F484522

General Info

Members Datasets Scaffolds Average Seq Length
881 546 705 223

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10143380|Ga0105240_101433803
Length 257
Sequence LYGPGSAAHHFVLRCARDTKSKTRERKMKSVVVRNIKRADNNAVATMAALGVSTVHEALGRSGLMKTYMRPIWAGAQIAGPAVTVLAQPGDNWMIHVAVEQCQKGDVLVVGCTTDNTDGMFGELLATSLTARGVKGLIIDAGCRDVKALHDMGFPVWSRAVSAKGTVKATPGAVNVPVVCAGVNVEPGDVIVADDDGVVVVPRKLAIETAQKAQKRHDDEDGKRKQLAAGVLGLDMYKMREPLAKAGLVYVDNPEDV

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
15 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
16 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
17 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
18 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
19 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
20 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
21 2791355199
22 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
23 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
24 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
25 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
26 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
27 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
28 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
29 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
30 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
31 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
32 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
33 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
34 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
35 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
36 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
37 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
38 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
39 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
40 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
41 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
42 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
43 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
44 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
45 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
46 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
47 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
48 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
49 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
50 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
51 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
52 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
53 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
54 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
55 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
56 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
57 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
58 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
59 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
60 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
61 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
62 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
63 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
64 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
65 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
66 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
67 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
68 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
69 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
70 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
71 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
72 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
73 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
74 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
75 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
76 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
77 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
78 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
79 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
80 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
81 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
82 2922368715
83 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
84 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
85 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
86 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
87 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
88 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
89 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
90 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
91 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
92 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
93 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
94 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
95 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
96 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
97 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
98 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
99 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
100 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
101 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
102 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
103 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
104 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
105 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
106 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
107 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
108 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
109 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
110 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
111 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
112 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
113 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
114 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
115 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
116 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
117 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
118 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
119 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
120 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
121 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
122 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
123 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
124 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
125 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
126 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
127 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
128 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
129 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
130 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
131 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
132 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
133 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
134 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
135 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
136 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
137 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
138 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
139 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
140 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
141 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
142 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
143 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
144 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
145 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
146 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
147 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
148 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
149 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
150 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
151 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
152 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
153 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
154 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
155 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
156 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
157 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
158 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
159 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
160 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
161 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
162 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
163 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
164 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
165 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
166 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
167 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
168 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
169 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
170 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
171 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
172 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
173 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
174 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
175 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
176 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
177 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
178 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
179 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
180 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
181 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
182 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
183 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
184 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
185 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
186 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
187 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
188 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
189 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
190 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
191 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
192 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
193 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
194 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
195 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
196 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
197 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
198 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
199 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
200 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
201 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
202 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
203 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
204 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
205 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
206 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
207 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
208 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
209 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
210 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
211 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
212 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
213 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
214 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
215 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
216 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
217 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
218 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
219 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
220 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
221 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
222 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
223 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
224 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
225 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
226 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
227 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
228 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
229 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
230 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
231 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
232 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
233 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
234 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
235 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
236 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
237 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
238 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
239 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
240 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
241 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
242 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
243 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
244 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
245 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
246 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
247 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
248 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
249 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
250 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
251 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
252 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
253 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
254 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
255 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
257 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
258 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
259 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
305 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
306 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
307 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
308 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
311 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
312 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
313 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
314 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
315 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
316 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
317 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
318 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
319 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
320 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
321 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
322 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
323 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
324 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
325 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
326 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
327 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
328 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
329 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
330 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
331 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
332 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
333 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
334 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
335 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
336 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
337 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
338 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
339 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
341 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
342 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
343 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
344 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
345 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
346 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
347 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
348 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
349 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
350 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
351 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
352 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
353 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
354 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
355 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
356 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
357 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
358 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
359 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
360 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
361 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
362 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
363 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
364 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
365 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
366 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
367 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
368 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
369 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
370 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
371 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
372 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
373 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
374 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
375 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
376 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
377 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
378 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
379 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
380 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
381 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
382 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
383 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
384 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
385 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
386 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
387 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
388 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
389 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
390 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
391 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
392 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
393 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
394 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
395 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
396 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
397 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
398 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
399 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
400 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
401 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
402 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
403 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
404 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
405 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
406 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
407 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
408 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
409 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
410 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
411 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
412 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
413 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
414 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
415 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
416 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
417 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
418 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
419 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
420 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
421 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
422 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
423 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
424 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
425 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
426 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
427 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
428 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
429 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
430 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
431 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
432 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
433 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
434 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
435 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
436 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
437 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
438 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
439 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
440 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
441 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
442 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
443 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
444 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
445 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
446 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
447 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
448 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
449 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
462 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
463 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
464 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
465 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
466 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
467 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
468 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
469 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
470 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
471 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
472 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
475 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
478 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
479 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
480 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
481 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
482 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
483 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
484 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
485 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
486 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
487 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
488 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
489 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
490 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
491 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
492 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
493 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
494 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
495 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
496 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
497 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
498 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
499 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
500 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
501 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
502 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
503 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
504 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
505 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
506 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
507 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
508 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
509 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
510 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
511 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
512 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
513 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
514 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
515 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
516 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
517 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
518 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
519 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
520 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
521 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
522 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
523 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
524 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
525 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
526 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
527 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
528 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
529 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
530 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
531 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
532 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
533 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
534 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
535 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
536 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
537 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
538 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
539 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
540 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
541 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
542 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
543 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
544 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
545 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
546 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.98
Metatranscriptomes 0.23
Isolates 19.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.99
Nodule 15.32
Rhizoplane 7.26
Rhizosphere 58.12
Stem 0
Stem Tuber 0
Unclassified 9.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C1063 2010549000 Bacteria 2363
2 JGI24739J22299_10071180 3300001989 Bacteria 1082
3 JGI25153J46596_10000394 3300003215 Bacteria 29469
4 JGI25153J46596_10003431 3300003215 Bacteria 8876
5 JGI25160J50197_1012586 3300003354 Bacteria 2928
6 Ga0055542_1011589 3300003762 Bacteria 1559
7 Ga0055531_10007393 3300003794 Bacteria 6010
8 Ga0055543_1002885 3300004625 Bacteria 5407
9 Ga0065165_1001731 3300005262 Bacteria 21826
10 Ga0065165_1002125 3300005262 Bacteria 18029
11 Ga0065712_10016912 3300005290 Bacteria 1759
12 Ga0070658_10004762 3300005327 Bacteria 11041
13 Ga0070658_10051844 3300005327 Bacteria 3325
14 Ga0070683_100477334 3300005329 Bacteria 1191
15 Ga0070683_100575298 3300005329 Bacteria 1077
16 Ga0068869_100509780 3300005334 Bacteria 1005
17 Ga0070680_100017453 3300005336 Bacteria 5660
18 Ga0070680_100107577 3300005336 Bacteria 2319
19 Ga0070682_100104282 3300005337 Bacteria 1878
20 Ga0068868_100103125 3300005338 Bacteria 2310
21 Ga0070660_100001944 3300005339 Bacteria 14250
22 Ga0070660_100069539 3300005339 Bacteria 2746
23 Ga0070661_100125958 3300005344 Bacteria 1922
24 Ga0070668_100323705 3300005347 Bacteria 1298
25 Ga0070675_100356650 3300005354 Bacteria 1298
26 Ga0070671_100001629 3300005355 Bacteria 16929
27 Ga0070673_100177979 3300005364 Bacteria 1819
28 Ga0070709_10014203 3300005434 Bacteria 4500
29 Ga0070709_10048689 3300005434 Bacteria 2646
30 Ga0070709_10077995 3300005434 Bacteria 2155
31 Ga0070709_10078036 3300005434 Bacteria 2154
32 Ga0070714_100041624 3300005435 Bacteria 3878
33 Ga0070714_100091008 3300005435 Bacteria 2672
34 Ga0070713_100012732 3300005436 Bacteria 6181
35 Ga0070713_100192501 3300005436 Bacteria 1838
36 Ga0070713_100195344 3300005436 Bacteria 1825
37 Ga0070713_100464464 3300005436 Bacteria 1190
38 Ga0070710_10002441 3300005437 Bacteria 8802
39 Ga0070710_10046159 3300005437 Bacteria 2425
40 Ga0070710_10159238 3300005437 Bacteria 1399
41 Ga0070711_100002925 3300005439 Bacteria 9841
42 Ga0070711_100005838 3300005439 Bacteria 7390
43 Ga0070711_100017055 3300005439 Bacteria 4619
44 Ga0070711_100020886 3300005439 Bacteria 4227
45 Ga0070711_100040240 3300005439 Bacteria 3151
46 Ga0070711_100179879 3300005439 Bacteria 1619
47 Ga0070711_100913954 3300005439 Bacteria 749
48 Ga0070663_100055656 3300005455 Bacteria 2832
49 Ga0070663_100226708 3300005455 Bacteria 1469
50 Ga0070663_100249004 3300005455 Bacteria 1406
51 Ga0070678_100011904 3300005456 Bacteria 5384
52 Ga0070678_100043206 3300005456 Bacteria 3209
53 Ga0070681_10004544 3300005458 Bacteria 13233
54 Ga0070681_10103453 3300005458 Bacteria 2792
55 Ga0070681_10219115 3300005458 Bacteria 1818
56 Ga0070681_10622008 3300005458 Bacteria 994
57 Ga0070706_100204227 3300005467 Bacteria 1846
58 Ga0070707_100739084 3300005468 Bacteria 947
59 Ga0070698_100079119 3300005471 Bacteria 3285
60 Ga0070699_100098367 3300005518 Bacteria 2564
61 Ga0070679_100006626 3300005530 Bacteria 10798
62 Ga0070679_100038870 3300005530 Bacteria 4731
63 Ga0070679_100395127 3300005530 Bacteria 1329
64 Ga0070679_100463679 3300005530 Bacteria 1211
65 Ga0070679_100539670 3300005530 Bacteria 1110
66 Ga0070684_100063932 3300005535 Bacteria 3227
67 Ga0070684_100393456 3300005535 Bacteria 1277
68 Ga0068853_100127758 3300005539 Bacteria 2272
69 Ga0068853_100486966 3300005539 Bacteria 1163
70 Ga0070672_100275735 3300005543 Bacteria 1421
71 Ga0070695_100149314 3300005545 Bacteria 1629
72 Ga0070696_100238502 3300005546 Bacteria 1370
73 Ga0070693_100128664 3300005547 Bacteria 1580
74 Ga0070665_101137226 3300005548 Bacteria 792
75 Ga0068855_100073110 3300005563 Bacteria 3984
76 Ga0068855_100837078 3300005563 Bacteria 976
77 Ga0068855_100858428 3300005563 Bacteria 961
78 Ga0070664_100024089 3300005564 Bacteria 5032
79 Ga0070664_100043917 3300005564 Bacteria 3773
80 Ga0068857_100139884 3300005577 Bacteria 2188
81 Ga0068854_100460406 3300005578 Bacteria 1064
82 Ga0068856_100000020 3300005614 Bacteria 146775
83 Ga0068856_100135286 3300005614 Bacteria 2470
84 Ga0068856_100168939 3300005614 Bacteria 2199
85 Ga0070702_100551212 3300005615 Bacteria 856
86 Ga0068852_100116503 3300005616 Bacteria 2438
87 Ga0068852_100420229 3300005616 Bacteria 1319
88 Ga0068852_100567177 3300005616 Bacteria 1137
89 Ga0068859_100171388 3300005617 Bacteria 2251
90 Ga0068864_100025488 3300005618 Bacteria 4981
91 Ga0068866_10026261 3300005718 Bacteria 2748
92 Ga0068861_100891841 3300005719 Bacteria 841
93 Ga0068870_10485385 3300005840 Bacteria 821
94 Ga0068863_100045728 3300005841 Bacteria 4154
95 Ga0068858_100008078 3300005842 Bacteria 10133
96 Ga0068860_100327827 3300005843 Bacteria 1503
97 Ga0068862_100268560 3300005844 Bacteria 1559
98 Ga0068862_100301425 3300005844 Bacteria 1474
99 Ga0081455_10017926 3300005937 Bacteria 6766
100 Ga0081455_10063868 3300005937 Bacteria 3087
101 Ga0081455_10105008 3300005937 Bacteria 2259
102 Ga0081538_10034813 3300005981 Bacteria 3321
103 Ga0081540_1002690 3300005983 Bacteria 14454
104 Ga0081540_1003654 3300005983 Bacteria 12058
105 Ga0081540_1017195 3300005983 Bacteria 4485
106 Ga0070717_10022005 3300006028 Bacteria 5031
107 Ga0070717_10064475 3300006028 Bacteria 3043
108 Ga0070717_10178883 3300006028 Bacteria 1848
109 Ga0075365_10054530 3300006038 Bacteria 2651
110 Ga0075365_10232908 3300006038 Bacteria 1293
111 Ga0075363_100063020 3300006048 Bacteria 2000
112 Ga0075364_10208643 3300006051 Bacteria 1325
113 Ga0070715_10000961 3300006163 Bacteria 8038
114 Ga0070716_100002442 3300006173 Bacteria 8562
115 Ga0070712_100015939 3300006175 Bacteria 4847
116 Ga0070712_100034659 3300006175 Bacteria 3422
117 Ga0070712_100043566 3300006175 Bacteria 3090
118 Ga0070712_100068339 3300006175 Bacteria 2531
119 Ga0070712_100070488 3300006175 Bacteria 2498
120 Ga0070712_100492850 3300006175 Bacteria 1026
121 Ga0075362_10022802 3300006177 Bacteria 2641
122 Ga0075367_10000988 3300006178 Bacteria 11650
123 Ga0075369_10008785 3300006186 Bacteria 3903
124 Ga0075366_10155752 3300006195 Bacteria 1384
125 Ga0075366_10411529 3300006195 Bacteria 832
126 Ga0075366_10483803 3300006195 Bacteria 765
127 Ga0097621_100019101 3300006237 Bacteria 5255
128 Ga0097621_100030570 3300006237 Bacteria 4265
129 Ga0097621_100567523 3300006237 Bacteria 1034
130 Ga0075370_10060519 3300006353 Bacteria 2157
131 Ga0068871_100010894 3300006358 Bacteria 6656
132 Ga0068871_100166449 3300006358 Bacteria 1887
133 Ga0075428_100079146 3300006844 Bacteria 3587
134 Ga0075434_100490088 3300006871 Bacteria 1250
135 Ga0068865_100381974 3300006881 Bacteria 1149
136 Ga0097620_100171379 3300006931 Bacteria 2251
137 Ga0099824_1012798 3300006942 Bacteria 8977
138 Ga0099794_10283726 3300007265 Bacteria 856
139 Ga0105240_10008282 3300009093 Bacteria 14882
140 Ga0105240_10143380 3300009093 Bacteria 2854
141 Ga0105240_10238154 3300009093 Bacteria 2111
142 Ga0105240_10273675 3300009093 Bacteria 1943
143 Ga0105240_11362552 3300009093 Bacteria 747
144 Ga0105245_10006619 3300009098 Bacteria 10177
145 Ga0105245_10007619 3300009098 Bacteria 9480
146 Ga0105245_10161198 3300009098 Bacteria 2128
147 Ga0105245_10365153 3300009098 Bacteria 1434
148 Ga0105247_10346942 3300009101 Bacteria 1043
149 Ga0114129_10111337 3300009147 Bacteria 3777
150 Ga0114129_10749936 3300009147 Bacteria 1250
151 Ga0105241_10053828 3300009174 Bacteria 3079
152 Ga0105241_10062670 3300009174 Bacteria 2867
153 Ga0105241_10072568 3300009174 Bacteria 2676
154 Ga0105241_10122821 3300009174 Bacteria 2093
155 Ga0105242_10018122 3300009176 Bacteria 5500
156 Ga0105242_10077188 3300009176 Bacteria 2779
157 Ga0105242_10418766 3300009176 Bacteria 1255
158 Ga0105242_10480797 3300009176 Bacteria 1177
159 Ga0105248_10015680 3300009177 Bacteria 8351
160 Ga0105248_10027920 3300009177 Bacteria 6284
161 Ga0105248_10164724 3300009177 Bacteria 2499
162 Ga0105248_10440910 3300009177 Bacteria 1467
163 Ga0105237_10006673 3300009545 Bacteria 12756
164 Ga0105237_10016711 3300009545 Bacteria 7618
165 Ga0105237_10026248 3300009545 Bacteria 5953
166 Ga0105237_11001220 3300009545 Bacteria 842
167 Ga0105238_10005356 3300009551 Bacteria 12677
168 Ga0105238_10157681 3300009551 Bacteria 2245
169 Ga0105238_10246610 3300009551 Bacteria 1764
170 Ga0105238_10288491 3300009551 Bacteria 1623
171 Ga0105238_10889307 3300009551 Bacteria 909
172 Ga0099796_10009831 3300010159 Bacteria 2605
173 Ga0105239_10502132 3300010375 Bacteria 1379
174 Ga0105246_10462649 3300011119 Bacteria 1069
175 Ga0105246_10597859 3300011119 Bacteria 953
176 Ga0105246_10716096 3300011119 Bacteria 879
177 Ga0157371_10013955 3300013102 Bacteria 6084
178 Ga0157370_10110323 3300013104 Bacteria 2572
179 Ga0157370_10161675 3300013104 Bacteria 2083
180 Ga0157369_10035175 3300013105 Bacteria 5494
181 Ga0157369_10104822 3300013105 Bacteria 3011
182 Ga0157369_10225065 3300013105 Bacteria 1963
183 Ga0157369_10457316 3300013105 Bacteria 1322
184 Ga0157369_10587395 3300013105 Bacteria 1150
185 Ga0157374_10012098 3300013296 Bacteria 7494
186 Ga0157378_10037040 3300013297 Bacteria 4319
187 Ga0163162_10019668 3300013306 Bacteria 6628
188 Ga0157372_10965973 3300013307 Bacteria 987
189 Ga0157375_10015754 3300013308 Bacteria 6774
190 Ga0157375_10031030 3300013308 Bacteria 5045
191 Ga0157375_10034118 3300013308 Bacteria 4844
192 Ga0163163_10047665 3300014325 Bacteria 4212
193 Ga0163163_10490357 3300014325 Bacteria 1290
194 Ga0157379_10005550 3300014968 Bacteria 10838
195 Ga0157379_10015374 3300014968 Bacteria 6715
196 Ga0157379_10090305 3300014968 Bacteria 2748
197 Ga0157376_10073840 3300014969 Bacteria 2905
198 Ga0206356_11553529 3300020070 Bacteria 1534
199 Ga0206353_11806622 3300020082 Bacteria 1611
200 Ga0213872_10034960 3300021361 Bacteria 2299
201 Ga0213876_10057753 3300021384 Bacteria 2049
202 Ga0213875_10056323 3300021388 Bacteria 1842
203 Ga0209148_1000500 3300025254 Bacteria 39994
204 Ga0209564_1019909 3300025295 Bacteria 2484
205 Ga0209758_1000024 3300025297 Bacteria 591966
206 Ga0209758_1001533 3300025297 Bacteria 26615
207 Ga0209758_1004785 3300025297 Bacteria 10950
208 Ga0209758_1007070 3300025297 Bacteria 7780
209 Ga0207426_1000510 3300025302 Bacteria 56675
210 Ga0209257_1001149 3300025304 Bacteria 33675
211 Ga0207656_10045648 3300025321 Bacteria 1876
212 Ga0207692_10008992 3300025898 Bacteria 4157
213 Ga0207692_10094891 3300025898 Bacteria 1625
214 Ga0207688_10059355 3300025901 Bacteria 2154
215 Ga0207680_10219026 3300025903 Bacteria 1304
216 Ga0207685_10016843 3300025905 Bacteria 2348
217 Ga0207699_10002766 3300025906 Bacteria 8287
218 Ga0207699_10034074 3300025906 Bacteria 2884
219 Ga0207699_10040124 3300025906 Bacteria 2696
220 Ga0207699_10297819 3300025906 Bacteria 1125
221 Ga0207699_10354584 3300025906 Bacteria 1036
222 Ga0207705_10463919 3300025909 Bacteria 983
223 Ga0207707_10000950 3300025912 Bacteria 27902
224 Ga0207707_10004626 3300025912 Bacteria 12087
225 Ga0207707_10052762 3300025912 Bacteria 3539
226 Ga0207707_10232394 3300025912 Bacteria 1604
227 Ga0207707_10474556 3300025912 Bacteria 1069
228 Ga0207695_10000008 3300025913 Bacteria 1058268
229 Ga0207695_10084653 3300025913 Bacteria 3201
230 Ga0207695_10161968 3300025913 Bacteria 2168
231 Ga0207671_10003142 3300025914 Bacteria 16765
232 Ga0207693_10000068 3300025915 Bacteria 91004
233 Ga0207693_10010099 3300025915 Bacteria 7669
234 Ga0207693_10012278 3300025915 Bacteria 6922
235 Ga0207693_10013028 3300025915 Bacteria 6710
236 Ga0207693_10059172 3300025915 Bacteria 3001
237 Ga0207693_10208751 3300025915 Bacteria 1535
238 Ga0207663_10000098 3300025916 Bacteria 41171
239 Ga0207663_10035907 3300025916 Bacteria 2978
240 Ga0207663_10053162 3300025916 Bacteria 2529
241 Ga0207660_10002564 3300025917 Bacteria 11938
242 Ga0207660_10027186 3300025917 Bacteria 3902
243 Ga0207660_10218329 3300025917 Bacteria 1495
244 Ga0207657_10000658 3300025919 Bacteria 36762
245 Ga0207657_10155771 3300025919 Bacteria 1858
246 Ga0207649_10029765 3300025920 Bacteria 3228
247 Ga0207652_10003470 3300025921 Bacteria 12999
248 Ga0207652_10079037 3300025921 Bacteria 2873
249 Ga0207652_10088350 3300025921 Bacteria 2719
250 Ga0207652_10264824 3300025921 Bacteria 1550
251 Ga0207652_10283302 3300025921 Bacteria 1495
252 Ga0207652_10355623 3300025921 Bacteria 1322
253 Ga0207652_10651436 3300025921 Bacteria 942
254 Ga0207646_10210051 3300025922 Bacteria 1758
255 Ga0207646_10599160 3300025922 Bacteria 989
256 Ga0207694_10089008 3300025924 Bacteria 2434
257 Ga0207694_10145180 3300025924 Bacteria 1910
258 Ga0207694_10190212 3300025924 Bacteria 1667
259 Ga0207687_10116864 3300025927 Bacteria 1989
260 Ga0207687_10123341 3300025927 Bacteria 1941
261 Ga0207687_10331011 3300025927 Bacteria 1235
262 Ga0207700_10015748 3300025928 Bacteria 5000
263 Ga0207700_10091132 3300025928 Bacteria 2407
264 Ga0207700_10197106 3300025928 Bacteria 1695
265 Ga0207700_10303626 3300025928 Bacteria 1379
266 Ga0207700_10411601 3300025928 Bacteria 1186
267 Ga0207700_10455503 3300025928 Bacteria 1128
268 Ga0207664_10042775 3300025929 Bacteria 3539
269 Ga0207664_10043417 3300025929 Bacteria 3516
270 Ga0207664_10162299 3300025929 Bacteria 1907
271 Ga0207690_10107114 3300025932 Bacteria 2007
272 Ga0207706_10403102 3300025933 Bacteria 1186
273 Ga0207709_10443739 3300025935 Bacteria 1001
274 Ga0207704_10296267 3300025938 Bacteria 1237
275 Ga0207665_10000355 3300025939 Bacteria 31763
276 Ga0207665_10432670 3300025939 Bacteria 1007
277 Ga0207711_10174186 3300025941 Bacteria 1954
278 Ga0207711_10233979 3300025941 Bacteria 1683
279 Ga0207711_10317721 3300025941 Bacteria 1438
280 Ga0207689_10021146 3300025942 Bacteria 5470
281 Ga0207661_10001747 3300025944 Bacteria 14871
282 Ga0207661_10051941 3300025944 Bacteria 3273
283 Ga0207661_10262245 3300025944 Bacteria 1539
284 Ga0207661_10649613 3300025944 Bacteria 969
285 Ga0207679_10036381 3300025945 Bacteria 3492
286 Ga0207667_10215773 3300025949 Bacteria 1966
287 Ga0207667_10296284 3300025949 Bacteria 1652
288 Ga0207667_10682469 3300025949 Bacteria 1030
289 Ga0207651_10370470 3300025960 Bacteria 1211
290 Ga0207640_10139666 3300025981 Bacteria 1764
291 Ga0207677_10020108 3300026023 Bacteria 4047
292 Ga0207677_10372683 3300026023 Bacteria 1202
293 Ga0207677_10727925 3300026023 Bacteria 882
294 Ga0207703_10323706 3300026035 Bacteria 1412
295 Ga0207639_10043047 3300026041 Bacteria 3387
296 Ga0207639_10122518 3300026041 Bacteria 2138
297 Ga0207639_10149674 3300026041 Bacteria 1954
298 Ga0207639_10486835 3300026041 Bacteria 1125
299 Ga0207678_10035639 3300026067 Bacteria 4332
300 Ga0207678_10043159 3300026067 Bacteria 3903
301 Ga0207678_10111029 3300026067 Bacteria 2339
302 Ga0207678_10111451 3300026067 Bacteria 2334
303 Ga0207702_10000126 3300026078 Bacteria 90550
304 Ga0207641_10083530 3300026088 Bacteria 2778
305 Ga0207641_10866328 3300026088 Bacteria 896
306 Ga0207676_10190935 3300026095 Unclassified 1802
307 Ga0207674_10129603 3300026116 Bacteria 2486
308 Ga0207674_10261908 3300026116 Bacteria 1676
309 Ga0207675_100438424 3300026118 Bacteria 1293
310 Ga0207675_100495090 3300026118 Bacteria 1216
311 Ga0207675_100802265 3300026118 Bacteria 955
312 Ga0207683_10001340 3300026121 Bacteria 22231
313 Ga0207683_10028473 3300026121 Bacteria 4830
314 Ga0207683_10358569 3300026121 Bacteria 1339
315 Ga0207698_10336335 3300026142 Bacteria 1420
316 Ga0209389_1000185 3300027296 Bacteria 47184
317 Ga0209589_1000036 3300027357 Bacteria 131278
318 Ga0209489_100006 3300027361 Bacteria 475698
319 Ga0209700_100005 3300027363 Bacteria 573969
320 Ga0268266_10002394 3300028379 Bacteria 20226
321 Ga0268266_10483755 3300028379 Bacteria 1180
322 Ga0268266_10925741 3300028379 Bacteria 843
323 Ga0268264_10027494 3300028381 Bacteria 4648
324 Ga0307517_10000008 3300028786 Bacteria 243202
325 Ga0307517_10228925 3300028786 Bacteria 1119
326 Ga0307515_10045960 3300028794 Bacteria 6689
327 Ga0265330_10045567 3300031235 Bacteria 1934
328 Ga0265330_10088362 3300031235 Bacteria 1332
329 Ga0265325_10000044 3300031241 Bacteria 89107
330 Ga0265325_10011538 3300031241 Bacteria 5074
331 Ga0265325_10045607 3300031241 Bacteria 2277
332 Ga0265339_10019022 3300031249 Bacteria 4038
333 Ga0265339_10057328 3300031249 Bacteria 2107
334 Ga0265339_10141434 3300031249 Bacteria 1224
335 Ga0265339_10180991 3300031249 Bacteria 1050
336 Ga0265339_10207939 3300031249 Bacteria 963
337 Ga0265316_10042156 3300031344 Bacteria 3649
338 Ga0307513_10029676 3300031456 Bacteria 6228
339 Ga0307513_10418380 3300031456 Bacteria 1071
340 Ga0307509_10180532 3300031507 Bacteria 1976
341 Ga0307408_100449154 3300031548 Bacteria 1118
342 Ga0265313_10009939 3300031595 Bacteria 6106
343 Ga0307508_10229059 3300031616 Bacteria 1457
344 Ga0265314_10008091 3300031711 Bacteria 9048
345 Ga0265314_10050093 3300031711 Bacteria 2919
346 Ga0307516_10077115 3300031730 Bacteria 3182
347 Ga0307406_10332610 3300031901 Bacteria 1180
348 Ga0307406_10517961 3300031901 Bacteria 970
349 Ga0307409_100577749 3300031995 Bacteria 1107
350 Ga0307416_100271276 3300032002 Bacteria 1666
351 Ga0307415_100069687 3300032126 Bacteria 2467
352 Ga0316583_10000267 3300032133 Bacteria 14347
353 Ga0307510_10001061 3300033180 Bacteria 29217
354 Ga0307510_10018144 3300033180 Bacteria 8285
355 Ga0307510_10125011 3300033180 Bacteria 2264
356 Ga0373926_0042232 3300035083 Bacteria 1630
357 Ga0373923_0135165 3300035111 Bacteria 1111
358 Ga0373939_0000811 3300035114 Bacteria 7714
359 Ga0373953_0005595 3300035117 Bacteria 4090
360 Ga0373953_0048107 3300035117 Bacteria 1717
361 Ga0373954_0013096 3300035118 Bacteria 3693
362 Ga0373956_0015090 3300035119 Bacteria 3231
363 Ga0373956_0089214 3300035119 Bacteria 1421
364 Ga0373957_0022135 3300035120 Bacteria 2262
365 Ga0373943_0028143 3300035170 Bacteria 2647
366 Ga0373955_0009673 3300035172 Bacteria 4526
367 Ga0373955_0015065 3300035172 Bacteria 3777
368 Ga0373955_0108075 3300035172 Bacteria 1606
369 Ga0316574_0209557 3300035398 Bacteria 1251
370 Ga0373924_0021198 3300035410 Bacteria 2534
371 Ga0373935_0044130 3300035692 Bacteria 2808
372 Ga0373927_0016784 3300035695 Bacteria 4829
373 Ga0373927_0027467 3300035695 Bacteria 3715
374 Ga0373933_0000199 3300035724 Bacteria 39593
375 Ga0373933_0012562 3300035724 Bacteria 4680
376 Ga0373947_0047946 3300035725 Bacteria 2562
377 Ga0373937_0003498 3300036401 Bacteria 13203
378 Ga0373925_0000767 3300037068 Bacteria 29498
379 Ga0373925_0157538 3300037068 Bacteria 1787
380 Ga0373925_0263518 3300037068 Bacteria 1385
381 Ga0373925_0265765 3300037068 Bacteria 1379
382 Ga0373925_0442365 3300037068 Bacteria 1064
383 Ga0395900_0044295 3300037418 Bacteria 4585
384 Ga0395900_0288678 3300037418 Bacteria 1630
385 Ga0395900_0291201 3300037418 Bacteria 1621
386 Ga0395898_0010583 3300037466 Bacteria 9632
387 Ga0395898_0185548 3300037466 Bacteria 1987
388 Ga0395898_0436159 3300037466 Bacteria 1248
389 Ga0395905_0040677 3300037471 Bacteria 4361
390 Ga0395905_0136213 3300037471 Bacteria 2310
391 Ga0436364_0397486 3300037853 Bacteria 1508
392 Ga0436364_1535696 3300037853 Bacteria 2655
393 Ga0395901_0011779 3300038443 Bacteria 8868
394 Ga0395901_0123610 3300038443 Bacteria 2719
395 Ga0395901_0182755 3300038443 Bacteria 2199
396 Ga0436365_0042699 3300039437 Bacteria 1950
397 Ga0436360_1256664 3300039438 Bacteria 1900
398 Ga0436361_0532883 3300039447 Bacteria 1128
399 Ga0436361_0833650 3300039447 Bacteria 10674
400 Ga0436363_0842295 3300039450 Bacteria 928
401 Ga0439441_022090 3300042001 Bacteria 1180
402 Ga0466963_0038369 3300044694 Bacteria 3131
403 Ga0466963_0132734 3300044694 Bacteria 1721
404 Ga0466963_0169940 3300044694 Bacteria 1519
405 Ga0466964_0092261 3300044706 Bacteria 1320
406 Ga0466971_0248365 3300044719 Bacteria 847
407 Ga0466957_0005921 3300044842 Bacteria 6888
408 Ga0466957_0067739 3300044842 Bacteria 2203
409 Ga0466959_0030990 3300045049 Bacteria 3959
410 Ga0451576_1082748 3300045051 Bacteria 839
411 Ga0466958_0055054 3300045836 Bacteria 2413
412 Ga0466958_0131752 3300045836 Bacteria 1570
413 Ga0466967_0066574 3300045976 Bacteria 3210
414 Ga0466967_0863177 3300045976 Bacteria 899
415 Ga0495617_137550 3300046452 Bacteria 781
416 Ga0495592_0003279 3300046454 Bacteria 11596
417 Ga0495603_0004410 3300046455 Bacteria 8389
418 Ga0495603_0006388 3300046455 Bacteria 7051
419 Ga0495603_0044718 3300046455 Bacteria 2642
420 Ga0495603_0083749 3300046455 Bacteria 1868
421 Ga0495629_0192979 3300046459 Bacteria 1409
422 Ga0495641_0022963 3300046461 Bacteria 3110
423 Ga0495641_0130608 3300046461 Bacteria 1121
424 Ga0495651_0055037 3300046462 Bacteria 3057
425 Ga0495651_0064165 3300046462 Bacteria 2807
426 Ga0495653_0141442 3300046463 Bacteria 1692
427 Ga0495580_0001449 3300046472 Bacteria 20800
428 Ga0495580_0113921 3300046472 Bacteria 1878
429 Ga0495580_0133464 3300046472 Bacteria 1721
430 Ga0495582_0120766 3300046473 Bacteria 1476
431 Ga0495605_0139756 3300046474 Bacteria 1087
432 Ga0495639_0044746 3300046475 Bacteria 2001
433 Ga0495662_0133154 3300046476 Bacteria 1222
434 Ga0495664_0006747 3300046477 Bacteria 6348
435 Ga0495664_0019399 3300046477 Bacteria 3909
436 Ga0495664_0045522 3300046477 Bacteria 2602
437 Ga0495585_0053425 3300046492 Bacteria 2236
438 Ga0495594_0066599 3300046499 Bacteria 1998
439 Ga0495594_0217607 3300046499 Bacteria 1089
440 Ga0495606_0001179 3300046507 Bacteria 36884
441 Ga0495606_0025719 3300046507 Bacteria 4209
442 Ga0495608_0042556 3300046511 Bacteria 3037
443 Ga0495608_0121182 3300046511 Bacteria 1677
444 Ga0495618_0005389 3300046514 Bacteria 7805
445 Ga0495628_0015673 3300046516 Bacteria 6328
446 Ga0495628_0041443 3300046516 Bacteria 3675
447 Ga0495628_0274934 3300046516 Bacteria 1252
448 Ga0495628_0410575 3300046516 Bacteria 988
449 Ga0495630_0256501 3300046517 Bacteria 1336
450 Ga0495630_0402568 3300046517 Bacteria 1049
451 Ga0495632_0062420 3300046519 Bacteria 1806
452 Ga0495637_0113053 3300046520 Bacteria 1051
453 Ga0495666_0042687 3300046526 Bacteria 2192
454 Ga0495666_0051380 3300046526 Bacteria 1980
455 Ga0495652_0002979 3300046529 Bacteria 17017
456 Ga0495652_0083205 3300046529 Bacteria 2635
457 Ga0495665_0038334 3300046531 Bacteria 2555
458 Ga0495640_0011617 3300046533 Bacteria 6764
459 Ga0495640_0027667 3300046533 Bacteria 4087
460 Ga0495640_0103913 3300046533 Bacteria 1862
461 Ga0495640_0187589 3300046533 Bacteria 1315
462 Ga0495587_0011641 3300046536 Bacteria 5569
463 Ga0495598_0004011 3300046537 Bacteria 3162
464 Ga0495645_0001025 3300046543 Bacteria 19015
465 Ga0495645_0001772 3300046543 Bacteria 14693
466 Ga0495622_0041218 3300046557 Bacteria 2147
467 Ga0495622_0068255 3300046557 Bacteria 1642
468 Ga0495667_0001273 3300046559 Bacteria 16514
469 Ga0495667_0033238 3300046559 Bacteria 3452
470 Ga0495667_0069109 3300046559 Bacteria 2306
471 Ga0495656_0131030 3300046615 Bacteria 1193
472 Ga0495668_0261772 3300046616 Bacteria 947
473 Ga0495634_0053454 3300046642 Bacteria 2705
474 Ga0495625_0190042 3300046660 Bacteria 1361
475 Ga0495635_0114378 3300046663 Bacteria 1842
476 Ga0495659_0019059 3300046664 Bacteria 2293
477 Ga0495588_0006176 3300046674 Bacteria 5381
478 Ga0495588_0009960 3300046674 Bacteria 4406
479 Ga0495657_0067361 3300046675 Bacteria 2350
480 Ga0495599_0007196 3300046678 Bacteria 6741
481 Ga0495623_0013803 3300046679 Bacteria 5237
482 Ga0495623_0069959 3300046679 Bacteria 2186
483 Ga0495646_0067005 3300046680 Bacteria 2123
484 Ga0495647_0029905 3300046681 Bacteria 2017
485 Ga0495647_0059378 3300046681 Bacteria 1506
486 Ga0495658_0171470 3300046683 Bacteria 1343
487 Ga0495658_0303068 3300046683 Bacteria 1011
488 Ga0495624_0020197 3300046690 Bacteria 4436
489 Ga0495624_0137708 3300046690 Bacteria 1496
490 Ga0495670_0303218 3300046691 Bacteria 856
491 Ga0495600_0003839 3300046809 Bacteria 8910
492 Ga0495600_0049859 3300046809 Bacteria 2731
493 Ga0495604_0002660 3300047317 Bacteria 14340
494 Ga0495604_0010726 3300047317 Bacteria 7272
495 Ga0495674_0013103 3300047319 Bacteria 7798
496 Ga0495674_0014178 3300047319 Bacteria 7466
497 Ga0495674_0048940 3300047319 Bacteria 3738
498 Ga0495674_0072773 3300047319 Bacteria 2964
499 Ga0495674_0128534 3300047319 Bacteria 2136
500 Ga0495672_0039595 3300047320 Bacteria 2865
501 Ga0495676_0072253 3300047321 Bacteria 2650
502 Ga0495676_0084983 3300047321 Bacteria 2385
503 Ga0495676_0161515 3300047321 Bacteria 1585
504 Ga0495680_0009088 3300047322 Bacteria 8971
505 Ga0495680_0044688 3300047322 Bacteria 3502
506 Ga0495680_0284136 3300047322 Bacteria 1165
507 Ga0495683_0246945 3300047323 Bacteria 785
508 Ga0495675_0000984 3300047444 Bacteria 17289
509 Ga0495675_0198151 3300047444 Bacteria 1223
510 Ga0495681_0132100 3300047470 Bacteria 1062
511 Ga0495684_0051684 3300047471 Bacteria 3136
512 Ga0495684_0103345 3300047471 Bacteria 2154
513 Ga0495686_0076873 3300047472 Bacteria 2045
514 Ga0495593_0064886 3300047673 Bacteria 1905
515 Ga0495602_0000726 3300048088 Bacteria 31111
516 Ga0495614_0050196 3300048089 Bacteria 1787
517 Ga0495626_0150224 3300048091 Bacteria 983
518 Ga0496100_0006817 3300048903 Bacteria 6260
519 Ga0496100_0087309 3300048903 Bacteria 2120
520 Ga0496101_0000213 3300048904 Bacteria 43662
521 Ga0496101_0020482 3300048904 Bacteria 4529
522 Ga0496101_0237976 3300048904 Bacteria 1416
523 Ga0496101_0257105 3300048904 Bacteria 1361
524 Ga0496101_0275356 3300048904 Bacteria 1314
525 Ga0496102_0030253 3300048905 Bacteria 4845
526 Ga0496102_0107202 3300048905 Bacteria 2601
527 Ga0496102_0157581 3300048905 Bacteria 2135
528 Ga0496102_0179875 3300048905 Bacteria 1992
529 Ga0496103_0000323 3300048906 Bacteria 43761
530 Ga0496103_0045764 3300048906 Bacteria 2700
531 Ga0496103_0226854 3300048906 Bacteria 1201
532 Ga0496103_0294408 3300048906 Bacteria 1044
533 Ga0496104_0000580 3300048907 Bacteria 31194
534 Ga0496104_0002456 3300048907 Bacteria 15968
535 Ga0496104_0069164 3300048907 Bacteria 3355
536 Ga0496104_0109269 3300048907 Bacteria 2650
537 Ga0496104_0118307 3300048907 Bacteria 2543
538 Ga0496104_0205595 3300048907 Bacteria 1881
539 Ga0496104_0916199 3300048907 Bacteria 781
540 Ga0496105_0000402 3300048908 Bacteria 28437
541 Ga0496105_0005338 3300048908 Bacteria 9737
542 Ga0496105_0006042 3300048908 Bacteria 9260
543 Ga0496105_0019704 3300048908 Bacteria 5442
544 Ga0496105_0034625 3300048908 Bacteria 4154
545 Ga0496106_0002551 3300048909 Bacteria 13535
546 Ga0496106_0019968 3300048909 Bacteria 4969
547 Ga0496106_0673926 3300048909 Bacteria 825
548 Ga0496107_0005110 3300048910 Bacteria 8949
549 Ga0496107_0007348 3300048910 Bacteria 7597
550 Ga0496107_0011880 3300048910 Bacteria 6083
551 Ga0496108_0007691 3300048911 Bacteria 8729
552 Ga0496108_0018148 3300048911 Bacteria 5758
553 Ga0496108_0018223 3300048911 Bacteria 5748
554 Ga0496108_0099899 3300048911 Bacteria 2474
555 Ga0496109_0010098 3300048912 Bacteria 8054
556 Ga0496109_0030334 3300048912 Bacteria 4847
557 Ga0496109_0188433 3300048912 Bacteria 1938
558 Ga0496109_0480397 3300048912 Bacteria 1173
559 Ga0496110_0023813 3300048913 Bacteria 5211
560 Ga0496110_0067437 3300048913 Bacteria 3166
561 Ga0496110_0232617 3300048913 Bacteria 1676
562 Ga0496110_0634889 3300048913 Bacteria 967
563 Ga0496111_0000449 3300048914 Bacteria 20923
564 Ga0496111_0014244 3300048914 Bacteria 5427
565 Ga0496112_0034239 3300048915 Bacteria 4941
566 Ga0496112_0075363 3300048915 Bacteria 3336
567 Ga0496113_0000528 3300048916 Bacteria 18859
568 Ga0496113_0036976 3300048916 Bacteria 3580
569 Ga0496113_0288256 3300048916 Bacteria 1313
570 Ga0496113_0344749 3300048916 Bacteria 1195
571 Ga0496114_0057383 3300048917 Bacteria 3250
572 Ga0496114_0094109 3300048917 Bacteria 2548
573 Ga0496114_0170210 3300048917 Bacteria 1898
574 Ga0496114_0261912 3300048917 Bacteria 1522
575 Ga0496114_0387221 3300048917 Bacteria 1238
576 Ga0496115_0006273 3300048918 Bacteria 8697
577 Ga0496115_0027561 3300048918 Bacteria 4445
578 Ga0496115_0095967 3300048918 Bacteria 2427
579 Ga0496115_0165195 3300048918 Bacteria 1831
580 Ga0496115_0261882 3300048918 Bacteria 1422
581 Ga0496115_0354614 3300048918 Bacteria 1196
582 Ga0496116_0000691 3300048919 Bacteria 43800
583 Ga0496116_0017742 3300048919 Bacteria 5514
584 Ga0496117_0000018 3300048920 Bacteria 479613
585 Ga0496117_0040858 3300048920 Bacteria 3406
586 Ga0496118_0000013 3300048921 Bacteria 574008
587 Ga0496118_0041838 3300048921 Bacteria 3622
588 Ga0496118_0347342 3300048921 Bacteria 792
589 Ga0496119_0035537 3300048922 Bacteria 3263
590 Ga0496121_0014546 3300048924 Bacteria 8342
591 Ga0496121_0224248 3300048924 Bacteria 1321
592 Ga0496121_0313416 3300048924 Bacteria 1059
593 Ga0496124_0150774 3300048927 Bacteria 1824
594 Ga0496125_0203754 3300048928 Bacteria 1292
595 Ga0496126_0000902 3300048929 Bacteria 51705
596 Ga0496126_0001122 3300048929 Bacteria 44809
597 Ga0496126_0015735 3300048929 Bacteria 7601
598 Ga0496126_0048493 3300048929 Bacteria 3881
599 Ga0496126_0097147 3300048929 Bacteria 2582
600 Ga0496126_0129917 3300048929 Bacteria 2177
601 Ga0496126_0482171 3300048929 Bacteria 993
602 Ga0501031_0035285 3300049568 Bacteria 3262
603 Ga0501032_0140627 3300049569 Bacteria 1589
604 Ga0501032_0190204 3300049569 Bacteria 1342
605 Ga0501033_0076639 3300049570 Bacteria 2454
606 Ga0501034_0190459 3300049571 Bacteria 2013
607 Ga0501034_0423571 3300049571 Bacteria 1252
608 Ga0501036_0116806 3300049572 Bacteria 2253
609 Ga0501037_0369219 3300049573 Bacteria 987
610 Ga0501038_0037203 3300049574 Bacteria 4268
611 Ga0501039_0184272 3300049575 Bacteria 1642
612 Ga0501039_0209369 3300049575 Bacteria 1533
613 Ga0501043_0154376 3300049579 Bacteria 1796
614 Ga0501043_0416932 3300049579 Bacteria 1013
615 Ga0501046_0615463 3300049580 Bacteria 770
616 Ga0501047_0098128 3300049581 Bacteria 2808
617 Ga0501047_0314286 3300049581 Bacteria 1407
618 Ga0501048_0365352 3300049582 Bacteria 1030
619 Ga0501067_0298735 3300049583 Bacteria 896
620 Ga0501070_0005092 3300049586 Bacteria 11201
621 Ga0501070_0101042 3300049586 Bacteria 2385
622 Ga0501073_0057668 3300049589 Bacteria 2714
623 Ga0501073_0084887 3300049589 Bacteria 2203
624 Ga0501074_0008292 3300049590 Bacteria 7535
625 Ga0501074_0012164 3300049590 Bacteria 6256
626 Ga0501079_0256190 3300049741 Bacteria 1368
627 Ga0501044_0080499 3300049823 Bacteria 3299
628 Ga0501044_0093205 3300049823 Bacteria 3037
629 Ga0501044_0132475 3300049823 Bacteria 2486
630 nmdc:mga03683_247809_c1 3300050489 Bacteria 827
631 nmdc:mga03n38_20431_c1 3300050490 Bacteria 2649
632 nmdc:mga03n38_26265_c1 3300050490 Bacteria 2403
633 nmdc:mga00v17_179291_c1 3300050491 Bacteria 1367
634 nmdc:mga00v17_278130_c1 3300050491 Bacteria 1086
635 nmdc:mga0yw44_215299_c1 3300050492 Bacteria 1272
636 nmdc:mga0yw44_79637_c1 3300050492 Bacteria 2050
637 nmdc:mga0k408_162592_c1 3300050493 Bacteria 1330
638 nmdc:mga0k408_215548_c1 3300050493 Bacteria 1146
639 nmdc:mga06z11_59313_c1 3300050494 Bacteria 1989
640 nmdc:mga07m45_13999_c1 3300050496 Bacteria 4265
641 nmdc:mga07m45_343835_c1 3300050496 Bacteria 867
642 nmdc:mga05p37_141849_c1 3300050507 Bacteria 2943
643 nmdc:mga08y16_307608_c1 3300050511 Bacteria 1632
644 nmdc:mga0sz30_191847_c1 3300050516 Bacteria 907
645 nmdc:mga0sz30_238604_c1 3300050516 Bacteria 809
646 Ga0495601_0000232 3300053077 Bacteria 29854
647 Ga0495601_0004312 3300053077 Bacteria 8215
648 Ga0495601_0014166 3300053077 Bacteria 4804
649 Ga0495601_0330339 3300053077 Bacteria 992
650 Ga0495612_0000608 3300053078 Bacteria 14397
651 Ga0495612_0008328 3300053078 Bacteria 4208
652 Ga0495612_0064474 3300053078 Bacteria 1520
653 Ga0500635_0008149 3300053080 Bacteria 2866
654 Ga0500635_0067466 3300053080 Bacteria 1262
655 Ga0500635_0116019 3300053080 Bacteria 998
656 Ga0495595_0000240 3300053084 Bacteria 21669
657 Ga0495595_0000284 3300053084 Bacteria 19932
658 Ga0495619_0000145 3300053085 Bacteria 52248
659 Ga0495619_0001165 3300053085 Bacteria 17262
660 Ga0495619_0001565 3300053085 Bacteria 15043
661 Ga0495619_0028070 3300053085 Bacteria 3629
662 Ga0500578_0023708 3300053086 Bacteria 3939
663 Ga0500578_0148732 3300053086 Bacteria 1460
664 Ga0500644_0119011 3300053088 Bacteria 1027
665 Ga0500647_0039154 3300053091 Bacteria 2272
666 Ga0500583_0036800 3300053092 Bacteria 2194
667 Ga0500566_0000006 3300053094 Bacteria 153632
668 Ga0500640_000036 3300053095 Bacteria 20472
669 Ga0500641_0131994 3300053096 Bacteria 1078
670 Ga0500554_009687 3300053102 Bacteria 2317
671 Ga0500555_004027 3300053103 Bacteria 4175
672 Ga0500557_000052 3300053105 Bacteria 50636
673 Ga0500562_020239 3300053108 Bacteria 1727
674 Ga0500572_005599 3300053111 Bacteria 2852
675 Ga0500572_036126 3300053111 Bacteria 1409
676 Ga0500593_012965 3300053117 Bacteria 3548
677 Ga0500607_040291 3300053121 Bacteria 2532
678 Ga0500608_021487 3300053122 Bacteria 2983
679 Ga0500608_078010 3300053122 Bacteria 1567
680 Ga0500614_000846 3300053123 Bacteria 7731
681 Ga0500642_0000468 3300053130 Bacteria 12589
682 Ga0500642_0104047 3300053130 Bacteria 1322
683 Ga0500655_022213 3300053133 Bacteria 1193
684 Ga0500658_0051537 3300053134 Bacteria 1683
685 Ga0500658_0089405 3300053134 Bacteria 1329
686 Ga0500559_0023353 3300053136 Bacteria 2625
687 Ga0500559_0029799 3300053136 Bacteria 2338
688 Ga0500585_156795 3300053144 Bacteria 790
689 Ga0500590_057832 3300053148 Bacteria 1955
690 Ga0500603_000195 3300053150 Bacteria 15888
691 Ga0500603_002409 3300053150 Bacteria 4106
692 Ga0500604_0109479 3300053151 Bacteria 917
693 Ga0500619_038193 3300053154 Bacteria 1503
694 Ga0500620_001550 3300053155 Bacteria 4302
695 Ga0500630_001646 3300053159 Bacteria 10694
696 Ga0500638_026391 3300053162 Bacteria 2783
697 Ga0500639_000170 3300053163 Bacteria 31566
698 Ga0500639_051091 3300053163 Bacteria 2152
699 Ga0500636_0001217 3300053177 Bacteria 13893
700 Ga0500637_0012756 3300053178 Bacteria 4387
701 Ga0500637_0038627 3300053178 Bacteria 2691
702 Ga0500625_038855 3300053729 Bacteria 2245
703 Ga0500645_074604 3300053730 Bacteria 972
704 Ga0500601_003622 3300053737 Bacteria 1677
705 Ga0466962_0044607 3300061719 Bacteria 2121

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10014203 Ga0070709_100142033 189
2 3300025906 Ga0207699_10034074 Ga0207699_100340743 189
3 3300048929 Ga0496126_0015735 Ga0496126_0015735_5333_6094 189
4 iso_pu_bacteria 8016583857 8016593237 191
5 3300044694 Ga0466963_0169940 Ga0466963_0169940_696_1487 192
6 3300005290 Ga0065712_10016912 Ga0065712_100169123 193
7 3300037068 Ga0373925_0000767 Ga0373925_0000767_8291_9022 193
8 3300005329 Ga0070683_100575298 Ga0070683_1005752982 194
9 3300005436 Ga0070713_100464464 Ga0070713_1004644641 194
10 3300005458 Ga0070681_10622008 Ga0070681_106220081 194
11 3300025912 Ga0207707_10474556 Ga0207707_104745561 194
12 3300025928 Ga0207700_10455503 Ga0207700_104555032 194
13 3300048903 Ga0496100_0006817 Ga0496100_0006817_288_1004 194
14 3300048904 Ga0496101_0000213 Ga0496101_0000213_37366_38082 194
15 3300048922 Ga0496119_0035537 Ga0496119_0035537_1910_2626 194
16 3300048924 Ga0496121_0014546 Ga0496121_0014546_3742_4458 194
17 3300007265 Ga0099794_10283726 Ga0099794_102837261 195
18 3300037853 Ga0436364_0397486 Ga0436364_0397486_113_817 195
19 3300005437 Ga0070710_10046159 Ga0070710_100461593 196
20 3300006175 Ga0070712_100015939 Ga0070712_1000159395 196
21 3300035695 Ga0373927_0016784 Ga0373927_0016784_1476_2168 196
22 3300005434 Ga0070709_10077995 Ga0070709_100779953 197
23 3300005436 Ga0070713_100195344 Ga0070713_1001953441 197
24 3300005530 Ga0070679_100395127 Ga0070679_1003951272 197
25 3300005530 Ga0070679_100463679 Ga0070679_1004636792 197
26 3300005577 Ga0068857_100139884 Ga0068857_1001398843 197
27 3300013105 Ga0157369_10457316 Ga0157369_104573162 197
28 3300025906 Ga0207699_10040124 Ga0207699_100401243 197
29 3300025915 Ga0207693_10012278 Ga0207693_100122783 197
30 3300025921 Ga0207652_10355623 Ga0207652_103556232 197
31 3300025924 Ga0207694_10089008 Ga0207694_100890083 197
32 3300025928 Ga0207700_10303626 Ga0207700_103036262 197
33 3300026116 Ga0207674_10129603 Ga0207674_101296033 197
34 3300026118 Ga0207675_100438424 Ga0207675_1004384242 197
35 3300046459 Ga0495629_0192979 Ga0495629_0192979_445_1137 197
36 3300047673 Ga0495593_0064886 Ga0495593_0064886_258_950 197
37 iso_pu_bacteria 8019576017 8019583155 197
38 3300025297 Ga0209758_1007070 Ga0209758_10070707 198
39 3300005467 Ga0070706_100204227 Ga0070706_1002042272 199
40 3300005530 Ga0070679_100539670 Ga0070679_1005396702 199
41 3300005616 Ga0068852_100420229 Ga0068852_1004202292 199
42 3300009551 Ga0105238_10246610 Ga0105238_102466102 199
43 3300025924 Ga0207694_10145180 Ga0207694_101451802 199
44 3300026041 Ga0207639_10122518 Ga0207639_101225182 199
45 3300037418 Ga0395900_0044295 Ga0395900_0044295_389_1081 199
46 3300037466 Ga0395898_0010583 Ga0395898_0010583_78_770 199
47 3300038443 Ga0395901_0182755 Ga0395901_0182755_363_1055 199
48 3300046507 Ga0495606_0001179 Ga0495606_0001179_7780_8472 199
49 3300050490 nmdc:mga03n38_26265_c1 nmdc:mga03n38_26265_c1_1520_2212 199
50 3300009551 Ga0105238_10889307 Ga0105238_108893072 200
51 3300037068 Ga0373925_0265765 Ga0373925_0265765_304_996 200
52 3300046683 Ga0495658_0303068 Ga0495658_0303068_88_780 200
53 3300053080 Ga0500635_0116019 Ga0500635_0116019_80_772 200
54 3300053163 Ga0500639_051091 Ga0500639_051091_978_1670 200
55 3300053178 Ga0500637_0038627 Ga0500637_0038627_709_1401 200
56 3300005327 Ga0070658_10051844 Ga0070658_100518444 201
57 3300005455 Ga0070663_100249004 Ga0070663_1002490041 201
58 3300006038 Ga0075365_10054530 Ga0075365_100545303 201
59 3300009545 Ga0105237_11001220 Ga0105237_110012202 201
60 3300025921 Ga0207652_10651436 Ga0207652_106514362 201
61 3300026067 Ga0207678_10043159 Ga0207678_100431592 201
62 3300028786 Ga0307517_10000008 Ga0307517_10000008155 201
63 3300035724 Ga0373933_0000199 Ga0373933_0000199_11821_12513 201
64 3300044694 Ga0466963_0132734 Ga0466963_0132734_884_1576 201
65 3300046507 Ga0495606_0025719 Ga0495606_0025719_1441_2124 201
66 3300047321 Ga0495676_0161515 Ga0495676_0161515_142_834 201
67 3300048905 Ga0496102_0179875 Ga0496102_0179875_247_939 201
68 3300048907 Ga0496104_0002456 Ga0496104_0002456_12432_13124 201
69 3300048908 Ga0496105_0006042 Ga0496105_0006042_3365_4057 201
70 3300048911 Ga0496108_0007691 Ga0496108_0007691_4896_5588 201
71 3300048912 Ga0496109_0010098 Ga0496109_0010098_4945_5637 201
72 3300048914 Ga0496111_0000449 Ga0496111_0000449_7820_8512 201
73 3300048915 Ga0496112_0034239 Ga0496112_0034239_1842_2534 201
74 3300048916 Ga0496113_0000528 Ga0496113_0000528_13453_14145 201
75 3300048918 Ga0496115_0095967 Ga0496115_0095967_1254_1946 201
76 3300050491 nmdc:mga00v17_179291_c1 nmdc:mga00v17_179291_c1_75_767 201
77 3300050492 nmdc:mga0yw44_79637_c1 nmdc:mga0yw44_79637_c1_1064_1756 201
78 3300050516 nmdc:mga0sz30_238604_c1 nmdc:mga0sz30_238604_c1_53_745 201
79 3300005518 Ga0070699_100098367 Ga0070699_1000983673 202
80 3300005719 Ga0068861_100891841 Ga0068861_1008918411 202
81 3300006195 Ga0075366_10155752 Ga0075366_101557522 202
82 3300006871 Ga0075434_100490088 Ga0075434_1004900882 202
83 3300009101 Ga0105247_10346942 Ga0105247_103469422 202
84 3300009147 Ga0114129_10749936 Ga0114129_107499362 202
85 3300009174 Ga0105241_10122821 Ga0105241_101228212 202
86 3300025942 Ga0207689_10021146 Ga0207689_100211466 202
87 3300026118 Ga0207675_100495090 Ga0207675_1004950901 202
88 3300026118 Ga0207675_100802265 Ga0207675_1008022652 202
89 3300031616 Ga0307508_10229059 Ga0307508_102290592 202
90 3300046519 Ga0495632_0062420 Ga0495632_0062420_1023_1715 202
91 3300048091 Ga0495626_0150224 Ga0495626_0150224_20_712 202
92 3300048927 Ga0496124_0150774 Ga0496124_0150774_969_1661 202
93 3300048929 Ga0496126_0482171 Ga0496126_0482171_161_853 202
94 3300050493 nmdc:mga0k408_215548_c1 nmdc:mga0k408_215548_c1_16_708 202
95 3300005347 Ga0070668_100323705 Ga0070668_1003237052 203
96 3300005354 Ga0070675_100356650 Ga0070675_1003566502 203
97 3300005355 Ga0070671_100001629 Ga0070671_10000162913 203
98 3300005364 Ga0070673_100177979 Ga0070673_1001779792 203
99 3300005435 Ga0070714_100041624 Ga0070714_1000416244 203
100 3300005439 Ga0070711_100040240 Ga0070711_1000402403 203
101 3300005456 Ga0070678_100011904 Ga0070678_1000119043 203
102 3300005468 Ga0070707_100739084 Ga0070707_1007390842 203
103 3300005539 Ga0068853_100486966 Ga0068853_1004869661 203
104 3300005564 Ga0070664_100043917 Ga0070664_1000439177 203
105 3300005616 Ga0068852_100567177 Ga0068852_1005671772 203
106 3300005937 Ga0081455_10063868 Ga0081455_100638683 203
107 3300005981 Ga0081538_10034813 Ga0081538_100348133 203
108 3300005983 Ga0081540_1002690 Ga0081540_100269014 203
109 3300006175 Ga0070712_100492850 Ga0070712_1004928502 203
110 3300006237 Ga0097621_100019101 Ga0097621_1000191016 203
111 3300006358 Ga0068871_100010894 Ga0068871_1000108944 203
112 3300009098 Ga0105245_10007619 Ga0105245_100076199 203
113 3300009176 Ga0105242_10018122 Ga0105242_100181225 203
114 3300009177 Ga0105248_10015680 Ga0105248_100156805 203
115 3300011119 Ga0105246_10716096 Ga0105246_107160961 203
116 3300013105 Ga0157369_10225065 Ga0157369_102250653 203
117 3300013297 Ga0157378_10037040 Ga0157378_100370404 203
118 3300013307 Ga0157372_10965973 Ga0157372_109659732 203
119 3300013308 Ga0157375_10015754 Ga0157375_100157547 203
120 3300014968 Ga0157379_10015374 Ga0157379_100153744 203
121 3300014969 Ga0157376_10073840 Ga0157376_100738401 203
122 3300021384 Ga0213876_10057753 Ga0213876_100577532 203
123 3300025906 Ga0207699_10297819 Ga0207699_102978191 203
124 3300025920 Ga0207649_10029765 Ga0207649_100297654 203
125 3300025922 Ga0207646_10599160 Ga0207646_105991601 203
126 3300025927 Ga0207687_10123341 Ga0207687_101233412 203
127 3300025929 Ga0207664_10162299 Ga0207664_101622992 203
128 3300025932 Ga0207690_10107114 Ga0207690_101071143 203
129 3300025945 Ga0207679_10036381 Ga0207679_100363814 203
130 3300025960 Ga0207651_10370470 Ga0207651_103704702 203
131 3300026035 Ga0207703_10323706 Ga0207703_103237062 203
132 3300026067 Ga0207678_10111451 Ga0207678_101114513 203
133 3300026121 Ga0207683_10028473 Ga0207683_100284735 203
134 3300026121 Ga0207683_10358569 Ga0207683_103585692 203
135 3300031456 Ga0307513_10418380 Ga0307513_104183801 203
136 3300035117 Ga0373953_0005595 Ga0373953_0005595_184_876 203
137 3300035118 Ga0373954_0013096 Ga0373954_0013096_1137_1829 203
138 3300035120 Ga0373957_0022135 Ga0373957_0022135_859_1551 203
139 3300035172 Ga0373955_0009673 Ga0373955_0009673_2442_3134 203
140 3300036401 Ga0373937_0003498 Ga0373937_0003498_10632_11324 203
141 3300039437 Ga0436365_0042699 Ga0436365_0042699_260_952 203
142 3300046452 Ga0495617_137550 Ga0495617_137550_77_769 203
143 3300046454 Ga0495592_0003279 Ga0495592_0003279_6373_7065 203
144 3300046462 Ga0495651_0055037 Ga0495651_0055037_624_1316 203
145 3300046476 Ga0495662_0133154 Ga0495662_0133154_490_1182 203
146 3300046477 Ga0495664_0019399 Ga0495664_0019399_2580_3272 203
147 3300046511 Ga0495608_0042556 Ga0495608_0042556_1741_2433 203
148 3300046514 Ga0495618_0005389 Ga0495618_0005389_1103_1795 203
149 3300046516 Ga0495628_0041443 Ga0495628_0041443_2840_3532 203
150 3300046529 Ga0495652_0002979 Ga0495652_0002979_10987_11679 203
151 3300046533 Ga0495640_0011617 Ga0495640_0011617_1751_2443 203
152 3300046543 Ga0495645_0001772 Ga0495645_0001772_7127_7819 203
153 3300046559 Ga0495667_0033238 Ga0495667_0033238_1967_2659 203
154 3300046675 Ga0495657_0067361 Ga0495657_0067361_732_1424 203
155 3300046679 Ga0495623_0069959 Ga0495623_0069959_934_1626 203
156 3300046809 Ga0495600_0003839 Ga0495600_0003839_4266_4958 203
157 3300047317 Ga0495604_0002660 Ga0495604_0002660_433_1125 203
158 3300047319 Ga0495674_0013103 Ga0495674_0013103_1966_2658 203
159 3300047444 Ga0495675_0000984 Ga0495675_0000984_1967_2659 203
160 3300048904 Ga0496101_0257105 Ga0496101_0257105_549_1241 203
161 3300048905 Ga0496102_0030253 Ga0496102_0030253_3540_4232 203
162 3300048906 Ga0496103_0045764 Ga0496103_0045764_1559_2251 203
163 3300048907 Ga0496104_0109269 Ga0496104_0109269_918_1610 203
164 3300048908 Ga0496105_0034625 Ga0496105_0034625_408_1100 203
165 3300048909 Ga0496106_0002551 Ga0496106_0002551_10720_11412 203
166 3300048910 Ga0496107_0005110 Ga0496107_0005110_7633_8325 203
167 3300048911 Ga0496108_0018148 Ga0496108_0018148_96_788 203
168 3300048913 Ga0496110_0634889 Ga0496110_0634889_29_721 203
169 3300048916 Ga0496113_0344749 Ga0496113_0344749_44_736 203
170 3300048917 Ga0496114_0057383 Ga0496114_0057383_885_1577 203
171 3300050511 nmdc:mga08y16_307608_c1 nmdc:mga08y16_307608_c1_812_1504 203
172 3300053077 Ga0495601_0004312 Ga0495601_0004312_2305_2997 203
173 3300053078 Ga0495612_0008328 Ga0495612_0008328_144_836 203
174 3300053084 Ga0495595_0000240 Ga0495595_0000240_16087_16779 203
175 3300053091 Ga0500647_0039154 Ga0500647_0039154_628_1320 203
176 3300053094 Ga0500566_0000006 Ga0500566_0000006_139468_140160 203
177 3300053095 Ga0500640_000036 Ga0500640_000036_896_1588 203
178 3300053111 Ga0500572_005599 Ga0500572_005599_870_1562 203
179 3300053122 Ga0500608_021487 Ga0500608_021487_2068_2760 203
180 3300053123 Ga0500614_000846 Ga0500614_000846_891_1583 203
181 3300053136 Ga0500559_0029799 Ga0500559_0029799_891_1583 203
182 3300053144 Ga0500585_156795 Ga0500585_156795_81_773 203
183 3300053148 Ga0500590_057832 Ga0500590_057832_89_781 203
184 3300053150 Ga0500603_000195 Ga0500603_000195_4129_4821 203
185 3300053159 Ga0500630_001646 Ga0500630_001646_3923_4615 203
186 3300053163 Ga0500639_000170 Ga0500639_000170_5086_5778 203
187 3300053737 Ga0500601_003622 Ga0500601_003622_870_1562 203
188 3300005546 Ga0070696_100238502 Ga0070696_1002385022 204
189 3300005937 Ga0081455_10017926 Ga0081455_100179267 204
190 3300009098 Ga0105245_10365153 Ga0105245_103651532 204
191 3300025909 Ga0207705_10463919 Ga0207705_104639191 204
192 3300025927 Ga0207687_10116864 Ga0207687_101168643 204
193 3300025933 Ga0207706_10403102 Ga0207706_104031021 204
194 3300028381 Ga0268264_10027494 Ga0268264_100274943 204
195 3300031901 Ga0307406_10517961 Ga0307406_105179612 204
196 3300031995 Ga0307409_100577749 Ga0307409_1005777492 204
197 3300035172 Ga0373955_0108075 Ga0373955_0108075_164_856 204
198 3300039447 Ga0436361_0532883 Ga0436361_0532883_91_774 204
199 3300046455 Ga0495603_0044718 Ga0495603_0044718_1302_1994 204
200 3300046474 Ga0495605_0139756 Ga0495605_0139756_141_833 204
201 3300046477 Ga0495664_0045522 Ga0495664_0045522_1639_2331 204
202 3300046516 Ga0495628_0274934 Ga0495628_0274934_314_1006 204
203 3300046533 Ga0495640_0187589 Ga0495640_0187589_11_703 204
204 3300046557 Ga0495622_0068255 Ga0495622_0068255_247_939 204
205 3300046559 Ga0495667_0069109 Ga0495667_0069109_1398_2090 204
206 3300046615 Ga0495656_0131030 Ga0495656_0131030_112_804 204
207 3300046660 Ga0495625_0190042 Ga0495625_0190042_38_730 204
208 3300046674 Ga0495588_0009960 Ga0495588_0009960_1692_2384 204
209 3300046681 Ga0495647_0059378 Ga0495647_0059378_371_1063 204
210 3300047319 Ga0495674_0048940 Ga0495674_0048940_294_986 204
211 3300047321 Ga0495676_0072253 Ga0495676_0072253_1756_2448 204
212 3300047322 Ga0495680_0044688 Ga0495680_0044688_1379_2071 204
213 3300048924 Ga0496121_0224248 Ga0496121_0224248_226_918 204
214 3300053077 Ga0495601_0330339 Ga0495601_0330339_107_799 204
215 3300053085 Ga0495619_0000145 Ga0495619_0000145_668_1360 204
216 3300053086 Ga0500578_0023708 Ga0500578_0023708_2133_2816 204
217 3300003215 JGI25153J46596_10000394 JGI25153J46596_1000039412 205
218 3300003794 Ga0055531_10007393 Ga0055531_100073937 205
219 3300004625 Ga0055543_1002885 Ga0055543_10028855 205
220 3300005262 Ga0065165_1001731 Ga0065165_100173111 205
221 3300005455 Ga0070663_100226708 Ga0070663_1002267082 205
222 3300005844 Ga0068862_100268560 Ga0068862_1002685602 205
223 3300009176 Ga0105242_10480797 Ga0105242_104807972 205
224 3300025297 Ga0209758_1000024 Ga0209758_100002466 205
225 3300025304 Ga0209257_1001149 Ga0209257_100114917 205
226 3300026023 Ga0207677_10727925 Ga0207677_107279252 205
227 3300035398 Ga0316574_0209557 Ga0316574_0209557_559_1233 205
228 3300048907 Ga0496104_0205595 Ga0496104_0205595_23_715 205
229 iso_pu_bacteria 2857509624 2857515892 205
230 3300005334 Ga0068869_100509780 Ga0068869_1005097802 206
231 3300005336 Ga0070680_100017453 Ga0070680_1000174532 206
232 3300005337 Ga0070682_100104282 Ga0070682_1001042821 206
233 3300005344 Ga0070661_100125958 Ga0070661_1001259582 206
234 3300005439 Ga0070711_100179879 Ga0070711_1001798792 206
235 3300005455 Ga0070663_100055656 Ga0070663_1000556563 206
236 3300005614 Ga0068856_100168939 Ga0068856_1001689392 206
237 3300005617 Ga0068859_100171388 Ga0068859_1001713883 206
238 3300005844 Ga0068862_100301425 Ga0068862_1003014252 206
239 3300005937 Ga0081455_10105008 Ga0081455_101050083 206
240 3300005983 Ga0081540_1003654 Ga0081540_10036541 206
241 3300005983 Ga0081540_1017195 Ga0081540_10171954 206
242 3300006038 Ga0075365_10232908 Ga0075365_102329082 206
243 3300006048 Ga0075363_100063020 Ga0075363_1000630202 206
244 3300006051 Ga0075364_10208643 Ga0075364_102086432 206
245 3300006177 Ga0075362_10022802 Ga0075362_100228023 206
246 3300006178 Ga0075367_10000988 Ga0075367_100009885 206
247 3300006186 Ga0075369_10008785 Ga0075369_100087855 206
248 3300006195 Ga0075366_10483803 Ga0075366_104838031 206
249 3300006844 Ga0075428_100079146 Ga0075428_1000791464 206
250 3300006931 Ga0097620_100171379 Ga0097620_1001713792 206
251 3300009147 Ga0114129_10111337 Ga0114129_101113372 206
252 3300011119 Ga0105246_10462649 Ga0105246_104626492 206
253 3300020070 Ga0206356_11553529 Ga0206356_115535292 206
254 3300025295 Ga0209564_1019909 Ga0209564_10199093 206
255 3300025921 Ga0207652_10283302 Ga0207652_102833022 206
256 3300025935 Ga0207709_10443739 Ga0207709_104437392 206
257 3300026067 Ga0207678_10035639 Ga0207678_100356394 206
258 3300028379 Ga0268266_10002394 Ga0268266_100023942 206
259 3300028786 Ga0307517_10228925 Ga0307517_102289252 206
260 3300031507 Ga0307509_10180532 Ga0307509_101805323 206
261 3300031548 Ga0307408_100449154 Ga0307408_1004491542 206
262 3300031730 Ga0307516_10077115 Ga0307516_100771153 206
263 3300031901 Ga0307406_10332610 Ga0307406_103326101 206
264 3300032002 Ga0307416_100271276 Ga0307416_1002712762 206
265 3300032126 Ga0307415_100069687 Ga0307415_1000696872 206
266 3300033180 Ga0307510_10001061 Ga0307510_100010618 206
267 3300046455 Ga0495603_0004410 Ga0495603_0004410_1199_1891 206
268 3300046461 Ga0495641_0022963 Ga0495641_0022963_1539_2231 206
269 3300046499 Ga0495594_0217607 Ga0495594_0217607_235_927 206
270 3300046537 Ga0495598_0004011 Ga0495598_0004011_1520_2212 206
271 3300046557 Ga0495622_0041218 Ga0495622_0041218_215_907 206
272 3300046664 Ga0495659_0019059 Ga0495659_0019059_193_885 206
273 3300046691 Ga0495670_0303218 Ga0495670_0303218_46_738 206
274 3300047470 Ga0495681_0132100 Ga0495681_0132100_108_800 206
275 3300047472 Ga0495686_0076873 Ga0495686_0076873_202_885 206
276 3300048906 Ga0496103_0294408 Ga0496103_0294408_320_1012 206
277 3300048924 Ga0496121_0313416 Ga0496121_0313416_120_812 206
278 3300048928 Ga0496125_0203754 Ga0496125_0203754_87_779 206
279 3300048929 Ga0496126_0129917 Ga0496126_0129917_331_1023 206
280 3300050489 nmdc:mga03683_247809_c1 nmdc:mga03683_247809_c1_116_808 206
281 3300050490 nmdc:mga03n38_20431_c1 nmdc:mga03n38_20431_c1_383_1075 206
282 3300050492 nmdc:mga0yw44_215299_c1 nmdc:mga0yw44_215299_c1_103_795 206
283 3300050493 nmdc:mga0k408_162592_c1 nmdc:mga0k408_162592_c1_433_1125 206
284 3300050494 nmdc:mga06z11_59313_c1 nmdc:mga06z11_59313_c1_275_967 206
285 3300050496 nmdc:mga07m45_13999_c1 nmdc:mga07m45_13999_c1_2717_3409 206
286 3300050507 nmdc:mga05p37_141849_c1 nmdc:mga05p37_141849_c1_817_1509 206
287 3300050516 nmdc:mga0sz30_191847_c1 nmdc:mga0sz30_191847_c1_70_762 206
288 3300053133 Ga0500655_022213 Ga0500655_022213_228_920 206
289 3300053134 Ga0500658_0089405 Ga0500658_0089405_206_898 206
290 3300053730 Ga0500645_074604 Ga0500645_074604_244_936 206
291 iso_pu_bacteria 2513237101 2513692891 206
292 iso_pu_bacteria 2721755755 2723846524 206
293 iso_pu_bacteria 2791355199 2793079923 206
294 iso_pu_bacteria 2874604998 2874605540 206
295 iso_pu_bacteria 2879110137 2879115854 206
296 iso_pu_bacteria 2889033259 2889039413 206
297 iso_pu_bacteria 2922361189 2922365728 206
298 iso_pu_bacteria 8006964411 8006972441 206
299 iso_pu_bacteria 8006984368 8006987900 206
300 3300003354 JGI25160J50197_1012586 JGI25160J50197_10125861 207
301 3300005262 Ga0065165_1002125 Ga0065165_10021259 207
302 3300005578 Ga0068854_100460406 Ga0068854_1004604062 207
303 3300006942 Ga0099824_1012798 Ga0099824_10127985 207
304 3300025302 Ga0207426_1000510 Ga0207426_10005104 207
305 3300027296 Ga0209389_1000185 Ga0209389_100018537 207
306 3300027357 Ga0209589_1000036 Ga0209589_1000036101 207
307 3300027361 Ga0209489_100006 Ga0209489_100006429 207
308 3300042001 Ga0439441_022090 Ga0439441_022090_95_787 207
309 3300046616 Ga0495668_0261772 Ga0495668_0261772_39_722 207
310 iso_pu_bacteria 2507262055 2507508247 207
311 iso_pu_bacteria 2508501009 2508542316 207
312 iso_pu_bacteria 2508501042 2508691924 207
313 iso_pu_bacteria 2511231028 2511397496 207
314 iso_pu_bacteria 2513237092 2513622376 207
315 iso_pu_bacteria 2513237094 2513640553 207
316 iso_pu_bacteria 2513237095 2513645466 207
317 iso_pu_bacteria 2513237102 2513702501 207
318 iso_pu_bacteria 2513237104 2513718416 207
319 iso_pu_bacteria 2513237139 2513873113 207
320 iso_pu_bacteria 2513237161 2514016546 207
321 iso_pu_bacteria 2517093001 2517102651 207
322 iso_pu_bacteria 2524023205 2524437713 207
323 iso_pu_bacteria 2528768022 2528848685 207
324 iso_pu_bacteria 2617270735 2617347021 207
325 iso_pu_bacteria 2744054633 2745081181 207
326 iso_pu_bacteria 2791355196 2793062620 207
327 iso_pu_bacteria 2802429603 2805914988 207
328 iso_pu_bacteria 2816332527 2818239693 207
329 iso_pu_bacteria 2824600985 2824602375 207
330 iso_pu_bacteria 2824609381 2824610531 207
331 iso_pu_bacteria 2824617872 2824618090 207
332 iso_pu_bacteria 2824626560 2824626758 207
333 iso_pu_bacteria 2824635225 2824636607 207
334 iso_pu_bacteria 2824644064 2824645141 207
335 iso_pu_bacteria 2824653114 2824654344 207
336 iso_pu_bacteria 2824661429 2824661572 207
337 iso_pu_bacteria 2824671348 2824672014 207
338 iso_pu_bacteria 2824679649 2824679841 207
339 iso_pu_bacteria 2824687955 2824688613 207
340 iso_pu_bacteria 2824704595 2824705277 207
341 iso_pu_bacteria 2824714736 2824715698 207
342 iso_pu_bacteria 2824723954 2824725181 207
343 iso_pu_bacteria 2824753945 2824754349 207
344 iso_pu_bacteria 2824763712 2824767848 207
345 iso_pu_bacteria 2824773399 2824775274 207
346 iso_pu_bacteria 2838122688 2838123376 207
347 iso_pu_bacteria 2841941048 2841946669 207
348 iso_pu_bacteria 2841949485 2841954097 207
349 iso_pu_bacteria 2841957949 2841964042 207
350 iso_pu_bacteria 2841966195 2841969475 207
351 iso_pu_bacteria 2841983080 2841983800 207
352 iso_pu_bacteria 2842038055 2842040158 207
353 iso_pu_bacteria 2842045827 2842046897 207
354 iso_pu_bacteria 2844315083 2844319388 207
355 iso_pu_bacteria 2847930680 2847936558 207
356 iso_pu_bacteria 2874590934 2874598383 207
357 iso_pu_bacteria 2874612657 2874619398 207
358 iso_pu_bacteria 2874620515 2874626384 207
359 iso_pu_bacteria 2874628541 2874632248 207
360 iso_pu_bacteria 2874645413 2874652562 207
361 iso_pu_bacteria 2876761206 2876764935 207
362 iso_pu_bacteria 2876771140 2876778139 207
363 iso_pu_bacteria 2876818435 2876825992 207
364 iso_pu_bacteria 2879074833 2879081933 207
365 iso_pu_bacteria 2879083081 2879089537 207
366 iso_pu_bacteria 2879099564 2879108325 207
367 iso_pu_bacteria 2879127579 2879135055 207
368 iso_pu_bacteria 2879142872 2879149740 207
369 iso_pu_bacteria 2881364244 2881368488 207
370 iso_pu_bacteria 2881665667 2881672554 207
371 iso_pu_bacteria 2885366525 2885369239 207
372 iso_pu_bacteria 2885409591 2885413338 207
373 iso_pu_bacteria 2888378607 2888384456 207
374 iso_pu_bacteria 2888388044 2888393452 207
375 iso_pu_bacteria 2888419890 2888424906 207
376 iso_pu_bacteria 2903727486 2903734329 207
377 iso_pu_bacteria 2904666416 2904671723 207
378 iso_pu_bacteria 2904711408 2904715072 207
379 iso_pu_bacteria 2906602504 2906605574 207
380 iso_pu_bacteria 2906626472 2906633653 207
381 iso_pu_bacteria 2906643746 2906646555 207
382 iso_pu_bacteria 2922368715 2922374866 207
383 iso_pu_bacteria 2922393267 2922400450 207
384 iso_pu_bacteria 2929615660 2929621912 207
385 iso_pu_bacteria 2929624759 2929629781 207
386 iso_pu_bacteria 2932784394 2932788780 207
387 iso_pu_bacteria 2932794094 2932798021 207
388 iso_pu_bacteria 2932801729 2932807137 207
389 iso_pu_bacteria 2932809354 2932812754 207
390 iso_pu_bacteria 2932818245 2932819154 207
391 iso_pu_bacteria 2932828146 2932830446 207
392 iso_pu_bacteria 2933577622 2933583812 207
393 iso_pu_bacteria 2935608549 2935609271 207
394 iso_pu_bacteria 2935616580 2935616740 207
395 iso_pu_bacteria 2935638405 2935641930 207
396 iso_pu_bacteria 2935656913 2935659120 207
397 iso_pu_bacteria 2935665750 2935673061 207
398 iso_pu_bacteria 2935675223 2935675866 207
399 iso_pu_bacteria 2935684952 2935685863 207
400 iso_pu_bacteria 2935694250 2935697891 207
401 iso_pu_bacteria 2935703347 2935705703 207
402 iso_pu_bacteria 2935713505 2935714415 207
403 iso_pu_bacteria 2935722832 2935725034 207
404 iso_pu_bacteria 2935732158 2935732607 207
405 iso_pu_bacteria 2935741537 2935741986 207
406 iso_pu_bacteria 2935750917 2935751828 207
407 iso_pu_bacteria 2935760218 2935765085 207
408 iso_pu_bacteria 2935769743 2935771702 207
409 iso_pu_bacteria 2935777560 2935778883 207
410 iso_pu_bacteria 2935785616 2935791196 207
411 iso_pu_bacteria 2935793552 2935795475 207
412 iso_pu_bacteria 2935801545 2935802681 207
413 iso_pu_bacteria 2935810662 2935813489 207
414 iso_pu_bacteria 2935819856 2935822431 207
415 iso_pu_bacteria 2935827899 2935830097 207
416 iso_pu_bacteria 2935837841 2935838015 207
417 iso_pu_bacteria 2935847175 2935848013 207
418 iso_pu_bacteria 2935855204 2935855364 207
419 iso_pu_bacteria 2935864058 2935867392 207
420 iso_pu_bacteria 2935873716 2935875789 207
421 iso_pu_bacteria 2935908558 2935908764 207
422 iso_pu_bacteria 2935916978 2935917909 207
423 iso_pu_bacteria 2935926038 2935926662 207
424 iso_pu_bacteria 2935934488 2935935112 207
425 iso_pu_bacteria 2935942939 2935943562 207
426 iso_pu_bacteria 2935951376 2935952000 207
427 iso_pu_bacteria 2935959822 2935960768 207
428 iso_pu_bacteria 2935967501 2935968125 207
429 iso_pu_bacteria 2935975950 2935978740 207
430 iso_pu_bacteria 2935984226 2935987389 207
431 iso_pu_bacteria 2935992306 2935996452 207
432 iso_pu_bacteria 2936002035 2936003733 207
433 iso_pu_bacteria 2936011229 2936013535 207
434 iso_pu_bacteria 2936019824 2936022338 207
435 iso_pu_bacteria 2936028420 2936030784 207
436 iso_pu_bacteria 2936037263 2936042438 207
437 iso_pu_bacteria 2936046547 2936048597 207
438 iso_pu_bacteria 2936055302 2936058811 207
439 iso_pu_bacteria 2940556831 2940557369 207
440 iso_pu_bacteria 2941531003 2941533160 207
441 iso_pu_bacteria 2941538514 2941539319 207
442 iso_pu_bacteria 3005483717 3005484636 207
443 iso_pu_bacteria 3005506211 3005510649 207
444 iso_pu_bacteria 3005587118 3005587713 207
445 iso_pu_bacteria 3005594810 3005599584 207
446 iso_pu_bacteria 3005710791 3005715242 207
447 iso_pu_bacteria 3005718088 3005722626 207
448 iso_pu_bacteria 8016511872 8016521846 207
449 iso_pu_bacteria 8016522445 8016529257 207
450 iso_pu_bacteria 8016530956 8016534471 207
451 iso_pu_bacteria 8016539877 8016547691 207
452 iso_pu_bacteria 8016548790 8016554446 207
453 iso_pu_bacteria 8016557553 8016562819 207
454 iso_pu_bacteria 8016566248 8016572810 207
455 iso_pu_bacteria 8016575299 8016576969 207
456 iso_pu_bacteria 8016595262 8016600594 207
457 iso_pu_bacteria 8016622563 8016626190 207
458 iso_pu_bacteria 8016630954 8016639971 207
459 iso_pu_bacteria 8017057580 8017063807 207
460 iso_pu_bacteria 8019530166 8019534231 207
461 iso_pu_bacteria 8019538911 8019545228 207
462 iso_pu_bacteria 8019547302 8019553287 207
463 iso_pu_bacteria 8019586578 8019590958 207
464 iso_pu_bacteria 8019597564 8019600389 207
465 iso_pu_bacteria 8019619141 8019628548 207
466 iso_pu_bacteria 8019629233 8019634089 207
467 iso_pu_bacteria 8019638758 8019645640 207
468 iso_pu_bacteria 8019648815 8019658901 207
469 iso_pu_bacteria 8019659431 8019661967 207
470 iso_pu_bacteria 8019668869 8019671492 207
471 iso_pu_bacteria 8019678201 8019684615 207
472 iso_pu_bacteria 8019687851 8019690433 207
473 iso_pu_bacteria 8055742211 8055745922 207
474 3300006237 Ga0097621_100567523 Ga0097621_1005675231 208
475 3300021361 Ga0213872_10034960 Ga0213872_100349602 208
476 3300025921 Ga0207652_10079037 Ga0207652_100790373 208
477 3300031249 Ga0265339_10057328 Ga0265339_100573282 208
478 3300031249 Ga0265339_10207939 Ga0265339_102079392 208
479 3300039447 Ga0436361_0833650 Ga0436361_0833650_5235_5918 208
480 3300044694 Ga0466963_0038369 Ga0466963_0038369_174_866 208
481 3300044706 Ga0466964_0092261 Ga0466964_0092261_146_838 208
482 3300044719 Ga0466971_0248365 Ga0466971_0248365_79_771 208
483 3300045836 Ga0466958_0131752 Ga0466958_0131752_849_1541 208
484 3300045976 Ga0466967_0066574 Ga0466967_0066574_743_1435 208
485 3300053086 Ga0500578_0148732 Ga0500578_0148732_31_714 208
486 3300053088 Ga0500644_0119011 Ga0500644_0119011_243_926 208
487 3300005338 Ga0068868_100103125 Ga0068868_1001031252 209
488 3300005436 Ga0070713_100012732 Ga0070713_1000127324 209
489 3300005456 Ga0070678_100043206 Ga0070678_1000432063 209
490 3300005545 Ga0070695_100149314 Ga0070695_1001493142 209
491 3300005614 Ga0068856_100000020 Ga0068856_100000020110 209
492 3300005614 Ga0068856_100135286 Ga0068856_1001352862 209
493 3300005718 Ga0068866_10026261 Ga0068866_100262612 209
494 3300005841 Ga0068863_100045728 Ga0068863_1000457282 209
495 3300005842 Ga0068858_100008078 Ga0068858_10000807811 209
496 3300005843 Ga0068860_100327827 Ga0068860_1003278272 209
497 3300006173 Ga0070716_100002442 Ga0070716_1000024426 209
498 3300006175 Ga0070712_100034659 Ga0070712_1000346593 209
499 3300006358 Ga0068871_100166449 Ga0068871_1001664492 209
500 3300009098 Ga0105245_10006619 Ga0105245_1000661910 209
501 3300009174 Ga0105241_10062670 Ga0105241_100626702 209
502 3300009176 Ga0105242_10077188 Ga0105242_100771882 209
503 3300009177 Ga0105248_10027920 Ga0105248_100279207 209
504 3300009545 Ga0105237_10026248 Ga0105237_100262482 209
505 3300010375 Ga0105239_10502132 Ga0105239_105021322 209
506 3300013296 Ga0157374_10012098 Ga0157374_100120988 209
507 3300013308 Ga0157375_10031030 Ga0157375_100310304 209
508 3300014325 Ga0163163_10047665 Ga0163163_100476654 209
509 3300014968 Ga0157379_10005550 Ga0157379_100055503 209
510 3300025898 Ga0207692_10094891 Ga0207692_100948912 209
511 3300025903 Ga0207680_10219026 Ga0207680_102190261 209
512 3300025905 Ga0207685_10016843 Ga0207685_100168432 209
513 3300025915 Ga0207693_10000068 Ga0207693_1000006827 209
514 3300025916 Ga0207663_10053162 Ga0207663_100531623 209
515 3300025928 Ga0207700_10015748 Ga0207700_100157482 209
516 3300025941 Ga0207711_10317721 Ga0207711_103177212 209
517 3300025949 Ga0207667_10296284 Ga0207667_102962842 209
518 3300026023 Ga0207677_10372683 Ga0207677_103726832 209
519 3300026078 Ga0207702_10000126 Ga0207702_1000012638 209
520 3300026088 Ga0207641_10083530 Ga0207641_100835302 209
521 3300026121 Ga0207683_10001340 Ga0207683_100013402 209
522 3300028379 Ga0268266_10483755 Ga0268266_104837552 209
523 3300035111 Ga0373923_0135165 Ga0373923_0135165_331_1020 209
524 3300035119 Ga0373956_0089214 Ga0373956_0089214_234_923 209
525 3300035170 Ga0373943_0028143 Ga0373943_0028143_1922_2611 209
526 3300037068 Ga0373925_0263518 Ga0373925_0263518_273_962 209
527 3300037068 Ga0373925_0442365 Ga0373925_0442365_38_727 209
528 3300037418 Ga0395900_0291201 Ga0395900_0291201_460_1152 209
529 3300038443 Ga0395901_0011779 Ga0395901_0011779_3487_4179 209
530 3300039438 Ga0436360_1256664 Ga0436360_1256664_1089_1781 209
531 3300044842 Ga0466957_0005921 Ga0466957_0005921_4797_5489 209
532 3300045049 Ga0466959_0030990 Ga0466959_0030990_2495_3187 209
533 3300045836 Ga0466958_0055054 Ga0466958_0055054_911_1603 209
534 3300046472 Ga0495580_0001449 Ga0495580_0001449_8431_9120 209
535 3300046472 Ga0495580_0133464 Ga0495580_0133464_287_976 209
536 3300046517 Ga0495630_0256501 Ga0495630_0256501_465_1154 209
537 3300047319 Ga0495674_0128534 Ga0495674_0128534_966_1655 209
538 3300048903 Ga0496100_0087309 Ga0496100_0087309_91_780 209
539 3300048904 Ga0496101_0237976 Ga0496101_0237976_548_1237 209
540 3300048905 Ga0496102_0157581 Ga0496102_0157581_897_1586 209
541 3300048907 Ga0496104_0069164 Ga0496104_0069164_1871_2560 209
542 3300048908 Ga0496105_0005338 Ga0496105_0005338_4014_4703 209
543 3300048910 Ga0496107_0011880 Ga0496107_0011880_4069_4758 209
544 3300048911 Ga0496108_0099899 Ga0496108_0099899_1548_2237 209
545 3300048913 Ga0496110_0067437 Ga0496110_0067437_1296_1985 209
546 3300048914 Ga0496111_0014244 Ga0496111_0014244_432_1121 209
547 3300048917 Ga0496114_0261912 Ga0496114_0261912_808_1497 209
548 3300048918 Ga0496115_0027561 Ga0496115_0027561_2233_2922 209
549 3300048918 Ga0496115_0261882 Ga0496115_0261882_157_840 209
550 3300048921 Ga0496118_0347342 Ga0496118_0347342_68_751 209
551 3300061719 Ga0466962_0044607 Ga0466962_0044607_612_1304 209
552 3300005329 Ga0070683_100477334 Ga0070683_1004773341 210
553 3300005336 Ga0070680_100107577 Ga0070680_1001075772 210
554 3300005339 Ga0070660_100001944 Ga0070660_10000194413 210
555 3300005434 Ga0070709_10048689 Ga0070709_100486891 210
556 3300005436 Ga0070713_100192501 Ga0070713_1001925012 210
557 3300005437 Ga0070710_10002441 Ga0070710_100024412 210
558 3300005439 Ga0070711_100005838 Ga0070711_1000058389 210
559 3300005439 Ga0070711_100017055 Ga0070711_1000170555 210
560 3300005439 Ga0070711_100020886 Ga0070711_1000208863 210
561 3300005458 Ga0070681_10004544 Ga0070681_100045446 210
562 3300005458 Ga0070681_10103453 Ga0070681_101034533 210
563 3300005458 Ga0070681_10219115 Ga0070681_102191152 210
564 3300005471 Ga0070698_100079119 Ga0070698_1000791191 210
565 3300005530 Ga0070679_100006626 Ga0070679_1000066261 210
566 3300005530 Ga0070679_100038870 Ga0070679_1000388704 210
567 3300005535 Ga0070684_100063932 Ga0070684_1000639323 210
568 3300005535 Ga0070684_100393456 Ga0070684_1003934561 210
569 3300005539 Ga0068853_100127758 Ga0068853_1001277581 210
570 3300005543 Ga0070672_100275735 Ga0070672_1002757351 210
571 3300005548 Ga0070665_101137226 Ga0070665_1011372261 210
572 3300005563 Ga0068855_100837078 Ga0068855_1008370782 210
573 3300005563 Ga0068855_100858428 Ga0068855_1008584282 210
574 3300005564 Ga0070664_100024089 Ga0070664_1000240893 210
575 3300005615 Ga0070702_100551212 Ga0070702_1005512121 210
576 3300005616 Ga0068852_100116503 Ga0068852_1001165033 210
577 3300005618 Ga0068864_100025488 Ga0068864_1000254887 210
578 3300005840 Ga0068870_10485385 Ga0068870_104853851 210
579 3300006028 Ga0070717_10022005 Ga0070717_100220056 210
580 3300006028 Ga0070717_10064475 Ga0070717_100644752 210
581 3300006028 Ga0070717_10178883 Ga0070717_101788832 210
582 3300006163 Ga0070715_10000961 Ga0070715_100009612 210
583 3300006175 Ga0070712_100043566 Ga0070712_1000435664 210
584 3300006237 Ga0097621_100030570 Ga0097621_1000305705 210
585 3300006881 Ga0068865_100381974 Ga0068865_1003819742 210
586 3300009093 Ga0105240_10238154 Ga0105240_102381543 210
587 3300009093 Ga0105240_10273675 Ga0105240_102736753 210
588 3300009093 Ga0105240_11362552 Ga0105240_113625521 210
589 3300009098 Ga0105245_10161198 Ga0105245_101611982 210
590 3300009176 Ga0105242_10418766 Ga0105242_104187662 210
591 3300009177 Ga0105248_10164724 Ga0105248_101647243 210
592 3300009177 Ga0105248_10440910 Ga0105248_104409102 210
593 3300009545 Ga0105237_10016711 Ga0105237_100167118 210
594 3300009551 Ga0105238_10005356 Ga0105238_1000535613 210
595 3300009551 Ga0105238_10288491 Ga0105238_102884912 210
596 3300010159 Ga0099796_10009831 Ga0099796_100098312 210
597 3300011119 Ga0105246_10597859 Ga0105246_105978591 210
598 3300013105 Ga0157369_10035175 Ga0157369_100351755 210
599 3300013105 Ga0157369_10104822 Ga0157369_101048222 210
600 3300013306 Ga0163162_10019668 Ga0163162_100196686 210
601 3300013308 Ga0157375_10034118 Ga0157375_100341184 210
602 3300014325 Ga0163163_10490357 Ga0163163_104903572 210
603 3300014968 Ga0157379_10090305 Ga0157379_100903054 210
604 3300025297 Ga0209758_1004785 Ga0209758_10047852 210
605 3300025321 Ga0207656_10045648 Ga0207656_100456483 210
606 3300025898 Ga0207692_10008992 Ga0207692_100089922 210
607 3300025901 Ga0207688_10059355 Ga0207688_100593552 210
608 3300025906 Ga0207699_10002766 Ga0207699_100027664 210
609 3300025906 Ga0207699_10354584 Ga0207699_103545842 210
610 3300025912 Ga0207707_10000950 Ga0207707_100009501 210
611 3300025912 Ga0207707_10004626 Ga0207707_1000462613 210
612 3300025912 Ga0207707_10052762 Ga0207707_100527623 210
613 3300025913 Ga0207695_10161968 Ga0207695_101619681 210
614 3300025915 Ga0207693_10013028 Ga0207693_100130285 210
615 3300025916 Ga0207663_10000098 Ga0207663_1000009818 210
616 3300025916 Ga0207663_10035907 Ga0207663_100359073 210
617 3300025917 Ga0207660_10002564 Ga0207660_1000256413 210
618 3300025917 Ga0207660_10027186 Ga0207660_100271862 210
619 3300025917 Ga0207660_10218329 Ga0207660_102183292 210
620 3300025919 Ga0207657_10000658 Ga0207657_100006583 210
621 3300025921 Ga0207652_10003470 Ga0207652_100034703 210
622 3300025921 Ga0207652_10264824 Ga0207652_102648242 210
623 3300025922 Ga0207646_10210051 Ga0207646_102100512 210
624 3300025928 Ga0207700_10091132 Ga0207700_100911322 210
625 3300025928 Ga0207700_10197106 Ga0207700_101971062 210
626 3300025928 Ga0207700_10411601 Ga0207700_104116012 210
627 3300025929 Ga0207664_10042775 Ga0207664_100427753 210
628 3300025929 Ga0207664_10043417 Ga0207664_100434172 210
629 3300025938 Ga0207704_10296267 Ga0207704_102962672 210
630 3300025939 Ga0207665_10000355 Ga0207665_1000035520 210
631 3300025941 Ga0207711_10174186 Ga0207711_101741862 210
632 3300025941 Ga0207711_10233979 Ga0207711_102339792 210
633 3300025944 Ga0207661_10001747 Ga0207661_100017479 210
634 3300025944 Ga0207661_10051941 Ga0207661_100519413 210
635 3300025944 Ga0207661_10262245 Ga0207661_102622452 210
636 3300025944 Ga0207661_10649613 Ga0207661_106496132 210
637 3300025949 Ga0207667_10215773 Ga0207667_102157733 210
638 3300025949 Ga0207667_10682469 Ga0207667_106824692 210
639 3300026023 Ga0207677_10020108 Ga0207677_100201082 210
640 3300026041 Ga0207639_10043047 Ga0207639_100430472 210
641 3300026041 Ga0207639_10149674 Ga0207639_101496742 210
642 3300026067 Ga0207678_10111029 Ga0207678_101110292 210
643 3300026088 Ga0207641_10866328 Ga0207641_108663282 210
644 3300026095 Ga0207676_10190935 Ga0207676_101909352 210
645 3300026116 Ga0207674_10261908 Ga0207674_102619082 210
646 3300026142 Ga0207698_10336335 Ga0207698_103363352 210
647 3300028379 Ga0268266_10925741 Ga0268266_109257412 210
648 3300028794 Ga0307515_10045960 Ga0307515_100459602 210
649 3300031456 Ga0307513_10029676 Ga0307513_100296762 210
650 3300033180 Ga0307510_10018144 Ga0307510_100181444 210
651 3300033180 Ga0307510_10125011 Ga0307510_101250113 210
652 3300035725 Ga0373947_0047946 Ga0373947_0047946_1520_2212 210
653 3300037068 Ga0373925_0157538 Ga0373925_0157538_146_838 210
654 3300037418 Ga0395900_0288678 Ga0395900_0288678_309_992 210
655 3300037466 Ga0395898_0436159 Ga0395898_0436159_202_885 210
656 3300037471 Ga0395905_0040677 Ga0395905_0040677_2476_3159 210
657 3300037471 Ga0395905_0136213 Ga0395905_0136213_1127_1819 210
658 3300039450 Ga0436363_0842295 Ga0436363_0842295_222_914 210
659 3300044842 Ga0466957_0067739 Ga0466957_0067739_329_1012 210
660 3300045976 Ga0466967_0863177 Ga0466967_0863177_46_738 210
661 3300046455 Ga0495603_0006388 Ga0495603_0006388_6262_6954 210
662 3300046455 Ga0495603_0083749 Ga0495603_0083749_210_902 210
663 3300046516 Ga0495628_0410575 Ga0495628_0410575_104_796 210
664 3300046526 Ga0495666_0042687 Ga0495666_0042687_983_1675 210
665 3300046683 Ga0495658_0171470 Ga0495658_0171470_371_1063 210
666 3300046690 Ga0495624_0137708 Ga0495624_0137708_771_1463 210
667 3300047320 Ga0495672_0039595 Ga0495672_0039595_1984_2676 210
668 3300047323 Ga0495683_0246945 Ga0495683_0246945_56_748 210
669 3300048904 Ga0496101_0020482 Ga0496101_0020482_2613_3305 210
670 3300048904 Ga0496101_0275356 Ga0496101_0275356_86_769 210
671 3300048905 Ga0496102_0107202 Ga0496102_0107202_135_827 210
672 3300048906 Ga0496103_0226854 Ga0496103_0226854_311_1003 210
673 3300048907 Ga0496104_0118307 Ga0496104_0118307_638_1330 210
674 3300048908 Ga0496105_0019704 Ga0496105_0019704_2709_3401 210
675 3300048909 Ga0496106_0019968 Ga0496106_0019968_2675_3367 210
676 3300048910 Ga0496107_0007348 Ga0496107_0007348_409_1101 210
677 3300048911 Ga0496108_0018223 Ga0496108_0018223_1878_2570 210
678 3300048912 Ga0496109_0030334 Ga0496109_0030334_2943_3635 210
679 3300048912 Ga0496109_0188433 Ga0496109_0188433_167_859 210
680 3300048913 Ga0496110_0023813 Ga0496110_0023813_1868_2560 210
681 3300048915 Ga0496112_0075363 Ga0496112_0075363_355_1047 210
682 3300048916 Ga0496113_0036976 Ga0496113_0036976_2738_3430 210
683 3300048916 Ga0496113_0288256 Ga0496113_0288256_339_1031 210
684 3300048917 Ga0496114_0094109 Ga0496114_0094109_1575_2267 210
685 3300048917 Ga0496114_0170210 Ga0496114_0170210_659_1351 210
686 3300048918 Ga0496115_0006273 Ga0496115_0006273_1613_2305 210
687 3300048918 Ga0496115_0165195 Ga0496115_0165195_1083_1775 210
688 3300048918 Ga0496115_0354614 Ga0496115_0354614_305_997 210
689 3300048919 Ga0496116_0017742 Ga0496116_0017742_614_1297 210
690 3300048920 Ga0496117_0040858 Ga0496117_0040858_2275_2958 210
691 3300048921 Ga0496118_0041838 Ga0496118_0041838_553_1236 210
692 3300048929 Ga0496126_0001122 Ga0496126_0001122_39565_40257 210
693 3300048929 Ga0496126_0048493 Ga0496126_0048493_2742_3434 210
694 3300048929 Ga0496126_0097147 Ga0496126_0097147_1733_2425 210
695 3300049586 Ga0501070_0005092 Ga0501070_0005092_10015_10719 210
696 3300049586 Ga0501070_0101042 Ga0501070_0101042_1457_2149 210
697 3300049589 Ga0501073_0057668 Ga0501073_0057668_1627_2319 210
698 3300049589 Ga0501073_0084887 Ga0501073_0084887_165_869 210
699 3300049590 Ga0501074_0008292 Ga0501074_0008292_4956_5660 210
700 3300049590 Ga0501074_0012164 Ga0501074_0012164_929_1621 210
701 3300049741 Ga0501079_0256190 Ga0501079_0256190_148_852 210
702 3300049823 Ga0501044_0093205 Ga0501044_0093205_2309_3001 210
703 3300053080 Ga0500635_0008149 Ga0500635_0008149_1817_2509 210
704 3300053085 Ga0495619_0028070 Ga0495619_0028070_645_1337 210
705 3300053102 Ga0500554_009687 Ga0500554_009687_1202_1894 210
706 3300053108 Ga0500562_020239 Ga0500562_020239_326_1018 210
707 3300053121 Ga0500607_040291 Ga0500607_040291_1181_1864 210
708 3300053150 Ga0500603_002409 Ga0500603_002409_538_1230 210
709 3300053151 Ga0500604_0109479 Ga0500604_0109479_65_754 210
710 3300053178 Ga0500637_0012756 Ga0500637_0012756_653_1345 210
711 2010549000 RicEn_C1063 RicEn_19680 211
712 3300001989 JGI24739J22299_10071180 JGI24739J22299_100711802 211
713 3300003215 JGI25153J46596_10003431 JGI25153J46596_100034316 211
714 3300003762 Ga0055542_1011589 Ga0055542_10115892 211
715 3300005327 Ga0070658_10004762 Ga0070658_1000476211 211
716 3300005339 Ga0070660_100069539 Ga0070660_1000695393 211
717 3300005434 Ga0070709_10078036 Ga0070709_100780361 211
718 3300005435 Ga0070714_100091008 Ga0070714_1000910082 211
719 3300005437 Ga0070710_10159238 Ga0070710_101592382 211
720 3300005439 Ga0070711_100002925 Ga0070711_1000029253 211
721 3300005439 Ga0070711_100913954 Ga0070711_1009139541 211
722 3300005547 Ga0070693_100128664 Ga0070693_1001286641 211
723 3300005563 Ga0068855_100073110 Ga0068855_1000731103 211
724 3300006175 Ga0070712_100068339 Ga0070712_1000683393 211
725 3300006175 Ga0070712_100070488 Ga0070712_1000704882 211
726 3300006195 Ga0075366_10411529 Ga0075366_104115292 211
727 3300006353 Ga0075370_10060519 Ga0075370_100605191 211
728 3300009093 Ga0105240_10008282 Ga0105240_100082822 211
729 3300009093 Ga0105240_10143380 Ga0105240_101433803 211
730 3300009174 Ga0105241_10053828 Ga0105241_100538283 211
731 3300009174 Ga0105241_10072568 Ga0105241_100725682 211
732 3300009545 Ga0105237_10006673 Ga0105237_1000667313 211
733 3300009551 Ga0105238_10157681 Ga0105238_101576812 211
734 3300013102 Ga0157371_10013955 Ga0157371_100139552 211
735 3300013104 Ga0157370_10110323 Ga0157370_101103233 211
736 3300013104 Ga0157370_10161675 Ga0157370_101616752 211
737 3300013105 Ga0157369_10587395 Ga0157369_105873952 211
738 3300020082 Ga0206353_11806622 Ga0206353_118066222 211
739 3300021388 Ga0213875_10056323 Ga0213875_100563232 211
740 3300025254 Ga0209148_1000500 Ga0209148_10005008 211
741 3300025297 Ga0209758_1001533 Ga0209758_100153321 211
742 3300025912 Ga0207707_10232394 Ga0207707_102323942 211
743 3300025913 Ga0207695_10000008 Ga0207695_10000008141 211
744 3300025913 Ga0207695_10084653 Ga0207695_100846536 211
745 3300025914 Ga0207671_10003142 Ga0207671_1000314214 211
746 3300025915 Ga0207693_10010099 Ga0207693_100100995 211
747 3300025915 Ga0207693_10059172 Ga0207693_100591723 211
748 3300025915 Ga0207693_10208751 Ga0207693_102087512 211
749 3300025919 Ga0207657_10155771 Ga0207657_101557712 211
750 3300025921 Ga0207652_10088350 Ga0207652_100883503 211
751 3300025924 Ga0207694_10190212 Ga0207694_101902122 211
752 3300025927 Ga0207687_10331011 Ga0207687_103310111 211
753 3300025939 Ga0207665_10432670 Ga0207665_104326702 211
754 3300025981 Ga0207640_10139666 Ga0207640_101396661 211
755 3300026041 Ga0207639_10486835 Ga0207639_104868352 211
756 3300027363 Ga0209700_100005 Ga0209700_100005296 211
757 3300031235 Ga0265330_10045567 Ga0265330_100455673 211
758 3300031235 Ga0265330_10088362 Ga0265330_100883622 211
759 3300031241 Ga0265325_10000044 Ga0265325_1000004413 211
760 3300031241 Ga0265325_10011538 Ga0265325_100115384 211
761 3300031241 Ga0265325_10045607 Ga0265325_100456072 211
762 3300031249 Ga0265339_10019022 Ga0265339_100190224 211
763 3300031249 Ga0265339_10141434 Ga0265339_101414341 211
764 3300031249 Ga0265339_10180991 Ga0265339_101809912 211
765 3300031344 Ga0265316_10042156 Ga0265316_100421563 211
766 3300031595 Ga0265313_10009939 Ga0265313_100099394 211
767 3300031711 Ga0265314_10008091 Ga0265314_100080917 211
768 3300031711 Ga0265314_10050093 Ga0265314_100500933 211
769 3300032133 Ga0316583_10000267 Ga0316583_100002675 211
770 3300035083 Ga0373926_0042232 Ga0373926_0042232_814_1506 211
771 3300035114 Ga0373939_0000811 Ga0373939_0000811_3706_4398 211
772 3300035117 Ga0373953_0048107 Ga0373953_0048107_34_726 211
773 3300035119 Ga0373956_0015090 Ga0373956_0015090_676_1368 211
774 3300035172 Ga0373955_0015065 Ga0373955_0015065_609_1301 211
775 3300035410 Ga0373924_0021198 Ga0373924_0021198_973_1665 211
776 3300035692 Ga0373935_0044130 Ga0373935_0044130_157_849 211
777 3300035695 Ga0373927_0027467 Ga0373927_0027467_1186_1878 211
778 3300035724 Ga0373933_0012562 Ga0373933_0012562_3821_4513 211
779 3300037466 Ga0395898_0185548 Ga0395898_0185548_827_1519 211
780 3300037853 Ga0436364_1535696 Ga0436364_1535696_275_970 211
781 3300038443 Ga0395901_0123610 Ga0395901_0123610_1700_2392 211
782 3300045051 Ga0451576_1082748 Ga0451576_1082748_57_755 211
783 3300046461 Ga0495641_0130608 Ga0495641_0130608_147_839 211
784 3300046462 Ga0495651_0064165 Ga0495651_0064165_1891_2583 211
785 3300046463 Ga0495653_0141442 Ga0495653_0141442_79_771 211
786 3300046472 Ga0495580_0113921 Ga0495580_0113921_40_732 211
787 3300046473 Ga0495582_0120766 Ga0495582_0120766_539_1231 211
788 3300046475 Ga0495639_0044746 Ga0495639_0044746_1175_1867 211
789 3300046477 Ga0495664_0006747 Ga0495664_0006747_1314_2006 211
790 3300046492 Ga0495585_0053425 Ga0495585_0053425_467_1150 211
791 3300046499 Ga0495594_0066599 Ga0495594_0066599_1283_1975 211
792 3300046511 Ga0495608_0121182 Ga0495608_0121182_331_1023 211
793 3300046516 Ga0495628_0015673 Ga0495628_0015673_4975_5667 211
794 3300046517 Ga0495630_0402568 Ga0495630_0402568_217_909 211
795 3300046520 Ga0495637_0113053 Ga0495637_0113053_200_892 211
796 3300046526 Ga0495666_0051380 Ga0495666_0051380_657_1349 211
797 3300046529 Ga0495652_0083205 Ga0495652_0083205_1541_2233 211
798 3300046531 Ga0495665_0038334 Ga0495665_0038334_414_1106 211
799 3300046533 Ga0495640_0027667 Ga0495640_0027667_2680_3372 211
800 3300046533 Ga0495640_0103913 Ga0495640_0103913_759_1451 211
801 3300046536 Ga0495587_0011641 Ga0495587_0011641_3727_4419 211
802 3300046543 Ga0495645_0001025 Ga0495645_0001025_742_1434 211
803 3300046559 Ga0495667_0001273 Ga0495667_0001273_10296_10988 211
804 3300046642 Ga0495634_0053454 Ga0495634_0053454_1244_1936 211
805 3300046663 Ga0495635_0114378 Ga0495635_0114378_103_795 211
806 3300046674 Ga0495588_0006176 Ga0495588_0006176_805_1497 211
807 3300046678 Ga0495599_0007196 Ga0495599_0007196_4349_5041 211
808 3300046679 Ga0495623_0013803 Ga0495623_0013803_472_1164 211
809 3300046680 Ga0495646_0067005 Ga0495646_0067005_878_1570 211
810 3300046681 Ga0495647_0029905 Ga0495647_0029905_901_1593 211
811 3300046690 Ga0495624_0020197 Ga0495624_0020197_2992_3684 211
812 3300046809 Ga0495600_0049859 Ga0495600_0049859_1142_1834 211
813 3300047317 Ga0495604_0010726 Ga0495604_0010726_5835_6527 211
814 3300047319 Ga0495674_0014178 Ga0495674_0014178_4435_5127 211
815 3300047319 Ga0495674_0072773 Ga0495674_0072773_604_1296 211
816 3300047321 Ga0495676_0084983 Ga0495676_0084983_179_871 211
817 3300047322 Ga0495680_0009088 Ga0495680_0009088_5197_5889 211
818 3300047322 Ga0495680_0284136 Ga0495680_0284136_132_824 211
819 3300047444 Ga0495675_0198151 Ga0495675_0198151_28_720 211
820 3300047471 Ga0495684_0051684 Ga0495684_0051684_525_1217 211
821 3300047471 Ga0495684_0103345 Ga0495684_0103345_929_1621 211
822 3300048088 Ga0495602_0000726 Ga0495602_0000726_13167_13859 211
823 3300048089 Ga0495614_0050196 Ga0495614_0050196_1057_1749 211
824 3300048906 Ga0496103_0000323 Ga0496103_0000323_37403_38119 211
825 3300048907 Ga0496104_0000580 Ga0496104_0000580_5718_6410 211
826 3300048907 Ga0496104_0916199 Ga0496104_0916199_80_763 211
827 3300048908 Ga0496105_0000402 Ga0496105_0000402_23398_24090 211
828 3300048909 Ga0496106_0673926 Ga0496106_0673926_43_726 211
829 3300048912 Ga0496109_0480397 Ga0496109_0480397_91_774 211
830 3300048913 Ga0496110_0232617 Ga0496110_0232617_222_905 211
831 3300048917 Ga0496114_0387221 Ga0496114_0387221_24_716 211
832 3300048919 Ga0496116_0000691 Ga0496116_0000691_5682_6398 211
833 3300048920 Ga0496117_0000018 Ga0496117_0000018_441495_442211 211
834 3300048921 Ga0496118_0000013 Ga0496118_0000013_37403_38119 211
835 3300048929 Ga0496126_0000902 Ga0496126_0000902_50598_51314 211
836 3300049568 Ga0501031_0035285 Ga0501031_0035285_2502_3194 211
837 3300049569 Ga0501032_0140627 Ga0501032_0140627_322_1014 211
838 3300049569 Ga0501032_0190204 Ga0501032_0190204_287_979 211
839 3300049570 Ga0501033_0076639 Ga0501033_0076639_293_991 211
840 3300049571 Ga0501034_0190459 Ga0501034_0190459_182_880 211
841 3300049571 Ga0501034_0423571 Ga0501034_0423571_290_982 211
842 3300049572 Ga0501036_0116806 Ga0501036_0116806_83_775 211
843 3300049573 Ga0501037_0369219 Ga0501037_0369219_11_709 211
844 3300049574 Ga0501038_0037203 Ga0501038_0037203_2245_2943 211
845 3300049575 Ga0501039_0184272 Ga0501039_0184272_748_1440 211
846 3300049575 Ga0501039_0209369 Ga0501039_0209369_286_978 211
847 3300049579 Ga0501043_0154376 Ga0501043_0154376_1033_1725 211
848 3300049579 Ga0501043_0416932 Ga0501043_0416932_160_858 211
849 3300049580 Ga0501046_0615463 Ga0501046_0615463_34_729 211
850 3300049581 Ga0501047_0098128 Ga0501047_0098128_365_1063 211
851 3300049581 Ga0501047_0314286 Ga0501047_0314286_639_1331 211
852 3300049582 Ga0501048_0365352 Ga0501048_0365352_293_985 211
853 3300049583 Ga0501067_0298735 Ga0501067_0298735_92_784 211
854 3300049823 Ga0501044_0080499 Ga0501044_0080499_2313_3089 211
855 3300049823 Ga0501044_0132475 Ga0501044_0132475_986_1678 211
856 3300050491 nmdc:mga00v17_278130_c1 nmdc:mga00v17_278130_c1_67_759 211
857 3300050496 nmdc:mga07m45_343835_c1 nmdc:mga07m45_343835_c1_87_779 211
858 3300053077 Ga0495601_0000232 Ga0495601_0000232_10603_11295 211
859 3300053077 Ga0495601_0014166 Ga0495601_0014166_3627_4319 211
860 3300053078 Ga0495612_0000608 Ga0495612_0000608_2659_3351 211
861 3300053078 Ga0495612_0064474 Ga0495612_0064474_466_1158 211
862 3300053080 Ga0500635_0067466 Ga0500635_0067466_84_767 211
863 3300053084 Ga0495595_0000284 Ga0495595_0000284_651_1343 211
864 3300053085 Ga0495619_0001165 Ga0495619_0001165_4409_5101 211
865 3300053085 Ga0495619_0001565 Ga0495619_0001565_737_1429 211
866 3300053092 Ga0500583_0036800 Ga0500583_0036800_786_1469 211
867 3300053096 Ga0500641_0131994 Ga0500641_0131994_89_781 211
868 3300053103 Ga0500555_004027 Ga0500555_004027_2909_3592 211
869 3300053105 Ga0500557_000052 Ga0500557_000052_47087_47770 211
870 3300053111 Ga0500572_036126 Ga0500572_036126_223_906 211
871 3300053117 Ga0500593_012965 Ga0500593_012965_1441_2133 211
872 3300053122 Ga0500608_078010 Ga0500608_078010_134_817 211
873 3300053130 Ga0500642_0000468 Ga0500642_0000468_9026_9709 211
874 3300053130 Ga0500642_0104047 Ga0500642_0104047_309_992 211
875 3300053134 Ga0500658_0051537 Ga0500658_0051537_428_1111 211
876 3300053136 Ga0500559_0023353 Ga0500559_0023353_217_900 211
877 3300053154 Ga0500619_038193 Ga0500619_038193_633_1316 211
878 3300053155 Ga0500620_001550 Ga0500620_001550_1614_2297 211
879 3300053162 Ga0500638_026391 Ga0500638_026391_227_910 211
880 3300053177 Ga0500636_0001217 Ga0500636_0001217_4890_5573 211
881 3300053729 Ga0500625_038855 Ga0500625_038855_801_1484 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

52

200

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcn-assembly1.cif.gz_A crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426 0.9092 34 160
1j3l-assembly1.cif.gz_A structure of the rna-processing inhibitor rraa from thermus thermophilis 0.895 35 160
3c8o-assembly1.cif.gz_B the crystal structure of rraa from pao1 0.8917 20 160
1vi4-assembly1.cif.gz_A crystal structure of regulator of ribonuclease activity a protein 1 0.8907 34 160
1nxj-assembly1.cif.gz_A structure of rv3853 from mycobacterium tuberculosis 0.887 32 160
ID Description Score Start End Superfamily
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9757 21 160 3.50.30.40
2pcnA00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9092 34 160 3.50.30.40
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8943 21 160 3.50.30.40
af_P0A8R0_1_161_3.50.30.40 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8919 20 160 3.50.30.40
1j3lD00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8903 34 160 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A2M8V5U8-F1-model_v4 deleted 0.9818 37 135
AF-A0A7X5SB67-F1-model_v4 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase (EC 4.1.3.17) 0.9774 2 160 GO:0046872
GO:0047443
AF-A0A7W1K333-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (RraA-like protein) 0.9766 2 131 GO:0046872
AF-A0A2V8LMN1-F1-model_v4 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase 0.9764 1 160 GO:0046872
AF-A0A7W9G7T8-F1-model_v4 Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (RraA-like protein) 0.9736 1 160 GO:0046872
GO:0047443

Feature Viewer

pLDDT pTM Quality
85.22 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map