F484522
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 881 | 546 | 705 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10143380|Ga0105240_101433803 |
| Length | 257 |
| Sequence | LYGPGSAAHHFVLRCARDTKSKTRERKMKSVVVRNIKRADNNAVATMAALGVSTVHEALGRSGLMKTYMRPIWAGAQIAGPAVTVLAQPGDNWMIHVAVEQCQKGDVLVVGCTTDNTDGMFGELLATSLTARGVKGLIIDAGCRDVKALHDMGFPVWSRAVSAKGTVKATPGAVNVPVVCAGVNVEPGDVIVADDDGVVVVPRKLAIETAQKAQKRHDDEDGKRKQLAAGVLGLDMYKMREPLAKAGLVYVDNPEDV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 15 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 16 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 17 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 18 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 19 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 20 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 21 | 2791355199 | |||
| 22 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 23 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 24 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 25 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 26 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 27 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 28 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 29 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 30 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 31 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 32 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 33 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 34 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 35 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 36 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 37 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 38 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 39 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 40 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 41 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 42 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 43 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 44 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 45 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 46 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 47 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 48 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 49 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 50 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 51 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 52 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 53 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 54 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 55 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 56 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 57 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 58 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 59 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 60 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 61 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 62 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 63 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 64 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 65 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 66 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 67 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 68 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 69 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 70 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 71 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 72 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 73 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 74 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 75 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 76 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 77 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 78 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 79 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 80 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 81 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 82 | 2922368715 | |||
| 83 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 84 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 85 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 86 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 87 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 88 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 89 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 90 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 91 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 92 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 93 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 94 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 95 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 96 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 97 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 98 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 99 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 100 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 101 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 102 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 103 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 104 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 105 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 106 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 107 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 108 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 109 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 110 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 111 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 112 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 113 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 114 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 115 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 116 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 117 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 118 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 119 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 120 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 121 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 122 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 123 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 124 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 125 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 126 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 127 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 128 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 129 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 130 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 131 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 132 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 133 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 134 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 135 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 136 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 137 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 138 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 139 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 140 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 141 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 142 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 143 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 144 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 145 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 146 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 147 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 148 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 149 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 150 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 151 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 152 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 153 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 154 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 155 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 156 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 158 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 159 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 160 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 161 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 162 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 169 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 171 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 172 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 176 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 177 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 178 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 179 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 181 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 182 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 183 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 189 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 191 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 192 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 193 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 195 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 196 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 197 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 198 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 199 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 200 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 201 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 202 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 203 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 204 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 205 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 206 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 207 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 209 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 210 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 211 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 212 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 215 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 216 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 217 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 218 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 220 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 221 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 222 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 223 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 224 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 226 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 227 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 237 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 251 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 252 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 253 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 254 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 255 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 257 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 305 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 306 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 307 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 308 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 311 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 312 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 313 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 314 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 315 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 316 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 317 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 318 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 319 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 320 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 321 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 322 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 323 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 324 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 325 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 326 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 327 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 328 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 329 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 330 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 331 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 332 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 333 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 334 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 335 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 336 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 337 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 338 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 339 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 340 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 341 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 342 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 343 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 344 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 345 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 346 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 347 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 348 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 349 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 350 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 351 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 352 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 353 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 354 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 355 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 356 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 357 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 358 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 359 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 360 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 361 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 362 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 363 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 364 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 428 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 429 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 430 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 431 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 432 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 433 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 436 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 437 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 438 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 439 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 440 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 441 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 442 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 443 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 444 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 445 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 446 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 447 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 448 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 449 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 469 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 470 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 471 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 472 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 477 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 480 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 483 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 485 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 486 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 488 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 489 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 490 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 491 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 492 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 493 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 494 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 495 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 496 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 498 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 499 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 500 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 501 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 502 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 503 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 504 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 505 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 506 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 507 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 508 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 509 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 511 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 512 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 513 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 514 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 515 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 516 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 517 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 518 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 519 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 520 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 521 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 522 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 523 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 524 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 525 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 526 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 527 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 528 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 529 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 530 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 531 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 532 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 533 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 534 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 535 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 536 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 537 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 538 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 539 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 540 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 541 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 542 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 543 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 544 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 545 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 546 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.98 |
| Metatranscriptomes | 0.23 |
| Isolates | 19.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.99 |
| Nodule | 15.32 |
| Rhizoplane | 7.26 |
| Rhizosphere | 58.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C1063 | 2010549000 | Bacteria | 2363 |
| 2 | JGI24739J22299_10071180 | 3300001989 | Bacteria | 1082 |
| 3 | JGI25153J46596_10000394 | 3300003215 | Bacteria | 29469 |
| 4 | JGI25153J46596_10003431 | 3300003215 | Bacteria | 8876 |
| 5 | JGI25160J50197_1012586 | 3300003354 | Bacteria | 2928 |
| 6 | Ga0055542_1011589 | 3300003762 | Bacteria | 1559 |
| 7 | Ga0055531_10007393 | 3300003794 | Bacteria | 6010 |
| 8 | Ga0055543_1002885 | 3300004625 | Bacteria | 5407 |
| 9 | Ga0065165_1001731 | 3300005262 | Bacteria | 21826 |
| 10 | Ga0065165_1002125 | 3300005262 | Bacteria | 18029 |
| 11 | Ga0065712_10016912 | 3300005290 | Bacteria | 1759 |
| 12 | Ga0070658_10004762 | 3300005327 | Bacteria | 11041 |
| 13 | Ga0070658_10051844 | 3300005327 | Bacteria | 3325 |
| 14 | Ga0070683_100477334 | 3300005329 | Bacteria | 1191 |
| 15 | Ga0070683_100575298 | 3300005329 | Bacteria | 1077 |
| 16 | Ga0068869_100509780 | 3300005334 | Bacteria | 1005 |
| 17 | Ga0070680_100017453 | 3300005336 | Bacteria | 5660 |
| 18 | Ga0070680_100107577 | 3300005336 | Bacteria | 2319 |
| 19 | Ga0070682_100104282 | 3300005337 | Bacteria | 1878 |
| 20 | Ga0068868_100103125 | 3300005338 | Bacteria | 2310 |
| 21 | Ga0070660_100001944 | 3300005339 | Bacteria | 14250 |
| 22 | Ga0070660_100069539 | 3300005339 | Bacteria | 2746 |
| 23 | Ga0070661_100125958 | 3300005344 | Bacteria | 1922 |
| 24 | Ga0070668_100323705 | 3300005347 | Bacteria | 1298 |
| 25 | Ga0070675_100356650 | 3300005354 | Bacteria | 1298 |
| 26 | Ga0070671_100001629 | 3300005355 | Bacteria | 16929 |
| 27 | Ga0070673_100177979 | 3300005364 | Bacteria | 1819 |
| 28 | Ga0070709_10014203 | 3300005434 | Bacteria | 4500 |
| 29 | Ga0070709_10048689 | 3300005434 | Bacteria | 2646 |
| 30 | Ga0070709_10077995 | 3300005434 | Bacteria | 2155 |
| 31 | Ga0070709_10078036 | 3300005434 | Bacteria | 2154 |
| 32 | Ga0070714_100041624 | 3300005435 | Bacteria | 3878 |
| 33 | Ga0070714_100091008 | 3300005435 | Bacteria | 2672 |
| 34 | Ga0070713_100012732 | 3300005436 | Bacteria | 6181 |
| 35 | Ga0070713_100192501 | 3300005436 | Bacteria | 1838 |
| 36 | Ga0070713_100195344 | 3300005436 | Bacteria | 1825 |
| 37 | Ga0070713_100464464 | 3300005436 | Bacteria | 1190 |
| 38 | Ga0070710_10002441 | 3300005437 | Bacteria | 8802 |
| 39 | Ga0070710_10046159 | 3300005437 | Bacteria | 2425 |
| 40 | Ga0070710_10159238 | 3300005437 | Bacteria | 1399 |
| 41 | Ga0070711_100002925 | 3300005439 | Bacteria | 9841 |
| 42 | Ga0070711_100005838 | 3300005439 | Bacteria | 7390 |
| 43 | Ga0070711_100017055 | 3300005439 | Bacteria | 4619 |
| 44 | Ga0070711_100020886 | 3300005439 | Bacteria | 4227 |
| 45 | Ga0070711_100040240 | 3300005439 | Bacteria | 3151 |
| 46 | Ga0070711_100179879 | 3300005439 | Bacteria | 1619 |
| 47 | Ga0070711_100913954 | 3300005439 | Bacteria | 749 |
| 48 | Ga0070663_100055656 | 3300005455 | Bacteria | 2832 |
| 49 | Ga0070663_100226708 | 3300005455 | Bacteria | 1469 |
| 50 | Ga0070663_100249004 | 3300005455 | Bacteria | 1406 |
| 51 | Ga0070678_100011904 | 3300005456 | Bacteria | 5384 |
| 52 | Ga0070678_100043206 | 3300005456 | Bacteria | 3209 |
| 53 | Ga0070681_10004544 | 3300005458 | Bacteria | 13233 |
| 54 | Ga0070681_10103453 | 3300005458 | Bacteria | 2792 |
| 55 | Ga0070681_10219115 | 3300005458 | Bacteria | 1818 |
| 56 | Ga0070681_10622008 | 3300005458 | Bacteria | 994 |
| 57 | Ga0070706_100204227 | 3300005467 | Bacteria | 1846 |
| 58 | Ga0070707_100739084 | 3300005468 | Bacteria | 947 |
| 59 | Ga0070698_100079119 | 3300005471 | Bacteria | 3285 |
| 60 | Ga0070699_100098367 | 3300005518 | Bacteria | 2564 |
| 61 | Ga0070679_100006626 | 3300005530 | Bacteria | 10798 |
| 62 | Ga0070679_100038870 | 3300005530 | Bacteria | 4731 |
| 63 | Ga0070679_100395127 | 3300005530 | Bacteria | 1329 |
| 64 | Ga0070679_100463679 | 3300005530 | Bacteria | 1211 |
| 65 | Ga0070679_100539670 | 3300005530 | Bacteria | 1110 |
| 66 | Ga0070684_100063932 | 3300005535 | Bacteria | 3227 |
| 67 | Ga0070684_100393456 | 3300005535 | Bacteria | 1277 |
| 68 | Ga0068853_100127758 | 3300005539 | Bacteria | 2272 |
| 69 | Ga0068853_100486966 | 3300005539 | Bacteria | 1163 |
| 70 | Ga0070672_100275735 | 3300005543 | Bacteria | 1421 |
| 71 | Ga0070695_100149314 | 3300005545 | Bacteria | 1629 |
| 72 | Ga0070696_100238502 | 3300005546 | Bacteria | 1370 |
| 73 | Ga0070693_100128664 | 3300005547 | Bacteria | 1580 |
| 74 | Ga0070665_101137226 | 3300005548 | Bacteria | 792 |
| 75 | Ga0068855_100073110 | 3300005563 | Bacteria | 3984 |
| 76 | Ga0068855_100837078 | 3300005563 | Bacteria | 976 |
| 77 | Ga0068855_100858428 | 3300005563 | Bacteria | 961 |
| 78 | Ga0070664_100024089 | 3300005564 | Bacteria | 5032 |
| 79 | Ga0070664_100043917 | 3300005564 | Bacteria | 3773 |
| 80 | Ga0068857_100139884 | 3300005577 | Bacteria | 2188 |
| 81 | Ga0068854_100460406 | 3300005578 | Bacteria | 1064 |
| 82 | Ga0068856_100000020 | 3300005614 | Bacteria | 146775 |
| 83 | Ga0068856_100135286 | 3300005614 | Bacteria | 2470 |
| 84 | Ga0068856_100168939 | 3300005614 | Bacteria | 2199 |
| 85 | Ga0070702_100551212 | 3300005615 | Bacteria | 856 |
| 86 | Ga0068852_100116503 | 3300005616 | Bacteria | 2438 |
| 87 | Ga0068852_100420229 | 3300005616 | Bacteria | 1319 |
| 88 | Ga0068852_100567177 | 3300005616 | Bacteria | 1137 |
| 89 | Ga0068859_100171388 | 3300005617 | Bacteria | 2251 |
| 90 | Ga0068864_100025488 | 3300005618 | Bacteria | 4981 |
| 91 | Ga0068866_10026261 | 3300005718 | Bacteria | 2748 |
| 92 | Ga0068861_100891841 | 3300005719 | Bacteria | 841 |
| 93 | Ga0068870_10485385 | 3300005840 | Bacteria | 821 |
| 94 | Ga0068863_100045728 | 3300005841 | Bacteria | 4154 |
| 95 | Ga0068858_100008078 | 3300005842 | Bacteria | 10133 |
| 96 | Ga0068860_100327827 | 3300005843 | Bacteria | 1503 |
| 97 | Ga0068862_100268560 | 3300005844 | Bacteria | 1559 |
| 98 | Ga0068862_100301425 | 3300005844 | Bacteria | 1474 |
| 99 | Ga0081455_10017926 | 3300005937 | Bacteria | 6766 |
| 100 | Ga0081455_10063868 | 3300005937 | Bacteria | 3087 |
| 101 | Ga0081455_10105008 | 3300005937 | Bacteria | 2259 |
| 102 | Ga0081538_10034813 | 3300005981 | Bacteria | 3321 |
| 103 | Ga0081540_1002690 | 3300005983 | Bacteria | 14454 |
| 104 | Ga0081540_1003654 | 3300005983 | Bacteria | 12058 |
| 105 | Ga0081540_1017195 | 3300005983 | Bacteria | 4485 |
| 106 | Ga0070717_10022005 | 3300006028 | Bacteria | 5031 |
| 107 | Ga0070717_10064475 | 3300006028 | Bacteria | 3043 |
| 108 | Ga0070717_10178883 | 3300006028 | Bacteria | 1848 |
| 109 | Ga0075365_10054530 | 3300006038 | Bacteria | 2651 |
| 110 | Ga0075365_10232908 | 3300006038 | Bacteria | 1293 |
| 111 | Ga0075363_100063020 | 3300006048 | Bacteria | 2000 |
| 112 | Ga0075364_10208643 | 3300006051 | Bacteria | 1325 |
| 113 | Ga0070715_10000961 | 3300006163 | Bacteria | 8038 |
| 114 | Ga0070716_100002442 | 3300006173 | Bacteria | 8562 |
| 115 | Ga0070712_100015939 | 3300006175 | Bacteria | 4847 |
| 116 | Ga0070712_100034659 | 3300006175 | Bacteria | 3422 |
| 117 | Ga0070712_100043566 | 3300006175 | Bacteria | 3090 |
| 118 | Ga0070712_100068339 | 3300006175 | Bacteria | 2531 |
| 119 | Ga0070712_100070488 | 3300006175 | Bacteria | 2498 |
| 120 | Ga0070712_100492850 | 3300006175 | Bacteria | 1026 |
| 121 | Ga0075362_10022802 | 3300006177 | Bacteria | 2641 |
| 122 | Ga0075367_10000988 | 3300006178 | Bacteria | 11650 |
| 123 | Ga0075369_10008785 | 3300006186 | Bacteria | 3903 |
| 124 | Ga0075366_10155752 | 3300006195 | Bacteria | 1384 |
| 125 | Ga0075366_10411529 | 3300006195 | Bacteria | 832 |
| 126 | Ga0075366_10483803 | 3300006195 | Bacteria | 765 |
| 127 | Ga0097621_100019101 | 3300006237 | Bacteria | 5255 |
| 128 | Ga0097621_100030570 | 3300006237 | Bacteria | 4265 |
| 129 | Ga0097621_100567523 | 3300006237 | Bacteria | 1034 |
| 130 | Ga0075370_10060519 | 3300006353 | Bacteria | 2157 |
| 131 | Ga0068871_100010894 | 3300006358 | Bacteria | 6656 |
| 132 | Ga0068871_100166449 | 3300006358 | Bacteria | 1887 |
| 133 | Ga0075428_100079146 | 3300006844 | Bacteria | 3587 |
| 134 | Ga0075434_100490088 | 3300006871 | Bacteria | 1250 |
| 135 | Ga0068865_100381974 | 3300006881 | Bacteria | 1149 |
| 136 | Ga0097620_100171379 | 3300006931 | Bacteria | 2251 |
| 137 | Ga0099824_1012798 | 3300006942 | Bacteria | 8977 |
| 138 | Ga0099794_10283726 | 3300007265 | Bacteria | 856 |
| 139 | Ga0105240_10008282 | 3300009093 | Bacteria | 14882 |
| 140 | Ga0105240_10143380 | 3300009093 | Bacteria | 2854 |
| 141 | Ga0105240_10238154 | 3300009093 | Bacteria | 2111 |
| 142 | Ga0105240_10273675 | 3300009093 | Bacteria | 1943 |
| 143 | Ga0105240_11362552 | 3300009093 | Bacteria | 747 |
| 144 | Ga0105245_10006619 | 3300009098 | Bacteria | 10177 |
| 145 | Ga0105245_10007619 | 3300009098 | Bacteria | 9480 |
| 146 | Ga0105245_10161198 | 3300009098 | Bacteria | 2128 |
| 147 | Ga0105245_10365153 | 3300009098 | Bacteria | 1434 |
| 148 | Ga0105247_10346942 | 3300009101 | Bacteria | 1043 |
| 149 | Ga0114129_10111337 | 3300009147 | Bacteria | 3777 |
| 150 | Ga0114129_10749936 | 3300009147 | Bacteria | 1250 |
| 151 | Ga0105241_10053828 | 3300009174 | Bacteria | 3079 |
| 152 | Ga0105241_10062670 | 3300009174 | Bacteria | 2867 |
| 153 | Ga0105241_10072568 | 3300009174 | Bacteria | 2676 |
| 154 | Ga0105241_10122821 | 3300009174 | Bacteria | 2093 |
| 155 | Ga0105242_10018122 | 3300009176 | Bacteria | 5500 |
| 156 | Ga0105242_10077188 | 3300009176 | Bacteria | 2779 |
| 157 | Ga0105242_10418766 | 3300009176 | Bacteria | 1255 |
| 158 | Ga0105242_10480797 | 3300009176 | Bacteria | 1177 |
| 159 | Ga0105248_10015680 | 3300009177 | Bacteria | 8351 |
| 160 | Ga0105248_10027920 | 3300009177 | Bacteria | 6284 |
| 161 | Ga0105248_10164724 | 3300009177 | Bacteria | 2499 |
| 162 | Ga0105248_10440910 | 3300009177 | Bacteria | 1467 |
| 163 | Ga0105237_10006673 | 3300009545 | Bacteria | 12756 |
| 164 | Ga0105237_10016711 | 3300009545 | Bacteria | 7618 |
| 165 | Ga0105237_10026248 | 3300009545 | Bacteria | 5953 |
| 166 | Ga0105237_11001220 | 3300009545 | Bacteria | 842 |
| 167 | Ga0105238_10005356 | 3300009551 | Bacteria | 12677 |
| 168 | Ga0105238_10157681 | 3300009551 | Bacteria | 2245 |
| 169 | Ga0105238_10246610 | 3300009551 | Bacteria | 1764 |
| 170 | Ga0105238_10288491 | 3300009551 | Bacteria | 1623 |
| 171 | Ga0105238_10889307 | 3300009551 | Bacteria | 909 |
| 172 | Ga0099796_10009831 | 3300010159 | Bacteria | 2605 |
| 173 | Ga0105239_10502132 | 3300010375 | Bacteria | 1379 |
| 174 | Ga0105246_10462649 | 3300011119 | Bacteria | 1069 |
| 175 | Ga0105246_10597859 | 3300011119 | Bacteria | 953 |
| 176 | Ga0105246_10716096 | 3300011119 | Bacteria | 879 |
| 177 | Ga0157371_10013955 | 3300013102 | Bacteria | 6084 |
| 178 | Ga0157370_10110323 | 3300013104 | Bacteria | 2572 |
| 179 | Ga0157370_10161675 | 3300013104 | Bacteria | 2083 |
| 180 | Ga0157369_10035175 | 3300013105 | Bacteria | 5494 |
| 181 | Ga0157369_10104822 | 3300013105 | Bacteria | 3011 |
| 182 | Ga0157369_10225065 | 3300013105 | Bacteria | 1963 |
| 183 | Ga0157369_10457316 | 3300013105 | Bacteria | 1322 |
| 184 | Ga0157369_10587395 | 3300013105 | Bacteria | 1150 |
| 185 | Ga0157374_10012098 | 3300013296 | Bacteria | 7494 |
| 186 | Ga0157378_10037040 | 3300013297 | Bacteria | 4319 |
| 187 | Ga0163162_10019668 | 3300013306 | Bacteria | 6628 |
| 188 | Ga0157372_10965973 | 3300013307 | Bacteria | 987 |
| 189 | Ga0157375_10015754 | 3300013308 | Bacteria | 6774 |
| 190 | Ga0157375_10031030 | 3300013308 | Bacteria | 5045 |
| 191 | Ga0157375_10034118 | 3300013308 | Bacteria | 4844 |
| 192 | Ga0163163_10047665 | 3300014325 | Bacteria | 4212 |
| 193 | Ga0163163_10490357 | 3300014325 | Bacteria | 1290 |
| 194 | Ga0157379_10005550 | 3300014968 | Bacteria | 10838 |
| 195 | Ga0157379_10015374 | 3300014968 | Bacteria | 6715 |
| 196 | Ga0157379_10090305 | 3300014968 | Bacteria | 2748 |
| 197 | Ga0157376_10073840 | 3300014969 | Bacteria | 2905 |
| 198 | Ga0206356_11553529 | 3300020070 | Bacteria | 1534 |
| 199 | Ga0206353_11806622 | 3300020082 | Bacteria | 1611 |
| 200 | Ga0213872_10034960 | 3300021361 | Bacteria | 2299 |
| 201 | Ga0213876_10057753 | 3300021384 | Bacteria | 2049 |
| 202 | Ga0213875_10056323 | 3300021388 | Bacteria | 1842 |
| 203 | Ga0209148_1000500 | 3300025254 | Bacteria | 39994 |
| 204 | Ga0209564_1019909 | 3300025295 | Bacteria | 2484 |
| 205 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 206 | Ga0209758_1001533 | 3300025297 | Bacteria | 26615 |
| 207 | Ga0209758_1004785 | 3300025297 | Bacteria | 10950 |
| 208 | Ga0209758_1007070 | 3300025297 | Bacteria | 7780 |
| 209 | Ga0207426_1000510 | 3300025302 | Bacteria | 56675 |
| 210 | Ga0209257_1001149 | 3300025304 | Bacteria | 33675 |
| 211 | Ga0207656_10045648 | 3300025321 | Bacteria | 1876 |
| 212 | Ga0207692_10008992 | 3300025898 | Bacteria | 4157 |
| 213 | Ga0207692_10094891 | 3300025898 | Bacteria | 1625 |
| 214 | Ga0207688_10059355 | 3300025901 | Bacteria | 2154 |
| 215 | Ga0207680_10219026 | 3300025903 | Bacteria | 1304 |
| 216 | Ga0207685_10016843 | 3300025905 | Bacteria | 2348 |
| 217 | Ga0207699_10002766 | 3300025906 | Bacteria | 8287 |
| 218 | Ga0207699_10034074 | 3300025906 | Bacteria | 2884 |
| 219 | Ga0207699_10040124 | 3300025906 | Bacteria | 2696 |
| 220 | Ga0207699_10297819 | 3300025906 | Bacteria | 1125 |
| 221 | Ga0207699_10354584 | 3300025906 | Bacteria | 1036 |
| 222 | Ga0207705_10463919 | 3300025909 | Bacteria | 983 |
| 223 | Ga0207707_10000950 | 3300025912 | Bacteria | 27902 |
| 224 | Ga0207707_10004626 | 3300025912 | Bacteria | 12087 |
| 225 | Ga0207707_10052762 | 3300025912 | Bacteria | 3539 |
| 226 | Ga0207707_10232394 | 3300025912 | Bacteria | 1604 |
| 227 | Ga0207707_10474556 | 3300025912 | Bacteria | 1069 |
| 228 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 229 | Ga0207695_10084653 | 3300025913 | Bacteria | 3201 |
| 230 | Ga0207695_10161968 | 3300025913 | Bacteria | 2168 |
| 231 | Ga0207671_10003142 | 3300025914 | Bacteria | 16765 |
| 232 | Ga0207693_10000068 | 3300025915 | Bacteria | 91004 |
| 233 | Ga0207693_10010099 | 3300025915 | Bacteria | 7669 |
| 234 | Ga0207693_10012278 | 3300025915 | Bacteria | 6922 |
| 235 | Ga0207693_10013028 | 3300025915 | Bacteria | 6710 |
| 236 | Ga0207693_10059172 | 3300025915 | Bacteria | 3001 |
| 237 | Ga0207693_10208751 | 3300025915 | Bacteria | 1535 |
| 238 | Ga0207663_10000098 | 3300025916 | Bacteria | 41171 |
| 239 | Ga0207663_10035907 | 3300025916 | Bacteria | 2978 |
| 240 | Ga0207663_10053162 | 3300025916 | Bacteria | 2529 |
| 241 | Ga0207660_10002564 | 3300025917 | Bacteria | 11938 |
| 242 | Ga0207660_10027186 | 3300025917 | Bacteria | 3902 |
| 243 | Ga0207660_10218329 | 3300025917 | Bacteria | 1495 |
| 244 | Ga0207657_10000658 | 3300025919 | Bacteria | 36762 |
| 245 | Ga0207657_10155771 | 3300025919 | Bacteria | 1858 |
| 246 | Ga0207649_10029765 | 3300025920 | Bacteria | 3228 |
| 247 | Ga0207652_10003470 | 3300025921 | Bacteria | 12999 |
| 248 | Ga0207652_10079037 | 3300025921 | Bacteria | 2873 |
| 249 | Ga0207652_10088350 | 3300025921 | Bacteria | 2719 |
| 250 | Ga0207652_10264824 | 3300025921 | Bacteria | 1550 |
| 251 | Ga0207652_10283302 | 3300025921 | Bacteria | 1495 |
| 252 | Ga0207652_10355623 | 3300025921 | Bacteria | 1322 |
| 253 | Ga0207652_10651436 | 3300025921 | Bacteria | 942 |
| 254 | Ga0207646_10210051 | 3300025922 | Bacteria | 1758 |
| 255 | Ga0207646_10599160 | 3300025922 | Bacteria | 989 |
| 256 | Ga0207694_10089008 | 3300025924 | Bacteria | 2434 |
| 257 | Ga0207694_10145180 | 3300025924 | Bacteria | 1910 |
| 258 | Ga0207694_10190212 | 3300025924 | Bacteria | 1667 |
| 259 | Ga0207687_10116864 | 3300025927 | Bacteria | 1989 |
| 260 | Ga0207687_10123341 | 3300025927 | Bacteria | 1941 |
| 261 | Ga0207687_10331011 | 3300025927 | Bacteria | 1235 |
| 262 | Ga0207700_10015748 | 3300025928 | Bacteria | 5000 |
| 263 | Ga0207700_10091132 | 3300025928 | Bacteria | 2407 |
| 264 | Ga0207700_10197106 | 3300025928 | Bacteria | 1695 |
| 265 | Ga0207700_10303626 | 3300025928 | Bacteria | 1379 |
| 266 | Ga0207700_10411601 | 3300025928 | Bacteria | 1186 |
| 267 | Ga0207700_10455503 | 3300025928 | Bacteria | 1128 |
| 268 | Ga0207664_10042775 | 3300025929 | Bacteria | 3539 |
| 269 | Ga0207664_10043417 | 3300025929 | Bacteria | 3516 |
| 270 | Ga0207664_10162299 | 3300025929 | Bacteria | 1907 |
| 271 | Ga0207690_10107114 | 3300025932 | Bacteria | 2007 |
| 272 | Ga0207706_10403102 | 3300025933 | Bacteria | 1186 |
| 273 | Ga0207709_10443739 | 3300025935 | Bacteria | 1001 |
| 274 | Ga0207704_10296267 | 3300025938 | Bacteria | 1237 |
| 275 | Ga0207665_10000355 | 3300025939 | Bacteria | 31763 |
| 276 | Ga0207665_10432670 | 3300025939 | Bacteria | 1007 |
| 277 | Ga0207711_10174186 | 3300025941 | Bacteria | 1954 |
| 278 | Ga0207711_10233979 | 3300025941 | Bacteria | 1683 |
| 279 | Ga0207711_10317721 | 3300025941 | Bacteria | 1438 |
| 280 | Ga0207689_10021146 | 3300025942 | Bacteria | 5470 |
| 281 | Ga0207661_10001747 | 3300025944 | Bacteria | 14871 |
| 282 | Ga0207661_10051941 | 3300025944 | Bacteria | 3273 |
| 283 | Ga0207661_10262245 | 3300025944 | Bacteria | 1539 |
| 284 | Ga0207661_10649613 | 3300025944 | Bacteria | 969 |
| 285 | Ga0207679_10036381 | 3300025945 | Bacteria | 3492 |
| 286 | Ga0207667_10215773 | 3300025949 | Bacteria | 1966 |
| 287 | Ga0207667_10296284 | 3300025949 | Bacteria | 1652 |
| 288 | Ga0207667_10682469 | 3300025949 | Bacteria | 1030 |
| 289 | Ga0207651_10370470 | 3300025960 | Bacteria | 1211 |
| 290 | Ga0207640_10139666 | 3300025981 | Bacteria | 1764 |
| 291 | Ga0207677_10020108 | 3300026023 | Bacteria | 4047 |
| 292 | Ga0207677_10372683 | 3300026023 | Bacteria | 1202 |
| 293 | Ga0207677_10727925 | 3300026023 | Bacteria | 882 |
| 294 | Ga0207703_10323706 | 3300026035 | Bacteria | 1412 |
| 295 | Ga0207639_10043047 | 3300026041 | Bacteria | 3387 |
| 296 | Ga0207639_10122518 | 3300026041 | Bacteria | 2138 |
| 297 | Ga0207639_10149674 | 3300026041 | Bacteria | 1954 |
| 298 | Ga0207639_10486835 | 3300026041 | Bacteria | 1125 |
| 299 | Ga0207678_10035639 | 3300026067 | Bacteria | 4332 |
| 300 | Ga0207678_10043159 | 3300026067 | Bacteria | 3903 |
| 301 | Ga0207678_10111029 | 3300026067 | Bacteria | 2339 |
| 302 | Ga0207678_10111451 | 3300026067 | Bacteria | 2334 |
| 303 | Ga0207702_10000126 | 3300026078 | Bacteria | 90550 |
| 304 | Ga0207641_10083530 | 3300026088 | Bacteria | 2778 |
| 305 | Ga0207641_10866328 | 3300026088 | Bacteria | 896 |
| 306 | Ga0207676_10190935 | 3300026095 | Unclassified | 1802 |
| 307 | Ga0207674_10129603 | 3300026116 | Bacteria | 2486 |
| 308 | Ga0207674_10261908 | 3300026116 | Bacteria | 1676 |
| 309 | Ga0207675_100438424 | 3300026118 | Bacteria | 1293 |
| 310 | Ga0207675_100495090 | 3300026118 | Bacteria | 1216 |
| 311 | Ga0207675_100802265 | 3300026118 | Bacteria | 955 |
| 312 | Ga0207683_10001340 | 3300026121 | Bacteria | 22231 |
| 313 | Ga0207683_10028473 | 3300026121 | Bacteria | 4830 |
| 314 | Ga0207683_10358569 | 3300026121 | Bacteria | 1339 |
| 315 | Ga0207698_10336335 | 3300026142 | Bacteria | 1420 |
| 316 | Ga0209389_1000185 | 3300027296 | Bacteria | 47184 |
| 317 | Ga0209589_1000036 | 3300027357 | Bacteria | 131278 |
| 318 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 319 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 320 | Ga0268266_10002394 | 3300028379 | Bacteria | 20226 |
| 321 | Ga0268266_10483755 | 3300028379 | Bacteria | 1180 |
| 322 | Ga0268266_10925741 | 3300028379 | Bacteria | 843 |
| 323 | Ga0268264_10027494 | 3300028381 | Bacteria | 4648 |
| 324 | Ga0307517_10000008 | 3300028786 | Bacteria | 243202 |
| 325 | Ga0307517_10228925 | 3300028786 | Bacteria | 1119 |
| 326 | Ga0307515_10045960 | 3300028794 | Bacteria | 6689 |
| 327 | Ga0265330_10045567 | 3300031235 | Bacteria | 1934 |
| 328 | Ga0265330_10088362 | 3300031235 | Bacteria | 1332 |
| 329 | Ga0265325_10000044 | 3300031241 | Bacteria | 89107 |
| 330 | Ga0265325_10011538 | 3300031241 | Bacteria | 5074 |
| 331 | Ga0265325_10045607 | 3300031241 | Bacteria | 2277 |
| 332 | Ga0265339_10019022 | 3300031249 | Bacteria | 4038 |
| 333 | Ga0265339_10057328 | 3300031249 | Bacteria | 2107 |
| 334 | Ga0265339_10141434 | 3300031249 | Bacteria | 1224 |
| 335 | Ga0265339_10180991 | 3300031249 | Bacteria | 1050 |
| 336 | Ga0265339_10207939 | 3300031249 | Bacteria | 963 |
| 337 | Ga0265316_10042156 | 3300031344 | Bacteria | 3649 |
| 338 | Ga0307513_10029676 | 3300031456 | Bacteria | 6228 |
| 339 | Ga0307513_10418380 | 3300031456 | Bacteria | 1071 |
| 340 | Ga0307509_10180532 | 3300031507 | Bacteria | 1976 |
| 341 | Ga0307408_100449154 | 3300031548 | Bacteria | 1118 |
| 342 | Ga0265313_10009939 | 3300031595 | Bacteria | 6106 |
| 343 | Ga0307508_10229059 | 3300031616 | Bacteria | 1457 |
| 344 | Ga0265314_10008091 | 3300031711 | Bacteria | 9048 |
| 345 | Ga0265314_10050093 | 3300031711 | Bacteria | 2919 |
| 346 | Ga0307516_10077115 | 3300031730 | Bacteria | 3182 |
| 347 | Ga0307406_10332610 | 3300031901 | Bacteria | 1180 |
| 348 | Ga0307406_10517961 | 3300031901 | Bacteria | 970 |
| 349 | Ga0307409_100577749 | 3300031995 | Bacteria | 1107 |
| 350 | Ga0307416_100271276 | 3300032002 | Bacteria | 1666 |
| 351 | Ga0307415_100069687 | 3300032126 | Bacteria | 2467 |
| 352 | Ga0316583_10000267 | 3300032133 | Bacteria | 14347 |
| 353 | Ga0307510_10001061 | 3300033180 | Bacteria | 29217 |
| 354 | Ga0307510_10018144 | 3300033180 | Bacteria | 8285 |
| 355 | Ga0307510_10125011 | 3300033180 | Bacteria | 2264 |
| 356 | Ga0373926_0042232 | 3300035083 | Bacteria | 1630 |
| 357 | Ga0373923_0135165 | 3300035111 | Bacteria | 1111 |
| 358 | Ga0373939_0000811 | 3300035114 | Bacteria | 7714 |
| 359 | Ga0373953_0005595 | 3300035117 | Bacteria | 4090 |
| 360 | Ga0373953_0048107 | 3300035117 | Bacteria | 1717 |
| 361 | Ga0373954_0013096 | 3300035118 | Bacteria | 3693 |
| 362 | Ga0373956_0015090 | 3300035119 | Bacteria | 3231 |
| 363 | Ga0373956_0089214 | 3300035119 | Bacteria | 1421 |
| 364 | Ga0373957_0022135 | 3300035120 | Bacteria | 2262 |
| 365 | Ga0373943_0028143 | 3300035170 | Bacteria | 2647 |
| 366 | Ga0373955_0009673 | 3300035172 | Bacteria | 4526 |
| 367 | Ga0373955_0015065 | 3300035172 | Bacteria | 3777 |
| 368 | Ga0373955_0108075 | 3300035172 | Bacteria | 1606 |
| 369 | Ga0316574_0209557 | 3300035398 | Bacteria | 1251 |
| 370 | Ga0373924_0021198 | 3300035410 | Bacteria | 2534 |
| 371 | Ga0373935_0044130 | 3300035692 | Bacteria | 2808 |
| 372 | Ga0373927_0016784 | 3300035695 | Bacteria | 4829 |
| 373 | Ga0373927_0027467 | 3300035695 | Bacteria | 3715 |
| 374 | Ga0373933_0000199 | 3300035724 | Bacteria | 39593 |
| 375 | Ga0373933_0012562 | 3300035724 | Bacteria | 4680 |
| 376 | Ga0373947_0047946 | 3300035725 | Bacteria | 2562 |
| 377 | Ga0373937_0003498 | 3300036401 | Bacteria | 13203 |
| 378 | Ga0373925_0000767 | 3300037068 | Bacteria | 29498 |
| 379 | Ga0373925_0157538 | 3300037068 | Bacteria | 1787 |
| 380 | Ga0373925_0263518 | 3300037068 | Bacteria | 1385 |
| 381 | Ga0373925_0265765 | 3300037068 | Bacteria | 1379 |
| 382 | Ga0373925_0442365 | 3300037068 | Bacteria | 1064 |
| 383 | Ga0395900_0044295 | 3300037418 | Bacteria | 4585 |
| 384 | Ga0395900_0288678 | 3300037418 | Bacteria | 1630 |
| 385 | Ga0395900_0291201 | 3300037418 | Bacteria | 1621 |
| 386 | Ga0395898_0010583 | 3300037466 | Bacteria | 9632 |
| 387 | Ga0395898_0185548 | 3300037466 | Bacteria | 1987 |
| 388 | Ga0395898_0436159 | 3300037466 | Bacteria | 1248 |
| 389 | Ga0395905_0040677 | 3300037471 | Bacteria | 4361 |
| 390 | Ga0395905_0136213 | 3300037471 | Bacteria | 2310 |
| 391 | Ga0436364_0397486 | 3300037853 | Bacteria | 1508 |
| 392 | Ga0436364_1535696 | 3300037853 | Bacteria | 2655 |
| 393 | Ga0395901_0011779 | 3300038443 | Bacteria | 8868 |
| 394 | Ga0395901_0123610 | 3300038443 | Bacteria | 2719 |
| 395 | Ga0395901_0182755 | 3300038443 | Bacteria | 2199 |
| 396 | Ga0436365_0042699 | 3300039437 | Bacteria | 1950 |
| 397 | Ga0436360_1256664 | 3300039438 | Bacteria | 1900 |
| 398 | Ga0436361_0532883 | 3300039447 | Bacteria | 1128 |
| 399 | Ga0436361_0833650 | 3300039447 | Bacteria | 10674 |
| 400 | Ga0436363_0842295 | 3300039450 | Bacteria | 928 |
| 401 | Ga0439441_022090 | 3300042001 | Bacteria | 1180 |
| 402 | Ga0466963_0038369 | 3300044694 | Bacteria | 3131 |
| 403 | Ga0466963_0132734 | 3300044694 | Bacteria | 1721 |
| 404 | Ga0466963_0169940 | 3300044694 | Bacteria | 1519 |
| 405 | Ga0466964_0092261 | 3300044706 | Bacteria | 1320 |
| 406 | Ga0466971_0248365 | 3300044719 | Bacteria | 847 |
| 407 | Ga0466957_0005921 | 3300044842 | Bacteria | 6888 |
| 408 | Ga0466957_0067739 | 3300044842 | Bacteria | 2203 |
| 409 | Ga0466959_0030990 | 3300045049 | Bacteria | 3959 |
| 410 | Ga0451576_1082748 | 3300045051 | Bacteria | 839 |
| 411 | Ga0466958_0055054 | 3300045836 | Bacteria | 2413 |
| 412 | Ga0466958_0131752 | 3300045836 | Bacteria | 1570 |
| 413 | Ga0466967_0066574 | 3300045976 | Bacteria | 3210 |
| 414 | Ga0466967_0863177 | 3300045976 | Bacteria | 899 |
| 415 | Ga0495617_137550 | 3300046452 | Bacteria | 781 |
| 416 | Ga0495592_0003279 | 3300046454 | Bacteria | 11596 |
| 417 | Ga0495603_0004410 | 3300046455 | Bacteria | 8389 |
| 418 | Ga0495603_0006388 | 3300046455 | Bacteria | 7051 |
| 419 | Ga0495603_0044718 | 3300046455 | Bacteria | 2642 |
| 420 | Ga0495603_0083749 | 3300046455 | Bacteria | 1868 |
| 421 | Ga0495629_0192979 | 3300046459 | Bacteria | 1409 |
| 422 | Ga0495641_0022963 | 3300046461 | Bacteria | 3110 |
| 423 | Ga0495641_0130608 | 3300046461 | Bacteria | 1121 |
| 424 | Ga0495651_0055037 | 3300046462 | Bacteria | 3057 |
| 425 | Ga0495651_0064165 | 3300046462 | Bacteria | 2807 |
| 426 | Ga0495653_0141442 | 3300046463 | Bacteria | 1692 |
| 427 | Ga0495580_0001449 | 3300046472 | Bacteria | 20800 |
| 428 | Ga0495580_0113921 | 3300046472 | Bacteria | 1878 |
| 429 | Ga0495580_0133464 | 3300046472 | Bacteria | 1721 |
| 430 | Ga0495582_0120766 | 3300046473 | Bacteria | 1476 |
| 431 | Ga0495605_0139756 | 3300046474 | Bacteria | 1087 |
| 432 | Ga0495639_0044746 | 3300046475 | Bacteria | 2001 |
| 433 | Ga0495662_0133154 | 3300046476 | Bacteria | 1222 |
| 434 | Ga0495664_0006747 | 3300046477 | Bacteria | 6348 |
| 435 | Ga0495664_0019399 | 3300046477 | Bacteria | 3909 |
| 436 | Ga0495664_0045522 | 3300046477 | Bacteria | 2602 |
| 437 | Ga0495585_0053425 | 3300046492 | Bacteria | 2236 |
| 438 | Ga0495594_0066599 | 3300046499 | Bacteria | 1998 |
| 439 | Ga0495594_0217607 | 3300046499 | Bacteria | 1089 |
| 440 | Ga0495606_0001179 | 3300046507 | Bacteria | 36884 |
| 441 | Ga0495606_0025719 | 3300046507 | Bacteria | 4209 |
| 442 | Ga0495608_0042556 | 3300046511 | Bacteria | 3037 |
| 443 | Ga0495608_0121182 | 3300046511 | Bacteria | 1677 |
| 444 | Ga0495618_0005389 | 3300046514 | Bacteria | 7805 |
| 445 | Ga0495628_0015673 | 3300046516 | Bacteria | 6328 |
| 446 | Ga0495628_0041443 | 3300046516 | Bacteria | 3675 |
| 447 | Ga0495628_0274934 | 3300046516 | Bacteria | 1252 |
| 448 | Ga0495628_0410575 | 3300046516 | Bacteria | 988 |
| 449 | Ga0495630_0256501 | 3300046517 | Bacteria | 1336 |
| 450 | Ga0495630_0402568 | 3300046517 | Bacteria | 1049 |
| 451 | Ga0495632_0062420 | 3300046519 | Bacteria | 1806 |
| 452 | Ga0495637_0113053 | 3300046520 | Bacteria | 1051 |
| 453 | Ga0495666_0042687 | 3300046526 | Bacteria | 2192 |
| 454 | Ga0495666_0051380 | 3300046526 | Bacteria | 1980 |
| 455 | Ga0495652_0002979 | 3300046529 | Bacteria | 17017 |
| 456 | Ga0495652_0083205 | 3300046529 | Bacteria | 2635 |
| 457 | Ga0495665_0038334 | 3300046531 | Bacteria | 2555 |
| 458 | Ga0495640_0011617 | 3300046533 | Bacteria | 6764 |
| 459 | Ga0495640_0027667 | 3300046533 | Bacteria | 4087 |
| 460 | Ga0495640_0103913 | 3300046533 | Bacteria | 1862 |
| 461 | Ga0495640_0187589 | 3300046533 | Bacteria | 1315 |
| 462 | Ga0495587_0011641 | 3300046536 | Bacteria | 5569 |
| 463 | Ga0495598_0004011 | 3300046537 | Bacteria | 3162 |
| 464 | Ga0495645_0001025 | 3300046543 | Bacteria | 19015 |
| 465 | Ga0495645_0001772 | 3300046543 | Bacteria | 14693 |
| 466 | Ga0495622_0041218 | 3300046557 | Bacteria | 2147 |
| 467 | Ga0495622_0068255 | 3300046557 | Bacteria | 1642 |
| 468 | Ga0495667_0001273 | 3300046559 | Bacteria | 16514 |
| 469 | Ga0495667_0033238 | 3300046559 | Bacteria | 3452 |
| 470 | Ga0495667_0069109 | 3300046559 | Bacteria | 2306 |
| 471 | Ga0495656_0131030 | 3300046615 | Bacteria | 1193 |
| 472 | Ga0495668_0261772 | 3300046616 | Bacteria | 947 |
| 473 | Ga0495634_0053454 | 3300046642 | Bacteria | 2705 |
| 474 | Ga0495625_0190042 | 3300046660 | Bacteria | 1361 |
| 475 | Ga0495635_0114378 | 3300046663 | Bacteria | 1842 |
| 476 | Ga0495659_0019059 | 3300046664 | Bacteria | 2293 |
| 477 | Ga0495588_0006176 | 3300046674 | Bacteria | 5381 |
| 478 | Ga0495588_0009960 | 3300046674 | Bacteria | 4406 |
| 479 | Ga0495657_0067361 | 3300046675 | Bacteria | 2350 |
| 480 | Ga0495599_0007196 | 3300046678 | Bacteria | 6741 |
| 481 | Ga0495623_0013803 | 3300046679 | Bacteria | 5237 |
| 482 | Ga0495623_0069959 | 3300046679 | Bacteria | 2186 |
| 483 | Ga0495646_0067005 | 3300046680 | Bacteria | 2123 |
| 484 | Ga0495647_0029905 | 3300046681 | Bacteria | 2017 |
| 485 | Ga0495647_0059378 | 3300046681 | Bacteria | 1506 |
| 486 | Ga0495658_0171470 | 3300046683 | Bacteria | 1343 |
| 487 | Ga0495658_0303068 | 3300046683 | Bacteria | 1011 |
| 488 | Ga0495624_0020197 | 3300046690 | Bacteria | 4436 |
| 489 | Ga0495624_0137708 | 3300046690 | Bacteria | 1496 |
| 490 | Ga0495670_0303218 | 3300046691 | Bacteria | 856 |
| 491 | Ga0495600_0003839 | 3300046809 | Bacteria | 8910 |
| 492 | Ga0495600_0049859 | 3300046809 | Bacteria | 2731 |
| 493 | Ga0495604_0002660 | 3300047317 | Bacteria | 14340 |
| 494 | Ga0495604_0010726 | 3300047317 | Bacteria | 7272 |
| 495 | Ga0495674_0013103 | 3300047319 | Bacteria | 7798 |
| 496 | Ga0495674_0014178 | 3300047319 | Bacteria | 7466 |
| 497 | Ga0495674_0048940 | 3300047319 | Bacteria | 3738 |
| 498 | Ga0495674_0072773 | 3300047319 | Bacteria | 2964 |
| 499 | Ga0495674_0128534 | 3300047319 | Bacteria | 2136 |
| 500 | Ga0495672_0039595 | 3300047320 | Bacteria | 2865 |
| 501 | Ga0495676_0072253 | 3300047321 | Bacteria | 2650 |
| 502 | Ga0495676_0084983 | 3300047321 | Bacteria | 2385 |
| 503 | Ga0495676_0161515 | 3300047321 | Bacteria | 1585 |
| 504 | Ga0495680_0009088 | 3300047322 | Bacteria | 8971 |
| 505 | Ga0495680_0044688 | 3300047322 | Bacteria | 3502 |
| 506 | Ga0495680_0284136 | 3300047322 | Bacteria | 1165 |
| 507 | Ga0495683_0246945 | 3300047323 | Bacteria | 785 |
| 508 | Ga0495675_0000984 | 3300047444 | Bacteria | 17289 |
| 509 | Ga0495675_0198151 | 3300047444 | Bacteria | 1223 |
| 510 | Ga0495681_0132100 | 3300047470 | Bacteria | 1062 |
| 511 | Ga0495684_0051684 | 3300047471 | Bacteria | 3136 |
| 512 | Ga0495684_0103345 | 3300047471 | Bacteria | 2154 |
| 513 | Ga0495686_0076873 | 3300047472 | Bacteria | 2045 |
| 514 | Ga0495593_0064886 | 3300047673 | Bacteria | 1905 |
| 515 | Ga0495602_0000726 | 3300048088 | Bacteria | 31111 |
| 516 | Ga0495614_0050196 | 3300048089 | Bacteria | 1787 |
| 517 | Ga0495626_0150224 | 3300048091 | Bacteria | 983 |
| 518 | Ga0496100_0006817 | 3300048903 | Bacteria | 6260 |
| 519 | Ga0496100_0087309 | 3300048903 | Bacteria | 2120 |
| 520 | Ga0496101_0000213 | 3300048904 | Bacteria | 43662 |
| 521 | Ga0496101_0020482 | 3300048904 | Bacteria | 4529 |
| 522 | Ga0496101_0237976 | 3300048904 | Bacteria | 1416 |
| 523 | Ga0496101_0257105 | 3300048904 | Bacteria | 1361 |
| 524 | Ga0496101_0275356 | 3300048904 | Bacteria | 1314 |
| 525 | Ga0496102_0030253 | 3300048905 | Bacteria | 4845 |
| 526 | Ga0496102_0107202 | 3300048905 | Bacteria | 2601 |
| 527 | Ga0496102_0157581 | 3300048905 | Bacteria | 2135 |
| 528 | Ga0496102_0179875 | 3300048905 | Bacteria | 1992 |
| 529 | Ga0496103_0000323 | 3300048906 | Bacteria | 43761 |
| 530 | Ga0496103_0045764 | 3300048906 | Bacteria | 2700 |
| 531 | Ga0496103_0226854 | 3300048906 | Bacteria | 1201 |
| 532 | Ga0496103_0294408 | 3300048906 | Bacteria | 1044 |
| 533 | Ga0496104_0000580 | 3300048907 | Bacteria | 31194 |
| 534 | Ga0496104_0002456 | 3300048907 | Bacteria | 15968 |
| 535 | Ga0496104_0069164 | 3300048907 | Bacteria | 3355 |
| 536 | Ga0496104_0109269 | 3300048907 | Bacteria | 2650 |
| 537 | Ga0496104_0118307 | 3300048907 | Bacteria | 2543 |
| 538 | Ga0496104_0205595 | 3300048907 | Bacteria | 1881 |
| 539 | Ga0496104_0916199 | 3300048907 | Bacteria | 781 |
| 540 | Ga0496105_0000402 | 3300048908 | Bacteria | 28437 |
| 541 | Ga0496105_0005338 | 3300048908 | Bacteria | 9737 |
| 542 | Ga0496105_0006042 | 3300048908 | Bacteria | 9260 |
| 543 | Ga0496105_0019704 | 3300048908 | Bacteria | 5442 |
| 544 | Ga0496105_0034625 | 3300048908 | Bacteria | 4154 |
| 545 | Ga0496106_0002551 | 3300048909 | Bacteria | 13535 |
| 546 | Ga0496106_0019968 | 3300048909 | Bacteria | 4969 |
| 547 | Ga0496106_0673926 | 3300048909 | Bacteria | 825 |
| 548 | Ga0496107_0005110 | 3300048910 | Bacteria | 8949 |
| 549 | Ga0496107_0007348 | 3300048910 | Bacteria | 7597 |
| 550 | Ga0496107_0011880 | 3300048910 | Bacteria | 6083 |
| 551 | Ga0496108_0007691 | 3300048911 | Bacteria | 8729 |
| 552 | Ga0496108_0018148 | 3300048911 | Bacteria | 5758 |
| 553 | Ga0496108_0018223 | 3300048911 | Bacteria | 5748 |
| 554 | Ga0496108_0099899 | 3300048911 | Bacteria | 2474 |
| 555 | Ga0496109_0010098 | 3300048912 | Bacteria | 8054 |
| 556 | Ga0496109_0030334 | 3300048912 | Bacteria | 4847 |
| 557 | Ga0496109_0188433 | 3300048912 | Bacteria | 1938 |
| 558 | Ga0496109_0480397 | 3300048912 | Bacteria | 1173 |
| 559 | Ga0496110_0023813 | 3300048913 | Bacteria | 5211 |
| 560 | Ga0496110_0067437 | 3300048913 | Bacteria | 3166 |
| 561 | Ga0496110_0232617 | 3300048913 | Bacteria | 1676 |
| 562 | Ga0496110_0634889 | 3300048913 | Bacteria | 967 |
| 563 | Ga0496111_0000449 | 3300048914 | Bacteria | 20923 |
| 564 | Ga0496111_0014244 | 3300048914 | Bacteria | 5427 |
| 565 | Ga0496112_0034239 | 3300048915 | Bacteria | 4941 |
| 566 | Ga0496112_0075363 | 3300048915 | Bacteria | 3336 |
| 567 | Ga0496113_0000528 | 3300048916 | Bacteria | 18859 |
| 568 | Ga0496113_0036976 | 3300048916 | Bacteria | 3580 |
| 569 | Ga0496113_0288256 | 3300048916 | Bacteria | 1313 |
| 570 | Ga0496113_0344749 | 3300048916 | Bacteria | 1195 |
| 571 | Ga0496114_0057383 | 3300048917 | Bacteria | 3250 |
| 572 | Ga0496114_0094109 | 3300048917 | Bacteria | 2548 |
| 573 | Ga0496114_0170210 | 3300048917 | Bacteria | 1898 |
| 574 | Ga0496114_0261912 | 3300048917 | Bacteria | 1522 |
| 575 | Ga0496114_0387221 | 3300048917 | Bacteria | 1238 |
| 576 | Ga0496115_0006273 | 3300048918 | Bacteria | 8697 |
| 577 | Ga0496115_0027561 | 3300048918 | Bacteria | 4445 |
| 578 | Ga0496115_0095967 | 3300048918 | Bacteria | 2427 |
| 579 | Ga0496115_0165195 | 3300048918 | Bacteria | 1831 |
| 580 | Ga0496115_0261882 | 3300048918 | Bacteria | 1422 |
| 581 | Ga0496115_0354614 | 3300048918 | Bacteria | 1196 |
| 582 | Ga0496116_0000691 | 3300048919 | Bacteria | 43800 |
| 583 | Ga0496116_0017742 | 3300048919 | Bacteria | 5514 |
| 584 | Ga0496117_0000018 | 3300048920 | Bacteria | 479613 |
| 585 | Ga0496117_0040858 | 3300048920 | Bacteria | 3406 |
| 586 | Ga0496118_0000013 | 3300048921 | Bacteria | 574008 |
| 587 | Ga0496118_0041838 | 3300048921 | Bacteria | 3622 |
| 588 | Ga0496118_0347342 | 3300048921 | Bacteria | 792 |
| 589 | Ga0496119_0035537 | 3300048922 | Bacteria | 3263 |
| 590 | Ga0496121_0014546 | 3300048924 | Bacteria | 8342 |
| 591 | Ga0496121_0224248 | 3300048924 | Bacteria | 1321 |
| 592 | Ga0496121_0313416 | 3300048924 | Bacteria | 1059 |
| 593 | Ga0496124_0150774 | 3300048927 | Bacteria | 1824 |
| 594 | Ga0496125_0203754 | 3300048928 | Bacteria | 1292 |
| 595 | Ga0496126_0000902 | 3300048929 | Bacteria | 51705 |
| 596 | Ga0496126_0001122 | 3300048929 | Bacteria | 44809 |
| 597 | Ga0496126_0015735 | 3300048929 | Bacteria | 7601 |
| 598 | Ga0496126_0048493 | 3300048929 | Bacteria | 3881 |
| 599 | Ga0496126_0097147 | 3300048929 | Bacteria | 2582 |
| 600 | Ga0496126_0129917 | 3300048929 | Bacteria | 2177 |
| 601 | Ga0496126_0482171 | 3300048929 | Bacteria | 993 |
| 602 | Ga0501031_0035285 | 3300049568 | Bacteria | 3262 |
| 603 | Ga0501032_0140627 | 3300049569 | Bacteria | 1589 |
| 604 | Ga0501032_0190204 | 3300049569 | Bacteria | 1342 |
| 605 | Ga0501033_0076639 | 3300049570 | Bacteria | 2454 |
| 606 | Ga0501034_0190459 | 3300049571 | Bacteria | 2013 |
| 607 | Ga0501034_0423571 | 3300049571 | Bacteria | 1252 |
| 608 | Ga0501036_0116806 | 3300049572 | Bacteria | 2253 |
| 609 | Ga0501037_0369219 | 3300049573 | Bacteria | 987 |
| 610 | Ga0501038_0037203 | 3300049574 | Bacteria | 4268 |
| 611 | Ga0501039_0184272 | 3300049575 | Bacteria | 1642 |
| 612 | Ga0501039_0209369 | 3300049575 | Bacteria | 1533 |
| 613 | Ga0501043_0154376 | 3300049579 | Bacteria | 1796 |
| 614 | Ga0501043_0416932 | 3300049579 | Bacteria | 1013 |
| 615 | Ga0501046_0615463 | 3300049580 | Bacteria | 770 |
| 616 | Ga0501047_0098128 | 3300049581 | Bacteria | 2808 |
| 617 | Ga0501047_0314286 | 3300049581 | Bacteria | 1407 |
| 618 | Ga0501048_0365352 | 3300049582 | Bacteria | 1030 |
| 619 | Ga0501067_0298735 | 3300049583 | Bacteria | 896 |
| 620 | Ga0501070_0005092 | 3300049586 | Bacteria | 11201 |
| 621 | Ga0501070_0101042 | 3300049586 | Bacteria | 2385 |
| 622 | Ga0501073_0057668 | 3300049589 | Bacteria | 2714 |
| 623 | Ga0501073_0084887 | 3300049589 | Bacteria | 2203 |
| 624 | Ga0501074_0008292 | 3300049590 | Bacteria | 7535 |
| 625 | Ga0501074_0012164 | 3300049590 | Bacteria | 6256 |
| 626 | Ga0501079_0256190 | 3300049741 | Bacteria | 1368 |
| 627 | Ga0501044_0080499 | 3300049823 | Bacteria | 3299 |
| 628 | Ga0501044_0093205 | 3300049823 | Bacteria | 3037 |
| 629 | Ga0501044_0132475 | 3300049823 | Bacteria | 2486 |
| 630 | nmdc:mga03683_247809_c1 | 3300050489 | Bacteria | 827 |
| 631 | nmdc:mga03n38_20431_c1 | 3300050490 | Bacteria | 2649 |
| 632 | nmdc:mga03n38_26265_c1 | 3300050490 | Bacteria | 2403 |
| 633 | nmdc:mga00v17_179291_c1 | 3300050491 | Bacteria | 1367 |
| 634 | nmdc:mga00v17_278130_c1 | 3300050491 | Bacteria | 1086 |
| 635 | nmdc:mga0yw44_215299_c1 | 3300050492 | Bacteria | 1272 |
| 636 | nmdc:mga0yw44_79637_c1 | 3300050492 | Bacteria | 2050 |
| 637 | nmdc:mga0k408_162592_c1 | 3300050493 | Bacteria | 1330 |
| 638 | nmdc:mga0k408_215548_c1 | 3300050493 | Bacteria | 1146 |
| 639 | nmdc:mga06z11_59313_c1 | 3300050494 | Bacteria | 1989 |
| 640 | nmdc:mga07m45_13999_c1 | 3300050496 | Bacteria | 4265 |
| 641 | nmdc:mga07m45_343835_c1 | 3300050496 | Bacteria | 867 |
| 642 | nmdc:mga05p37_141849_c1 | 3300050507 | Bacteria | 2943 |
| 643 | nmdc:mga08y16_307608_c1 | 3300050511 | Bacteria | 1632 |
| 644 | nmdc:mga0sz30_191847_c1 | 3300050516 | Bacteria | 907 |
| 645 | nmdc:mga0sz30_238604_c1 | 3300050516 | Bacteria | 809 |
| 646 | Ga0495601_0000232 | 3300053077 | Bacteria | 29854 |
| 647 | Ga0495601_0004312 | 3300053077 | Bacteria | 8215 |
| 648 | Ga0495601_0014166 | 3300053077 | Bacteria | 4804 |
| 649 | Ga0495601_0330339 | 3300053077 | Bacteria | 992 |
| 650 | Ga0495612_0000608 | 3300053078 | Bacteria | 14397 |
| 651 | Ga0495612_0008328 | 3300053078 | Bacteria | 4208 |
| 652 | Ga0495612_0064474 | 3300053078 | Bacteria | 1520 |
| 653 | Ga0500635_0008149 | 3300053080 | Bacteria | 2866 |
| 654 | Ga0500635_0067466 | 3300053080 | Bacteria | 1262 |
| 655 | Ga0500635_0116019 | 3300053080 | Bacteria | 998 |
| 656 | Ga0495595_0000240 | 3300053084 | Bacteria | 21669 |
| 657 | Ga0495595_0000284 | 3300053084 | Bacteria | 19932 |
| 658 | Ga0495619_0000145 | 3300053085 | Bacteria | 52248 |
| 659 | Ga0495619_0001165 | 3300053085 | Bacteria | 17262 |
| 660 | Ga0495619_0001565 | 3300053085 | Bacteria | 15043 |
| 661 | Ga0495619_0028070 | 3300053085 | Bacteria | 3629 |
| 662 | Ga0500578_0023708 | 3300053086 | Bacteria | 3939 |
| 663 | Ga0500578_0148732 | 3300053086 | Bacteria | 1460 |
| 664 | Ga0500644_0119011 | 3300053088 | Bacteria | 1027 |
| 665 | Ga0500647_0039154 | 3300053091 | Bacteria | 2272 |
| 666 | Ga0500583_0036800 | 3300053092 | Bacteria | 2194 |
| 667 | Ga0500566_0000006 | 3300053094 | Bacteria | 153632 |
| 668 | Ga0500640_000036 | 3300053095 | Bacteria | 20472 |
| 669 | Ga0500641_0131994 | 3300053096 | Bacteria | 1078 |
| 670 | Ga0500554_009687 | 3300053102 | Bacteria | 2317 |
| 671 | Ga0500555_004027 | 3300053103 | Bacteria | 4175 |
| 672 | Ga0500557_000052 | 3300053105 | Bacteria | 50636 |
| 673 | Ga0500562_020239 | 3300053108 | Bacteria | 1727 |
| 674 | Ga0500572_005599 | 3300053111 | Bacteria | 2852 |
| 675 | Ga0500572_036126 | 3300053111 | Bacteria | 1409 |
| 676 | Ga0500593_012965 | 3300053117 | Bacteria | 3548 |
| 677 | Ga0500607_040291 | 3300053121 | Bacteria | 2532 |
| 678 | Ga0500608_021487 | 3300053122 | Bacteria | 2983 |
| 679 | Ga0500608_078010 | 3300053122 | Bacteria | 1567 |
| 680 | Ga0500614_000846 | 3300053123 | Bacteria | 7731 |
| 681 | Ga0500642_0000468 | 3300053130 | Bacteria | 12589 |
| 682 | Ga0500642_0104047 | 3300053130 | Bacteria | 1322 |
| 683 | Ga0500655_022213 | 3300053133 | Bacteria | 1193 |
| 684 | Ga0500658_0051537 | 3300053134 | Bacteria | 1683 |
| 685 | Ga0500658_0089405 | 3300053134 | Bacteria | 1329 |
| 686 | Ga0500559_0023353 | 3300053136 | Bacteria | 2625 |
| 687 | Ga0500559_0029799 | 3300053136 | Bacteria | 2338 |
| 688 | Ga0500585_156795 | 3300053144 | Bacteria | 790 |
| 689 | Ga0500590_057832 | 3300053148 | Bacteria | 1955 |
| 690 | Ga0500603_000195 | 3300053150 | Bacteria | 15888 |
| 691 | Ga0500603_002409 | 3300053150 | Bacteria | 4106 |
| 692 | Ga0500604_0109479 | 3300053151 | Bacteria | 917 |
| 693 | Ga0500619_038193 | 3300053154 | Bacteria | 1503 |
| 694 | Ga0500620_001550 | 3300053155 | Bacteria | 4302 |
| 695 | Ga0500630_001646 | 3300053159 | Bacteria | 10694 |
| 696 | Ga0500638_026391 | 3300053162 | Bacteria | 2783 |
| 697 | Ga0500639_000170 | 3300053163 | Bacteria | 31566 |
| 698 | Ga0500639_051091 | 3300053163 | Bacteria | 2152 |
| 699 | Ga0500636_0001217 | 3300053177 | Bacteria | 13893 |
| 700 | Ga0500637_0012756 | 3300053178 | Bacteria | 4387 |
| 701 | Ga0500637_0038627 | 3300053178 | Bacteria | 2691 |
| 702 | Ga0500625_038855 | 3300053729 | Bacteria | 2245 |
| 703 | Ga0500645_074604 | 3300053730 | Bacteria | 972 |
| 704 | Ga0500601_003622 | 3300053737 | Bacteria | 1677 |
| 705 | Ga0466962_0044607 | 3300061719 | Bacteria | 2121 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10014203 | Ga0070709_100142033 | 189 |
| 2 | 3300025906 | Ga0207699_10034074 | Ga0207699_100340743 | 189 |
| 3 | 3300048929 | Ga0496126_0015735 | Ga0496126_0015735_5333_6094 | 189 |
| 4 | iso_pu_bacteria | 8016583857 | 8016593237 | 191 |
| 5 | 3300044694 | Ga0466963_0169940 | Ga0466963_0169940_696_1487 | 192 |
| 6 | 3300005290 | Ga0065712_10016912 | Ga0065712_100169123 | 193 |
| 7 | 3300037068 | Ga0373925_0000767 | Ga0373925_0000767_8291_9022 | 193 |
| 8 | 3300005329 | Ga0070683_100575298 | Ga0070683_1005752982 | 194 |
| 9 | 3300005436 | Ga0070713_100464464 | Ga0070713_1004644641 | 194 |
| 10 | 3300005458 | Ga0070681_10622008 | Ga0070681_106220081 | 194 |
| 11 | 3300025912 | Ga0207707_10474556 | Ga0207707_104745561 | 194 |
| 12 | 3300025928 | Ga0207700_10455503 | Ga0207700_104555032 | 194 |
| 13 | 3300048903 | Ga0496100_0006817 | Ga0496100_0006817_288_1004 | 194 |
| 14 | 3300048904 | Ga0496101_0000213 | Ga0496101_0000213_37366_38082 | 194 |
| 15 | 3300048922 | Ga0496119_0035537 | Ga0496119_0035537_1910_2626 | 194 |
| 16 | 3300048924 | Ga0496121_0014546 | Ga0496121_0014546_3742_4458 | 194 |
| 17 | 3300007265 | Ga0099794_10283726 | Ga0099794_102837261 | 195 |
| 18 | 3300037853 | Ga0436364_0397486 | Ga0436364_0397486_113_817 | 195 |
| 19 | 3300005437 | Ga0070710_10046159 | Ga0070710_100461593 | 196 |
| 20 | 3300006175 | Ga0070712_100015939 | Ga0070712_1000159395 | 196 |
| 21 | 3300035695 | Ga0373927_0016784 | Ga0373927_0016784_1476_2168 | 196 |
| 22 | 3300005434 | Ga0070709_10077995 | Ga0070709_100779953 | 197 |
| 23 | 3300005436 | Ga0070713_100195344 | Ga0070713_1001953441 | 197 |
| 24 | 3300005530 | Ga0070679_100395127 | Ga0070679_1003951272 | 197 |
| 25 | 3300005530 | Ga0070679_100463679 | Ga0070679_1004636792 | 197 |
| 26 | 3300005577 | Ga0068857_100139884 | Ga0068857_1001398843 | 197 |
| 27 | 3300013105 | Ga0157369_10457316 | Ga0157369_104573162 | 197 |
| 28 | 3300025906 | Ga0207699_10040124 | Ga0207699_100401243 | 197 |
| 29 | 3300025915 | Ga0207693_10012278 | Ga0207693_100122783 | 197 |
| 30 | 3300025921 | Ga0207652_10355623 | Ga0207652_103556232 | 197 |
| 31 | 3300025924 | Ga0207694_10089008 | Ga0207694_100890083 | 197 |
| 32 | 3300025928 | Ga0207700_10303626 | Ga0207700_103036262 | 197 |
| 33 | 3300026116 | Ga0207674_10129603 | Ga0207674_101296033 | 197 |
| 34 | 3300026118 | Ga0207675_100438424 | Ga0207675_1004384242 | 197 |
| 35 | 3300046459 | Ga0495629_0192979 | Ga0495629_0192979_445_1137 | 197 |
| 36 | 3300047673 | Ga0495593_0064886 | Ga0495593_0064886_258_950 | 197 |
| 37 | iso_pu_bacteria | 8019576017 | 8019583155 | 197 |
| 38 | 3300025297 | Ga0209758_1007070 | Ga0209758_10070707 | 198 |
| 39 | 3300005467 | Ga0070706_100204227 | Ga0070706_1002042272 | 199 |
| 40 | 3300005530 | Ga0070679_100539670 | Ga0070679_1005396702 | 199 |
| 41 | 3300005616 | Ga0068852_100420229 | Ga0068852_1004202292 | 199 |
| 42 | 3300009551 | Ga0105238_10246610 | Ga0105238_102466102 | 199 |
| 43 | 3300025924 | Ga0207694_10145180 | Ga0207694_101451802 | 199 |
| 44 | 3300026041 | Ga0207639_10122518 | Ga0207639_101225182 | 199 |
| 45 | 3300037418 | Ga0395900_0044295 | Ga0395900_0044295_389_1081 | 199 |
| 46 | 3300037466 | Ga0395898_0010583 | Ga0395898_0010583_78_770 | 199 |
| 47 | 3300038443 | Ga0395901_0182755 | Ga0395901_0182755_363_1055 | 199 |
| 48 | 3300046507 | Ga0495606_0001179 | Ga0495606_0001179_7780_8472 | 199 |
| 49 | 3300050490 | nmdc:mga03n38_26265_c1 | nmdc:mga03n38_26265_c1_1520_2212 | 199 |
| 50 | 3300009551 | Ga0105238_10889307 | Ga0105238_108893072 | 200 |
| 51 | 3300037068 | Ga0373925_0265765 | Ga0373925_0265765_304_996 | 200 |
| 52 | 3300046683 | Ga0495658_0303068 | Ga0495658_0303068_88_780 | 200 |
| 53 | 3300053080 | Ga0500635_0116019 | Ga0500635_0116019_80_772 | 200 |
| 54 | 3300053163 | Ga0500639_051091 | Ga0500639_051091_978_1670 | 200 |
| 55 | 3300053178 | Ga0500637_0038627 | Ga0500637_0038627_709_1401 | 200 |
| 56 | 3300005327 | Ga0070658_10051844 | Ga0070658_100518444 | 201 |
| 57 | 3300005455 | Ga0070663_100249004 | Ga0070663_1002490041 | 201 |
| 58 | 3300006038 | Ga0075365_10054530 | Ga0075365_100545303 | 201 |
| 59 | 3300009545 | Ga0105237_11001220 | Ga0105237_110012202 | 201 |
| 60 | 3300025921 | Ga0207652_10651436 | Ga0207652_106514362 | 201 |
| 61 | 3300026067 | Ga0207678_10043159 | Ga0207678_100431592 | 201 |
| 62 | 3300028786 | Ga0307517_10000008 | Ga0307517_10000008155 | 201 |
| 63 | 3300035724 | Ga0373933_0000199 | Ga0373933_0000199_11821_12513 | 201 |
| 64 | 3300044694 | Ga0466963_0132734 | Ga0466963_0132734_884_1576 | 201 |
| 65 | 3300046507 | Ga0495606_0025719 | Ga0495606_0025719_1441_2124 | 201 |
| 66 | 3300047321 | Ga0495676_0161515 | Ga0495676_0161515_142_834 | 201 |
| 67 | 3300048905 | Ga0496102_0179875 | Ga0496102_0179875_247_939 | 201 |
| 68 | 3300048907 | Ga0496104_0002456 | Ga0496104_0002456_12432_13124 | 201 |
| 69 | 3300048908 | Ga0496105_0006042 | Ga0496105_0006042_3365_4057 | 201 |
| 70 | 3300048911 | Ga0496108_0007691 | Ga0496108_0007691_4896_5588 | 201 |
| 71 | 3300048912 | Ga0496109_0010098 | Ga0496109_0010098_4945_5637 | 201 |
| 72 | 3300048914 | Ga0496111_0000449 | Ga0496111_0000449_7820_8512 | 201 |
| 73 | 3300048915 | Ga0496112_0034239 | Ga0496112_0034239_1842_2534 | 201 |
| 74 | 3300048916 | Ga0496113_0000528 | Ga0496113_0000528_13453_14145 | 201 |
| 75 | 3300048918 | Ga0496115_0095967 | Ga0496115_0095967_1254_1946 | 201 |
| 76 | 3300050491 | nmdc:mga00v17_179291_c1 | nmdc:mga00v17_179291_c1_75_767 | 201 |
| 77 | 3300050492 | nmdc:mga0yw44_79637_c1 | nmdc:mga0yw44_79637_c1_1064_1756 | 201 |
| 78 | 3300050516 | nmdc:mga0sz30_238604_c1 | nmdc:mga0sz30_238604_c1_53_745 | 201 |
| 79 | 3300005518 | Ga0070699_100098367 | Ga0070699_1000983673 | 202 |
| 80 | 3300005719 | Ga0068861_100891841 | Ga0068861_1008918411 | 202 |
| 81 | 3300006195 | Ga0075366_10155752 | Ga0075366_101557522 | 202 |
| 82 | 3300006871 | Ga0075434_100490088 | Ga0075434_1004900882 | 202 |
| 83 | 3300009101 | Ga0105247_10346942 | Ga0105247_103469422 | 202 |
| 84 | 3300009147 | Ga0114129_10749936 | Ga0114129_107499362 | 202 |
| 85 | 3300009174 | Ga0105241_10122821 | Ga0105241_101228212 | 202 |
| 86 | 3300025942 | Ga0207689_10021146 | Ga0207689_100211466 | 202 |
| 87 | 3300026118 | Ga0207675_100495090 | Ga0207675_1004950901 | 202 |
| 88 | 3300026118 | Ga0207675_100802265 | Ga0207675_1008022652 | 202 |
| 89 | 3300031616 | Ga0307508_10229059 | Ga0307508_102290592 | 202 |
| 90 | 3300046519 | Ga0495632_0062420 | Ga0495632_0062420_1023_1715 | 202 |
| 91 | 3300048091 | Ga0495626_0150224 | Ga0495626_0150224_20_712 | 202 |
| 92 | 3300048927 | Ga0496124_0150774 | Ga0496124_0150774_969_1661 | 202 |
| 93 | 3300048929 | Ga0496126_0482171 | Ga0496126_0482171_161_853 | 202 |
| 94 | 3300050493 | nmdc:mga0k408_215548_c1 | nmdc:mga0k408_215548_c1_16_708 | 202 |
| 95 | 3300005347 | Ga0070668_100323705 | Ga0070668_1003237052 | 203 |
| 96 | 3300005354 | Ga0070675_100356650 | Ga0070675_1003566502 | 203 |
| 97 | 3300005355 | Ga0070671_100001629 | Ga0070671_10000162913 | 203 |
| 98 | 3300005364 | Ga0070673_100177979 | Ga0070673_1001779792 | 203 |
| 99 | 3300005435 | Ga0070714_100041624 | Ga0070714_1000416244 | 203 |
| 100 | 3300005439 | Ga0070711_100040240 | Ga0070711_1000402403 | 203 |
| 101 | 3300005456 | Ga0070678_100011904 | Ga0070678_1000119043 | 203 |
| 102 | 3300005468 | Ga0070707_100739084 | Ga0070707_1007390842 | 203 |
| 103 | 3300005539 | Ga0068853_100486966 | Ga0068853_1004869661 | 203 |
| 104 | 3300005564 | Ga0070664_100043917 | Ga0070664_1000439177 | 203 |
| 105 | 3300005616 | Ga0068852_100567177 | Ga0068852_1005671772 | 203 |
| 106 | 3300005937 | Ga0081455_10063868 | Ga0081455_100638683 | 203 |
| 107 | 3300005981 | Ga0081538_10034813 | Ga0081538_100348133 | 203 |
| 108 | 3300005983 | Ga0081540_1002690 | Ga0081540_100269014 | 203 |
| 109 | 3300006175 | Ga0070712_100492850 | Ga0070712_1004928502 | 203 |
| 110 | 3300006237 | Ga0097621_100019101 | Ga0097621_1000191016 | 203 |
| 111 | 3300006358 | Ga0068871_100010894 | Ga0068871_1000108944 | 203 |
| 112 | 3300009098 | Ga0105245_10007619 | Ga0105245_100076199 | 203 |
| 113 | 3300009176 | Ga0105242_10018122 | Ga0105242_100181225 | 203 |
| 114 | 3300009177 | Ga0105248_10015680 | Ga0105248_100156805 | 203 |
| 115 | 3300011119 | Ga0105246_10716096 | Ga0105246_107160961 | 203 |
| 116 | 3300013105 | Ga0157369_10225065 | Ga0157369_102250653 | 203 |
| 117 | 3300013297 | Ga0157378_10037040 | Ga0157378_100370404 | 203 |
| 118 | 3300013307 | Ga0157372_10965973 | Ga0157372_109659732 | 203 |
| 119 | 3300013308 | Ga0157375_10015754 | Ga0157375_100157547 | 203 |
| 120 | 3300014968 | Ga0157379_10015374 | Ga0157379_100153744 | 203 |
| 121 | 3300014969 | Ga0157376_10073840 | Ga0157376_100738401 | 203 |
| 122 | 3300021384 | Ga0213876_10057753 | Ga0213876_100577532 | 203 |
| 123 | 3300025906 | Ga0207699_10297819 | Ga0207699_102978191 | 203 |
| 124 | 3300025920 | Ga0207649_10029765 | Ga0207649_100297654 | 203 |
| 125 | 3300025922 | Ga0207646_10599160 | Ga0207646_105991601 | 203 |
| 126 | 3300025927 | Ga0207687_10123341 | Ga0207687_101233412 | 203 |
| 127 | 3300025929 | Ga0207664_10162299 | Ga0207664_101622992 | 203 |
| 128 | 3300025932 | Ga0207690_10107114 | Ga0207690_101071143 | 203 |
| 129 | 3300025945 | Ga0207679_10036381 | Ga0207679_100363814 | 203 |
| 130 | 3300025960 | Ga0207651_10370470 | Ga0207651_103704702 | 203 |
| 131 | 3300026035 | Ga0207703_10323706 | Ga0207703_103237062 | 203 |
| 132 | 3300026067 | Ga0207678_10111451 | Ga0207678_101114513 | 203 |
| 133 | 3300026121 | Ga0207683_10028473 | Ga0207683_100284735 | 203 |
| 134 | 3300026121 | Ga0207683_10358569 | Ga0207683_103585692 | 203 |
| 135 | 3300031456 | Ga0307513_10418380 | Ga0307513_104183801 | 203 |
| 136 | 3300035117 | Ga0373953_0005595 | Ga0373953_0005595_184_876 | 203 |
| 137 | 3300035118 | Ga0373954_0013096 | Ga0373954_0013096_1137_1829 | 203 |
| 138 | 3300035120 | Ga0373957_0022135 | Ga0373957_0022135_859_1551 | 203 |
| 139 | 3300035172 | Ga0373955_0009673 | Ga0373955_0009673_2442_3134 | 203 |
| 140 | 3300036401 | Ga0373937_0003498 | Ga0373937_0003498_10632_11324 | 203 |
| 141 | 3300039437 | Ga0436365_0042699 | Ga0436365_0042699_260_952 | 203 |
| 142 | 3300046452 | Ga0495617_137550 | Ga0495617_137550_77_769 | 203 |
| 143 | 3300046454 | Ga0495592_0003279 | Ga0495592_0003279_6373_7065 | 203 |
| 144 | 3300046462 | Ga0495651_0055037 | Ga0495651_0055037_624_1316 | 203 |
| 145 | 3300046476 | Ga0495662_0133154 | Ga0495662_0133154_490_1182 | 203 |
| 146 | 3300046477 | Ga0495664_0019399 | Ga0495664_0019399_2580_3272 | 203 |
| 147 | 3300046511 | Ga0495608_0042556 | Ga0495608_0042556_1741_2433 | 203 |
| 148 | 3300046514 | Ga0495618_0005389 | Ga0495618_0005389_1103_1795 | 203 |
| 149 | 3300046516 | Ga0495628_0041443 | Ga0495628_0041443_2840_3532 | 203 |
| 150 | 3300046529 | Ga0495652_0002979 | Ga0495652_0002979_10987_11679 | 203 |
| 151 | 3300046533 | Ga0495640_0011617 | Ga0495640_0011617_1751_2443 | 203 |
| 152 | 3300046543 | Ga0495645_0001772 | Ga0495645_0001772_7127_7819 | 203 |
| 153 | 3300046559 | Ga0495667_0033238 | Ga0495667_0033238_1967_2659 | 203 |
| 154 | 3300046675 | Ga0495657_0067361 | Ga0495657_0067361_732_1424 | 203 |
| 155 | 3300046679 | Ga0495623_0069959 | Ga0495623_0069959_934_1626 | 203 |
| 156 | 3300046809 | Ga0495600_0003839 | Ga0495600_0003839_4266_4958 | 203 |
| 157 | 3300047317 | Ga0495604_0002660 | Ga0495604_0002660_433_1125 | 203 |
| 158 | 3300047319 | Ga0495674_0013103 | Ga0495674_0013103_1966_2658 | 203 |
| 159 | 3300047444 | Ga0495675_0000984 | Ga0495675_0000984_1967_2659 | 203 |
| 160 | 3300048904 | Ga0496101_0257105 | Ga0496101_0257105_549_1241 | 203 |
| 161 | 3300048905 | Ga0496102_0030253 | Ga0496102_0030253_3540_4232 | 203 |
| 162 | 3300048906 | Ga0496103_0045764 | Ga0496103_0045764_1559_2251 | 203 |
| 163 | 3300048907 | Ga0496104_0109269 | Ga0496104_0109269_918_1610 | 203 |
| 164 | 3300048908 | Ga0496105_0034625 | Ga0496105_0034625_408_1100 | 203 |
| 165 | 3300048909 | Ga0496106_0002551 | Ga0496106_0002551_10720_11412 | 203 |
| 166 | 3300048910 | Ga0496107_0005110 | Ga0496107_0005110_7633_8325 | 203 |
| 167 | 3300048911 | Ga0496108_0018148 | Ga0496108_0018148_96_788 | 203 |
| 168 | 3300048913 | Ga0496110_0634889 | Ga0496110_0634889_29_721 | 203 |
| 169 | 3300048916 | Ga0496113_0344749 | Ga0496113_0344749_44_736 | 203 |
| 170 | 3300048917 | Ga0496114_0057383 | Ga0496114_0057383_885_1577 | 203 |
| 171 | 3300050511 | nmdc:mga08y16_307608_c1 | nmdc:mga08y16_307608_c1_812_1504 | 203 |
| 172 | 3300053077 | Ga0495601_0004312 | Ga0495601_0004312_2305_2997 | 203 |
| 173 | 3300053078 | Ga0495612_0008328 | Ga0495612_0008328_144_836 | 203 |
| 174 | 3300053084 | Ga0495595_0000240 | Ga0495595_0000240_16087_16779 | 203 |
| 175 | 3300053091 | Ga0500647_0039154 | Ga0500647_0039154_628_1320 | 203 |
| 176 | 3300053094 | Ga0500566_0000006 | Ga0500566_0000006_139468_140160 | 203 |
| 177 | 3300053095 | Ga0500640_000036 | Ga0500640_000036_896_1588 | 203 |
| 178 | 3300053111 | Ga0500572_005599 | Ga0500572_005599_870_1562 | 203 |
| 179 | 3300053122 | Ga0500608_021487 | Ga0500608_021487_2068_2760 | 203 |
| 180 | 3300053123 | Ga0500614_000846 | Ga0500614_000846_891_1583 | 203 |
| 181 | 3300053136 | Ga0500559_0029799 | Ga0500559_0029799_891_1583 | 203 |
| 182 | 3300053144 | Ga0500585_156795 | Ga0500585_156795_81_773 | 203 |
| 183 | 3300053148 | Ga0500590_057832 | Ga0500590_057832_89_781 | 203 |
| 184 | 3300053150 | Ga0500603_000195 | Ga0500603_000195_4129_4821 | 203 |
| 185 | 3300053159 | Ga0500630_001646 | Ga0500630_001646_3923_4615 | 203 |
| 186 | 3300053163 | Ga0500639_000170 | Ga0500639_000170_5086_5778 | 203 |
| 187 | 3300053737 | Ga0500601_003622 | Ga0500601_003622_870_1562 | 203 |
| 188 | 3300005546 | Ga0070696_100238502 | Ga0070696_1002385022 | 204 |
| 189 | 3300005937 | Ga0081455_10017926 | Ga0081455_100179267 | 204 |
| 190 | 3300009098 | Ga0105245_10365153 | Ga0105245_103651532 | 204 |
| 191 | 3300025909 | Ga0207705_10463919 | Ga0207705_104639191 | 204 |
| 192 | 3300025927 | Ga0207687_10116864 | Ga0207687_101168643 | 204 |
| 193 | 3300025933 | Ga0207706_10403102 | Ga0207706_104031021 | 204 |
| 194 | 3300028381 | Ga0268264_10027494 | Ga0268264_100274943 | 204 |
| 195 | 3300031901 | Ga0307406_10517961 | Ga0307406_105179612 | 204 |
| 196 | 3300031995 | Ga0307409_100577749 | Ga0307409_1005777492 | 204 |
| 197 | 3300035172 | Ga0373955_0108075 | Ga0373955_0108075_164_856 | 204 |
| 198 | 3300039447 | Ga0436361_0532883 | Ga0436361_0532883_91_774 | 204 |
| 199 | 3300046455 | Ga0495603_0044718 | Ga0495603_0044718_1302_1994 | 204 |
| 200 | 3300046474 | Ga0495605_0139756 | Ga0495605_0139756_141_833 | 204 |
| 201 | 3300046477 | Ga0495664_0045522 | Ga0495664_0045522_1639_2331 | 204 |
| 202 | 3300046516 | Ga0495628_0274934 | Ga0495628_0274934_314_1006 | 204 |
| 203 | 3300046533 | Ga0495640_0187589 | Ga0495640_0187589_11_703 | 204 |
| 204 | 3300046557 | Ga0495622_0068255 | Ga0495622_0068255_247_939 | 204 |
| 205 | 3300046559 | Ga0495667_0069109 | Ga0495667_0069109_1398_2090 | 204 |
| 206 | 3300046615 | Ga0495656_0131030 | Ga0495656_0131030_112_804 | 204 |
| 207 | 3300046660 | Ga0495625_0190042 | Ga0495625_0190042_38_730 | 204 |
| 208 | 3300046674 | Ga0495588_0009960 | Ga0495588_0009960_1692_2384 | 204 |
| 209 | 3300046681 | Ga0495647_0059378 | Ga0495647_0059378_371_1063 | 204 |
| 210 | 3300047319 | Ga0495674_0048940 | Ga0495674_0048940_294_986 | 204 |
| 211 | 3300047321 | Ga0495676_0072253 | Ga0495676_0072253_1756_2448 | 204 |
| 212 | 3300047322 | Ga0495680_0044688 | Ga0495680_0044688_1379_2071 | 204 |
| 213 | 3300048924 | Ga0496121_0224248 | Ga0496121_0224248_226_918 | 204 |
| 214 | 3300053077 | Ga0495601_0330339 | Ga0495601_0330339_107_799 | 204 |
| 215 | 3300053085 | Ga0495619_0000145 | Ga0495619_0000145_668_1360 | 204 |
| 216 | 3300053086 | Ga0500578_0023708 | Ga0500578_0023708_2133_2816 | 204 |
| 217 | 3300003215 | JGI25153J46596_10000394 | JGI25153J46596_1000039412 | 205 |
| 218 | 3300003794 | Ga0055531_10007393 | Ga0055531_100073937 | 205 |
| 219 | 3300004625 | Ga0055543_1002885 | Ga0055543_10028855 | 205 |
| 220 | 3300005262 | Ga0065165_1001731 | Ga0065165_100173111 | 205 |
| 221 | 3300005455 | Ga0070663_100226708 | Ga0070663_1002267082 | 205 |
| 222 | 3300005844 | Ga0068862_100268560 | Ga0068862_1002685602 | 205 |
| 223 | 3300009176 | Ga0105242_10480797 | Ga0105242_104807972 | 205 |
| 224 | 3300025297 | Ga0209758_1000024 | Ga0209758_100002466 | 205 |
| 225 | 3300025304 | Ga0209257_1001149 | Ga0209257_100114917 | 205 |
| 226 | 3300026023 | Ga0207677_10727925 | Ga0207677_107279252 | 205 |
| 227 | 3300035398 | Ga0316574_0209557 | Ga0316574_0209557_559_1233 | 205 |
| 228 | 3300048907 | Ga0496104_0205595 | Ga0496104_0205595_23_715 | 205 |
| 229 | iso_pu_bacteria | 2857509624 | 2857515892 | 205 |
| 230 | 3300005334 | Ga0068869_100509780 | Ga0068869_1005097802 | 206 |
| 231 | 3300005336 | Ga0070680_100017453 | Ga0070680_1000174532 | 206 |
| 232 | 3300005337 | Ga0070682_100104282 | Ga0070682_1001042821 | 206 |
| 233 | 3300005344 | Ga0070661_100125958 | Ga0070661_1001259582 | 206 |
| 234 | 3300005439 | Ga0070711_100179879 | Ga0070711_1001798792 | 206 |
| 235 | 3300005455 | Ga0070663_100055656 | Ga0070663_1000556563 | 206 |
| 236 | 3300005614 | Ga0068856_100168939 | Ga0068856_1001689392 | 206 |
| 237 | 3300005617 | Ga0068859_100171388 | Ga0068859_1001713883 | 206 |
| 238 | 3300005844 | Ga0068862_100301425 | Ga0068862_1003014252 | 206 |
| 239 | 3300005937 | Ga0081455_10105008 | Ga0081455_101050083 | 206 |
| 240 | 3300005983 | Ga0081540_1003654 | Ga0081540_10036541 | 206 |
| 241 | 3300005983 | Ga0081540_1017195 | Ga0081540_10171954 | 206 |
| 242 | 3300006038 | Ga0075365_10232908 | Ga0075365_102329082 | 206 |
| 243 | 3300006048 | Ga0075363_100063020 | Ga0075363_1000630202 | 206 |
| 244 | 3300006051 | Ga0075364_10208643 | Ga0075364_102086432 | 206 |
| 245 | 3300006177 | Ga0075362_10022802 | Ga0075362_100228023 | 206 |
| 246 | 3300006178 | Ga0075367_10000988 | Ga0075367_100009885 | 206 |
| 247 | 3300006186 | Ga0075369_10008785 | Ga0075369_100087855 | 206 |
| 248 | 3300006195 | Ga0075366_10483803 | Ga0075366_104838031 | 206 |
| 249 | 3300006844 | Ga0075428_100079146 | Ga0075428_1000791464 | 206 |
| 250 | 3300006931 | Ga0097620_100171379 | Ga0097620_1001713792 | 206 |
| 251 | 3300009147 | Ga0114129_10111337 | Ga0114129_101113372 | 206 |
| 252 | 3300011119 | Ga0105246_10462649 | Ga0105246_104626492 | 206 |
| 253 | 3300020070 | Ga0206356_11553529 | Ga0206356_115535292 | 206 |
| 254 | 3300025295 | Ga0209564_1019909 | Ga0209564_10199093 | 206 |
| 255 | 3300025921 | Ga0207652_10283302 | Ga0207652_102833022 | 206 |
| 256 | 3300025935 | Ga0207709_10443739 | Ga0207709_104437392 | 206 |
| 257 | 3300026067 | Ga0207678_10035639 | Ga0207678_100356394 | 206 |
| 258 | 3300028379 | Ga0268266_10002394 | Ga0268266_100023942 | 206 |
| 259 | 3300028786 | Ga0307517_10228925 | Ga0307517_102289252 | 206 |
| 260 | 3300031507 | Ga0307509_10180532 | Ga0307509_101805323 | 206 |
| 261 | 3300031548 | Ga0307408_100449154 | Ga0307408_1004491542 | 206 |
| 262 | 3300031730 | Ga0307516_10077115 | Ga0307516_100771153 | 206 |
| 263 | 3300031901 | Ga0307406_10332610 | Ga0307406_103326101 | 206 |
| 264 | 3300032002 | Ga0307416_100271276 | Ga0307416_1002712762 | 206 |
| 265 | 3300032126 | Ga0307415_100069687 | Ga0307415_1000696872 | 206 |
| 266 | 3300033180 | Ga0307510_10001061 | Ga0307510_100010618 | 206 |
| 267 | 3300046455 | Ga0495603_0004410 | Ga0495603_0004410_1199_1891 | 206 |
| 268 | 3300046461 | Ga0495641_0022963 | Ga0495641_0022963_1539_2231 | 206 |
| 269 | 3300046499 | Ga0495594_0217607 | Ga0495594_0217607_235_927 | 206 |
| 270 | 3300046537 | Ga0495598_0004011 | Ga0495598_0004011_1520_2212 | 206 |
| 271 | 3300046557 | Ga0495622_0041218 | Ga0495622_0041218_215_907 | 206 |
| 272 | 3300046664 | Ga0495659_0019059 | Ga0495659_0019059_193_885 | 206 |
| 273 | 3300046691 | Ga0495670_0303218 | Ga0495670_0303218_46_738 | 206 |
| 274 | 3300047470 | Ga0495681_0132100 | Ga0495681_0132100_108_800 | 206 |
| 275 | 3300047472 | Ga0495686_0076873 | Ga0495686_0076873_202_885 | 206 |
| 276 | 3300048906 | Ga0496103_0294408 | Ga0496103_0294408_320_1012 | 206 |
| 277 | 3300048924 | Ga0496121_0313416 | Ga0496121_0313416_120_812 | 206 |
| 278 | 3300048928 | Ga0496125_0203754 | Ga0496125_0203754_87_779 | 206 |
| 279 | 3300048929 | Ga0496126_0129917 | Ga0496126_0129917_331_1023 | 206 |
| 280 | 3300050489 | nmdc:mga03683_247809_c1 | nmdc:mga03683_247809_c1_116_808 | 206 |
| 281 | 3300050490 | nmdc:mga03n38_20431_c1 | nmdc:mga03n38_20431_c1_383_1075 | 206 |
| 282 | 3300050492 | nmdc:mga0yw44_215299_c1 | nmdc:mga0yw44_215299_c1_103_795 | 206 |
| 283 | 3300050493 | nmdc:mga0k408_162592_c1 | nmdc:mga0k408_162592_c1_433_1125 | 206 |
| 284 | 3300050494 | nmdc:mga06z11_59313_c1 | nmdc:mga06z11_59313_c1_275_967 | 206 |
| 285 | 3300050496 | nmdc:mga07m45_13999_c1 | nmdc:mga07m45_13999_c1_2717_3409 | 206 |
| 286 | 3300050507 | nmdc:mga05p37_141849_c1 | nmdc:mga05p37_141849_c1_817_1509 | 206 |
| 287 | 3300050516 | nmdc:mga0sz30_191847_c1 | nmdc:mga0sz30_191847_c1_70_762 | 206 |
| 288 | 3300053133 | Ga0500655_022213 | Ga0500655_022213_228_920 | 206 |
| 289 | 3300053134 | Ga0500658_0089405 | Ga0500658_0089405_206_898 | 206 |
| 290 | 3300053730 | Ga0500645_074604 | Ga0500645_074604_244_936 | 206 |
| 291 | iso_pu_bacteria | 2513237101 | 2513692891 | 206 |
| 292 | iso_pu_bacteria | 2721755755 | 2723846524 | 206 |
| 293 | iso_pu_bacteria | 2791355199 | 2793079923 | 206 |
| 294 | iso_pu_bacteria | 2874604998 | 2874605540 | 206 |
| 295 | iso_pu_bacteria | 2879110137 | 2879115854 | 206 |
| 296 | iso_pu_bacteria | 2889033259 | 2889039413 | 206 |
| 297 | iso_pu_bacteria | 2922361189 | 2922365728 | 206 |
| 298 | iso_pu_bacteria | 8006964411 | 8006972441 | 206 |
| 299 | iso_pu_bacteria | 8006984368 | 8006987900 | 206 |
| 300 | 3300003354 | JGI25160J50197_1012586 | JGI25160J50197_10125861 | 207 |
| 301 | 3300005262 | Ga0065165_1002125 | Ga0065165_10021259 | 207 |
| 302 | 3300005578 | Ga0068854_100460406 | Ga0068854_1004604062 | 207 |
| 303 | 3300006942 | Ga0099824_1012798 | Ga0099824_10127985 | 207 |
| 304 | 3300025302 | Ga0207426_1000510 | Ga0207426_10005104 | 207 |
| 305 | 3300027296 | Ga0209389_1000185 | Ga0209389_100018537 | 207 |
| 306 | 3300027357 | Ga0209589_1000036 | Ga0209589_1000036101 | 207 |
| 307 | 3300027361 | Ga0209489_100006 | Ga0209489_100006429 | 207 |
| 308 | 3300042001 | Ga0439441_022090 | Ga0439441_022090_95_787 | 207 |
| 309 | 3300046616 | Ga0495668_0261772 | Ga0495668_0261772_39_722 | 207 |
| 310 | iso_pu_bacteria | 2507262055 | 2507508247 | 207 |
| 311 | iso_pu_bacteria | 2508501009 | 2508542316 | 207 |
| 312 | iso_pu_bacteria | 2508501042 | 2508691924 | 207 |
| 313 | iso_pu_bacteria | 2511231028 | 2511397496 | 207 |
| 314 | iso_pu_bacteria | 2513237092 | 2513622376 | 207 |
| 315 | iso_pu_bacteria | 2513237094 | 2513640553 | 207 |
| 316 | iso_pu_bacteria | 2513237095 | 2513645466 | 207 |
| 317 | iso_pu_bacteria | 2513237102 | 2513702501 | 207 |
| 318 | iso_pu_bacteria | 2513237104 | 2513718416 | 207 |
| 319 | iso_pu_bacteria | 2513237139 | 2513873113 | 207 |
| 320 | iso_pu_bacteria | 2513237161 | 2514016546 | 207 |
| 321 | iso_pu_bacteria | 2517093001 | 2517102651 | 207 |
| 322 | iso_pu_bacteria | 2524023205 | 2524437713 | 207 |
| 323 | iso_pu_bacteria | 2528768022 | 2528848685 | 207 |
| 324 | iso_pu_bacteria | 2617270735 | 2617347021 | 207 |
| 325 | iso_pu_bacteria | 2744054633 | 2745081181 | 207 |
| 326 | iso_pu_bacteria | 2791355196 | 2793062620 | 207 |
| 327 | iso_pu_bacteria | 2802429603 | 2805914988 | 207 |
| 328 | iso_pu_bacteria | 2816332527 | 2818239693 | 207 |
| 329 | iso_pu_bacteria | 2824600985 | 2824602375 | 207 |
| 330 | iso_pu_bacteria | 2824609381 | 2824610531 | 207 |
| 331 | iso_pu_bacteria | 2824617872 | 2824618090 | 207 |
| 332 | iso_pu_bacteria | 2824626560 | 2824626758 | 207 |
| 333 | iso_pu_bacteria | 2824635225 | 2824636607 | 207 |
| 334 | iso_pu_bacteria | 2824644064 | 2824645141 | 207 |
| 335 | iso_pu_bacteria | 2824653114 | 2824654344 | 207 |
| 336 | iso_pu_bacteria | 2824661429 | 2824661572 | 207 |
| 337 | iso_pu_bacteria | 2824671348 | 2824672014 | 207 |
| 338 | iso_pu_bacteria | 2824679649 | 2824679841 | 207 |
| 339 | iso_pu_bacteria | 2824687955 | 2824688613 | 207 |
| 340 | iso_pu_bacteria | 2824704595 | 2824705277 | 207 |
| 341 | iso_pu_bacteria | 2824714736 | 2824715698 | 207 |
| 342 | iso_pu_bacteria | 2824723954 | 2824725181 | 207 |
| 343 | iso_pu_bacteria | 2824753945 | 2824754349 | 207 |
| 344 | iso_pu_bacteria | 2824763712 | 2824767848 | 207 |
| 345 | iso_pu_bacteria | 2824773399 | 2824775274 | 207 |
| 346 | iso_pu_bacteria | 2838122688 | 2838123376 | 207 |
| 347 | iso_pu_bacteria | 2841941048 | 2841946669 | 207 |
| 348 | iso_pu_bacteria | 2841949485 | 2841954097 | 207 |
| 349 | iso_pu_bacteria | 2841957949 | 2841964042 | 207 |
| 350 | iso_pu_bacteria | 2841966195 | 2841969475 | 207 |
| 351 | iso_pu_bacteria | 2841983080 | 2841983800 | 207 |
| 352 | iso_pu_bacteria | 2842038055 | 2842040158 | 207 |
| 353 | iso_pu_bacteria | 2842045827 | 2842046897 | 207 |
| 354 | iso_pu_bacteria | 2844315083 | 2844319388 | 207 |
| 355 | iso_pu_bacteria | 2847930680 | 2847936558 | 207 |
| 356 | iso_pu_bacteria | 2874590934 | 2874598383 | 207 |
| 357 | iso_pu_bacteria | 2874612657 | 2874619398 | 207 |
| 358 | iso_pu_bacteria | 2874620515 | 2874626384 | 207 |
| 359 | iso_pu_bacteria | 2874628541 | 2874632248 | 207 |
| 360 | iso_pu_bacteria | 2874645413 | 2874652562 | 207 |
| 361 | iso_pu_bacteria | 2876761206 | 2876764935 | 207 |
| 362 | iso_pu_bacteria | 2876771140 | 2876778139 | 207 |
| 363 | iso_pu_bacteria | 2876818435 | 2876825992 | 207 |
| 364 | iso_pu_bacteria | 2879074833 | 2879081933 | 207 |
| 365 | iso_pu_bacteria | 2879083081 | 2879089537 | 207 |
| 366 | iso_pu_bacteria | 2879099564 | 2879108325 | 207 |
| 367 | iso_pu_bacteria | 2879127579 | 2879135055 | 207 |
| 368 | iso_pu_bacteria | 2879142872 | 2879149740 | 207 |
| 369 | iso_pu_bacteria | 2881364244 | 2881368488 | 207 |
| 370 | iso_pu_bacteria | 2881665667 | 2881672554 | 207 |
| 371 | iso_pu_bacteria | 2885366525 | 2885369239 | 207 |
| 372 | iso_pu_bacteria | 2885409591 | 2885413338 | 207 |
| 373 | iso_pu_bacteria | 2888378607 | 2888384456 | 207 |
| 374 | iso_pu_bacteria | 2888388044 | 2888393452 | 207 |
| 375 | iso_pu_bacteria | 2888419890 | 2888424906 | 207 |
| 376 | iso_pu_bacteria | 2903727486 | 2903734329 | 207 |
| 377 | iso_pu_bacteria | 2904666416 | 2904671723 | 207 |
| 378 | iso_pu_bacteria | 2904711408 | 2904715072 | 207 |
| 379 | iso_pu_bacteria | 2906602504 | 2906605574 | 207 |
| 380 | iso_pu_bacteria | 2906626472 | 2906633653 | 207 |
| 381 | iso_pu_bacteria | 2906643746 | 2906646555 | 207 |
| 382 | iso_pu_bacteria | 2922368715 | 2922374866 | 207 |
| 383 | iso_pu_bacteria | 2922393267 | 2922400450 | 207 |
| 384 | iso_pu_bacteria | 2929615660 | 2929621912 | 207 |
| 385 | iso_pu_bacteria | 2929624759 | 2929629781 | 207 |
| 386 | iso_pu_bacteria | 2932784394 | 2932788780 | 207 |
| 387 | iso_pu_bacteria | 2932794094 | 2932798021 | 207 |
| 388 | iso_pu_bacteria | 2932801729 | 2932807137 | 207 |
| 389 | iso_pu_bacteria | 2932809354 | 2932812754 | 207 |
| 390 | iso_pu_bacteria | 2932818245 | 2932819154 | 207 |
| 391 | iso_pu_bacteria | 2932828146 | 2932830446 | 207 |
| 392 | iso_pu_bacteria | 2933577622 | 2933583812 | 207 |
| 393 | iso_pu_bacteria | 2935608549 | 2935609271 | 207 |
| 394 | iso_pu_bacteria | 2935616580 | 2935616740 | 207 |
| 395 | iso_pu_bacteria | 2935638405 | 2935641930 | 207 |
| 396 | iso_pu_bacteria | 2935656913 | 2935659120 | 207 |
| 397 | iso_pu_bacteria | 2935665750 | 2935673061 | 207 |
| 398 | iso_pu_bacteria | 2935675223 | 2935675866 | 207 |
| 399 | iso_pu_bacteria | 2935684952 | 2935685863 | 207 |
| 400 | iso_pu_bacteria | 2935694250 | 2935697891 | 207 |
| 401 | iso_pu_bacteria | 2935703347 | 2935705703 | 207 |
| 402 | iso_pu_bacteria | 2935713505 | 2935714415 | 207 |
| 403 | iso_pu_bacteria | 2935722832 | 2935725034 | 207 |
| 404 | iso_pu_bacteria | 2935732158 | 2935732607 | 207 |
| 405 | iso_pu_bacteria | 2935741537 | 2935741986 | 207 |
| 406 | iso_pu_bacteria | 2935750917 | 2935751828 | 207 |
| 407 | iso_pu_bacteria | 2935760218 | 2935765085 | 207 |
| 408 | iso_pu_bacteria | 2935769743 | 2935771702 | 207 |
| 409 | iso_pu_bacteria | 2935777560 | 2935778883 | 207 |
| 410 | iso_pu_bacteria | 2935785616 | 2935791196 | 207 |
| 411 | iso_pu_bacteria | 2935793552 | 2935795475 | 207 |
| 412 | iso_pu_bacteria | 2935801545 | 2935802681 | 207 |
| 413 | iso_pu_bacteria | 2935810662 | 2935813489 | 207 |
| 414 | iso_pu_bacteria | 2935819856 | 2935822431 | 207 |
| 415 | iso_pu_bacteria | 2935827899 | 2935830097 | 207 |
| 416 | iso_pu_bacteria | 2935837841 | 2935838015 | 207 |
| 417 | iso_pu_bacteria | 2935847175 | 2935848013 | 207 |
| 418 | iso_pu_bacteria | 2935855204 | 2935855364 | 207 |
| 419 | iso_pu_bacteria | 2935864058 | 2935867392 | 207 |
| 420 | iso_pu_bacteria | 2935873716 | 2935875789 | 207 |
| 421 | iso_pu_bacteria | 2935908558 | 2935908764 | 207 |
| 422 | iso_pu_bacteria | 2935916978 | 2935917909 | 207 |
| 423 | iso_pu_bacteria | 2935926038 | 2935926662 | 207 |
| 424 | iso_pu_bacteria | 2935934488 | 2935935112 | 207 |
| 425 | iso_pu_bacteria | 2935942939 | 2935943562 | 207 |
| 426 | iso_pu_bacteria | 2935951376 | 2935952000 | 207 |
| 427 | iso_pu_bacteria | 2935959822 | 2935960768 | 207 |
| 428 | iso_pu_bacteria | 2935967501 | 2935968125 | 207 |
| 429 | iso_pu_bacteria | 2935975950 | 2935978740 | 207 |
| 430 | iso_pu_bacteria | 2935984226 | 2935987389 | 207 |
| 431 | iso_pu_bacteria | 2935992306 | 2935996452 | 207 |
| 432 | iso_pu_bacteria | 2936002035 | 2936003733 | 207 |
| 433 | iso_pu_bacteria | 2936011229 | 2936013535 | 207 |
| 434 | iso_pu_bacteria | 2936019824 | 2936022338 | 207 |
| 435 | iso_pu_bacteria | 2936028420 | 2936030784 | 207 |
| 436 | iso_pu_bacteria | 2936037263 | 2936042438 | 207 |
| 437 | iso_pu_bacteria | 2936046547 | 2936048597 | 207 |
| 438 | iso_pu_bacteria | 2936055302 | 2936058811 | 207 |
| 439 | iso_pu_bacteria | 2940556831 | 2940557369 | 207 |
| 440 | iso_pu_bacteria | 2941531003 | 2941533160 | 207 |
| 441 | iso_pu_bacteria | 2941538514 | 2941539319 | 207 |
| 442 | iso_pu_bacteria | 3005483717 | 3005484636 | 207 |
| 443 | iso_pu_bacteria | 3005506211 | 3005510649 | 207 |
| 444 | iso_pu_bacteria | 3005587118 | 3005587713 | 207 |
| 445 | iso_pu_bacteria | 3005594810 | 3005599584 | 207 |
| 446 | iso_pu_bacteria | 3005710791 | 3005715242 | 207 |
| 447 | iso_pu_bacteria | 3005718088 | 3005722626 | 207 |
| 448 | iso_pu_bacteria | 8016511872 | 8016521846 | 207 |
| 449 | iso_pu_bacteria | 8016522445 | 8016529257 | 207 |
| 450 | iso_pu_bacteria | 8016530956 | 8016534471 | 207 |
| 451 | iso_pu_bacteria | 8016539877 | 8016547691 | 207 |
| 452 | iso_pu_bacteria | 8016548790 | 8016554446 | 207 |
| 453 | iso_pu_bacteria | 8016557553 | 8016562819 | 207 |
| 454 | iso_pu_bacteria | 8016566248 | 8016572810 | 207 |
| 455 | iso_pu_bacteria | 8016575299 | 8016576969 | 207 |
| 456 | iso_pu_bacteria | 8016595262 | 8016600594 | 207 |
| 457 | iso_pu_bacteria | 8016622563 | 8016626190 | 207 |
| 458 | iso_pu_bacteria | 8016630954 | 8016639971 | 207 |
| 459 | iso_pu_bacteria | 8017057580 | 8017063807 | 207 |
| 460 | iso_pu_bacteria | 8019530166 | 8019534231 | 207 |
| 461 | iso_pu_bacteria | 8019538911 | 8019545228 | 207 |
| 462 | iso_pu_bacteria | 8019547302 | 8019553287 | 207 |
| 463 | iso_pu_bacteria | 8019586578 | 8019590958 | 207 |
| 464 | iso_pu_bacteria | 8019597564 | 8019600389 | 207 |
| 465 | iso_pu_bacteria | 8019619141 | 8019628548 | 207 |
| 466 | iso_pu_bacteria | 8019629233 | 8019634089 | 207 |
| 467 | iso_pu_bacteria | 8019638758 | 8019645640 | 207 |
| 468 | iso_pu_bacteria | 8019648815 | 8019658901 | 207 |
| 469 | iso_pu_bacteria | 8019659431 | 8019661967 | 207 |
| 470 | iso_pu_bacteria | 8019668869 | 8019671492 | 207 |
| 471 | iso_pu_bacteria | 8019678201 | 8019684615 | 207 |
| 472 | iso_pu_bacteria | 8019687851 | 8019690433 | 207 |
| 473 | iso_pu_bacteria | 8055742211 | 8055745922 | 207 |
| 474 | 3300006237 | Ga0097621_100567523 | Ga0097621_1005675231 | 208 |
| 475 | 3300021361 | Ga0213872_10034960 | Ga0213872_100349602 | 208 |
| 476 | 3300025921 | Ga0207652_10079037 | Ga0207652_100790373 | 208 |
| 477 | 3300031249 | Ga0265339_10057328 | Ga0265339_100573282 | 208 |
| 478 | 3300031249 | Ga0265339_10207939 | Ga0265339_102079392 | 208 |
| 479 | 3300039447 | Ga0436361_0833650 | Ga0436361_0833650_5235_5918 | 208 |
| 480 | 3300044694 | Ga0466963_0038369 | Ga0466963_0038369_174_866 | 208 |
| 481 | 3300044706 | Ga0466964_0092261 | Ga0466964_0092261_146_838 | 208 |
| 482 | 3300044719 | Ga0466971_0248365 | Ga0466971_0248365_79_771 | 208 |
| 483 | 3300045836 | Ga0466958_0131752 | Ga0466958_0131752_849_1541 | 208 |
| 484 | 3300045976 | Ga0466967_0066574 | Ga0466967_0066574_743_1435 | 208 |
| 485 | 3300053086 | Ga0500578_0148732 | Ga0500578_0148732_31_714 | 208 |
| 486 | 3300053088 | Ga0500644_0119011 | Ga0500644_0119011_243_926 | 208 |
| 487 | 3300005338 | Ga0068868_100103125 | Ga0068868_1001031252 | 209 |
| 488 | 3300005436 | Ga0070713_100012732 | Ga0070713_1000127324 | 209 |
| 489 | 3300005456 | Ga0070678_100043206 | Ga0070678_1000432063 | 209 |
| 490 | 3300005545 | Ga0070695_100149314 | Ga0070695_1001493142 | 209 |
| 491 | 3300005614 | Ga0068856_100000020 | Ga0068856_100000020110 | 209 |
| 492 | 3300005614 | Ga0068856_100135286 | Ga0068856_1001352862 | 209 |
| 493 | 3300005718 | Ga0068866_10026261 | Ga0068866_100262612 | 209 |
| 494 | 3300005841 | Ga0068863_100045728 | Ga0068863_1000457282 | 209 |
| 495 | 3300005842 | Ga0068858_100008078 | Ga0068858_10000807811 | 209 |
| 496 | 3300005843 | Ga0068860_100327827 | Ga0068860_1003278272 | 209 |
| 497 | 3300006173 | Ga0070716_100002442 | Ga0070716_1000024426 | 209 |
| 498 | 3300006175 | Ga0070712_100034659 | Ga0070712_1000346593 | 209 |
| 499 | 3300006358 | Ga0068871_100166449 | Ga0068871_1001664492 | 209 |
| 500 | 3300009098 | Ga0105245_10006619 | Ga0105245_1000661910 | 209 |
| 501 | 3300009174 | Ga0105241_10062670 | Ga0105241_100626702 | 209 |
| 502 | 3300009176 | Ga0105242_10077188 | Ga0105242_100771882 | 209 |
| 503 | 3300009177 | Ga0105248_10027920 | Ga0105248_100279207 | 209 |
| 504 | 3300009545 | Ga0105237_10026248 | Ga0105237_100262482 | 209 |
| 505 | 3300010375 | Ga0105239_10502132 | Ga0105239_105021322 | 209 |
| 506 | 3300013296 | Ga0157374_10012098 | Ga0157374_100120988 | 209 |
| 507 | 3300013308 | Ga0157375_10031030 | Ga0157375_100310304 | 209 |
| 508 | 3300014325 | Ga0163163_10047665 | Ga0163163_100476654 | 209 |
| 509 | 3300014968 | Ga0157379_10005550 | Ga0157379_100055503 | 209 |
| 510 | 3300025898 | Ga0207692_10094891 | Ga0207692_100948912 | 209 |
| 511 | 3300025903 | Ga0207680_10219026 | Ga0207680_102190261 | 209 |
| 512 | 3300025905 | Ga0207685_10016843 | Ga0207685_100168432 | 209 |
| 513 | 3300025915 | Ga0207693_10000068 | Ga0207693_1000006827 | 209 |
| 514 | 3300025916 | Ga0207663_10053162 | Ga0207663_100531623 | 209 |
| 515 | 3300025928 | Ga0207700_10015748 | Ga0207700_100157482 | 209 |
| 516 | 3300025941 | Ga0207711_10317721 | Ga0207711_103177212 | 209 |
| 517 | 3300025949 | Ga0207667_10296284 | Ga0207667_102962842 | 209 |
| 518 | 3300026023 | Ga0207677_10372683 | Ga0207677_103726832 | 209 |
| 519 | 3300026078 | Ga0207702_10000126 | Ga0207702_1000012638 | 209 |
| 520 | 3300026088 | Ga0207641_10083530 | Ga0207641_100835302 | 209 |
| 521 | 3300026121 | Ga0207683_10001340 | Ga0207683_100013402 | 209 |
| 522 | 3300028379 | Ga0268266_10483755 | Ga0268266_104837552 | 209 |
| 523 | 3300035111 | Ga0373923_0135165 | Ga0373923_0135165_331_1020 | 209 |
| 524 | 3300035119 | Ga0373956_0089214 | Ga0373956_0089214_234_923 | 209 |
| 525 | 3300035170 | Ga0373943_0028143 | Ga0373943_0028143_1922_2611 | 209 |
| 526 | 3300037068 | Ga0373925_0263518 | Ga0373925_0263518_273_962 | 209 |
| 527 | 3300037068 | Ga0373925_0442365 | Ga0373925_0442365_38_727 | 209 |
| 528 | 3300037418 | Ga0395900_0291201 | Ga0395900_0291201_460_1152 | 209 |
| 529 | 3300038443 | Ga0395901_0011779 | Ga0395901_0011779_3487_4179 | 209 |
| 530 | 3300039438 | Ga0436360_1256664 | Ga0436360_1256664_1089_1781 | 209 |
| 531 | 3300044842 | Ga0466957_0005921 | Ga0466957_0005921_4797_5489 | 209 |
| 532 | 3300045049 | Ga0466959_0030990 | Ga0466959_0030990_2495_3187 | 209 |
| 533 | 3300045836 | Ga0466958_0055054 | Ga0466958_0055054_911_1603 | 209 |
| 534 | 3300046472 | Ga0495580_0001449 | Ga0495580_0001449_8431_9120 | 209 |
| 535 | 3300046472 | Ga0495580_0133464 | Ga0495580_0133464_287_976 | 209 |
| 536 | 3300046517 | Ga0495630_0256501 | Ga0495630_0256501_465_1154 | 209 |
| 537 | 3300047319 | Ga0495674_0128534 | Ga0495674_0128534_966_1655 | 209 |
| 538 | 3300048903 | Ga0496100_0087309 | Ga0496100_0087309_91_780 | 209 |
| 539 | 3300048904 | Ga0496101_0237976 | Ga0496101_0237976_548_1237 | 209 |
| 540 | 3300048905 | Ga0496102_0157581 | Ga0496102_0157581_897_1586 | 209 |
| 541 | 3300048907 | Ga0496104_0069164 | Ga0496104_0069164_1871_2560 | 209 |
| 542 | 3300048908 | Ga0496105_0005338 | Ga0496105_0005338_4014_4703 | 209 |
| 543 | 3300048910 | Ga0496107_0011880 | Ga0496107_0011880_4069_4758 | 209 |
| 544 | 3300048911 | Ga0496108_0099899 | Ga0496108_0099899_1548_2237 | 209 |
| 545 | 3300048913 | Ga0496110_0067437 | Ga0496110_0067437_1296_1985 | 209 |
| 546 | 3300048914 | Ga0496111_0014244 | Ga0496111_0014244_432_1121 | 209 |
| 547 | 3300048917 | Ga0496114_0261912 | Ga0496114_0261912_808_1497 | 209 |
| 548 | 3300048918 | Ga0496115_0027561 | Ga0496115_0027561_2233_2922 | 209 |
| 549 | 3300048918 | Ga0496115_0261882 | Ga0496115_0261882_157_840 | 209 |
| 550 | 3300048921 | Ga0496118_0347342 | Ga0496118_0347342_68_751 | 209 |
| 551 | 3300061719 | Ga0466962_0044607 | Ga0466962_0044607_612_1304 | 209 |
| 552 | 3300005329 | Ga0070683_100477334 | Ga0070683_1004773341 | 210 |
| 553 | 3300005336 | Ga0070680_100107577 | Ga0070680_1001075772 | 210 |
| 554 | 3300005339 | Ga0070660_100001944 | Ga0070660_10000194413 | 210 |
| 555 | 3300005434 | Ga0070709_10048689 | Ga0070709_100486891 | 210 |
| 556 | 3300005436 | Ga0070713_100192501 | Ga0070713_1001925012 | 210 |
| 557 | 3300005437 | Ga0070710_10002441 | Ga0070710_100024412 | 210 |
| 558 | 3300005439 | Ga0070711_100005838 | Ga0070711_1000058389 | 210 |
| 559 | 3300005439 | Ga0070711_100017055 | Ga0070711_1000170555 | 210 |
| 560 | 3300005439 | Ga0070711_100020886 | Ga0070711_1000208863 | 210 |
| 561 | 3300005458 | Ga0070681_10004544 | Ga0070681_100045446 | 210 |
| 562 | 3300005458 | Ga0070681_10103453 | Ga0070681_101034533 | 210 |
| 563 | 3300005458 | Ga0070681_10219115 | Ga0070681_102191152 | 210 |
| 564 | 3300005471 | Ga0070698_100079119 | Ga0070698_1000791191 | 210 |
| 565 | 3300005530 | Ga0070679_100006626 | Ga0070679_1000066261 | 210 |
| 566 | 3300005530 | Ga0070679_100038870 | Ga0070679_1000388704 | 210 |
| 567 | 3300005535 | Ga0070684_100063932 | Ga0070684_1000639323 | 210 |
| 568 | 3300005535 | Ga0070684_100393456 | Ga0070684_1003934561 | 210 |
| 569 | 3300005539 | Ga0068853_100127758 | Ga0068853_1001277581 | 210 |
| 570 | 3300005543 | Ga0070672_100275735 | Ga0070672_1002757351 | 210 |
| 571 | 3300005548 | Ga0070665_101137226 | Ga0070665_1011372261 | 210 |
| 572 | 3300005563 | Ga0068855_100837078 | Ga0068855_1008370782 | 210 |
| 573 | 3300005563 | Ga0068855_100858428 | Ga0068855_1008584282 | 210 |
| 574 | 3300005564 | Ga0070664_100024089 | Ga0070664_1000240893 | 210 |
| 575 | 3300005615 | Ga0070702_100551212 | Ga0070702_1005512121 | 210 |
| 576 | 3300005616 | Ga0068852_100116503 | Ga0068852_1001165033 | 210 |
| 577 | 3300005618 | Ga0068864_100025488 | Ga0068864_1000254887 | 210 |
| 578 | 3300005840 | Ga0068870_10485385 | Ga0068870_104853851 | 210 |
| 579 | 3300006028 | Ga0070717_10022005 | Ga0070717_100220056 | 210 |
| 580 | 3300006028 | Ga0070717_10064475 | Ga0070717_100644752 | 210 |
| 581 | 3300006028 | Ga0070717_10178883 | Ga0070717_101788832 | 210 |
| 582 | 3300006163 | Ga0070715_10000961 | Ga0070715_100009612 | 210 |
| 583 | 3300006175 | Ga0070712_100043566 | Ga0070712_1000435664 | 210 |
| 584 | 3300006237 | Ga0097621_100030570 | Ga0097621_1000305705 | 210 |
| 585 | 3300006881 | Ga0068865_100381974 | Ga0068865_1003819742 | 210 |
| 586 | 3300009093 | Ga0105240_10238154 | Ga0105240_102381543 | 210 |
| 587 | 3300009093 | Ga0105240_10273675 | Ga0105240_102736753 | 210 |
| 588 | 3300009093 | Ga0105240_11362552 | Ga0105240_113625521 | 210 |
| 589 | 3300009098 | Ga0105245_10161198 | Ga0105245_101611982 | 210 |
| 590 | 3300009176 | Ga0105242_10418766 | Ga0105242_104187662 | 210 |
| 591 | 3300009177 | Ga0105248_10164724 | Ga0105248_101647243 | 210 |
| 592 | 3300009177 | Ga0105248_10440910 | Ga0105248_104409102 | 210 |
| 593 | 3300009545 | Ga0105237_10016711 | Ga0105237_100167118 | 210 |
| 594 | 3300009551 | Ga0105238_10005356 | Ga0105238_1000535613 | 210 |
| 595 | 3300009551 | Ga0105238_10288491 | Ga0105238_102884912 | 210 |
| 596 | 3300010159 | Ga0099796_10009831 | Ga0099796_100098312 | 210 |
| 597 | 3300011119 | Ga0105246_10597859 | Ga0105246_105978591 | 210 |
| 598 | 3300013105 | Ga0157369_10035175 | Ga0157369_100351755 | 210 |
| 599 | 3300013105 | Ga0157369_10104822 | Ga0157369_101048222 | 210 |
| 600 | 3300013306 | Ga0163162_10019668 | Ga0163162_100196686 | 210 |
| 601 | 3300013308 | Ga0157375_10034118 | Ga0157375_100341184 | 210 |
| 602 | 3300014325 | Ga0163163_10490357 | Ga0163163_104903572 | 210 |
| 603 | 3300014968 | Ga0157379_10090305 | Ga0157379_100903054 | 210 |
| 604 | 3300025297 | Ga0209758_1004785 | Ga0209758_10047852 | 210 |
| 605 | 3300025321 | Ga0207656_10045648 | Ga0207656_100456483 | 210 |
| 606 | 3300025898 | Ga0207692_10008992 | Ga0207692_100089922 | 210 |
| 607 | 3300025901 | Ga0207688_10059355 | Ga0207688_100593552 | 210 |
| 608 | 3300025906 | Ga0207699_10002766 | Ga0207699_100027664 | 210 |
| 609 | 3300025906 | Ga0207699_10354584 | Ga0207699_103545842 | 210 |
| 610 | 3300025912 | Ga0207707_10000950 | Ga0207707_100009501 | 210 |
| 611 | 3300025912 | Ga0207707_10004626 | Ga0207707_1000462613 | 210 |
| 612 | 3300025912 | Ga0207707_10052762 | Ga0207707_100527623 | 210 |
| 613 | 3300025913 | Ga0207695_10161968 | Ga0207695_101619681 | 210 |
| 614 | 3300025915 | Ga0207693_10013028 | Ga0207693_100130285 | 210 |
| 615 | 3300025916 | Ga0207663_10000098 | Ga0207663_1000009818 | 210 |
| 616 | 3300025916 | Ga0207663_10035907 | Ga0207663_100359073 | 210 |
| 617 | 3300025917 | Ga0207660_10002564 | Ga0207660_1000256413 | 210 |
| 618 | 3300025917 | Ga0207660_10027186 | Ga0207660_100271862 | 210 |
| 619 | 3300025917 | Ga0207660_10218329 | Ga0207660_102183292 | 210 |
| 620 | 3300025919 | Ga0207657_10000658 | Ga0207657_100006583 | 210 |
| 621 | 3300025921 | Ga0207652_10003470 | Ga0207652_100034703 | 210 |
| 622 | 3300025921 | Ga0207652_10264824 | Ga0207652_102648242 | 210 |
| 623 | 3300025922 | Ga0207646_10210051 | Ga0207646_102100512 | 210 |
| 624 | 3300025928 | Ga0207700_10091132 | Ga0207700_100911322 | 210 |
| 625 | 3300025928 | Ga0207700_10197106 | Ga0207700_101971062 | 210 |
| 626 | 3300025928 | Ga0207700_10411601 | Ga0207700_104116012 | 210 |
| 627 | 3300025929 | Ga0207664_10042775 | Ga0207664_100427753 | 210 |
| 628 | 3300025929 | Ga0207664_10043417 | Ga0207664_100434172 | 210 |
| 629 | 3300025938 | Ga0207704_10296267 | Ga0207704_102962672 | 210 |
| 630 | 3300025939 | Ga0207665_10000355 | Ga0207665_1000035520 | 210 |
| 631 | 3300025941 | Ga0207711_10174186 | Ga0207711_101741862 | 210 |
| 632 | 3300025941 | Ga0207711_10233979 | Ga0207711_102339792 | 210 |
| 633 | 3300025944 | Ga0207661_10001747 | Ga0207661_100017479 | 210 |
| 634 | 3300025944 | Ga0207661_10051941 | Ga0207661_100519413 | 210 |
| 635 | 3300025944 | Ga0207661_10262245 | Ga0207661_102622452 | 210 |
| 636 | 3300025944 | Ga0207661_10649613 | Ga0207661_106496132 | 210 |
| 637 | 3300025949 | Ga0207667_10215773 | Ga0207667_102157733 | 210 |
| 638 | 3300025949 | Ga0207667_10682469 | Ga0207667_106824692 | 210 |
| 639 | 3300026023 | Ga0207677_10020108 | Ga0207677_100201082 | 210 |
| 640 | 3300026041 | Ga0207639_10043047 | Ga0207639_100430472 | 210 |
| 641 | 3300026041 | Ga0207639_10149674 | Ga0207639_101496742 | 210 |
| 642 | 3300026067 | Ga0207678_10111029 | Ga0207678_101110292 | 210 |
| 643 | 3300026088 | Ga0207641_10866328 | Ga0207641_108663282 | 210 |
| 644 | 3300026095 | Ga0207676_10190935 | Ga0207676_101909352 | 210 |
| 645 | 3300026116 | Ga0207674_10261908 | Ga0207674_102619082 | 210 |
| 646 | 3300026142 | Ga0207698_10336335 | Ga0207698_103363352 | 210 |
| 647 | 3300028379 | Ga0268266_10925741 | Ga0268266_109257412 | 210 |
| 648 | 3300028794 | Ga0307515_10045960 | Ga0307515_100459602 | 210 |
| 649 | 3300031456 | Ga0307513_10029676 | Ga0307513_100296762 | 210 |
| 650 | 3300033180 | Ga0307510_10018144 | Ga0307510_100181444 | 210 |
| 651 | 3300033180 | Ga0307510_10125011 | Ga0307510_101250113 | 210 |
| 652 | 3300035725 | Ga0373947_0047946 | Ga0373947_0047946_1520_2212 | 210 |
| 653 | 3300037068 | Ga0373925_0157538 | Ga0373925_0157538_146_838 | 210 |
| 654 | 3300037418 | Ga0395900_0288678 | Ga0395900_0288678_309_992 | 210 |
| 655 | 3300037466 | Ga0395898_0436159 | Ga0395898_0436159_202_885 | 210 |
| 656 | 3300037471 | Ga0395905_0040677 | Ga0395905_0040677_2476_3159 | 210 |
| 657 | 3300037471 | Ga0395905_0136213 | Ga0395905_0136213_1127_1819 | 210 |
| 658 | 3300039450 | Ga0436363_0842295 | Ga0436363_0842295_222_914 | 210 |
| 659 | 3300044842 | Ga0466957_0067739 | Ga0466957_0067739_329_1012 | 210 |
| 660 | 3300045976 | Ga0466967_0863177 | Ga0466967_0863177_46_738 | 210 |
| 661 | 3300046455 | Ga0495603_0006388 | Ga0495603_0006388_6262_6954 | 210 |
| 662 | 3300046455 | Ga0495603_0083749 | Ga0495603_0083749_210_902 | 210 |
| 663 | 3300046516 | Ga0495628_0410575 | Ga0495628_0410575_104_796 | 210 |
| 664 | 3300046526 | Ga0495666_0042687 | Ga0495666_0042687_983_1675 | 210 |
| 665 | 3300046683 | Ga0495658_0171470 | Ga0495658_0171470_371_1063 | 210 |
| 666 | 3300046690 | Ga0495624_0137708 | Ga0495624_0137708_771_1463 | 210 |
| 667 | 3300047320 | Ga0495672_0039595 | Ga0495672_0039595_1984_2676 | 210 |
| 668 | 3300047323 | Ga0495683_0246945 | Ga0495683_0246945_56_748 | 210 |
| 669 | 3300048904 | Ga0496101_0020482 | Ga0496101_0020482_2613_3305 | 210 |
| 670 | 3300048904 | Ga0496101_0275356 | Ga0496101_0275356_86_769 | 210 |
| 671 | 3300048905 | Ga0496102_0107202 | Ga0496102_0107202_135_827 | 210 |
| 672 | 3300048906 | Ga0496103_0226854 | Ga0496103_0226854_311_1003 | 210 |
| 673 | 3300048907 | Ga0496104_0118307 | Ga0496104_0118307_638_1330 | 210 |
| 674 | 3300048908 | Ga0496105_0019704 | Ga0496105_0019704_2709_3401 | 210 |
| 675 | 3300048909 | Ga0496106_0019968 | Ga0496106_0019968_2675_3367 | 210 |
| 676 | 3300048910 | Ga0496107_0007348 | Ga0496107_0007348_409_1101 | 210 |
| 677 | 3300048911 | Ga0496108_0018223 | Ga0496108_0018223_1878_2570 | 210 |
| 678 | 3300048912 | Ga0496109_0030334 | Ga0496109_0030334_2943_3635 | 210 |
| 679 | 3300048912 | Ga0496109_0188433 | Ga0496109_0188433_167_859 | 210 |
| 680 | 3300048913 | Ga0496110_0023813 | Ga0496110_0023813_1868_2560 | 210 |
| 681 | 3300048915 | Ga0496112_0075363 | Ga0496112_0075363_355_1047 | 210 |
| 682 | 3300048916 | Ga0496113_0036976 | Ga0496113_0036976_2738_3430 | 210 |
| 683 | 3300048916 | Ga0496113_0288256 | Ga0496113_0288256_339_1031 | 210 |
| 684 | 3300048917 | Ga0496114_0094109 | Ga0496114_0094109_1575_2267 | 210 |
| 685 | 3300048917 | Ga0496114_0170210 | Ga0496114_0170210_659_1351 | 210 |
| 686 | 3300048918 | Ga0496115_0006273 | Ga0496115_0006273_1613_2305 | 210 |
| 687 | 3300048918 | Ga0496115_0165195 | Ga0496115_0165195_1083_1775 | 210 |
| 688 | 3300048918 | Ga0496115_0354614 | Ga0496115_0354614_305_997 | 210 |
| 689 | 3300048919 | Ga0496116_0017742 | Ga0496116_0017742_614_1297 | 210 |
| 690 | 3300048920 | Ga0496117_0040858 | Ga0496117_0040858_2275_2958 | 210 |
| 691 | 3300048921 | Ga0496118_0041838 | Ga0496118_0041838_553_1236 | 210 |
| 692 | 3300048929 | Ga0496126_0001122 | Ga0496126_0001122_39565_40257 | 210 |
| 693 | 3300048929 | Ga0496126_0048493 | Ga0496126_0048493_2742_3434 | 210 |
| 694 | 3300048929 | Ga0496126_0097147 | Ga0496126_0097147_1733_2425 | 210 |
| 695 | 3300049586 | Ga0501070_0005092 | Ga0501070_0005092_10015_10719 | 210 |
| 696 | 3300049586 | Ga0501070_0101042 | Ga0501070_0101042_1457_2149 | 210 |
| 697 | 3300049589 | Ga0501073_0057668 | Ga0501073_0057668_1627_2319 | 210 |
| 698 | 3300049589 | Ga0501073_0084887 | Ga0501073_0084887_165_869 | 210 |
| 699 | 3300049590 | Ga0501074_0008292 | Ga0501074_0008292_4956_5660 | 210 |
| 700 | 3300049590 | Ga0501074_0012164 | Ga0501074_0012164_929_1621 | 210 |
| 701 | 3300049741 | Ga0501079_0256190 | Ga0501079_0256190_148_852 | 210 |
| 702 | 3300049823 | Ga0501044_0093205 | Ga0501044_0093205_2309_3001 | 210 |
| 703 | 3300053080 | Ga0500635_0008149 | Ga0500635_0008149_1817_2509 | 210 |
| 704 | 3300053085 | Ga0495619_0028070 | Ga0495619_0028070_645_1337 | 210 |
| 705 | 3300053102 | Ga0500554_009687 | Ga0500554_009687_1202_1894 | 210 |
| 706 | 3300053108 | Ga0500562_020239 | Ga0500562_020239_326_1018 | 210 |
| 707 | 3300053121 | Ga0500607_040291 | Ga0500607_040291_1181_1864 | 210 |
| 708 | 3300053150 | Ga0500603_002409 | Ga0500603_002409_538_1230 | 210 |
| 709 | 3300053151 | Ga0500604_0109479 | Ga0500604_0109479_65_754 | 210 |
| 710 | 3300053178 | Ga0500637_0012756 | Ga0500637_0012756_653_1345 | 210 |
| 711 | 2010549000 | RicEn_C1063 | RicEn_19680 | 211 |
| 712 | 3300001989 | JGI24739J22299_10071180 | JGI24739J22299_100711802 | 211 |
| 713 | 3300003215 | JGI25153J46596_10003431 | JGI25153J46596_100034316 | 211 |
| 714 | 3300003762 | Ga0055542_1011589 | Ga0055542_10115892 | 211 |
| 715 | 3300005327 | Ga0070658_10004762 | Ga0070658_1000476211 | 211 |
| 716 | 3300005339 | Ga0070660_100069539 | Ga0070660_1000695393 | 211 |
| 717 | 3300005434 | Ga0070709_10078036 | Ga0070709_100780361 | 211 |
| 718 | 3300005435 | Ga0070714_100091008 | Ga0070714_1000910082 | 211 |
| 719 | 3300005437 | Ga0070710_10159238 | Ga0070710_101592382 | 211 |
| 720 | 3300005439 | Ga0070711_100002925 | Ga0070711_1000029253 | 211 |
| 721 | 3300005439 | Ga0070711_100913954 | Ga0070711_1009139541 | 211 |
| 722 | 3300005547 | Ga0070693_100128664 | Ga0070693_1001286641 | 211 |
| 723 | 3300005563 | Ga0068855_100073110 | Ga0068855_1000731103 | 211 |
| 724 | 3300006175 | Ga0070712_100068339 | Ga0070712_1000683393 | 211 |
| 725 | 3300006175 | Ga0070712_100070488 | Ga0070712_1000704882 | 211 |
| 726 | 3300006195 | Ga0075366_10411529 | Ga0075366_104115292 | 211 |
| 727 | 3300006353 | Ga0075370_10060519 | Ga0075370_100605191 | 211 |
| 728 | 3300009093 | Ga0105240_10008282 | Ga0105240_100082822 | 211 |
| 729 | 3300009093 | Ga0105240_10143380 | Ga0105240_101433803 | 211 |
| 730 | 3300009174 | Ga0105241_10053828 | Ga0105241_100538283 | 211 |
| 731 | 3300009174 | Ga0105241_10072568 | Ga0105241_100725682 | 211 |
| 732 | 3300009545 | Ga0105237_10006673 | Ga0105237_1000667313 | 211 |
| 733 | 3300009551 | Ga0105238_10157681 | Ga0105238_101576812 | 211 |
| 734 | 3300013102 | Ga0157371_10013955 | Ga0157371_100139552 | 211 |
| 735 | 3300013104 | Ga0157370_10110323 | Ga0157370_101103233 | 211 |
| 736 | 3300013104 | Ga0157370_10161675 | Ga0157370_101616752 | 211 |
| 737 | 3300013105 | Ga0157369_10587395 | Ga0157369_105873952 | 211 |
| 738 | 3300020082 | Ga0206353_11806622 | Ga0206353_118066222 | 211 |
| 739 | 3300021388 | Ga0213875_10056323 | Ga0213875_100563232 | 211 |
| 740 | 3300025254 | Ga0209148_1000500 | Ga0209148_10005008 | 211 |
| 741 | 3300025297 | Ga0209758_1001533 | Ga0209758_100153321 | 211 |
| 742 | 3300025912 | Ga0207707_10232394 | Ga0207707_102323942 | 211 |
| 743 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008141 | 211 |
| 744 | 3300025913 | Ga0207695_10084653 | Ga0207695_100846536 | 211 |
| 745 | 3300025914 | Ga0207671_10003142 | Ga0207671_1000314214 | 211 |
| 746 | 3300025915 | Ga0207693_10010099 | Ga0207693_100100995 | 211 |
| 747 | 3300025915 | Ga0207693_10059172 | Ga0207693_100591723 | 211 |
| 748 | 3300025915 | Ga0207693_10208751 | Ga0207693_102087512 | 211 |
| 749 | 3300025919 | Ga0207657_10155771 | Ga0207657_101557712 | 211 |
| 750 | 3300025921 | Ga0207652_10088350 | Ga0207652_100883503 | 211 |
| 751 | 3300025924 | Ga0207694_10190212 | Ga0207694_101902122 | 211 |
| 752 | 3300025927 | Ga0207687_10331011 | Ga0207687_103310111 | 211 |
| 753 | 3300025939 | Ga0207665_10432670 | Ga0207665_104326702 | 211 |
| 754 | 3300025981 | Ga0207640_10139666 | Ga0207640_101396661 | 211 |
| 755 | 3300026041 | Ga0207639_10486835 | Ga0207639_104868352 | 211 |
| 756 | 3300027363 | Ga0209700_100005 | Ga0209700_100005296 | 211 |
| 757 | 3300031235 | Ga0265330_10045567 | Ga0265330_100455673 | 211 |
| 758 | 3300031235 | Ga0265330_10088362 | Ga0265330_100883622 | 211 |
| 759 | 3300031241 | Ga0265325_10000044 | Ga0265325_1000004413 | 211 |
| 760 | 3300031241 | Ga0265325_10011538 | Ga0265325_100115384 | 211 |
| 761 | 3300031241 | Ga0265325_10045607 | Ga0265325_100456072 | 211 |
| 762 | 3300031249 | Ga0265339_10019022 | Ga0265339_100190224 | 211 |
| 763 | 3300031249 | Ga0265339_10141434 | Ga0265339_101414341 | 211 |
| 764 | 3300031249 | Ga0265339_10180991 | Ga0265339_101809912 | 211 |
| 765 | 3300031344 | Ga0265316_10042156 | Ga0265316_100421563 | 211 |
| 766 | 3300031595 | Ga0265313_10009939 | Ga0265313_100099394 | 211 |
| 767 | 3300031711 | Ga0265314_10008091 | Ga0265314_100080917 | 211 |
| 768 | 3300031711 | Ga0265314_10050093 | Ga0265314_100500933 | 211 |
| 769 | 3300032133 | Ga0316583_10000267 | Ga0316583_100002675 | 211 |
| 770 | 3300035083 | Ga0373926_0042232 | Ga0373926_0042232_814_1506 | 211 |
| 771 | 3300035114 | Ga0373939_0000811 | Ga0373939_0000811_3706_4398 | 211 |
| 772 | 3300035117 | Ga0373953_0048107 | Ga0373953_0048107_34_726 | 211 |
| 773 | 3300035119 | Ga0373956_0015090 | Ga0373956_0015090_676_1368 | 211 |
| 774 | 3300035172 | Ga0373955_0015065 | Ga0373955_0015065_609_1301 | 211 |
| 775 | 3300035410 | Ga0373924_0021198 | Ga0373924_0021198_973_1665 | 211 |
| 776 | 3300035692 | Ga0373935_0044130 | Ga0373935_0044130_157_849 | 211 |
| 777 | 3300035695 | Ga0373927_0027467 | Ga0373927_0027467_1186_1878 | 211 |
| 778 | 3300035724 | Ga0373933_0012562 | Ga0373933_0012562_3821_4513 | 211 |
| 779 | 3300037466 | Ga0395898_0185548 | Ga0395898_0185548_827_1519 | 211 |
| 780 | 3300037853 | Ga0436364_1535696 | Ga0436364_1535696_275_970 | 211 |
| 781 | 3300038443 | Ga0395901_0123610 | Ga0395901_0123610_1700_2392 | 211 |
| 782 | 3300045051 | Ga0451576_1082748 | Ga0451576_1082748_57_755 | 211 |
| 783 | 3300046461 | Ga0495641_0130608 | Ga0495641_0130608_147_839 | 211 |
| 784 | 3300046462 | Ga0495651_0064165 | Ga0495651_0064165_1891_2583 | 211 |
| 785 | 3300046463 | Ga0495653_0141442 | Ga0495653_0141442_79_771 | 211 |
| 786 | 3300046472 | Ga0495580_0113921 | Ga0495580_0113921_40_732 | 211 |
| 787 | 3300046473 | Ga0495582_0120766 | Ga0495582_0120766_539_1231 | 211 |
| 788 | 3300046475 | Ga0495639_0044746 | Ga0495639_0044746_1175_1867 | 211 |
| 789 | 3300046477 | Ga0495664_0006747 | Ga0495664_0006747_1314_2006 | 211 |
| 790 | 3300046492 | Ga0495585_0053425 | Ga0495585_0053425_467_1150 | 211 |
| 791 | 3300046499 | Ga0495594_0066599 | Ga0495594_0066599_1283_1975 | 211 |
| 792 | 3300046511 | Ga0495608_0121182 | Ga0495608_0121182_331_1023 | 211 |
| 793 | 3300046516 | Ga0495628_0015673 | Ga0495628_0015673_4975_5667 | 211 |
| 794 | 3300046517 | Ga0495630_0402568 | Ga0495630_0402568_217_909 | 211 |
| 795 | 3300046520 | Ga0495637_0113053 | Ga0495637_0113053_200_892 | 211 |
| 796 | 3300046526 | Ga0495666_0051380 | Ga0495666_0051380_657_1349 | 211 |
| 797 | 3300046529 | Ga0495652_0083205 | Ga0495652_0083205_1541_2233 | 211 |
| 798 | 3300046531 | Ga0495665_0038334 | Ga0495665_0038334_414_1106 | 211 |
| 799 | 3300046533 | Ga0495640_0027667 | Ga0495640_0027667_2680_3372 | 211 |
| 800 | 3300046533 | Ga0495640_0103913 | Ga0495640_0103913_759_1451 | 211 |
| 801 | 3300046536 | Ga0495587_0011641 | Ga0495587_0011641_3727_4419 | 211 |
| 802 | 3300046543 | Ga0495645_0001025 | Ga0495645_0001025_742_1434 | 211 |
| 803 | 3300046559 | Ga0495667_0001273 | Ga0495667_0001273_10296_10988 | 211 |
| 804 | 3300046642 | Ga0495634_0053454 | Ga0495634_0053454_1244_1936 | 211 |
| 805 | 3300046663 | Ga0495635_0114378 | Ga0495635_0114378_103_795 | 211 |
| 806 | 3300046674 | Ga0495588_0006176 | Ga0495588_0006176_805_1497 | 211 |
| 807 | 3300046678 | Ga0495599_0007196 | Ga0495599_0007196_4349_5041 | 211 |
| 808 | 3300046679 | Ga0495623_0013803 | Ga0495623_0013803_472_1164 | 211 |
| 809 | 3300046680 | Ga0495646_0067005 | Ga0495646_0067005_878_1570 | 211 |
| 810 | 3300046681 | Ga0495647_0029905 | Ga0495647_0029905_901_1593 | 211 |
| 811 | 3300046690 | Ga0495624_0020197 | Ga0495624_0020197_2992_3684 | 211 |
| 812 | 3300046809 | Ga0495600_0049859 | Ga0495600_0049859_1142_1834 | 211 |
| 813 | 3300047317 | Ga0495604_0010726 | Ga0495604_0010726_5835_6527 | 211 |
| 814 | 3300047319 | Ga0495674_0014178 | Ga0495674_0014178_4435_5127 | 211 |
| 815 | 3300047319 | Ga0495674_0072773 | Ga0495674_0072773_604_1296 | 211 |
| 816 | 3300047321 | Ga0495676_0084983 | Ga0495676_0084983_179_871 | 211 |
| 817 | 3300047322 | Ga0495680_0009088 | Ga0495680_0009088_5197_5889 | 211 |
| 818 | 3300047322 | Ga0495680_0284136 | Ga0495680_0284136_132_824 | 211 |
| 819 | 3300047444 | Ga0495675_0198151 | Ga0495675_0198151_28_720 | 211 |
| 820 | 3300047471 | Ga0495684_0051684 | Ga0495684_0051684_525_1217 | 211 |
| 821 | 3300047471 | Ga0495684_0103345 | Ga0495684_0103345_929_1621 | 211 |
| 822 | 3300048088 | Ga0495602_0000726 | Ga0495602_0000726_13167_13859 | 211 |
| 823 | 3300048089 | Ga0495614_0050196 | Ga0495614_0050196_1057_1749 | 211 |
| 824 | 3300048906 | Ga0496103_0000323 | Ga0496103_0000323_37403_38119 | 211 |
| 825 | 3300048907 | Ga0496104_0000580 | Ga0496104_0000580_5718_6410 | 211 |
| 826 | 3300048907 | Ga0496104_0916199 | Ga0496104_0916199_80_763 | 211 |
| 827 | 3300048908 | Ga0496105_0000402 | Ga0496105_0000402_23398_24090 | 211 |
| 828 | 3300048909 | Ga0496106_0673926 | Ga0496106_0673926_43_726 | 211 |
| 829 | 3300048912 | Ga0496109_0480397 | Ga0496109_0480397_91_774 | 211 |
| 830 | 3300048913 | Ga0496110_0232617 | Ga0496110_0232617_222_905 | 211 |
| 831 | 3300048917 | Ga0496114_0387221 | Ga0496114_0387221_24_716 | 211 |
| 832 | 3300048919 | Ga0496116_0000691 | Ga0496116_0000691_5682_6398 | 211 |
| 833 | 3300048920 | Ga0496117_0000018 | Ga0496117_0000018_441495_442211 | 211 |
| 834 | 3300048921 | Ga0496118_0000013 | Ga0496118_0000013_37403_38119 | 211 |
| 835 | 3300048929 | Ga0496126_0000902 | Ga0496126_0000902_50598_51314 | 211 |
| 836 | 3300049568 | Ga0501031_0035285 | Ga0501031_0035285_2502_3194 | 211 |
| 837 | 3300049569 | Ga0501032_0140627 | Ga0501032_0140627_322_1014 | 211 |
| 838 | 3300049569 | Ga0501032_0190204 | Ga0501032_0190204_287_979 | 211 |
| 839 | 3300049570 | Ga0501033_0076639 | Ga0501033_0076639_293_991 | 211 |
| 840 | 3300049571 | Ga0501034_0190459 | Ga0501034_0190459_182_880 | 211 |
| 841 | 3300049571 | Ga0501034_0423571 | Ga0501034_0423571_290_982 | 211 |
| 842 | 3300049572 | Ga0501036_0116806 | Ga0501036_0116806_83_775 | 211 |
| 843 | 3300049573 | Ga0501037_0369219 | Ga0501037_0369219_11_709 | 211 |
| 844 | 3300049574 | Ga0501038_0037203 | Ga0501038_0037203_2245_2943 | 211 |
| 845 | 3300049575 | Ga0501039_0184272 | Ga0501039_0184272_748_1440 | 211 |
| 846 | 3300049575 | Ga0501039_0209369 | Ga0501039_0209369_286_978 | 211 |
| 847 | 3300049579 | Ga0501043_0154376 | Ga0501043_0154376_1033_1725 | 211 |
| 848 | 3300049579 | Ga0501043_0416932 | Ga0501043_0416932_160_858 | 211 |
| 849 | 3300049580 | Ga0501046_0615463 | Ga0501046_0615463_34_729 | 211 |
| 850 | 3300049581 | Ga0501047_0098128 | Ga0501047_0098128_365_1063 | 211 |
| 851 | 3300049581 | Ga0501047_0314286 | Ga0501047_0314286_639_1331 | 211 |
| 852 | 3300049582 | Ga0501048_0365352 | Ga0501048_0365352_293_985 | 211 |
| 853 | 3300049583 | Ga0501067_0298735 | Ga0501067_0298735_92_784 | 211 |
| 854 | 3300049823 | Ga0501044_0080499 | Ga0501044_0080499_2313_3089 | 211 |
| 855 | 3300049823 | Ga0501044_0132475 | Ga0501044_0132475_986_1678 | 211 |
| 856 | 3300050491 | nmdc:mga00v17_278130_c1 | nmdc:mga00v17_278130_c1_67_759 | 211 |
| 857 | 3300050496 | nmdc:mga07m45_343835_c1 | nmdc:mga07m45_343835_c1_87_779 | 211 |
| 858 | 3300053077 | Ga0495601_0000232 | Ga0495601_0000232_10603_11295 | 211 |
| 859 | 3300053077 | Ga0495601_0014166 | Ga0495601_0014166_3627_4319 | 211 |
| 860 | 3300053078 | Ga0495612_0000608 | Ga0495612_0000608_2659_3351 | 211 |
| 861 | 3300053078 | Ga0495612_0064474 | Ga0495612_0064474_466_1158 | 211 |
| 862 | 3300053080 | Ga0500635_0067466 | Ga0500635_0067466_84_767 | 211 |
| 863 | 3300053084 | Ga0495595_0000284 | Ga0495595_0000284_651_1343 | 211 |
| 864 | 3300053085 | Ga0495619_0001165 | Ga0495619_0001165_4409_5101 | 211 |
| 865 | 3300053085 | Ga0495619_0001565 | Ga0495619_0001565_737_1429 | 211 |
| 866 | 3300053092 | Ga0500583_0036800 | Ga0500583_0036800_786_1469 | 211 |
| 867 | 3300053096 | Ga0500641_0131994 | Ga0500641_0131994_89_781 | 211 |
| 868 | 3300053103 | Ga0500555_004027 | Ga0500555_004027_2909_3592 | 211 |
| 869 | 3300053105 | Ga0500557_000052 | Ga0500557_000052_47087_47770 | 211 |
| 870 | 3300053111 | Ga0500572_036126 | Ga0500572_036126_223_906 | 211 |
| 871 | 3300053117 | Ga0500593_012965 | Ga0500593_012965_1441_2133 | 211 |
| 872 | 3300053122 | Ga0500608_078010 | Ga0500608_078010_134_817 | 211 |
| 873 | 3300053130 | Ga0500642_0000468 | Ga0500642_0000468_9026_9709 | 211 |
| 874 | 3300053130 | Ga0500642_0104047 | Ga0500642_0104047_309_992 | 211 |
| 875 | 3300053134 | Ga0500658_0051537 | Ga0500658_0051537_428_1111 | 211 |
| 876 | 3300053136 | Ga0500559_0023353 | Ga0500559_0023353_217_900 | 211 |
| 877 | 3300053154 | Ga0500619_038193 | Ga0500619_038193_633_1316 | 211 |
| 878 | 3300053155 | Ga0500620_001550 | Ga0500620_001550_1614_2297 | 211 |
| 879 | 3300053162 | Ga0500638_026391 | Ga0500638_026391_227_910 | 211 |
| 880 | 3300053177 | Ga0500636_0001217 | Ga0500636_0001217_4890_5573 | 211 |
| 881 | 3300053729 | Ga0500625_038855 | Ga0500625_038855_801_1484 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pcn-assembly1.cif.gz_A | crystal structure of s-adenosylmethionine: 2-dimethylmenaquinone methyltransferase (gk_1813) from geobacillus kaustophilus hta426 | 0.9092 | 34 | 160 |
| 1j3l-assembly1.cif.gz_A | structure of the rna-processing inhibitor rraa from thermus thermophilis | 0.895 | 35 | 160 |
| 3c8o-assembly1.cif.gz_B | the crystal structure of rraa from pao1 | 0.8917 | 20 | 160 |
| 1vi4-assembly1.cif.gz_A | crystal structure of regulator of ribonuclease activity a protein 1 | 0.8907 | 34 | 160 |
| 1nxj-assembly1.cif.gz_A | structure of rv3853 from mycobacterium tuberculosis | 0.887 | 32 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3nojA01 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.9757 | 21 | 160 | 3.50.30.40 |
| 2pcnA00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.9092 | 34 | 160 | 3.50.30.40 |
| 3nojA01 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.8943 | 21 | 160 | 3.50.30.40 |
| af_P0A8R0_1_161_3.50.30.40 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.8919 | 20 | 160 | 3.50.30.40 |
| 1j3lD00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.8903 | 34 | 160 | 3.50.30.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M8V5U8-F1-model_v4 | deleted | 0.9818 | 37 | 135 |
|
| AF-A0A7X5SB67-F1-model_v4 | 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase (EC 4.1.3.17) | 0.9774 | 2 | 160 |
GO:0046872
GO:0047443 |
| AF-A0A7W1K333-F1-model_v4 | Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (RraA-like protein) | 0.9766 | 2 | 131 |
GO:0046872
|
| AF-A0A2V8LMN1-F1-model_v4 | 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase | 0.9764 | 1 | 160 |
GO:0046872
|
| AF-A0A7W9G7T8-F1-model_v4 | Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (RraA-like protein) | 0.9736 | 1 | 160 |
GO:0046872
GO:0047443 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar