 522
51 3300028381 Ga0268264_10029148 Ga0268264_100291482 522
52 3300005616 Ga0068852_100001272 Ga0068852_1000012726 523
53 3300005985 Ga0081539_10002579 Ga0081539_100025791 523
54 3300026142 Ga0207698_10003187 Ga0207698_100031876 523
55 3300042005 Ga0439448_0011003 Ga0439448_0011003_550_2178 523
56 3300042993 Ga0439440_0000641 Ga0439440_0000641_1100_2728 523
57 3300006847 Ga0075431_100079027 Ga0075431_1000790272 524
58 3300005437 Ga0070710_10043749 Ga0070710_100437492 526
59 3300005439 Ga0070711_100029451 Ga0070711_1000294513 526
60 3300005614 Ga0068856_100056201 Ga0068856_1000562012 526
61 3300025898 Ga0207692_10017135 Ga0207692_100171352 526
62 3300025906 Ga0207699_10018875 Ga0207699_100188753 526
63 3300025928 Ga0207700_10035607 Ga0207700_100356072 526
64 3300025939 Ga0207665_10000684 Ga0207665_1000068413 526
65 3300031616 Ga0307508_10026785 Ga0307508_100267854 526
66 3300048905 Ga0496102_0082240 Ga0496102_0082240_471_2099 526
67 3300048908 Ga0496105_0000206 Ga0496105_0000206_2197_3825 526
68 3300048915 Ga0496112_0000167 Ga0496112_0000167_33233_34861 526
69 3300048916 Ga0496113_0000858 Ga0496113_0000858_6427_8055 526
70 3300005841 Ga0068863_100006850 Ga0068863_1000068506 527
71 3300006844 Ga0075428_100067164 Ga0075428_1000671642 527
72 3300009177 Ga0105248_10011203 Ga0105248_100112034 527
73 3300013308 Ga0157375_10050697 Ga0157375_100506973 527
74 3300022467 Ga0224712_10001181 Ga0224712_100011815 527
75 3300025915 Ga0207693_10006407 Ga0207693_1000640710 527
76 3300028379 Ga0268266_10013700 Ga0268266_100137005 527
77 3300035207 Ga0373942_0000505 Ga0373942_0000505_1113_2744 527
78 3300046459 Ga0495629_0099540 Ga0495629_0099540_56_1690 527
79 3300048915 Ga0496112_0039622 Ga0496112_0039622_1910_3538 527
80 3300053146 Ga0500588_0000330 Ga0500588_0000330_4617_6245 528
81 3300005985 Ga0081539_10002494 Ga0081539_1000249418 529
82 3300009098 Ga0105245_10030380 Ga0105245_100303803 529
83 3300025927 Ga0207687_10014753 Ga0207687_100147533 529
84 3300046462 Ga0495651_0014869 Ga0495651_0014869_3429_5048 529
85 3300046472 Ga0495580_0035662 Ga0495580_0035662_1147_2766 529
86 3300046476 Ga0495662_0001980 Ga0495662_0001980_1801_3420 529
87 3300046511 Ga0495608_0003847 Ga0495608_0003847_3685_5304 529
88 3300046516 Ga0495628_0004294 Ga0495628_0004294_2682_4301 529
89 3300046526 Ga0495666_0017129 Ga0495666_0017129_1527_3146 529
90 3300046529 Ga0495652_0041313 Ga0495652_0041313_1071_2690 529
91 3300046533 Ga0495640_0027410 Ga0495640_0027410_1071_2690 529
92 3300046536 Ga0495587_0022064 Ga0495587_0022064_1443_3062 529
93 3300046543 Ga0495645_0020551 Ga0495645_0020551_1071_2690 529
94 3300046559 Ga0495667_0055081 Ga0495667_0055081_463_2082 529
95 3300046642 Ga0495634_0021824 Ga0495634_0021824_2039_3658 529
96 3300046663 Ga0495635_0011633 Ga0495635_0011633_1119_2738 529
97 3300046675 Ga0495657_0012926 Ga0495657_0012926_2525_4144 529
98 3300046678 Ga0495599_0026206 Ga0495599_0026206_591_2210 529
99 3300046680 Ga0495646_0007368 Ga0495646_0007368_3294_4913 529
100 3300046689 Ga0495613_0003990 Ga0495613_0003990_3546_5165 529
101 3300047315 Ga0495581_0007278 Ga0495581_0007278_2387_4006 529
102 3300047317 Ga0495604_0015836 Ga0495604_0015836_3429_5048 529
103 3300047444 Ga0495675_0047123 Ga0495675_0047123_53_1672 529
104 3300047471 Ga0495684_0043897 Ga0495684_0043897_733_2352 529
105 3300048088 Ga0495602_0032335 Ga0495602_0032335_1269_2888 529
106 3300006844 Ga0075428_100025098 Ga0075428_1000250981 530
107 3300006847 Ga0075431_100000952 Ga0075431_10000095218 530
108 3300006880 Ga0075429_100012176 Ga0075429_1000121764 530
109 3300009147 Ga0114129_10000074 Ga0114129_1000007480 530
110 3300031727 Ga0316576_10011969 Ga0316576_100119694 530
111 3300031728 Ga0316578_10035876 Ga0316578_100358763 530
112 3300044656 Ga0466969_0000322 Ga0466969_0000322_7412_9067 530
113 3300044684 Ga0466966_0022754 Ga0466966_0022754_89_1744 530
114 3300044693 Ga0466961_0002172 Ga0466961_0002172_4912_6567 530
115 3300044719 Ga0466971_0003815 Ga0466971_0003815_4606_6261 530
116 3300045049 Ga0466959_0003872 Ga0466959_0003872_5322_6977 530
117 3300050507 nmdc:mga05p37_448_c1 nmdc:mga05p37_448_c1_27940_29568 530
118 3300050508 nmdc:mga09592_13_c1 nmdc:mga09592_13_c1_38186_39814 530
119 3300050509 nmdc:mga0qj67_1037_c1 nmdc:mga0qj67_1037_c1_958_2586 530
120 3300050510 nmdc:mga06r32_24_c1 nmdc:mga06r32_24_c1_38204_39832 530
121 3300061719 Ga0466962_0000098 Ga0466962_0000098_4781_6436 530
122 3300028794 Ga0307515_10000205 Ga0307515_1000020532 531
123 3300035171 Ga0373946_0024436 Ga0373946_0024436_718_2316 531
124 3300035695 Ga0373927_0065454 Ga0373927_0065454_369_1967 531
125 3300035725 Ga0373947_0030034 Ga0373947_0030034_1247_2845 531
126 3300031616 Ga0307508_10006175 Ga0307508_100061752 532
127 3300031730 Ga0307516_10023643 Ga0307516_100236435 532
128 3300035207 Ga0373942_0001543 Ga0373942_0001543_3217_4845 532
129 3300005334 Ga0068869_100040886 Ga0068869_1000408862 533
130 3300005338 Ga0068868_100117720 Ga0068868_1001177201 533
131 3300005435 Ga0070714_100064771 Ga0070714_1000647712 533
132 3300025927 Ga0207687_10089070 Ga0207687_100890701 533
133 3300046536 Ga0495587_0012446 Ga0495587_0012446_650_2266 533
134 3300047471 Ga0495684_0044672 Ga0495684_0044672_686_2302 533
135 3300045049 Ga0466959_0079481 Ga0466959_0079481_629_2275 534
136 3300005327 Ga0070658_10028400 Ga0070658_100284002 535
137 3300005937 Ga0081455_10081204 Ga0081455_100812043 535
138 3300031824 Ga0307413_10003652 Ga0307413_100036522 535
139 3300031901 Ga0307406_10002775 Ga0307406_100027758 535
140 3300032004 Ga0307414_10166373 Ga0307414_101663731 535
141 iso_pu_bacteria 2687453737 2689961372 535
142 iso_pu_bacteria 2547132424 2548698711 536
143 iso_pu_bacteria 2675903060 2676487719 536
144 iso_pu_bacteria 2856741275 2856743824 536
145 iso_pu_bacteria 2873314349 2873320607 536
146 iso_pu_bacteria 2884693830 2884697757 536
147 iso_pu_bacteria 2891395885 2891402832 536
148 iso_pu_bacteria 2891562705 2891564741 536
149 iso_pu_bacteria 2895427314 2895431848 536
150 iso_pu_bacteria 2895442618 2895444858 536
151 iso_pu_bacteria 2919713450 2919719396 536
152 iso_pu_bacteria 8055172936 8055178521 536
153 iso_pu_bacteria 8056054917 8056056993 536
154 3300005471 Ga0070698_100003756 Ga0070698_1000037566 537
155 iso_pu_bacteria 2501939600 2501944661 537
156 iso_pu_bacteria 2515154088 2515493664 537
157 iso_pu_bacteria 2515154137 2515759583 537
158 iso_pu_bacteria 2515154155 2515855615 537
159 iso_pu_bacteria 2515154203 2516087804 537
160 iso_pu_bacteria 2558860280 2559429097 537
161 iso_pu_bacteria 2582580736 2583151264 537
162 iso_pu_bacteria 2622736605 2623499588 537
163 iso_pu_bacteria 2622736626 2623586784 537
164 iso_pu_bacteria 2643221601 2644017908 537
165 iso_pu_bacteria 2643221631 2644180804 537
166 iso_pu_bacteria 2675903058 2676473409 537
167 iso_pu_bacteria 2675903059 2676480440 537
168 iso_pu_bacteria 2728369276 2729909163 537
169 iso_pu_bacteria 2751185782 2753263540 537
170 iso_pu_bacteria 2772190715 2772646232 537
171 iso_pu_bacteria 2791354901 2791910369 537
172 iso_pu_bacteria 2818991472 2819740132 537
173 iso_pu_bacteria 2827628540 2827631919 537
174 iso_pu_bacteria 2831935698 2831938655 537
175 iso_pu_bacteria 2832004796 2832006397 537
176 iso_pu_bacteria 2855670206 2855671426 537
177 iso_pu_bacteria 2855676851 2855680673 537
178 iso_pu_bacteria 2855683550 2855684816 537
179 iso_pu_bacteria 2856858025 2856860694 537
180 iso_pu_bacteria 2857288857 2857292122 537
181 iso_pu_bacteria 2858848962 2858850917 537
182 iso_pu_bacteria 2858868258 2858870798 537
183 iso_pu_bacteria 2858882152 2858883722 537
184 iso_pu_bacteria 2858888857 2858894198 537
185 iso_pu_bacteria 2858895516 2858901068 537
186 iso_pu_bacteria 2858902515 2858903470 537
187 iso_pu_bacteria 2861520306 2861527883 537
188 iso_pu_bacteria 2866065130 2866067243 537
189 iso_pu_bacteria 2866612099 2866613477 537
190 iso_pu_bacteria 2867302475 2867306547 537
191 iso_pu_bacteria 2867312974 2867313035 537
192 iso_pu_bacteria 2867319477 2867325059 537
193 iso_pu_bacteria 2867507094 2867509634 537
194 iso_pu_bacteria 2869048445 2869052197 537
195 iso_pu_bacteria 2869061728 2869068065 537
196 iso_pu_bacteria 2869068681 2869070793 537
197 iso_pu_bacteria 2880489317 2880493422 537
198 iso_pu_bacteria 2880495981 2880498885 537
199 iso_pu_bacteria 2887478801 2887483933 537
200 iso_pu_bacteria 2891326441 2891330181 537
201 iso_pu_bacteria 2891554331 2891560306 537
202 iso_pu_bacteria 2902582711 2902585560 537
203 iso_pu_bacteria 2929219909 2929220891 537
204 iso_pu_bacteria 2929226422 2929227477 537
205 iso_pu_bacteria 2996221748 2996225734 537
206 iso_pu_bacteria 3002998708 3003007673 537
207 iso_pu_bacteria 649633069 649811429 537
208 iso_pu_bacteria 8001781756 8001783706 537
209 iso_pu_bacteria 8001781756 8001784826 537
210 iso_pu_bacteria 8003830390 8003830789 537
211 iso_pu_bacteria 8003856774 8003860032 537
212 iso_pu_bacteria 8003870546 8003871434 537
213 iso_pu_bacteria 8053945823 8053949036 537
214 iso_pu_bacteria 8054704163 8054710878 537
215 iso_pu_bacteria 8054727385 8054727530 537
216 iso_pu_bacteria 8054734606 8054734976 537
217 iso_pu_bacteria 8055412473 8055413707 537
218 3300005366 Ga0070659_100023208 Ga0070659_1000232083 538
219 3300005441 Ga0070700_100009712 Ga0070700_1000097122 538
220 3300005981 Ga0081538_10000147 Ga0081538_1000014751 538
221 3300009094 Ga0111539_10014298 Ga0111539_100142981 538
222 3300009094 Ga0111539_10159356 Ga0111539_101593563 538
223 3300009147 Ga0114129_10036542 Ga0114129_100365424 538
224 3300009147 Ga0114129_10210742 Ga0114129_102107422 538
225 3300025926 Ga0207659_10066567 Ga0207659_100665672 538
226 3300027907 Ga0207428_10002279 Ga0207428_100022797 538
227 3300046543 Ga0495645_0004178 Ga0495645_0004178_2566_4185 538
228 3300047444 Ga0495675_0044083 Ga0495675_0044083_42_1661 538
229 iso_pu_bacteria 2643221601 2644013592 538
230 iso_pu_bacteria 2643221631 2644179227 538
231 iso_pu_bacteria 2816332119 2816423930 538
232 iso_pu_bacteria 2818991472 2819742529 538
233 iso_pu_bacteria 2995463766 2995464913 538
234 3300031456 Ga0307513_10047087 Ga0307513_100470876 539
235 3300031730 Ga0307516_10021531 Ga0307516_100215313 539
236 iso_pu_bacteria 2902837492 2902843865 539
237 iso_pu_bacteria 8056207758 8056207973 539
238 3300005329 Ga0070683_100000236 Ga0070683_10000023614 540
239 3300005336 Ga0070680_100119905 Ga0070680_1001199051 540
240 3300005458 Ga0070681_10022796 Ga0070681_100227966 540
241 3300005467 Ga0070706_100000040 Ga0070706_100000040112 540
242 3300005467 Ga0070706_100039173 Ga0070706_1000391732 540
243 3300005468 Ga0070707_100025820 Ga0070707_1000258202 540
244 3300005471 Ga0070698_100157754 Ga0070698_1001577542 540
245 3300005530 Ga0070679_100182353 Ga0070679_1001823531 540
246 3300005535 Ga0070684_100011504 Ga0070684_1000115045 540
247 3300005547 Ga0070693_100067367 Ga0070693_1000673671 540
248 3300005578 Ga0068854_100010227 Ga0068854_1000102278 540
249 3300006028 Ga0070717_10000229 Ga0070717_1000022919 540
250 3300006871 Ga0075434_100179563 Ga0075434_1001795632 540
251 3300006914 Ga0075436_100002418 Ga0075436_1000024182 540
252 3300007076 Ga0075435_100007304 Ga0075435_1000073044 540
253 3300009093 Ga0105240_10015717 Ga0105240_100157175 540
254 3300010375 Ga0105239_10195041 Ga0105239_101950412 540
255 3300025910 Ga0207684_10000012 Ga0207684_10000012326 540
256 3300025913 Ga0207695_10014951 Ga0207695_100149513 540
257 3300025915 Ga0207693_10094019 Ga0207693_100940192 540
258 3300025917 Ga0207660_10020746 Ga0207660_100207464 540
259 3300025921 Ga0207652_10007974 Ga0207652_100079747 540
260 3300025922 Ga0207646_10002067 Ga0207646_1000206722 540
261 3300025935 Ga0207709_10036325 Ga0207709_100363252 540
262 3300025944 Ga0207661_10004182 Ga0207661_100041828 540
263 3300025981 Ga0207640_10041468 Ga0207640_100414682 540
264 3300026075 Ga0207708_10000029 Ga0207708_10000029127 540
265 3300026095 Ga0207676_10066474 Ga0207676_100664743 540
266 3300026116 Ga0207674_10112258 Ga0207674_101122582 540
267 3300028800 Ga0265338_10144101 Ga0265338_101441012 540
268 3300031251 Ga0265327_10000329 Ga0265327_1000032972 540
269 3300031251 Ga0265327_10005907 Ga0265327_100059076 540
270 3300031456 Ga0307513_10000001 Ga0307513_10000001500 540
271 3300031595 Ga0265313_10007457 Ga0265313_100074573 540
272 3300041406 Ga0439439_0009397 Ga0439439_0009397_451_2076 540
273 3300041999 Ga0439433_0012465 Ga0439433_0012465_13_1638 540
274 3300042014 Ga0439457_000249 Ga0439457_000249_9702_11327 540
275 3300044656 Ga0466969_0024959 Ga0466969_0024959_767_2392 540
276 3300044694 Ga0466963_0000881 Ga0466963_0000881_1557_3188 540
277 3300044694 Ga0466963_0017505 Ga0466963_0017505_1708_3339 540
278 3300044842 Ga0466957_0047954 Ga0466957_0047954_750_2381 540
279 3300045836 Ga0466958_0013335 Ga0466958_0013335_2076_3707 540
280 3300045976 Ga0466967_0003468 Ga0466967_0003468_3686_5317 540
281 3300045976 Ga0466967_0003723 Ga0466967_0003723_1110_2741 540
282 3300045976 Ga0466967_0008345 Ga0466967_0008345_5697_7328 540
283 3300045976 Ga0466967_0013375 Ga0466967_0013375_4202_5833 540
284 3300046454 Ga0495592_0039813 Ga0495592_0039813_32_1657 540
285 3300046472 Ga0495580_0013333 Ga0495580_0013333_3582_5207 540
286 3300046476 Ga0495662_0014989 Ga0495662_0014989_1873_3498 540
287 3300046477 Ga0495664_0002361 Ga0495664_0002361_5169_6794 540
288 3300046511 Ga0495608_0001337 Ga0495608_0001337_5801_7426 540
289 3300046514 Ga0495618_0030895 Ga0495618_0030895_469_2094 540
290 3300046514 Ga0495618_0100279 Ga0495618_0100279_105_1730 540
291 3300046516 Ga0495628_0007279 Ga0495628_0007279_2657_4282 540
292 3300046531 Ga0495665_0000174 Ga0495665_0000174_8864_10489 540
293 3300046533 Ga0495640_0018426 Ga0495640_0018426_268_1893 540
294 3300046535 Ga0495586_0006408 Ga0495586_0006408_4114_5739 540
295 3300046543 Ga0495645_0017837 Ga0495645_0017837_2517_4142 540
296 3300046559 Ga0495667_0040952 Ga0495667_0040952_1031_2656 540
297 3300046663 Ga0495635_0057545 Ga0495635_0057545_985_2610 540
298 3300046675 Ga0495657_0035385 Ga0495657_0035385_806_2431 540
299 3300046680 Ga0495646_0026554 Ga0495646_0026554_1332_2957 540
300 3300046689 Ga0495613_0002951 Ga0495613_0002951_5928_7553 540
301 3300047317 Ga0495604_0000604 Ga0495604_0000604_23198_24823 540
302 3300047673 Ga0495593_0010466 Ga0495593_0010466_2968_4593 540
303 3300048903 Ga0496100_0011219 Ga0496100_0011219_3256_4887 540
304 3300048904 Ga0496101_0028662 Ga0496101_0028662_1739_3370 540
305 3300048908 Ga0496105_0060471 Ga0496105_0060471_551_2182 540
306 3300048909 Ga0496106_0032172 Ga0496106_0032172_2227_3858 540
307 3300048911 Ga0496108_0003488 Ga0496108_0003488_7396_9027 540
308 3300048912 Ga0496109_0002466 Ga0496109_0002466_6907_8538 540
309 3300048913 Ga0496110_0058650 Ga0496110_0058650_1463_3094 540
310 3300048915 Ga0496112_0009573 Ga0496112_0009573_2784_4415 540
311 3300048918 Ga0496115_0001834 Ga0496115_0001834_8101_9732 540
312 3300048918 Ga0496115_0112789 Ga0496115_0112789_209_1840 540
313 3300049586 Ga0501070_0039493 Ga0501070_0039493_1134_2759 540
314 3300049742 Ga0501080_0090596 Ga0501080_0090596_171_1796 540
315 3300050512 nmdc:mga0n895_181713_c1 nmdc:mga0n895_181713_c1_295_1926 540
316 3300050512 nmdc:mga0n895_68042_c1 nmdc:mga0n895_68042_c1_1121_2752 540
317 3300050513 nmdc:mga0rr50_15311_c1 nmdc:mga0rr50_15311_c1_1363_2994 540
318 3300050514 nmdc:mga08x19_15613_c1 nmdc:mga08x19_15613_c1_1829_3460 540
319 3300053077 Ga0495601_0003722 Ga0495601_0003722_605_2230 540
320 3300053140 Ga0500573_0035428 Ga0500573_0035428_359_1984 540
321 3300053143 Ga0500579_073466 Ga0500579_073466_255_1880 540
322 3300053149 Ga0500600_0055525 Ga0500600_0055525_206_1831 540
323 iso_pu_bacteria 2643221687 2644490989 540
324 3300003203 JGI25406J46586_10003320 JGI25406J46586_100033205 541
325 3300003659 JGI25404J52841_10001280 JGI25404J52841_100012802 541
326 3300005327 Ga0070658_10016387 Ga0070658_100163872 541
327 3300005327 Ga0070658_10061570 Ga0070658_100615702 541
328 3300005329 Ga0070683_100063537 Ga0070683_1000635373 541
329 3300005330 Ga0070690_100046565 Ga0070690_1000465652 541
330 3300005334 Ga0068869_100003606 Ga0068869_1000036066 541
331 3300005334 Ga0068869_100015454 Ga0068869_1000154546 541
332 3300005334 Ga0068869_100020213 Ga0068869_1000202132 541
333 3300005336 Ga0070680_100023060 Ga0070680_1000230603 541
334 3300005336 Ga0070680_100074535 Ga0070680_1000745352 541
335 3300005337 Ga0070682_100021149 Ga0070682_1000211495 541
336 3300005337 Ga0070682_100082961 Ga0070682_1000829611 541
337 3300005338 Ga0068868_100004884 Ga0068868_1000048843 541
338 3300005338 Ga0068868_100010826 Ga0068868_1000108266 541
339 3300005339 Ga0070660_100045836 Ga0070660_1000458363 541
340 3300005340 Ga0070689_100098133 Ga0070689_1000981332 541
341 3300005345 Ga0070692_10015787 Ga0070692_100157872 541
342 3300005345 Ga0070692_10031558 Ga0070692_100315582 541
343 3300005354 Ga0070675_100000474 Ga0070675_10000047414 541
344 3300005354 Ga0070675_100017552 Ga0070675_1000175523 541
345 3300005355 Ga0070671_100010047 Ga0070671_1000100472 541
346 3300005356 Ga0070674_100034076 Ga0070674_1000340762 541
347 3300005356 Ga0070674_100063498 Ga0070674_1000634981 541
348 3300005366 Ga0070659_100074678 Ga0070659_1000746782 541
349 3300005367 Ga0070667_100060409 Ga0070667_1000604093 541
350 3300005406 Ga0070703_10017981 Ga0070703_100179812 541
351 3300005435 Ga0070714_100000748 Ga0070714_1000007487 541
352 3300005435 Ga0070714_100007010 Ga0070714_1000070105 541
353 3300005437 Ga0070710_10000038 Ga0070710_1000003833 541
354 3300005441 Ga0070700_100021673 Ga0070700_1000216732 541
355 3300005445 Ga0070708_100001458 Ga0070708_1000014588 541
356 3300005455 Ga0070663_100005762 Ga0070663_1000057622 541
357 3300005455 Ga0070663_100012822 Ga0070663_1000128223 541
358 3300005455 Ga0070663_100035486 Ga0070663_1000354862 541
359 3300005456 Ga0070678_100035483 Ga0070678_1000354832 541
360 3300005458 Ga0070681_10012788 Ga0070681_100127884 541
361 3300005458 Ga0070681_10075668 Ga0070681_100756682 541
362 3300005458 Ga0070681_10183072 Ga0070681_101830721 541
363 3300005467 Ga0070706_100005462 Ga0070706_1000054626 541
364 3300005468 Ga0070707_100017512 Ga0070707_1000175123 541
365 3300005471 Ga0070698_100000882 Ga0070698_1000008829 541
366 3300005530 Ga0070679_100022803 Ga0070679_1000228032 541
367 3300005530 Ga0070679_100055772 Ga0070679_1000557722 541
368 3300005530 Ga0070679_100142805 Ga0070679_1001428051 541
369 3300005535 Ga0070684_100014776 Ga0070684_1000147766 541
370 3300005536 Ga0070697_100004326 Ga0070697_1000043266 541
371 3300005543 Ga0070672_100069484 Ga0070672_1000694843 541
372 3300005544 Ga0070686_100030018 Ga0070686_1000300182 541
373 3300005547 Ga0070693_100000306 Ga0070693_1000003064 541
374 3300005547 Ga0070693_100018379 Ga0070693_1000183793 541
375 3300005548 Ga0070665_100009637 Ga0070665_1000096373 541
376 3300005548 Ga0070665_100036664 Ga0070665_1000366645 541
377 3300005563 Ga0068855_100008986 Ga0068855_1000089866 541
378 3300005564 Ga0070664_100002642 Ga0070664_1000026429 541
379 3300005564 Ga0070664_100022108 Ga0070664_1000221084 541
380 3300005577 Ga0068857_100020839 Ga0068857_1000208393 541
381 3300005577 Ga0068857_100195580 Ga0068857_1001955801 541
382 3300005615 Ga0070702_100000311 Ga0070702_1000003112 541
383 3300005616 Ga0068852_100020490 Ga0068852_1000204904 541
384 3300005617 Ga0068859_100090513 Ga0068859_1000905133 541
385 3300005618 Ga0068864_100005592 Ga0068864_1000055922 541
386 3300005618 Ga0068864_100020948 Ga0068864_1000209483 541
387 3300005618 Ga0068864_100120732 Ga0068864_1001207322 541
388 3300005718 Ga0068866_10018583 Ga0068866_100185832 541
389 3300005719 Ga0068861_100150778 Ga0068861_1001507781 541
390 3300005834 Ga0068851_10007201 Ga0068851_100072012 541
391 3300005840 Ga0068870_10012656 Ga0068870_100126565 541
392 3300005841 Ga0068863_100003223 Ga0068863_1000032236 541
393 3300005841 Ga0068863_100069921 Ga0068863_1000699212 541
394 3300005841 Ga0068863_100073859 Ga0068863_1000738591 541
395 3300005842 Ga0068858_100028675 Ga0068858_1000286752 541
396 3300005842 Ga0068858_100052493 Ga0068858_1000524932 541
397 3300005843 Ga0068860_100074495 Ga0068860_1000744954 541
398 3300005937 Ga0081455_10000852 Ga0081455_1000085216 541
399 3300005937 Ga0081455_10002204 Ga0081455_1000220410 541
400 3300005937 Ga0081455_10004392 Ga0081455_1000439211 541
401 3300005937 Ga0081455_10059855 Ga0081455_100598553 541
402 3300005937 Ga0081455_10070056 Ga0081455_100700562 541
403 3300005937 Ga0081455_10078910 Ga0081455_100789102 541
404 3300005981 Ga0081538_10000072 Ga0081538_1000007278 541
405 3300005981 Ga0081538_10021992 Ga0081538_100219923 541
406 3300005983 Ga0081540_1000299 Ga0081540_100029943 541
407 3300005983 Ga0081540_1009660 Ga0081540_10096602 541
408 3300005983 Ga0081540_1015600 Ga0081540_10156004 541
409 3300005985 Ga0081539_10000111 Ga0081539_1000011168 541
410 3300005985 Ga0081539_10001764 Ga0081539_1000176427 541
411 3300005985 Ga0081539_10010149 Ga0081539_100101495 541
412 3300006028 Ga0070717_10029695 Ga0070717_100296953 541
413 3300006028 Ga0070717_10080161 Ga0070717_100801611 541
414 3300006038 Ga0075365_10061294 Ga0075365_100612942 541
415 3300006058 Ga0075432_10000174 Ga0075432_100001748 541
416 3300006173 Ga0070716_100024720 Ga0070716_1000247201 541
417 3300006237 Ga0097621_100036803 Ga0097621_1000368032 541
418 3300006358 Ga0068871_100036569 Ga0068871_1000365692 541
419 3300006844 Ga0075428_100003332 Ga0075428_1000033324 541
420 3300006844 Ga0075428_100012968 Ga0075428_1000129685 541
421 3300006844 Ga0075428_100099808 Ga0075428_1000998081 541
422 3300006844 Ga0075428_100117637 Ga0075428_1001176372 541
423 3300006846 Ga0075430_100000718 Ga0075430_10000071817 541
424 3300006846 Ga0075430_100010462 Ga0075430_1000104623 541
425 3300006847 Ga0075431_100001854 Ga0075431_1000018542 541
426 3300006847 Ga0075431_100006192 Ga0075431_1000061924 541
427 3300006852 Ga0075433_10130506 Ga0075433_101305062 541
428 3300006871 Ga0075434_100001116 Ga0075434_1000011169 541
429 3300006871 Ga0075434_100005314 Ga0075434_1000053145 541
430 3300006880 Ga0075429_100010863 Ga0075429_1000108636 541
431 3300006881 Ga0068865_100111050 Ga0068865_1001110502 541
432 3300006914 Ga0075436_100000994 Ga0075436_10000099416 541
433 3300006931 Ga0097620_100090512 Ga0097620_1000905123 541
434 3300007076 Ga0075435_100000791 Ga0075435_10000079111 541
435 3300007076 Ga0075435_100003771 Ga0075435_1000037716 541
436 3300009011 Ga0105251_10010563 Ga0105251_100105634 541
437 3300009094 Ga0111539_10000480 Ga0111539_1000048032 541
438 3300009094 Ga0111539_10013207 Ga0111539_100132073 541
439 3300009094 Ga0111539_10209500 Ga0111539_102095001 541
440 3300009098 Ga0105245_10050453 Ga0105245_100504533 541
441 3300009098 Ga0105245_10083181 Ga0105245_100831812 541
442 3300009098 Ga0105245_10117054 Ga0105245_101170542 541
443 3300009101 Ga0105247_10044249 Ga0105247_100442493 541
444 3300009147 Ga0114129_10000860 Ga0114129_1000086011 541
445 3300009147 Ga0114129_10078900 Ga0114129_100789003 541
446 3300009148 Ga0105243_10004905 Ga0105243_1000490511 541
447 3300009177 Ga0105248_10030258 Ga0105248_100302586 541
448 3300009177 Ga0105248_10040543 Ga0105248_100405435 541
449 3300009545 Ga0105237_10006790 Ga0105237_1000679012 541
450 3300009551 Ga0105238_10046069 Ga0105238_100460692 541
451 3300011119 Ga0105246_10000477 Ga0105246_100004772 541
452 3300011119 Ga0105246_10041874 Ga0105246_100418742 541
453 3300012507 Ga0157342_1001244 Ga0157342_10012442 541
454 3300013100 Ga0157373_10066593 Ga0157373_100665932 541
455 3300013297 Ga0157378_10044901 Ga0157378_100449012 541
456 3300013307 Ga0157372_10000031 Ga0157372_1000003130 541
457 3300013307 Ga0157372_10070789 Ga0157372_100707894 541
458 3300013307 Ga0157372_10135749 Ga0157372_101357491 541
459 3300013308 Ga0157375_10057277 Ga0157375_100572772 541
460 3300014325 Ga0163163_10022605 Ga0163163_100226057 541
461 3300014325 Ga0163163_10057192 Ga0163163_100571923 541
462 3300014745 Ga0157377_10045163 Ga0157377_100451632 541
463 3300014968 Ga0157379_10028196 Ga0157379_100281964 541
464 3300020070 Ga0206356_10233614 Ga0206356_102336141 541
465 3300020070 Ga0206356_11006926 Ga0206356_110069263 541
466 3300020078 Ga0206352_10520446 Ga0206352_105204461 541
467 3300020080 Ga0206350_10547176 Ga0206350_105471761 541
468 3300020082 Ga0206353_10598622 Ga0206353_105986222 541
469 3300021384 Ga0213876_10007156 Ga0213876_100071563 541
470 3300021388 Ga0213875_10012012 Ga0213875_100120124 541
471 3300022467 Ga0224712_10001326 Ga0224712_100013261 541
472 3300022467 Ga0224712_10017876 Ga0224712_100178762 541
473 3300025321 Ga0207656_10008362 Ga0207656_100083622 541
474 3300025885 Ga0207653_10003687 Ga0207653_100036873 541
475 3300025898 Ga0207692_10033123 Ga0207692_100331232 541
476 3300025899 Ga0207642_10018397 Ga0207642_100183971 541
477 3300025901 Ga0207688_10002120 Ga0207688_100021202 541
478 3300025901 Ga0207688_10005833 Ga0207688_100058334 541
479 3300025905 Ga0207685_10029334 Ga0207685_100293342 541
480 3300025906 Ga0207699_10013452 Ga0207699_100134522 541
481 3300025906 Ga0207699_10027577 Ga0207699_100275772 541
482 3300025908 Ga0207643_10001058 Ga0207643_100010589 541
483 3300025909 Ga0207705_10003565 Ga0207705_100035659 541
484 3300025910 Ga0207684_10014711 Ga0207684_100147113 541
485 3300025912 Ga0207707_10121776 Ga0207707_101217763 541
486 3300025917 Ga0207660_10115754 Ga0207660_101157542 541
487 3300025919 Ga0207657_10002605 Ga0207657_100026059 541
488 3300025920 Ga0207649_10003412 Ga0207649_100034129 541
489 3300025921 Ga0207652_10004799 Ga0207652_100047992 541
490 3300025922 Ga0207646_10013787 Ga0207646_100137875 541
491 3300025925 Ga0207650_10003121 Ga0207650_100031218 541
492 3300025926 Ga0207659_10039758 Ga0207659_100397583 541
493 3300025927 Ga0207687_10040111 Ga0207687_100401112 541
494 3300025928 Ga0207700_10019277 Ga0207700_100192774 541
495 3300025928 Ga0207700_10031111 Ga0207700_100311113 541
496 3300025929 Ga0207664_10004984 Ga0207664_100049846 541
497 3300025929 Ga0207664_10017678 Ga0207664_100176783 541
498 3300025929 Ga0207664_10051507 Ga0207664_100515072 541
499 3300025933 Ga0207706_10010254 Ga0207706_100102545 541
500 3300025933 Ga0207706_10024674 Ga0207706_100246744 541
501 3300025935 Ga0207709_10056786 Ga0207709_100567862 541
502 3300025936 Ga0207670_10114304 Ga0207670_101143042 541
503 3300025937 Ga0207669_10038735 Ga0207669_100387352 541
504 3300025938 Ga0207704_10083497 Ga0207704_100834972 541
505 3300025939 Ga0207665_10027979 Ga0207665_100279793 541
506 3300025940 Ga0207691_10021953 Ga0207691_100219534 541
507 3300025941 Ga0207711_10039479 Ga0207711_100394793 541
508 3300025941 Ga0207711_10143220 Ga0207711_101432202 541
509 3300025942 Ga0207689_10002005 Ga0207689_1000200521 541
510 3300025942 Ga0207689_10003674 Ga0207689_100036743 541
511 3300025942 Ga0207689_10017358 Ga0207689_100173582 541
512 3300025944 Ga0207661_10018102 Ga0207661_100181025 541
513 3300025945 Ga0207679_10005249 Ga0207679_100052492 541
514 3300025949 Ga0207667_10128573 Ga0207667_101285732 541
515 3300025960 Ga0207651_10018497 Ga0207651_100184972 541
516 3300025960 Ga0207651_10056984 Ga0207651_100569843 541
517 3300025972 Ga0207668_10001275 Ga0207668_100012752 541
518 3300025986 Ga0207658_10039275 Ga0207658_100392752 541
519 3300026023 Ga0207677_10121688 Ga0207677_101216882 541
520 3300026035 Ga0207703_10027684 Ga0207703_100276842 541
521 3300026067 Ga0207678_10000891 Ga0207678_100008918 541
522 3300026067 Ga0207678_10001928 Ga0207678_100019285 541
523 3300026075 Ga0207708_10003482 Ga0207708_100034822 541
524 3300026078 Ga0207702_10000901 Ga0207702_1000090121 541
525 3300026078 Ga0207702_10033797 Ga0207702_100337974 541
526 3300026088 Ga0207641_10016995 Ga0207641_100169954 541
527 3300026088 Ga0207641_10018373 Ga0207641_100183731 541
528 3300026088 Ga0207641_10127024 Ga0207641_101270242 541
529 3300026095 Ga0207676_10000683 Ga0207676_1000068319 541
530 3300026116 Ga0207674_10021848 Ga0207674_100218484 541
531 3300026116 Ga0207674_10039302 Ga0207674_100393025 541
532 3300026116 Ga0207674_10054800 Ga0207674_100548002 541
533 3300026118 Ga0207675_100006727 Ga0207675_1000067272 541
534 3300026118 Ga0207675_100012015 Ga0207675_1000120154 541
535 3300026118 Ga0207675_100103572 Ga0207675_1001035722 541
536 3300026121 Ga0207683_10003187 Ga0207683_100031875 541
537 3300026121 Ga0207683_10012621 Ga0207683_100126216 541
538 3300026142 Ga0207698_10007832 Ga0207698_100078327 541
539 3300026142 Ga0207698_10020661 Ga0207698_100206615 541
540 3300027907 Ga0207428_10000414 Ga0207428_1000041410 541
541 3300027907 Ga0207428_10005349 Ga0207428_100053492 541
542 3300027907 Ga0207428_10012320 Ga0207428_100123204 541
543 3300028794 Ga0307515_10037515 Ga0307515_100375154 541
544 3300028794 Ga0307515_10119249 Ga0307515_101192492 541
545 3300028800 Ga0265338_10001802 Ga0265338_100018027 541
546 3300030521 Ga0307511_10001476 Ga0307511_1000147619 541
547 3300030522 Ga0307512_10012399 Ga0307512_100123994 541
548 3300030522 Ga0307512_10029964 Ga0307512_100299646 541
549 3300030731 Ga0316177_1136358 Ga0316177_11363584 541
550 3300030732 Ga0316176_1130375 Ga0316176_11303753 541
551 3300031241 Ga0265325_10000179 Ga0265325_1000017932 541
552 3300031247 Ga0265340_10000074 Ga0265340_100000749 541
553 3300031247 Ga0265340_10003776 Ga0265340_100037762 541
554 3300031247 Ga0265340_10015933 Ga0265340_100159332 541
555 3300031249 Ga0265339_10003512 Ga0265339_100035125 541
556 3300031548 Ga0307408_100005281 Ga0307408_1000052813 541
557 3300031548 Ga0307408_100035813 Ga0307408_1000358132 541
558 3300031616 Ga0307508_10015004 Ga0307508_100150041 541
559 3300031616 Ga0307508_10015558 Ga0307508_100155583 541
560 3300031711 Ga0265314_10008167 Ga0265314_100081673 541
561 3300031730 Ga0307516_10009973 Ga0307516_100099734 541
562 3300031731 Ga0307405_10002680 Ga0307405_100026802 541
563 3300031731 Ga0307405_10021984 Ga0307405_100219844 541
564 3300031731 Ga0307405_10041159 Ga0307405_100411592 541
565 3300031824 Ga0307413_10001422 Ga0307413_100014222 541
566 3300031824 Ga0307413_10003080 Ga0307413_100030802 541
567 3300031824 Ga0307413_10010654 Ga0307413_100106544 541
568 3300031824 Ga0307413_10041105 Ga0307413_100411052 541
569 3300031852 Ga0307410_10000378 Ga0307410_100003785 541
570 3300031852 Ga0307410_10000601 Ga0307410_100006012 541
571 3300031852 Ga0307410_10013287 Ga0307410_100132873 541
572 3300031901 Ga0307406_10000809 Ga0307406_100008092 541
573 3300031901 Ga0307406_10001755 Ga0307406_100017557 541
574 3300031901 Ga0307406_10013284 Ga0307406_100132844 541
575 3300031901 Ga0307406_10043646 Ga0307406_100436462 541
576 3300031901 Ga0307406_10057879 Ga0307406_100578791 541
577 3300031903 Ga0307407_10001972 Ga0307407_100019724 541
578 3300031903 Ga0307407_10009714 Ga0307407_100097146 541
579 3300031903 Ga0307407_10029876 Ga0307407_100298762 541
580 3300031911 Ga0307412_10020393 Ga0307412_100203931 541
581 3300031995 Ga0307409_100000116 Ga0307409_10000011619 541
582 3300031995 Ga0307409_100001784 Ga0307409_1000017844 541
583 3300031995 Ga0307409_100046794 Ga0307409_1000467942 541
584 3300031995 Ga0307409_100142561 Ga0307409_1001425612 541
585 3300032002 Ga0307416_100015531 Ga0307416_1000155313 541
586 3300032002 Ga0307416_100022312 Ga0307416_1000223125 541
587 3300032002 Ga0307416_100039238 Ga0307416_1000392382 541
588 3300032002 Ga0307416_100062171 Ga0307416_1000621712 541
589 3300032004 Ga0307414_10005883 Ga0307414_100058834 541
590 3300032004 Ga0307414_10038554 Ga0307414_100385543 541
591 3300032005 Ga0307411_10001178 Ga0307411_100011782 541
592 3300032005 Ga0307411_10006244 Ga0307411_100062444 541
593 3300032005 Ga0307411_10026159 Ga0307411_100261592 541
594 3300032126 Ga0307415_100006570 Ga0307415_1000065705 541
595 3300032126 Ga0307415_100014981 Ga0307415_1000149813 541
596 3300032126 Ga0307415_100020756 Ga0307415_1000207563 541
597 3300032126 Ga0307415_100077718 Ga0307415_1000777182 541
598 3300035083 Ga0373926_0011010 Ga0373926_0011010_1250_2878 541
599 3300035086 Ga0373934_0013329 Ga0373934_0013329_793_2421 541
600 3300035090 Ga0373949_0007250 Ga0373949_0007250_333_1961 541
601 3300035091 Ga0373951_0000536 Ga0373951_0000536_7611_9239 541
602 3300035113 Ga0373936_0025152 Ga0373936_0025152_211_1839 541
603 3300035113 Ga0373936_0042142 Ga0373936_0042142_171_1799 541
604 3300035116 Ga0373945_0009189 Ga0373945_0009189_709_2337 541
605 3300035117 Ga0373953_0005549 Ga0373953_0005549_1599_3227 541
606 3300035118 Ga0373954_0015989 Ga0373954_0015989_1673_3301 541
607 3300035119 Ga0373956_0019918 Ga0373956_0019918_742_2370 541
608 3300035170 Ga0373943_0003061 Ga0373943_0003061_959_2587 541
609 3300035171 Ga0373946_0001422 Ga0373946_0001422_1450_3078 541
610 3300035172 Ga0373955_0014889 Ga0373955_0014889_2009_3637 541
611 3300035692 Ga0373935_0030511 Ga0373935_0030511_877_2505 541
612 3300035695 Ga0373927_0008513 Ga0373927_0008513_1039_2667 541
613 3300035725 Ga0373947_0001252 Ga0373947_0001252_13180_14808 541
614 3300037068 Ga0373925_0002220 Ga0373925_0002220_2780_4408 541
615 3300037068 Ga0373925_0003761 Ga0373925_0003761_1423_3051 541
616 3300037312 Ga0395899_0003664 Ga0395899_0003664_620_2245 541
617 3300037312 Ga0395899_0038909 Ga0395899_0038909_530_2158 541
618 3300037418 Ga0395900_0002497 Ga0395900_0002497_3572_5200 541
619 3300037466 Ga0395898_0001600 Ga0395898_0001600_7239_8867 541
620 3300037466 Ga0395898_0063063 Ga0395898_0063063_1139_2776 541
621 3300037471 Ga0395905_0002372 Ga0395905_0002372_10864_12492 541
622 3300037853 Ga0436364_1086439 Ga0436364_1086439_4404_6032 541
623 3300038443 Ga0395901_0005296 Ga0395901_0005296_8476_10104 541
624 3300038443 Ga0395901_0009518 Ga0395901_0009518_5253_6881 541
625 3300038443 Ga0395901_0012435 Ga0395901_0012435_2411_4048 541
626 3300039437 Ga0436365_1789266 Ga0436365_1789266_16204_17832 541
627 3300039450 Ga0436363_0110923 Ga0436363_0110923_1001_2629 541
628 3300044656 Ga0466969_0001204 Ga0466969_0001204_729_2354 541
629 3300044656 Ga0466969_0003369 Ga0466969_0003369_6100_7728 541
630 3300044683 Ga0466965_0008335 Ga0466965_0008335_1704_3332 541
631 3300044683 Ga0466965_0039781 Ga0466965_0039781_525_2153 541
632 3300044693 Ga0466961_0002620 Ga0466961_0002620_732_2360 541
633 3300044693 Ga0466961_0018404 Ga0466961_0018404_2454_4079 541
634 3300044694 Ga0466963_0016351 Ga0466963_0016351_1494_3134 541
635 3300044719 Ga0466971_0033923 Ga0466971_0033923_388_2013 541
636 3300044765 Ga0466970_0011138 Ga0466970_0011138_2322_3950 541
637 3300044765 Ga0466970_0066157 Ga0466970_0066157_186_1817 541
638 3300044901 Ga0466960_0001544 Ga0466960_0001544_5584_7212 541
639 3300045049 Ga0466959_0008070 Ga0466959_0008070_4092_5720 541
640 3300045836 Ga0466958_0042659 Ga0466958_0042659_796_2436 541
641 3300046455 Ga0495603_0016248 Ga0495603_0016248_1891_3519 541
642 3300046461 Ga0495641_0017707 Ga0495641_0017707_159_1787 541
643 3300046462 Ga0495651_0001770 Ga0495651_0001770_7716_9341 541
644 3300046462 Ga0495651_0015452 Ga0495651_0015452_3390_5018 541
645 3300046462 Ga0495651_0126738 Ga0495651_0126738_190_1818 541
646 3300046463 Ga0495653_0004030 Ga0495653_0004030_3378_5006 541
647 3300046472 Ga0495580_0041306 Ga0495580_0041306_990_2618 541
648 3300046475 Ga0495639_0003366 Ga0495639_0003366_148_1776 541
649 3300046476 Ga0495662_0027154 Ga0495662_0027154_91_1719 541
650 3300046477 Ga0495664_0001629 Ga0495664_0001629_4902_6530 541
651 3300046511 Ga0495608_0040310 Ga0495608_0040310_584_2224 541
652 3300046511 Ga0495608_0053593 Ga0495608_0053593_491_2119 541
653 3300046514 Ga0495618_0001099 Ga0495618_0001099_10785_12413 541
654 3300046515 Ga0495620_0043774 Ga0495620_0043774_233_1861 541
655 3300046517 Ga0495630_0002313 Ga0495630_0002313_5929_7557 541
656 3300046517 Ga0495630_0013048 Ga0495630_0013048_4047_5675 541
657 3300046519 Ga0495632_0013488 Ga0495632_0013488_1311_2939 541
658 3300046524 Ga0495648_0058770 Ga0495648_0058770_237_1880 541
659 3300046531 Ga0495665_0003579 Ga0495665_0003579_2270_3898 541
660 3300046533 Ga0495640_0007894 Ga0495640_0007894_1915_3543 541
661 3300046536 Ga0495587_0004437 Ga0495587_0004437_4717_6345 541
662 3300046543 Ga0495645_0010202 Ga0495645_0010202_3087_4715 541
663 3300046559 Ga0495667_0008113 Ga0495667_0008113_4932_6560 541
664 3300046559 Ga0495667_0031190 Ga0495667_0031190_1449_3077 541
665 3300046559 Ga0495667_0045109 Ga0495667_0045109_241_1881 541
666 3300046642 Ga0495634_0002199 Ga0495634_0002199_12688_14316 541
667 3300046642 Ga0495634_0077517 Ga0495634_0077517_51_1679 541
668 3300046663 Ga0495635_0002142 Ga0495635_0002142_5344_6969 541
669 3300046663 Ga0495635_0004779 Ga0495635_0004779_2319_3947 541
670 3300046675 Ga0495657_0052599 Ga0495657_0052599_672_2300 541
671 3300046689 Ga0495613_0008683 Ga0495613_0008683_610_2238 541
672 3300046690 Ga0495624_0027916 Ga0495624_0027916_1915_3543 541
673 3300046690 Ga0495624_0038002 Ga0495624_0038002_700_2328 541
674 3300046690 Ga0495624_0067028 Ga0495624_0067028_515_2143 541
675 3300046809 Ga0495600_0031126 Ga0495600_0031126_1454_3082 541
676 3300047317 Ga0495604_0003292 Ga0495604_0003292_3666_5294 541
677 3300047317 Ga0495604_0046744 Ga0495604_0046744_1237_2865 541
678 3300047319 Ga0495674_0008198 Ga0495674_0008198_4899_6527 541
679 3300047319 Ga0495674_0028189 Ga0495674_0028189_296_1924 541
680 3300047321 Ga0495676_0006159 Ga0495676_0006159_8029_9657 541
681 3300047321 Ga0495676_0012188 Ga0495676_0012188_979_2607 541
682 3300047322 Ga0495680_0003581 Ga0495680_0003581_10901_12529 541
683 3300047322 Ga0495680_0035463 Ga0495680_0035463_510_2138 541
684 3300047444 Ga0495675_0013608 Ga0495675_0013608_2876_4504 541
685 3300047471 Ga0495684_0016747 Ga0495684_0016747_2897_4525 541
686 3300048089 Ga0495614_0007604 Ga0495614_0007604_1283_2911 541
687 3300048903 Ga0496100_0032636 Ga0496100_0032636_748_2376 541
688 3300048905 Ga0496102_0003380 Ga0496102_0003380_62_1690 541
689 3300048905 Ga0496102_0006065 Ga0496102_0006065_1606_3234 541
690 3300048905 Ga0496102_0113141 Ga0496102_0113141_294_1922 541
691 3300048906 Ga0496103_0100816 Ga0496103_0100816_101_1729 541
692 3300048907 Ga0496104_0001600 Ga0496104_0001600_1610_3238 541
693 3300048907 Ga0496104_0020237 Ga0496104_0020237_1130_2758 541
694 3300048908 Ga0496105_0005190 Ga0496105_0005190_7468_9096 541
695 3300048909 Ga0496106_0082221 Ga0496106_0082221_155_1786 541
696 3300048910 Ga0496107_0006136 Ga0496107_0006136_2618_4246 541
697 3300048910 Ga0496107_0087015 Ga0496107_0087015_641_2269 541
698 3300048911 Ga0496108_0000117 Ga0496108_0000117_19483_21114 541
699 3300048911 Ga0496108_0004350 Ga0496108_0004350_3182_4810 541
700 3300048911 Ga0496108_0005676 Ga0496108_0005676_2067_3695 541
701 3300048911 Ga0496108_0050234 Ga0496108_0050234_686_2314 541
702 3300048911 Ga0496108_0097547 Ga0496108_0097547_409_2037 541
703 3300048912 Ga0496109_0057813 Ga0496109_0057813_1259_2887 541
704 3300048913 Ga0496110_0016417 Ga0496110_0016417_329_1957 541
705 3300048914 Ga0496111_0001418 Ga0496111_0001418_5919_7547 541
706 3300048914 Ga0496111_0005769 Ga0496111_0005769_4810_6438 541
707 3300048915 Ga0496112_0142446 Ga0496112_0142446_140_1768 541
708 3300048916 Ga0496113_0002915 Ga0496113_0002915_4672_6300 541
709 3300048916 Ga0496113_0021355 Ga0496113_0021355_406_2034 541
710 3300048917 Ga0496114_0173068 Ga0496114_0173068_204_1832 541
711 3300048918 Ga0496115_0002241 Ga0496115_0002241_12150_13781 541
712 3300048924 Ga0496121_0018715 Ga0496121_0018715_3230_4861 541
713 3300048929 Ga0496126_0001999 Ga0496126_0001999_7514_9145 541
714 3300049571 Ga0501034_0001474 Ga0501034_0001474_26991_28619 541
715 3300049571 Ga0501034_0028145 Ga0501034_0028145_1543_3168 541
716 3300049572 Ga0501036_0000822 Ga0501036_0000822_13498_15126 541
717 3300049572 Ga0501036_0001670 Ga0501036_0001670_9231_10856 541
718 3300049572 Ga0501036_0091059 Ga0501036_0091059_357_1982 541
719 3300049573 Ga0501037_0013233 Ga0501037_0013233_1553_3178 541
720 3300049573 Ga0501037_0017137 Ga0501037_0017137_1175_2803 541
721 3300049579 Ga0501043_0006890 Ga0501043_0006890_373_2001 541
722 3300049579 Ga0501043_0007797 Ga0501043_0007797_2762_4387 541
723 3300049581 Ga0501047_0000794 Ga0501047_0000794_6497_8122 541
724 3300049581 Ga0501047_0134945 Ga0501047_0134945_146_1774 541
725 3300049582 Ga0501048_0004267 Ga0501048_0004267_3821_5446 541
726 3300049582 Ga0501048_0005373 Ga0501048_0005373_403_2031 541
727 3300049584 Ga0501068_0069334 Ga0501068_0069334_14_1642 541
728 3300049590 Ga0501074_0002857 Ga0501074_0002857_5080_6705 541
729 3300049590 Ga0501074_0004099 Ga0501074_0004099_7881_9509 541
730 3300049592 Ga0501076_0037096 Ga0501076_0037096_1264_2889 541
731 3300049823 Ga0501044_0006420 Ga0501044_0006420_1615_3240 541
732 3300049823 Ga0501044_0022489 Ga0501044_0022489_2828_4459 541
733 3300050507 nmdc:mga05p37_351952_c1 nmdc:mga05p37_351952_c1_10_1638 541
734 3300050507 nmdc:mga05p37_6983_c1 nmdc:mga05p37_6983_c1_4148_5776 541
735 3300050508 nmdc:mga09592_1369_c1 nmdc:mga09592_1369_c1_11945_13573 541
736 3300050509 nmdc:mga0qj67_266_c1 nmdc:mga0qj67_266_c1_26794_28422 541
737 3300050510 nmdc:mga06r32_1775_c1 nmdc:mga06r32_1775_c1_16717_18345 541
738 3300050510 nmdc:mga06r32_20856_c1 nmdc:mga06r32_20856_c1_261_1889 541
739 3300050511 nmdc:mga08y16_25119_c2 nmdc:mga08y16_25119_c2_2251_3879 541
740 3300050511 nmdc:mga08y16_35213_c1 nmdc:mga08y16_35213_c1_2642_4270 541
741 3300050511 nmdc:mga08y16_8358_c1 nmdc:mga08y16_8358_c1_2230_3858 541
742 3300050512 nmdc:mga0n895_1353_c1 nmdc:mga0n895_1353_c1_10268_11896 541
743 3300050512 nmdc:mga0n895_3095_c1 nmdc:mga0n895_3095_c1_7641_9269 541
744 3300050513 nmdc:mga0rr50_2031_c1 nmdc:mga0rr50_2031_c1_2613_4241 541
745 3300050513 nmdc:mga0rr50_41038_c1 nmdc:mga0rr50_41038_c1_316_1944 541
746 3300050514 nmdc:mga08x19_16520_c1 nmdc:mga08x19_16520_c1_2522_4150 541
747 3300050515 nmdc:mga0a205_11806_c1 nmdc:mga0a205_11806_c1_5970_7598 541
748 3300053078 Ga0495612_0002601 Ga0495612_0002601_5701_7329 541
749 3300053079 Ga0500610_0010927 Ga0500610_0010927_801_2429 541
750 3300053085 Ga0495619_0002016 Ga0495619_0002016_4027_5655 541
751 3300053088 Ga0500644_0007540 Ga0500644_0007540_273_1901 541
752 3300053136 Ga0500559_0002853 Ga0500559_0002853_17_1645 541
753 3300053139 Ga0500568_0002143 Ga0500568_0002143_4119_5747 541
754 3300053158 Ga0500627_0004224 Ga0500627_0004224_1274_2905 541
755 3300061719 Ga0466962_0031991 Ga0466962_0031991_635_2260 541
756 3300005327 Ga0070658_10006030 Ga0070658_100060303 542
757 3300005329 Ga0070683_100079203 Ga0070683_1000792033 542
758 3300005336 Ga0070680_100009200 Ga0070680_1000092001 542
759 3300005366 Ga0070659_100000157 Ga0070659_1000001575 542
760 3300005458 Ga0070681_10000017 Ga0070681_10000017101 542
761 3300005468 Ga0070707_100007802 Ga0070707_1000078027 542
762 3300005468 Ga0070707_100155008 Ga0070707_1001550082 542
763 3300005530 Ga0070679_100000009 Ga0070679_10000000915 542
764 3300005563 Ga0068855_100006327 Ga0068855_1000063272 542
765 3300005937 Ga0081455_10030104 Ga0081455_100301043 542
766 3300005981 Ga0081538_10002418 Ga0081538_100024187 542
767 3300006871 Ga0075434_100010717 Ga0075434_1000107172 542
768 3300013104 Ga0157370_10001921 Ga0157370_1000192114 542
769 3300013105 Ga0157369_10003572 Ga0157369_100035724 542
770 3300013105 Ga0157369_10004005 Ga0157369_1000400516 542
771 3300013105 Ga0157369_10010650 Ga0157369_1001065010 542
772 3300020069 Ga0197907_10475933 Ga0197907_104759331 542
773 3300024225 Ga0224572_1001334 Ga0224572_10013343 542
774 3300025909 Ga0207705_10009940 Ga0207705_100099407 542
775 3300025910 Ga0207684_10013409 Ga0207684_100134094 542
776 3300025912 Ga0207707_10000227 Ga0207707_1000022738 542
777 3300025913 Ga0207695_10019917 Ga0207695_100199173 542
778 3300025917 Ga0207660_10006706 Ga0207660_100067062 542
779 3300025921 Ga0207652_10000124 Ga0207652_1000012459 542
780 3300025932 Ga0207690_10006654 Ga0207690_100066544 542
781 3300025949 Ga0207667_10017359 Ga0207667_100173595 542
782 3300031824 Ga0307413_10001727 Ga0307413_100017274 542
783 3300031852 Ga0307410_10002667 Ga0307410_100026674 542
784 3300031901 Ga0307406_10000477 Ga0307406_1000047716 542
785 3300031901 Ga0307406_10062849 Ga0307406_100628492 542
786 3300031903 Ga0307407_10008233 Ga0307407_100082332 542
787 3300031995 Ga0307409_100000009 Ga0307409_10000000983 542
788 3300032002 Ga0307416_100000281 Ga0307416_10000028113 542
789 3300032126 Ga0307415_100006514 Ga0307415_1000065144 542
790 3300035083 Ga0373926_0001496 Ga0373926_0001496_2344_3975 542
791 3300035171 Ga0373946_0006321 Ga0373946_0006321_1497_3128 542
792 3300035692 Ga0373935_0000034 Ga0373935_0000034_13652_15283 542
793 3300035725 Ga0373947_0000008 Ga0373947_0000008_42491_44122 542
794 3300037418 Ga0395900_0195053 Ga0395900_0195053_95_1744 542
795 3300037466 Ga0395898_0047920 Ga0395898_0047920_934_2583 542
796 3300038443 Ga0395901_0028604 Ga0395901_0028604_3589_5238 542
797 3300044901 Ga0466960_0013456 Ga0466960_0013456_1476_3104 542
798 3300046678 Ga0495599_0019886 Ga0495599_0019886_131_1798 542
799 3300047447 Ga0495685_013392 Ga0495685_013392_732_2363 542
800 3300050512 nmdc:mga0n895_67018_c1 nmdc:mga0n895_67018_c1_1793_3421 542
801 3300005367 Ga0070667_100000109 Ga0070667_10000010990 543
802 3300005548 Ga0070665_100010761 Ga0070665_1000107612 543
803 3300005617 Ga0068859_100003399 Ga0068859_10000339914 543
804 3300005841 Ga0068863_100000123 Ga0068863_10000012321 543
805 3300005842 Ga0068858_100003925 Ga0068858_1000039258 543
806 3300005843 Ga0068860_100000175 Ga0068860_10000017530 543
807 3300005844 Ga0068862_100000091 Ga0068862_10000009192 543
808 3300006931 Ga0097620_100003399 Ga0097620_1000033993 543
809 3300009101 Ga0105247_10000070 Ga0105247_1000007029 543
810 3300009177 Ga0105248_10000331 Ga0105248_1000033131 543
811 3300025303 Ga0209051_1000582 Ga0209051_100058235 543
812 3300025900 Ga0207710_10000010 Ga0207710_10000010365 543
813 3300025923 Ga0207681_10002083 Ga0207681_100020837 543
814 3300025941 Ga0207711_10000522 Ga0207711_1000052212 543
815 3300025961 Ga0207712_10000010 Ga0207712_1000001029 543
816 3300025986 Ga0207658_10000257 Ga0207658_1000025713 543
817 3300026035 Ga0207703_10005951 Ga0207703_100059513 543
818 3300026088 Ga0207641_10001365 Ga0207641_1000136521 543
819 3300028379 Ga0268266_10008723 Ga0268266_100087237 543
820 3300028380 Ga0268265_10000105 Ga0268265_1000010529 543
821 3300028381 Ga0268264_10000237 Ga0268264_1000023789 543
822 3300048903 Ga0496100_0011113 Ga0496100_0011113_3192_4832 543
823 3300048905 Ga0496102_0000985 Ga0496102_0000985_19704_21344 543
824 3300048919 Ga0496116_0066186 Ga0496116_0066186_370_2010 543
825 3300048920 Ga0496117_0010689 Ga0496117_0010689_1261_2901 543
826 3300048921 Ga0496118_0002176 Ga0496118_0002176_2595_4235 543
827 3300048922 Ga0496119_0002943 Ga0496119_0002943_7551_9191 543
828 3300048923 Ga0496120_0017026 Ga0496120_0017026_3055_4695 543
829 3300048924 Ga0496121_0091943 Ga0496121_0091943_107_1747 543
830 3300048929 Ga0496126_0059268 Ga0496126_0059268_1659_3299 543
831 3300005467 Ga0070706_100003339 Ga0070706_10000333913 544
832 3300005471 Ga0070698_100000926 Ga0070698_10000092616 544
833 3300005618 Ga0068864_100158555 Ga0068864_1001585552 544
834 3300013308 Ga0157375_10018586 Ga0157375_100185866 544
835 3300025273 Ga0209673_1019981 Ga0209673_10199812 544
836 3300025303 Ga0209051_1003521 Ga0209051_10035212 544
837 3300025303 Ga0209051_1006409 Ga0209051_10064094 544
838 3300025910 Ga0207684_10032957 Ga0207684_100329573 544
839 3300026067 Ga0207678_10054311 Ga0207678_100543111 544
840 3300037853 Ga0436364_0505858 Ga0436364_0505858_3440_5077 544
841 3300047472 Ga0495686_0010656 Ga0495686_0010656_636_2276 544
842 3300048908 Ga0496105_0145204 Ga0496105_0145204_173_1807 544
843 3300048914 Ga0496111_0082019 Ga0496111_0082019_574_2208 544
844 3300005366 Ga0070659_100021357 Ga0070659_1000213573 545
845 3300025932 Ga0207690_10006425 Ga0207690_100064253 545
846 3300037471 Ga0395905_0115113 Ga0395905_0115113_368_2044 545
847 3300038443 Ga0395901_0126351 Ga0395901_0126351_875_2551 545
848 3300005563 Ga0068855_100032330 Ga0068855_1000323306 546
849 3300044693 Ga0466961_0006591 Ga0466961_0006591_278_1930 547
850 3300021388 Ga0213875_10013610 Ga0213875_100136104 550
851 3300044656 Ga0466969_0005509 Ga0466969_0005509_1757_3475 550
852 3300013105 Ga0157369_10006696 Ga0157369_100066963 552
853 iso_pu_bacteria 2995463766 2995466206 552
854 3300036401 Ga0373937_0002052 Ga0373937_0002052_10168_11835 554
855 3300046454 Ga0495592_0039481 Ga0495592_0039481_1669_3336 554
856 3300046462 Ga0495651_0001980 Ga0495651_0001980_6762_8429 554
857 3300046463 Ga0495653_0004155 Ga0495653_0004155_3277_4944 554
858 3300046511 Ga0495608_0002887 Ga0495608_0002887_6939_8606 554
859 3300046516 Ga0495628_0139892 Ga0495628_0139892_11_1678 554
860 3300046529 Ga0495652_0002781 Ga0495652_0002781_15387_17054 554
861 3300046533 Ga0495640_0016533 Ga0495640_0016533_442_2109 554
862 3300046536 Ga0495587_0002902 Ga0495587_0002902_6470_8137 554
863 3300046559 Ga0495667_0000283 Ga0495667_0000283_9498_11165 554
864 3300046663 Ga0495635_0023067 Ga0495635_0023067_48_1715 554
865 3300046675 Ga0495657_0002522 Ga0495657_0002522_12210_13877 554
866 3300046679 Ga0495623_0057261 Ga0495623_0057261_710_2377 554
867 3300046809 Ga0495600_0033828 Ga0495600_0033828_896_2563 554
868 3300047317 Ga0495604_0053249 Ga0495604_0053249_634_2301 554
869 3300047319 Ga0495674_0009350 Ga0495674_0009350_5670_7337 554
870 3300047322 Ga0495680_0003391 Ga0495680_0003391_1320_2987 554
871 3300048088 Ga0495602_0004230 Ga0495602_0004230_3726_5393 554
872 3300053085 Ga0495619_0039614 Ga0495619_0039614_1303_2970 554
873 3300009147 Ga0114129_10045654 Ga0114129_100456542 557
874 3300050507 nmdc:mga05p37_201033_c1 nmdc:mga05p37_201033_c1_515_2191 557
875 3300050508 nmdc:mga09592_38118_c1 nmdc:mga09592_38118_c1_538_2214 557
876 3300050509 nmdc:mga0qj67_46855_c1 nmdc:mga0qj67_46855_c1_840_2516 557
877 3300050510 nmdc:mga06r32_7360_c1 nmdc:mga06r32_7360_c1_1993_3669 557
878 3300009174 Ga0105241_10007577 Ga0105241_100075772 565
879 3300010375 Ga0105239_10026716 Ga0105239_100267163 565
880 3300013100 Ga0157373_10017538 Ga0157373_100175382 565
881 3300014745 Ga0157377_10005188 Ga0157377_100051884 565
882 3300001979 JGI24740J21852_10006521 JGI24740J21852_100065211 567
883 3300001989 JGI24739J22299_10010192 JGI24739J22299_100101924 567

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

77

550

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4idm-assembly1.cif.gz_A crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis 0.9812 26 567
4jdc-assembly1.cif.gz_A crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis 0.981 26 567
4ihi-assembly1.cif.gz_A crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis bound with nad 0.9804 26 567
4ns3-assembly1.cif.gz_E crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis bound with nad and cobalamin 0.9785 26 567
4ihi-assembly1.cif.gz_A crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis bound with nad 0.9768 26 567
ID Description Score Start End Superfamily
3v9gA02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9796 321 518 3.40.309.10
af_P07275_43_316_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9748 53 318 3.40.605.10
4ns3E02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9721 321 517 3.40.309.10
3v9gA02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9699 321 518 3.40.309.10
4ns3E02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9669 321 517 3.40.309.10
ID Description Score Start End GO Terms
AF-A0A7Z9PYL7-F1-model_v4 Aldehyde dehydrogenase family protein 0.9802 25 297 GO:0003842
GO:0009898
GO:0010133
AF-A0A7Y5KH56-F1-model_v4 Aldehyde dehydrogenase family protein 0.9755 26 199 GO:0003842
GO:0009898
GO:0010133
AF-A0A383ZJQ1-F1-model_v4 Multifunctional fusion protein [Includes: Delta-1-pyrroline-5-carboxylate dehydrogenase (P5C dehydrogenase) (L-glutamate gamma-semialdehyde dehydrogenase); L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88)] 0.974 31 567 GO:0003842
GO:0005759
GO:0010133
AF-A0A7L1NPU6-F1-model_v4 AL4A1 protein 0.9726 30 318 GO:0003842
AF-A0A849FXS4-F1-model_v4 Aldehyde dehydrogenase family protein 0.9724 27 188 GO:0003842
GO:0009898
GO:0010133

Feature Viewer

pLDDT pTM Quality
90.28 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map