F484468

General Info

Members Datasets Scaffolds Average Seq Length
879 374 1758 125

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0016253|Ga0495638_0016253_3032_3466
Length 144
Sequence VEEIKMTDPNDMVSVRYMVDDVEASVAFYTKFLGFKVLNQFPPFADVARGQLRLLLSGPASSAGRPMPDGARPAPGGWNRIHLIVEDIESEVARLRDAGAPFRNDIVEGPGGKQILLQDPSGNVIELFQPAAVNSSAPGDGKRT

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
173 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
174 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
175 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
176 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
227 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
228 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
229 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
230 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
231 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
232 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
233 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
234 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
235 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
288 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
289 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
315 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
360 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
361 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
362 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
363 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
364 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
365 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
366 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
367 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
370 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
371 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
372 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
373 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
374 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.11
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0
Rhizoplane 9.33
Rhizosphere 84.41
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0016253 3300046460 Bacteria 4987
2 MBSR1b_contig_1334495 2162886012 Bacteria 1685
3 JGI24735J21928_10086629 3300002067 Unclassified 898
4 JGI25151J46595_10000212 3300003187 Bacteria 70741
5 JGI25153J46596_10096618 3300003215 Bacteria 703
6 JGI25407J50210_10009694 3300003373 Bacteria 2444
7 JGI25407J50210_10044878 3300003373 Bacteria 1128
8 JGI25407J50210_10084316 3300003373 Unclassified 787
9 Ga0065712_10169127 3300005290 Unclassified 1254
10 Ga0065715_10102665 3300005293 Bacteria 3095
11 Ga0070658_11458975 3300005327 Bacteria 593
12 Ga0070676_10478590 3300005328 Bacteria 880
13 Ga0070683_100549541 3300005329 Bacteria 1104
14 Ga0070683_101678492 3300005329 Bacteria 611
15 Ga0070683_102285572 3300005329 Bacteria 519
16 Ga0068869_100564734 3300005334 Unclassified 957
17 Ga0070680_100629873 3300005336 Bacteria 921
18 Ga0070682_100123141 3300005337 Bacteria 1744
19 Ga0068868_100227466 3300005338 Bacteria 1564
20 Ga0070660_100082340 3300005339 Bacteria 2527
21 Ga0070660_100696736 3300005339 Bacteria 851
22 Ga0070691_10511583 3300005341 Bacteria 696
23 Ga0070661_100509464 3300005344 Bacteria 964
24 Ga0070668_100207119 3300005347 Bacteria 1612
25 Ga0070675_100764365 3300005354 Bacteria 882
26 Ga0070671_100243193 3300005355 Bacteria 1528
27 Ga0070674_100011909 3300005356 Bacteria 5317
28 Ga0070674_102023870 3300005356 Bacteria 525
29 Ga0070673_100139027 3300005364 Bacteria 2047
30 Ga0070673_100140608 3300005364 Bacteria 2036
31 Ga0070673_100511680 3300005364 Bacteria 1087
32 Ga0070673_102267593 3300005364 Bacteria 516
33 Ga0070688_100118820 3300005365 Bacteria 1768
34 Ga0070659_100566443 3300005366 Unclassified 974
35 Ga0070667_100042271 3300005367 Bacteria 3824
36 Ga0070667_100403174 3300005367 Bacteria 1245
37 Ga0070667_100681213 3300005367 Bacteria 950
38 Ga0070714_100200894 3300005435 Bacteria 1823
39 Ga0070714_100977221 3300005435 Bacteria 823
40 Ga0070714_101747765 3300005435 Unclassified 607
41 Ga0070714_101870618 3300005435 Bacteria 586
42 Ga0070713_100494621 3300005436 Bacteria 1153
43 Ga0070713_100497968 3300005436 Bacteria 1149
44 Ga0070713_101035222 3300005436 Bacteria 792
45 Ga0070710_10571193 3300005437 Bacteria 783
46 Ga0070701_11027795 3300005438 Bacteria 576
47 Ga0070711_100823877 3300005439 Bacteria 788
48 Ga0070700_100265534 3300005441 Bacteria 1238
49 Ga0070694_100949767 3300005444 Bacteria 712
50 Ga0070678_100905053 3300005456 Unclassified 807
51 Ga0070678_101481154 3300005456 Bacteria 635
52 Ga0070662_100063045 3300005457 Bacteria 2710
53 Ga0070662_100087641 3300005457 Bacteria 2331
54 Ga0068867_100869395 3300005459 Bacteria 809
55 Ga0068867_101588683 3300005459 Bacteria 611
56 Ga0070685_10010442 3300005466 Bacteria 4826
57 Ga0070706_100018357 3300005467 Bacteria 6453
58 Ga0070706_101176196 3300005467 Bacteria 705
59 Ga0070684_100123760 3300005535 Bacteria 2328
60 Ga0070684_101025683 3300005535 Bacteria 774
61 Ga0070697_100933846 3300005536 Bacteria 770
62 Ga0068853_100235523 3300005539 Bacteria 1676
63 Ga0068853_101196107 3300005539 Bacteria 734
64 Ga0068853_101326982 3300005539 Bacteria 695
65 Ga0070672_100613347 3300005543 Bacteria 948
66 Ga0070672_101083506 3300005543 Unclassified 712
67 Ga0070686_101172175 3300005544 Bacteria 637
68 Ga0070693_100100229 3300005547 Bacteria 1763
69 Ga0070665_100000921 3300005548 Bacteria 37702
70 Ga0070665_100078778 3300005548 Bacteria 3302
71 Ga0070704_100449255 3300005549 Bacteria 1109
72 Ga0068855_100004796 3300005563 Bacteria 16509
73 Ga0068855_100006221 3300005563 Bacteria 14544
74 Ga0070664_100099451 3300005564 Bacteria 2528
75 Ga0068857_101255884 3300005577 Bacteria 718
76 Ga0068854_101645107 3300005578 Archaea 586
77 Ga0068856_100637522 3300005614 Bacteria 1086
78 Ga0068856_100838916 3300005614 Unclassified 938
79 Ga0070702_100531951 3300005615 Bacteria 869
80 Ga0068852_100003495 3300005616 Bacteria 10988
81 Ga0068852_100116851 3300005616 Bacteria 2435
82 Ga0068859_100012311 3300005617 Bacteria 8607
83 Ga0068859_100103353 3300005617 Unclassified 2907
84 Ga0068859_100996111 3300005617 Bacteria 920
85 Ga0068864_100029601 3300005618 Bacteria 4639
86 Ga0068864_100062768 3300005618 Bacteria 3219
87 Ga0068864_100087564 3300005618 Bacteria 2742
88 Ga0068864_101784845 3300005618 Bacteria 620
89 Ga0068864_102347351 3300005618 Bacteria 540
90 Ga0068866_10854979 3300005718 Bacteria 636
91 Ga0068866_10930825 3300005718 Bacteria 613
92 Ga0068861_100043259 3300005719 Bacteria 3380
93 Ga0068861_100174323 3300005719 Bacteria 1785
94 Ga0068861_101343100 3300005719 Bacteria 696
95 Ga0068863_100305864 3300005841 Bacteria 1543
96 Ga0068858_100002104 3300005842 Bacteria 20208
97 Ga0068858_100012612 3300005842 Bacteria 7968
98 Ga0068862_100430158 3300005844 Bacteria 1240
99 Ga0068862_101007505 3300005844 Bacteria 824
100 Ga0081455_10000808 3300005937 Bacteria 40304
101 Ga0081455_10007587 3300005937 Bacteria 11401
102 Ga0081455_10010606 3300005937 Bacteria 9323
103 Ga0081455_10016117 3300005937 Bacteria 7226
104 Ga0081455_10119701 3300005937 Bacteria 2076
105 Ga0081455_10693523 3300005937 Bacteria 650
106 Ga0081455_10704012 3300005937 Unclassified 643
107 Ga0081538_10001042 3300005981 Bacteria 29561
108 Ga0081538_10001329 3300005981 Bacteria 25435
109 Ga0081538_10012427 3300005981 Bacteria 6823
110 Ga0081538_10063331 3300005981 Bacteria 2100
111 Ga0081538_10102882 3300005981 Bacteria 1431
112 Ga0081539_10032539 3300005985 Bacteria 3192
113 Ga0070717_10208475 3300006028 Bacteria 1714
114 Ga0075365_10033194 3300006038 Bacteria 3324
115 Ga0075365_10036801 3300006038 Bacteria 3173
116 Ga0075365_10104167 3300006038 Bacteria 1945
117 Ga0075365_10318722 3300006038 Bacteria 1095
118 Ga0075365_10547043 3300006038 Bacteria 819
119 Ga0075363_100027300 3300006048 Bacteria 2926
120 Ga0075363_100949554 3300006048 Bacteria 528
121 Ga0075364_10068563 3300006051 Bacteria 2333
122 Ga0075364_10172821 3300006051 Bacteria 1461
123 Ga0070712_100063315 3300006175 Bacteria 2618
124 Ga0070712_100323685 3300006175 Bacteria 1254
125 Ga0075367_10143504 3300006178 Bacteria 1480
126 Ga0075367_10244784 3300006178 Bacteria 1124
127 Ga0097621_100975847 3300006237 Bacteria 792
128 Ga0075370_10023357 3300006353 Bacteria 3405
129 Ga0068871_100533587 3300006358 Bacteria 1061
130 Ga0068871_100976695 3300006358 Bacteria 788
131 Ga0068871_100995613 3300006358 Bacteria 780
132 Ga0068871_101458214 3300006358 Bacteria 646
133 Ga0075428_100079211 3300006844 Bacteria 3586
134 Ga0075428_100100341 3300006844 Bacteria 3156
135 Ga0075428_100120734 3300006844 Bacteria 2854
136 Ga0075428_100582229 3300006844 Bacteria 1196
137 Ga0075428_100968810 3300006844 Bacteria 901
138 Ga0075430_100017380 3300006846 Bacteria 6127
139 Ga0075430_100254627 3300006846 Bacteria 1454
140 Ga0075431_100004688 3300006847 Bacteria 13431
141 Ga0075431_100234119 3300006847 Bacteria 1870
142 Ga0075433_10120575 3300006852 Bacteria 2328
143 Ga0075434_101115792 3300006871 Bacteria 802
144 Ga0075429_100003834 3300006880 Bacteria 12843
145 Ga0075429_100884663 3300006880 Bacteria 782
146 Ga0075429_100885330 3300006880 Bacteria 781
147 Ga0068865_101439414 3300006881 Bacteria 616
148 Ga0097620_100012311 3300006931 Bacteria 8607
149 Ga0097620_100103355 3300006931 Unclassified 2907
150 Ga0097620_100996182 3300006931 Bacteria 920
151 Ga0075435_100580304 3300007076 Bacteria 972
152 Ga0105244_10038217 3300009036 Bacteria 2504
153 Ga0105240_10000641 3300009093 Bacteria 64500
154 Ga0105240_10016966 3300009093 Bacteria 9838
155 Ga0105240_10116607 3300009093 Bacteria 3221
156 Ga0111539_10047002 3300009094 Bacteria 5160
157 Ga0111539_10119091 3300009094 Bacteria 3094
158 Ga0111539_10215436 3300009094 Bacteria 2237
159 Ga0111539_10306198 3300009094 Bacteria 1849
160 Ga0111539_10369689 3300009094 Bacteria 1669
161 Ga0111539_10603141 3300009094 Bacteria 1279
162 Ga0111539_10952265 3300009094 Bacteria 998
163 Ga0111539_11915035 3300009094 Bacteria 687
164 Ga0105245_10847896 3300009098 Bacteria 954
165 Ga0105245_12154196 3300009098 Bacteria 611
166 Ga0105245_12932703 3300009098 Unclassified 529
167 Ga0105247_10088531 3300009101 Bacteria 1962
168 Ga0105247_10310716 3300009101 Bacteria 1096
169 Ga0114129_10074437 3300009147 Bacteria 4730
170 Ga0114129_10138056 3300009147 Bacteria 3344
171 Ga0114129_11275092 3300009147 Bacteria 912
172 Ga0114129_12288796 3300009147 Bacteria 649
173 Ga0105243_10061765 3300009148 Bacteria 2998
174 Ga0105243_10144371 3300009148 Bacteria 2035
175 Ga0105243_10563343 3300009148 Bacteria 1091
176 Ga0105243_10955806 3300009148 Bacteria 856
177 Ga0105243_11515430 3300009148 Bacteria 695
178 Ga0105241_10002139 3300009174 Bacteria 14924
179 Ga0105242_10283102 3300009176 Bacteria 1507
180 Ga0105242_10513472 3300009176 Bacteria 1142
181 Ga0105242_10706121 3300009176 Bacteria 987
182 Ga0105242_10971204 3300009176 Bacteria 855
183 Ga0105242_12890707 3300009176 Bacteria 531
184 Ga0105248_10003497 3300009177 Bacteria 17431
185 Ga0105248_10003633 3300009177 Bacteria 17119
186 Ga0105248_10069413 3300009177 Bacteria 3957
187 Ga0105248_10127550 3300009177 Bacteria 2870
188 Ga0105248_10324711 3300009177 Bacteria 1733
189 Ga0105248_12427336 3300009177 Bacteria 597
190 Ga0105237_10000140 3300009545 Bacteria 101776
191 Ga0105238_10001905 3300009551 Bacteria 20957
192 Ga0105238_10488424 3300009551 Bacteria 1231
193 Ga0105238_11779529 3300009551 Bacteria 648
194 Ga0105249_10054537 3300009553 Bacteria 3656
195 Ga0105249_10057608 3300009553 Bacteria 3560
196 Ga0105249_10226620 3300009553 Bacteria 1842
197 Ga0105249_10319879 3300009553 Bacteria 1562
198 Ga0105249_11091463 3300009553 Bacteria 868
199 Ga0105249_11175011 3300009553 Bacteria 838
200 Ga0105249_12852397 3300009553 Bacteria 555
201 Ga0105239_10008109 3300010375 Bacteria 11989
202 Ga0105239_10109599 3300010375 Bacteria 3060
203 Ga0105239_10349448 3300010375 Bacteria 1669
204 Ga0105246_10037104 3300011119 Bacteria 3269
205 Ga0105246_10641270 3300011119 Unclassified 923
206 Ga0105246_10759391 3300011119 Bacteria 856
207 Ga0105246_11089644 3300011119 Bacteria 729
208 Ga0157371_11038161 3300013102 Bacteria 627
209 Ga0157369_10021702 3300013105 Bacteria 7181
210 Ga0157369_10439449 3300013105 Bacteria 1351
211 Ga0157374_10020221 3300013296 Bacteria 5904
212 Ga0157374_10847574 3300013296 Unclassified 931
213 Ga0157378_10150504 3300013297 Bacteria 2168
214 Ga0157378_10387065 3300013297 Unclassified 1375
215 Ga0157378_12278379 3300013297 Bacteria 593
216 Ga0163162_10017607 3300013306 Bacteria 6991
217 Ga0163162_10142939 3300013306 Bacteria 2507
218 Ga0163162_10196254 3300013306 Bacteria 2147
219 Ga0163162_13230417 3300013306 Bacteria 523
220 Ga0157375_10026412 3300013308 Bacteria 5411
221 Ga0157375_10408822 3300013308 Bacteria 1523
222 Ga0157375_10568511 3300013308 Bacteria 1294
223 Ga0157375_10721536 3300013308 Bacteria 1149
224 Ga0157375_10730040 3300013308 Bacteria 1143
225 Ga0157375_11156309 3300013308 Bacteria 907
226 Ga0163163_10080145 3300014325 Bacteria 3264
227 Ga0163163_10218194 3300014325 Bacteria 1956
228 Ga0163163_10404973 3300014325 Bacteria 1422
229 Ga0163163_10520729 3300014325 Bacteria 1251
230 Ga0163163_11194014 3300014325 Bacteria 823
231 Ga0157380_10030805 3300014326 Bacteria 4112
232 Ga0157380_10483515 3300014326 Bacteria 1198
233 Ga0157380_12102062 3300014326 Bacteria 627
234 Ga0157377_10261212 3300014745 Bacteria 1127
235 Ga0157379_10003007 3300014968 Bacteria 14233
236 Ga0157379_10051570 3300014968 Bacteria 3675
237 Ga0157376_10004176 3300014969 Bacteria 10018
238 Ga0157376_11827314 3300014969 Bacteria 644
239 Ga0163161_11174451 3300017792 Bacteria 663
240 Ga0224712_10057224 3300022467 Bacteria 1540
241 Ga0209130_1000804 3300025284 Bacteria 26631
242 Ga0209025_1000779 3300025294 Bacteria 52611
243 Ga0209758_1004105 3300025297 Bacteria 12479
244 Ga0207426_1000066 3300025302 Bacteria 351182
245 Ga0207655_1075011 3300025728 Bacteria 1242
246 Ga0207642_10262180 3300025899 Bacteria 986
247 Ga0207642_10583579 3300025899 Bacteria 694
248 Ga0207710_10059530 3300025900 Bacteria 1729
249 Ga0207710_10160625 3300025900 Bacteria 1094
250 Ga0207688_10007997 3300025901 Bacteria 5754
251 Ga0207688_10216647 3300025901 Bacteria 1152
252 Ga0207680_10636150 3300025903 Bacteria 763
253 Ga0207699_10006318 3300025906 Bacteria 5727
254 Ga0207645_10976357 3300025907 Bacteria 574
255 Ga0207643_10595911 3300025908 Bacteria 711
256 Ga0207643_11070423 3300025908 Bacteria 521
257 Ga0207705_10410074 3300025909 Bacteria 1048
258 Ga0207654_10002695 3300025911 Bacteria 9017
259 Ga0207695_10000018 3300025913 Bacteria 766611
260 Ga0207695_10009948 3300025913 Bacteria 11689
261 Ga0207695_10027506 3300025913 Bacteria 6331
262 Ga0207695_10086674 3300025913 Bacteria 3157
263 Ga0207695_11098488 3300025913 Bacteria 675
264 Ga0207671_10000004 3300025914 Bacteria 1022356
265 Ga0207693_10008141 3300025915 Bacteria 8591
266 Ga0207693_10017763 3300025915 Bacteria 5672
267 Ga0207663_10259243 3300025916 Bacteria 1283
268 Ga0207663_10757355 3300025916 Bacteria 772
269 Ga0207662_10965898 3300025918 Bacteria 604
270 Ga0207657_10052367 3300025919 Bacteria 3542
271 Ga0207657_10112951 3300025919 Bacteria 2241
272 Ga0207657_11256251 3300025919 Unclassified 561
273 Ga0207649_10289974 3300025920 Bacteria 1193
274 Ga0207649_10610555 3300025920 Bacteria 840
275 Ga0207681_10041126 3300025923 Bacteria 3080
276 Ga0207681_10641982 3300025923 Bacteria 880
277 Ga0207694_10000018 3300025924 Bacteria 331281
278 Ga0207694_10713901 3300025924 Bacteria 846
279 Ga0207694_11447604 3300025924 Bacteria 580
280 Ga0207650_10167836 3300025925 Bacteria 1743
281 Ga0207687_10311706 3300025927 Bacteria 1271
282 Ga0207687_10495599 3300025927 Bacteria 1019
283 Ga0207700_10008372 3300025928 Bacteria 6403
284 Ga0207700_10117542 3300025928 Bacteria 2150
285 Ga0207700_10764170 3300025928 Bacteria 864
286 Ga0207700_11171280 3300025928 Bacteria 686
287 Ga0207664_10022079 3300025929 Bacteria 4745
288 Ga0207664_10416553 3300025929 Bacteria 1196
289 Ga0207664_11416638 3300025929 Unclassified 616
290 Ga0207664_11727083 3300025929 Bacteria 548
291 Ga0207644_10235955 3300025931 Bacteria 1455
292 Ga0207644_10754642 3300025931 Bacteria 813
293 Ga0207690_10892567 3300025932 Unclassified 737
294 Ga0207706_10028053 3300025933 Bacteria 5029
295 Ga0207706_10030213 3300025933 Bacteria 4835
296 Ga0207686_10874872 3300025934 Bacteria 724
297 Ga0207709_10073351 3300025935 Bacteria 2181
298 Ga0207709_10119926 3300025935 Bacteria 1774
299 Ga0207709_10397127 3300025935 Bacteria 1053
300 Ga0207709_10953969 3300025935 Bacteria 699
301 Ga0207709_11331822 3300025935 Bacteria 594
302 Ga0207669_10007642 3300025937 Bacteria 5019
303 Ga0207669_10882954 3300025937 Bacteria 746
304 Ga0207669_11398205 3300025937 Bacteria 596
305 Ga0207704_10116776 3300025938 Bacteria 1816
306 Ga0207704_10392071 3300025938 Bacteria 1093
307 Ga0207704_11241014 3300025938 Bacteria 636
308 Ga0207665_10007671 3300025939 Bacteria 7123
309 Ga0207665_10772280 3300025939 Bacteria 758
310 Ga0207691_10121356 3300025940 Bacteria 2316
311 Ga0207691_10544619 3300025940 Bacteria 984
312 Ga0207711_10052272 3300025941 Bacteria 3501
313 Ga0207711_10098923 3300025941 Bacteria 2578
314 Ga0207711_10331062 3300025941 Bacteria 1408
315 Ga0207711_10459436 3300025941 Bacteria 1186
316 Ga0207711_10688669 3300025941 Bacteria 953
317 Ga0207689_10543814 3300025942 Bacteria 975
318 Ga0207667_10000052 3300025949 Bacteria 232415
319 Ga0207667_10182402 3300025949 Bacteria 2155
320 Ga0207651_10152949 3300025960 Bacteria 1799
321 Ga0207651_10258164 3300025960 Bacteria 1429
322 Ga0207651_10548763 3300025960 Bacteria 1005
323 Ga0207712_10103305 3300025961 Bacteria 2123
324 Ga0207712_10409712 3300025961 Bacteria 1141
325 Ga0207712_10923942 3300025961 Bacteria 772
326 Ga0207668_10085193 3300025972 Bacteria 2305
327 Ga0207668_10672684 3300025972 Bacteria 908
328 Ga0207640_11989700 3300025981 Bacteria 526
329 Ga0207658_10148297 3300025986 Bacteria 1908
330 Ga0207677_10691408 3300026023 Bacteria 904
331 Ga0207703_10016843 3300026035 Bacteria 5700
332 Ga0207703_10074337 3300026035 Bacteria 2814
333 Ga0207703_10490061 3300026035 Bacteria 1152
334 Ga0207639_10046103 3300026041 Bacteria 3287
335 Ga0207639_10641178 3300026041 Bacteria 982
336 Ga0207639_11729479 3300026041 Bacteria 586
337 Ga0207678_10861478 3300026067 Bacteria 801
338 Ga0207708_10020026 3300026075 Bacteria 5045
339 Ga0207702_10064611 3300026078 Bacteria 3132
340 Ga0207702_10645220 3300026078 Unclassified 1041
341 Ga0207702_11101224 3300026078 Bacteria 788
342 Ga0207702_11951538 3300026078 Bacteria 578
343 Ga0207641_10222610 3300026088 Bacteria 1750
344 Ga0207641_10490646 3300026088 Bacteria 1192
345 Ga0207641_10701273 3300026088 Bacteria 997
346 Ga0207641_10792243 3300026088 Bacteria 937
347 Ga0207648_11103348 3300026089 Bacteria 744
348 Ga0207676_10136164 3300026095 Bacteria 2096
349 Ga0207676_10468289 3300026095 Bacteria 1191
350 Ga0207676_12584912 3300026095 Bacteria 504
351 Ga0207674_10510239 3300026116 Bacteria 1161
352 Ga0207675_100010405 3300026118 Bacteria 8715
353 Ga0207675_100063013 3300026118 Bacteria 3464
354 Ga0207675_100129837 3300026118 Bacteria 2389
355 Ga0207675_100802534 3300026118 Bacteria 955
356 Ga0207675_100914613 3300026118 Bacteria 894
357 Ga0207683_10096608 3300026121 Bacteria 2634
358 Ga0207683_10395615 3300026121 Bacteria 1271
359 Ga0207683_10824151 3300026121 Bacteria 861
360 Ga0207683_11436957 3300026121 Bacteria 637
361 Ga0207698_10006059 3300026142 Bacteria 7520
362 Ga0207698_10469509 3300026142 Bacteria 1218
363 Ga0207428_10194775 3300027907 Bacteria 1527
364 Ga0207428_10372526 3300027907 Bacteria 1048
365 Ga0207428_10439723 3300027907 Bacteria 952
366 Ga0207428_10477777 3300027907 Bacteria 907
367 Ga0268266_10000003 3300028379 Bacteria 1701703
368 Ga0268266_10009433 3300028379 Bacteria 8593
369 Ga0268266_10190403 3300028379 Bacteria 1873
370 Ga0268266_10395635 3300028379 Bacteria 1306
371 Ga0268266_11125076 3300028379 Bacteria 760
372 Ga0268265_10145363 3300028380 Bacteria 1992
373 Ga0268265_10388558 3300028380 Bacteria 1286
374 Ga0268265_11829649 3300028380 Bacteria 614
375 Ga0268264_12196650 3300028381 Bacteria 560
376 Ga0265338_10145512 3300028800 Unclassified 1849
377 Ga0316177_1191492 3300030731 Bacteria 3132
378 Ga0316176_1104526 3300030732 Bacteria 4031
379 Ga0314311_1125258 3300030733 Bacteria 7731
380 Ga0316178_1067458 3300030735 Unclassified 917
381 Ga0316180_1183703 3300030736 Bacteria 711
382 Ga0265332_10051096 3300031238 Unclassified 1776
383 Ga0265325_10004200 3300031241 Bacteria 9150
384 Ga0265339_10014044 3300031249 Bacteria 4837
385 Ga0265327_10107128 3300031251 Bacteria 1340
386 Ga0265316_10015415 3300031344 Bacteria 6684
387 Ga0307513_10191703 3300031456 Bacteria 1895
388 Ga0307509_10258945 3300031507 Bacteria 1517
389 Ga0307408_100328032 3300031548 Bacteria 1291
390 Ga0307408_100547580 3300031548 Bacteria 1020
391 Ga0307408_100739585 3300031548 Bacteria 887
392 Ga0265313_10001633 3300031595 Bacteria 20801
393 Ga0265342_10099577 3300031712 Bacteria 1658
394 Ga0307516_10088210 3300031730 Bacteria 2934
395 Ga0307405_10050511 3300031731 Bacteria 2575
396 Ga0307405_10059878 3300031731 Bacteria 2401
397 Ga0307405_10135358 3300031731 Bacteria 1710
398 Ga0307405_10360100 3300031731 Bacteria 1125
399 Ga0307405_10985663 3300031731 Bacteria 718
400 Ga0307405_11516216 3300031731 Bacteria 589
401 Ga0307405_11766642 3300031731 Bacteria 549
402 Ga0307413_10014653 3300031824 Bacteria 3991
403 Ga0307413_10105174 3300031824 Bacteria 1876
404 Ga0307413_10124587 3300031824 Bacteria 1752
405 Ga0307413_10174180 3300031824 Bacteria 1526
406 Ga0307413_10992891 3300031824 Bacteria 719
407 Ga0307410_10006028 3300031852 Bacteria 6497
408 Ga0307410_10026662 3300031852 Bacteria 3641
409 Ga0307410_10054643 3300031852 Bacteria 2708
410 Ga0307410_10088432 3300031852 Bacteria 2193
411 Ga0307410_10109083 3300031852 Bacteria 2000
412 Ga0307410_10283700 3300031852 Bacteria 1300
413 Ga0307410_10378826 3300031852 Bacteria 1138
414 Ga0307410_10635578 3300031852 Bacteria 894
415 Ga0307406_10041354 3300031901 Bacteria 2872
416 Ga0307406_10082497 3300031901 Bacteria 2141
417 Ga0307406_10088635 3300031901 Bacteria 2076
418 Ga0307406_10128428 3300031901 Bacteria 1775
419 Ga0307406_10463308 3300031901 Bacteria 1020
420 Ga0307406_10801031 3300031901 Bacteria 795
421 Ga0307406_11590299 3300031901 Bacteria 577
422 Ga0307407_10026487 3300031903 Bacteria 3071
423 Ga0307407_10034790 3300031903 Bacteria 2762
424 Ga0307407_10055705 3300031903 Bacteria 2286
425 Ga0307407_10450287 3300031903 Bacteria 934
426 Ga0307407_10629642 3300031903 Bacteria 802
427 Ga0307407_11333931 3300031903 Bacteria 564
428 Ga0307412_10133191 3300031911 Bacteria 1809
429 Ga0307412_10205474 3300031911 Bacteria 1499
430 Ga0307412_10208500 3300031911 Bacteria 1489
431 Ga0307412_10590348 3300031911 Bacteria 939
432 Ga0307412_11940696 3300031911 Bacteria 544
433 Ga0307409_100038617 3300031995 Bacteria 3533
434 Ga0307409_100059222 3300031995 Bacteria 2979
435 Ga0307409_100211724 3300031995 Bacteria 1742
436 Ga0307409_100290318 3300031995 Bacteria 1516
437 Ga0307409_100484107 3300031995 Bacteria 1201
438 Ga0307409_100528799 3300031995 Bacteria 1153
439 Ga0307409_100654889 3300031995 Bacteria 1044
440 Ga0307409_101369047 3300031995 Bacteria 734
441 Ga0307416_100019190 3300032002 Bacteria 4841
442 Ga0307416_100050386 3300032002 Bacteria 3318
443 Ga0307416_100061548 3300032002 Bacteria 3064
444 Ga0307416_100082931 3300032002 Bacteria 2718
445 Ga0307416_100120549 3300032002 Bacteria 2336
446 Ga0307416_100261582 3300032002 Bacteria 1692
447 Ga0307416_100474554 3300032002 Bacteria 1309
448 Ga0307416_100486760 3300032002 Bacteria 1295
449 Ga0307416_103315573 3300032002 Bacteria 539
450 Ga0307414_10085541 3300032004 Bacteria 2324
451 Ga0307414_10543652 3300032004 Bacteria 1034
452 Ga0307414_11439189 3300032004 Bacteria 641
453 Ga0307411_10007307 3300032005 Bacteria 5612
454 Ga0307411_11593108 3300032005 Bacteria 602
455 Ga0307415_100000674 3300032126 Bacteria 15138
456 Ga0307415_100033197 3300032126 Bacteria 3349
457 Ga0307415_100039148 3300032126 Bacteria 3131
458 Ga0307415_100059419 3300032126 Bacteria 2637
459 Ga0307415_100065630 3300032126 Bacteria 2530
460 Ga0307415_100107037 3300032126 Bacteria 2065
461 Ga0307415_100292951 3300032126 Bacteria 1344
462 Ga0307415_100375005 3300032126 Bacteria 1206
463 Ga0307415_100630680 3300032126 Bacteria 958
464 Ga0307415_100903346 3300032126 Bacteria 814
465 Ga0307415_101064047 3300032126 Bacteria 755
466 Ga0307415_101127486 3300032126 Bacteria 736
467 Ga0373940_0159917 3300035088 Bacteria 722
468 Ga0373936_0009520 3300035113 Bacteria 3662
469 Ga0373939_0429855 3300035114 Bacteria 552
470 Ga0373945_0333492 3300035116 Bacteria 655
471 Ga0373956_0193093 3300035119 Bacteria 964
472 Ga0373946_0275116 3300035171 Bacteria 827
473 Ga0373955_0189360 3300035172 Bacteria 1223
474 Ga0373955_0951876 3300035172 Unclassified 529
475 Ga0373924_0032626 3300035410 Bacteria 2099
476 Ga0373931_0080892 3300035691 Bacteria 1793
477 Ga0373935_0519857 3300035692 Bacteria 866
478 Ga0373935_0623084 3300035692 Bacteria 790
479 Ga0373935_1350604 3300035692 Unclassified 532
480 Ga0373927_0174025 3300035695 Bacteria 1412
481 Ga0373927_0453773 3300035695 Bacteria 847
482 Ga0373933_0226159 3300035724 Bacteria 1201
483 Ga0373947_0002654 3300035725 Bacteria 10746
484 Ga0373947_0548167 3300035725 Bacteria 787
485 Ga0373937_0152493 3300036401 Bacteria 2165
486 Ga0373937_0193324 3300036401 Bacteria 1912
487 Ga0373937_0239102 3300036401 Bacteria 1711
488 Ga0373937_0394633 3300036401 Bacteria 1313
489 Ga0373937_1044643 3300036401 Bacteria 766
490 Ga0373925_1147047 3300037068 Bacteria 639
491 Ga0395899_0042212 3300037312 Bacteria 3405
492 Ga0395899_0397259 3300037312 Bacteria 913
493 Ga0395899_0801607 3300037312 Bacteria 582
494 Ga0395900_0032165 3300037418 Bacteria 5393
495 Ga0395900_0044946 3300037418 Bacteria 4549
496 Ga0395900_1638487 3300037418 Bacteria 555
497 Ga0395898_0088529 3300037466 Bacteria 2980
498 Ga0395905_0060705 3300037471 Bacteria 3536
499 Ga0395905_0165909 3300037471 Bacteria 2075
500 Ga0395905_0406631 3300037471 Bacteria 1256
501 Ga0395901_0041377 3300038443 Bacteria 4775
502 Ga0395901_0070061 3300038443 Bacteria 3653
503 Ga0395901_0495709 3300038443 Bacteria 1244
504 Ga0395901_1281577 3300038443 Bacteria 695
505 Ga0400483_134154 3300039062 Bacteria 1391
506 Ga0439436_0002892 3300041404 Bacteria 5217
507 Ga0439439_0015600 3300041406 Bacteria 1857
508 Ga0439447_060393 3300041407 Bacteria 893
509 Ga0439466_0017615 3300041411 Bacteria 2573
510 Ga0439465_0380326 3300041413 Bacteria 536
511 Ga0439465_0399789 3300041413 Bacteria 523
512 Ga0451802_1922017 3300041460 Unclassified 513
513 Ga0439433_0011215 3300041999 Bacteria 1961
514 Ga0439442_006061 3300042002 Bacteria 2424
515 Ga0439449_0030225 3300042007 Bacteria 2018
516 Ga0439449_0192680 3300042007 Bacteria 763
517 Ga0439449_0312301 3300042007 Bacteria 594
518 Ga0439457_074057 3300042014 Bacteria 778
519 Ga0439462_0017164 3300042015 Bacteria 1875
520 Ga0450920_060075 3300042122 Bacteria 767
521 Ga0450907_043173 3300042146 Bacteria 772
522 Ga0450908_108217 3300042184 Bacteria 512
523 Ga0439434_0007779 3300042435 Bacteria 3142
524 Ga0439434_0039777 3300042435 Bacteria 1443
525 Ga0439459_0019852 3300042438 Bacteria 1278
526 Ga0466972_0001513 3300044658 Bacteria 11312
527 Ga0466965_0025726 3300044683 Bacteria 2850
528 Ga0466963_0784682 3300044694 Bacteria 672
529 Ga0466968_0050943 3300044735 Bacteria 1768
530 Ga0466960_0006797 3300044901 Bacteria 4607
531 Ga0451576_1743417 3300045051 Bacteria 644
532 Ga0466967_0089920 3300045976 Bacteria 2788
533 Ga0466967_0436129 3300045976 Bacteria 1279
534 Ga0495592_0218420 3300046454 Bacteria 1276
535 Ga0495603_0192546 3300046455 Bacteria 1179
536 Ga0495590_0063840 3300046457 Bacteria 1289
537 Ga0495641_0118026 3300046461 Bacteria 1183
538 Ga0495641_0584761 3300046461 Bacteria 510
539 Ga0495651_0087773 3300046462 Bacteria 2338
540 Ga0495651_0593423 3300046462 Unclassified 699
541 Ga0495651_0717131 3300046462 Bacteria 622
542 Ga0495653_0104958 3300046463 Bacteria 2041
543 Ga0495653_0835476 3300046463 Bacteria 552
544 Ga0495580_0017644 3300046472 Bacteria 5332
545 Ga0495662_0198798 3300046476 Bacteria 988
546 Ga0495664_0177606 3300046477 Bacteria 1291
547 Ga0495664_0400367 3300046477 Bacteria 824
548 Ga0495664_0509738 3300046477 Bacteria 718
549 Ga0495664_0659944 3300046477 Bacteria 619
550 Ga0495594_0650171 3300046499 Bacteria 597
551 Ga0495596_0188406 3300046500 Bacteria 802
552 Ga0495606_0007347 3300046507 Bacteria 9889
553 Ga0495608_0067083 3300046511 Bacteria 2348
554 Ga0495608_0333664 3300046511 Bacteria 935
555 Ga0495618_0172270 3300046514 Bacteria 1377
556 Ga0495628_0042385 3300046516 Bacteria 3630
557 Ga0495628_0352692 3300046516 Bacteria 1081
558 Ga0495630_0004600 3300046517 Bacteria 9672
559 Ga0495630_0029180 3300046517 Bacteria 4100
560 Ga0495630_1348491 3300046517 Bacteria 537
561 Ga0495631_0092243 3300046518 Bacteria 1304
562 Ga0495631_0113002 3300046518 Bacteria 1168
563 Ga0495663_0052576 3300046525 Bacteria 1265
564 Ga0495663_0185465 3300046525 Bacteria 722
565 Ga0495663_0251678 3300046525 Bacteria 627
566 Ga0495652_0033827 3300046529 Bacteria 4459
567 Ga0495652_0066597 3300046529 Bacteria 3022
568 Ga0495640_0015991 3300046533 Bacteria 5628
569 Ga0495640_0164916 3300046533 Unclassified 1418
570 Ga0495586_0023488 3300046535 Bacteria 3293
571 Ga0495586_0096041 3300046535 Bacteria 1641
572 Ga0495586_0112126 3300046535 Bacteria 1518
573 Ga0495586_0205261 3300046535 Bacteria 1118
574 Ga0495587_0111884 3300046536 Bacteria 1568
575 Ga0495598_0429295 3300046537 Unclassified 520
576 Ga0495645_0091643 3300046543 Bacteria 2171
577 Ga0495645_0131883 3300046543 Bacteria 1750
578 Ga0495645_0263546 3300046543 Bacteria 1140
579 Ga0495645_0940334 3300046543 Bacteria 511
580 Ga0495667_0060184 3300046559 Bacteria 2491
581 Ga0495667_0235605 3300046559 Bacteria 1166
582 Ga0495656_0002130 3300046615 Bacteria 6537
583 Ga0495656_0193353 3300046615 Bacteria 1006
584 Ga0495656_0615329 3300046615 Bacteria 582
585 Ga0495668_0000255 3300046616 Bacteria 75815
586 Ga0495668_0195468 3300046616 Bacteria 1108
587 Ga0495634_0158143 3300046642 Bacteria 1430
588 Ga0495625_0002407 3300046660 Bacteria 20273
589 Ga0495625_0278204 3300046660 Bacteria 1078
590 Ga0495635_0282848 3300046663 Bacteria 1114
591 Ga0495635_0336182 3300046663 Bacteria 1009
592 Ga0495635_0962047 3300046663 Bacteria 545
593 Ga0495659_0002974 3300046664 Bacteria 5440
594 Ga0495659_0363964 3300046664 Bacteria 620
595 Ga0495659_0365825 3300046664 Bacteria 618
596 Ga0495588_0090196 3300046674 Bacteria 1605
597 Ga0495588_0158349 3300046674 Bacteria 1197
598 Ga0495588_0258773 3300046674 Bacteria 917
599 Ga0495657_0097573 3300046675 Bacteria 1876
600 Ga0495599_0133673 3300046678 Bacteria 1540
601 Ga0495658_0157210 3300046683 Unclassified 1400
602 Ga0495669_0005032 3300046684 Bacteria 5495
603 Ga0495669_0206198 3300046684 Bacteria 941
604 Ga0495613_0098323 3300046689 Bacteria 2115
605 Ga0495624_0006892 3300046690 Bacteria 8015
606 Ga0495624_0612189 3300046690 Unclassified 649
607 Ga0495670_0003596 3300046691 Bacteria 7608
608 Ga0495670_0261628 3300046691 Bacteria 923
609 Ga0495604_0288784 3300047317 Bacteria 1105
610 Ga0495604_0535549 3300047317 Bacteria 756
611 Ga0495636_0299098 3300047318 Bacteria 752
612 Ga0495636_0454614 3300047318 Bacteria 615
613 Ga0495674_0033658 3300047319 Bacteria 4640
614 Ga0495676_0331972 3300047321 Bacteria 1020
615 Ga0495680_0050033 3300047322 Bacteria 3269
616 Ga0495680_0068193 3300047322 Bacteria 2718
617 Ga0495680_0547245 3300047322 Bacteria 780
618 Ga0495683_0033031 3300047323 Bacteria 2635
619 Ga0495675_0517301 3300047444 Bacteria 684
620 Ga0495685_093035 3300047447 Bacteria 998
621 Ga0495684_0371725 3300047471 Bacteria 1010
622 Ga0495684_0987288 3300047471 Bacteria 536
623 Ga0495593_0060921 3300047673 Bacteria 1975
624 Ga0495602_0248647 3300048088 Bacteria 1326
625 Ga0495602_0434481 3300048088 Bacteria 929
626 Ga0495626_0000764 3300048091 Bacteria 29671
627 Ga0495626_0071291 3300048091 Bacteria 1562
628 Ga0496100_0008690 3300048903 Bacteria 5674
629 Ga0496100_0037762 3300048903 Bacteria 3056
630 Ga0496100_0071563 3300048903 Bacteria 2316
631 Ga0496100_0172557 3300048903 Bacteria 1559
632 Ga0496100_1057668 3300048903 Bacteria 639
633 Ga0496100_1537277 3300048903 Bacteria 526
634 Ga0496101_0005580 3300048904 Bacteria 8031
635 Ga0496101_0190026 3300048904 Bacteria 1584
636 Ga0496101_0289043 3300048904 Bacteria 1282
637 Ga0496101_0305717 3300048904 Bacteria 1246
638 Ga0496101_1215798 3300048904 Bacteria 590
639 Ga0496102_0112020 3300048905 Bacteria 2544
640 Ga0496102_0134019 3300048905 Bacteria 2320
641 Ga0496102_0312594 3300048905 Bacteria 1481
642 Ga0496102_0485848 3300048905 Bacteria 1156
643 Ga0496102_1119145 3300048905 Unclassified 707
644 Ga0496103_0009030 3300048906 Bacteria 5903
645 Ga0496103_0324542 3300048906 Bacteria 990
646 Ga0496104_0019890 3300048907 Bacteria 6148
647 Ga0496104_0145831 3300048907 Bacteria 2273
648 Ga0496104_0233804 3300048907 Bacteria 1750
649 Ga0496104_0375943 3300048907 Bacteria 1333
650 Ga0496104_0720420 3300048907 Bacteria 905
651 Ga0496104_1325371 3300048907 Bacteria 623
652 Ga0496105_0009334 3300048908 Bacteria 7668
653 Ga0496105_0084139 3300048908 Bacteria 2628
654 Ga0496105_0117886 3300048908 Unclassified 2190
655 Ga0496105_0363800 3300048908 Bacteria 1153
656 Ga0496105_0373395 3300048908 Bacteria 1136
657 Ga0496106_0025488 3300048909 Bacteria 4401
658 Ga0496106_0145998 3300048909 Bacteria 1863
659 Ga0496106_0390442 3300048909 Bacteria 1118
660 Ga0496106_0798489 3300048909 Bacteria 749
661 Ga0496106_0985690 3300048909 Bacteria 663
662 Ga0496107_0006066 3300048910 Bacteria 8296
663 Ga0496107_0060871 3300048910 Bacteria 2733
664 Ga0496108_0082811 3300048911 Bacteria 2721
665 Ga0496108_0172947 3300048911 Bacteria 1869
666 Ga0496108_0349011 3300048911 Bacteria 1291
667 Ga0496108_0822514 3300048911 Bacteria 800
668 Ga0496108_1047569 3300048911 Bacteria 695
669 Ga0496109_0087913 3300048912 Bacteria 2871
670 Ga0496109_0209434 3300048912 Bacteria 1833
671 Ga0496109_0220810 3300048912 Bacteria 1782
672 Ga0496109_0245611 3300048912 Bacteria 1685
673 Ga0496109_0257373 3300048912 Bacteria 1644
674 Ga0496109_0424544 3300048912 Bacteria 1256
675 Ga0496109_0631071 3300048912 Unclassified 1008
676 Ga0496109_0660402 3300048912 Bacteria 983
677 Ga0496109_0802148 3300048912 Bacteria 879
678 Ga0496110_0022249 3300048913 Bacteria 5380
679 Ga0496110_0055077 3300048913 Bacteria 3499
680 Ga0496110_0090081 3300048913 Bacteria 2742
681 Ga0496110_0176104 3300048913 Bacteria 1941
682 Ga0496110_1499265 3300048913 Bacteria 584
683 Ga0496111_0018949 3300048914 Bacteria 4770
684 Ga0496111_0027403 3300048914 Bacteria 4031
685 Ga0496111_0279432 3300048914 Bacteria 1238
686 Ga0496111_0372082 3300048914 Bacteria 1057
687 Ga0496111_0421208 3300048914 Bacteria 986
688 Ga0496111_0464331 3300048914 Bacteria 933
689 Ga0496112_0130959 3300048915 Bacteria 2479
690 Ga0496112_0406019 3300048915 Bacteria 1302
691 Ga0496112_0627059 3300048915 Bacteria 1006
692 Ga0496112_0849333 3300048915 Bacteria 836
693 Ga0496112_0901848 3300048915 Bacteria 806
694 Ga0496112_0997500 3300048915 Bacteria 757
695 Ga0496113_0349611 3300048916 Bacteria 1186
696 Ga0496113_0747541 3300048916 Bacteria 779
697 Ga0496113_0877631 3300048916 Bacteria 710
698 Ga0496113_1087276 3300048916 Bacteria 628
699 Ga0496113_1189904 3300048916 Bacteria 595
700 Ga0496114_0222098 3300048917 Bacteria 1659
701 Ga0496114_0459684 3300048917 Bacteria 1127
702 Ga0496114_1308842 3300048917 Unclassified 611
703 Ga0496115_0022278 3300048918 Bacteria 4907
704 Ga0496115_0036751 3300048918 Bacteria 3879
705 Ga0496115_0226871 3300048918 Bacteria 1541
706 Ga0496115_0444260 3300048918 Bacteria 1048
707 Ga0496115_0488398 3300048918 Bacteria 991
708 Ga0496115_0649594 3300048918 Bacteria 834
709 Ga0496119_0016355 3300048922 Bacteria 5650
710 Ga0496119_0022918 3300048922 Bacteria 4448
711 Ga0496120_0011175 3300048923 Bacteria 6196
712 Ga0496120_0202641 3300048923 Bacteria 960
713 Ga0496121_0010886 3300048924 Bacteria 10167
714 Ga0496121_0299101 3300048924 Bacteria 1093
715 Ga0496125_0078166 3300048928 Bacteria 2545
716 Ga0496125_0763780 3300048928 Bacteria 505
717 Ga0495682_0062825 3300049460 Bacteria 1340
718 Ga0501031_0032965 3300049568 Bacteria 3378
719 Ga0501031_0038115 3300049568 Bacteria 3137
720 Ga0501031_0058687 3300049568 Bacteria 2508
721 Ga0501032_0277071 3300049569 Bacteria 1086
722 Ga0501033_0239648 3300049570 Bacteria 1287
723 Ga0501033_0277168 3300049570 Bacteria 1184
724 Ga0501033_0485883 3300049570 Bacteria 855
725 Ga0501034_1158261 3300049571 Bacteria 653
726 Ga0501036_0029124 3300049572 Bacteria 4667
727 Ga0501036_0123197 3300049572 Bacteria 2189
728 Ga0501036_0439140 3300049572 Bacteria 1088
729 Ga0501036_0636709 3300049572 Bacteria 883
730 Ga0501036_0869778 3300049572 Bacteria 740
731 Ga0501037_0090394 3300049573 Bacteria 2215
732 Ga0501037_0203087 3300049573 Bacteria 1400
733 Ga0501038_0085531 3300049574 Bacteria 2652
734 Ga0501038_0150834 3300049574 Bacteria 1895
735 Ga0501038_0302978 3300049574 Bacteria 1254
736 Ga0501039_0003839 3300049575 Bacteria 11284
737 Ga0501039_0110259 3300049575 Bacteria 2151
738 Ga0501039_0226326 3300049575 Bacteria 1470
739 Ga0501039_0372654 3300049575 Bacteria 1122
740 Ga0501040_0002378 3300049576 Bacteria 12089
741 Ga0501040_0184353 3300049576 Bacteria 1480
742 Ga0501040_0436019 3300049576 Bacteria 942
743 Ga0501041_0007664 3300049577 Bacteria 6341
744 Ga0501041_0044616 3300049577 Bacteria 2694
745 Ga0501041_0163752 3300049577 Bacteria 1391
746 Ga0501041_0341626 3300049577 Unclassified 945
747 Ga0501042_0069835 3300049578 Bacteria 2513
748 Ga0501042_0376551 3300049578 Bacteria 1027
749 Ga0501042_0404713 3300049578 Bacteria 989
750 Ga0501042_0724087 3300049578 Bacteria 723
751 Ga0501043_0167024 3300049579 Bacteria 1718
752 Ga0501043_0256259 3300049579 Bacteria 1347
753 Ga0501046_0022194 3300049580 Bacteria 5231
754 Ga0501046_0472896 3300049580 Bacteria 900
755 Ga0501046_0485139 3300049580 Bacteria 886
756 Ga0501046_0497906 3300049580 Bacteria 873
757 Ga0501046_0654105 3300049580 Bacteria 743
758 Ga0501047_0405583 3300049581 Bacteria 1196
759 Ga0501047_0781724 3300049581 Unclassified 770
760 Ga0501047_1383562 3300049581 Unclassified 519
761 Ga0501048_0245530 3300049582 Bacteria 1270
762 Ga0501048_0339177 3300049582 Bacteria 1071
763 Ga0501048_0425049 3300049582 Bacteria 950
764 Ga0501048_0443981 3300049582 Bacteria 929
765 Ga0501048_0890677 3300049582 Bacteria 640
766 Ga0501068_0129833 3300049584 Bacteria 1575
767 Ga0501068_0381552 3300049584 Bacteria 908
768 Ga0501068_0929835 3300049584 Bacteria 573
769 Ga0501069_0058796 3300049585 Unclassified 2145
770 Ga0501069_0670362 3300049585 Unclassified 625
771 Ga0501070_0869103 3300049586 Bacteria 705
772 Ga0501070_0940340 3300049586 Unclassified 673
773 Ga0501070_1343072 3300049586 Bacteria 545
774 Ga0501071_0110802 3300049587 Unclassified 2028
775 Ga0501071_0119763 3300049587 Bacteria 1951
776 Ga0501071_0238813 3300049587 Bacteria 1370
777 Ga0501071_0481477 3300049587 Bacteria 951
778 Ga0501071_0490695 3300049587 Bacteria 942
779 Ga0501071_0665839 3300049587 Bacteria 801
780 Ga0501072_0049296 3300049588 Bacteria 3315
781 Ga0501072_0156589 3300049588 Bacteria 1816
782 Ga0501072_0175880 3300049588 Bacteria 1708
783 Ga0501073_0243428 3300049589 Bacteria 1242
784 Ga0501073_0300650 3300049589 Bacteria 1107
785 Ga0501073_0393275 3300049589 Bacteria 958
786 Ga0501074_0027540 3300049590 Bacteria 4121
787 Ga0501074_0147480 3300049590 Bacteria 1683
788 Ga0501074_0257657 3300049590 Bacteria 1240
789 Ga0501074_0487572 3300049590 Bacteria 873
790 Ga0501074_0543029 3300049590 Bacteria 823
791 Ga0501075_0005211 3300049591 Bacteria 8889
792 Ga0501075_0036916 3300049591 Bacteria 3648
793 Ga0501075_0332660 3300049591 Bacteria 1157
794 Ga0501075_0484792 3300049591 Bacteria 943
795 Ga0501075_0908177 3300049591 Bacteria 669
796 Ga0501075_1245041 3300049591 Unclassified 564
797 Ga0501076_0003685 3300049592 Bacteria 10773
798 Ga0501076_0152781 3300049592 Bacteria 1878
799 Ga0501076_1306770 3300049592 Unclassified 596
800 Ga0501077_0008224 3300049593 Bacteria 6450
801 Ga0501077_0274083 3300049593 Bacteria 1073
802 Ga0501077_0548216 3300049593 Bacteria 742
803 Ga0501077_0825859 3300049593 Bacteria 596
804 Ga0501079_0001681 3300049741 Bacteria 15735
805 Ga0501079_0097332 3300049741 Bacteria 2281
806 Ga0501079_0141149 3300049741 Unclassified 1877
807 Ga0501080_0682651 3300049742 Bacteria 907
808 Ga0501080_1231421 3300049742 Bacteria 643
809 Ga0501081_0004461 3300049743 Bacteria 8977
810 Ga0501081_0038829 3300049743 Bacteria 3255
811 Ga0501081_1003260 3300049743 Bacteria 631
812 Ga0501081_1015761 3300049743 Bacteria 627
813 Ga0501083_0274676 3300049744 Bacteria 1096
814 Ga0501083_0484069 3300049744 Bacteria 805
815 Ga0501035_0444727 3300049822 Bacteria 1073
816 Ga0501044_1188162 3300049823 Bacteria 631
817 Ga0501044_1284455 3300049823 Unclassified 599
818 Ga0501044_1547254 3300049823 Bacteria 528
819 Ga0501045_0067138 3300049824 Bacteria 2634
820 Ga0501045_0498640 3300049824 Bacteria 904
821 Ga0501045_1057880 3300049824 Bacteria 594
822 Ga0501045_1331268 3300049824 Bacteria 522
823 nmdc:mga03n38_25099_c1 3300050490 Bacteria 2443
824 nmdc:mga00v17_140026_c1 3300050491 Bacteria 1550
825 nmdc:mga00v17_277712_c1 3300050491 Bacteria 1087
826 nmdc:mga00v17_498877_c1 3300050491 Bacteria 789
827 nmdc:mga00v17_78932_c1 3300050491 Bacteria 2052
828 nmdc:mga0yw44_160426_c1 3300050492 Bacteria 1472
829 nmdc:mga0yw44_250863_c1 3300050492 Bacteria 1178
830 nmdc:mga0yw44_328183_c1 3300050492 Bacteria 1028
831 nmdc:mga0yw44_57589_c1 3300050492 Bacteria 2371
832 nmdc:mga0yw44_84550_c1 3300050492 Bacteria 1995
833 nmdc:mga0yw44_889998_c1 3300050492 Bacteria 604
834 nmdc:mga06z11_262595_c1 3300050494 Bacteria 1019
835 nmdc:mga06z11_70830_c1 3300050494 Bacteria 1844
836 nmdc:mga06z11_85423_c1 3300050494 Bacteria 1702
837 nmdc:mga07m45_62172_c1 3300050496 Bacteria 2116
838 nmdc:mga07m45_78763_c1 3300050496 Bacteria 1880
839 nmdc:mga05p37_19536_c1 3300050507 Bacteria 8196
840 nmdc:mga05p37_833437_c1 3300050507 Bacteria 1004
841 nmdc:mga09592_1116129_c1 3300050508 Bacteria 655
842 nmdc:mga09592_206266_c1 3300050508 Bacteria 1702
843 nmdc:mga09592_68077_c1 3300050508 Bacteria 3020
844 nmdc:mga0qj67_110604_c1 3300050509 Bacteria 2218
845 nmdc:mga0qj67_6873_c1 3300050509 Bacteria 8368
846 nmdc:mga06r32_2060_c1 3300050510 Bacteria 17993
847 nmdc:mga06r32_328252_c1 3300050510 Bacteria 1515
848 nmdc:mga08y16_1528832_c1 3300050511 Bacteria 627
849 nmdc:mga08y16_894109_c1 3300050511 Bacteria 875
850 nmdc:mga0n895_2035536_c1 3300050512 Bacteria 531
851 nmdc:mga0rr50_228310_c1 3300050513 Bacteria 1539
852 nmdc:mga0a205_173805_c1 3300050515 Bacteria 2050
853 Ga0495601_0201244 3300053077 Bacteria 1301
854 Ga0495612_0325849 3300053078 Bacteria 691
855 Ga0495655_0089087 3300053083 Bacteria 896
856 Ga0495619_0624100 3300053085 Unclassified 736
857 Ga0500644_0000019 3300053088 Bacteria 102598
858 Ga0500594_0130390 3300053118 Unclassified 796
859 Ga0500655_037329 3300053133 Bacteria 947
860 Ga0500655_060376 3300053133 Bacteria 763
861 Ga0500568_0000264 3300053139 Bacteria 44366
862 Ga0500568_0102030 3300053139 Bacteria 1076
863 Ga0501084_0033243 3300054114 Bacteria 4314
864 Ga0501084_0168684 3300054114 Bacteria 1848
865 Ga0501084_0173424 3300054114 Bacteria 1820
866 Ga0501084_0606492 3300054114 Bacteria 925
867 Ga0501084_1159127 3300054114 Bacteria 648
868 Ga0501082_0033259 3300060353 Bacteria 4448
869 Ga0501082_0538785 3300060353 Bacteria 1021
870 Ga0501082_0596515 3300060353 Bacteria 966
871 Ga0501082_1513970 3300060353 Bacteria 586
872 Ga0530510_0038764 3300061734 Bacteria 3441
873 Ga0530510_0356325 3300061734 Bacteria 1099
874 Ga0530510_0469374 3300061734 Bacteria 952
875 Ga0530510_0745570 3300061734 Unclassified 747
876 2821449084 2821443989 Bacteria 7658172
877 2870784693 2870782633 Bacteria 9624083
878 2919393606 2919391150 Bacteria 4884741
879 8054109405 8054107350 Bacteria 5022511
880 Ga0495638_0016253
881 MBSR1b_contig_1334495
882 JGI24735J21928_10086629
883 JGI25151J46595_10000212
884 JGI25153J46596_10096618
885 JGI25407J50210_10009694
886 JGI25407J50210_10044878
887 JGI25407J50210_10084316
888 Ga0065712_10169127
889 Ga0065715_10102665
890 Ga0070658_11458975
891 Ga0070676_10478590
892 Ga0070683_100549541
893 Ga0070683_101678492
894 Ga0070683_102285572
895 Ga0068869_100564734
896 Ga0070680_100629873
897 Ga0070682_100123141
898 Ga0068868_100227466
899 Ga0070660_100082340
900 Ga0070660_100696736
901 Ga0070691_10511583
902 Ga0070661_100509464
903 Ga0070668_100207119
904 Ga0070675_100764365
905 Ga0070671_100243193
906 Ga0070674_100011909
907 Ga0070674_102023870
908 Ga0070673_100139027
909 Ga0070673_100140608
910 Ga0070673_100511680
911 Ga0070673_102267593
912 Ga0070688_100118820
913 Ga0070659_100566443
914 Ga0070667_100042271
915 Ga0070667_100403174
916 Ga0070667_100681213
917 Ga0070714_100200894
918 Ga0070714_100977221
919 Ga0070714_101747765
920 Ga0070714_101870618
921 Ga0070713_100494621
922 Ga0070713_100497968
923 Ga0070713_101035222
924 Ga0070710_10571193
925 Ga0070701_11027795
926 Ga0070711_100823877
927 Ga0070700_100265534
928 Ga0070694_100949767
929 Ga0070678_100905053
930 Ga0070678_101481154
931 Ga0070662_100063045
932 Ga0070662_100087641
933 Ga0068867_100869395
934 Ga0068867_101588683
935 Ga0070685_10010442
936 Ga0070706_100018357
937 Ga0070706_101176196
938 Ga0070684_100123760
939 Ga0070684_101025683
940 Ga0070697_100933846
941 Ga0068853_100235523
942 Ga0068853_101196107
943 Ga0068853_101326982
944 Ga0070672_100613347
945 Ga0070672_101083506
946 Ga0070686_101172175
947 Ga0070693_100100229
948 Ga0070665_100000921
949 Ga0070665_100078778
950 Ga0070704_100449255
951 Ga0068855_100004796
952 Ga0068855_100006221
953 Ga0070664_100099451
954 Ga0068857_101255884
955 Ga0068854_101645107
956 Ga0068856_100637522
957 Ga0068856_100838916
958 Ga0070702_100531951
959 Ga0068852_100003495
960 Ga0068852_100116851
961 Ga0068859_100012311
962 Ga0068859_100103353
963 Ga0068859_100996111
964 Ga0068864_100029601
965 Ga0068864_100062768
966 Ga0068864_100087564
967 Ga0068864_101784845
968 Ga0068864_102347351
969 Ga0068866_10854979
970 Ga0068866_10930825
971 Ga0068861_100043259
972 Ga0068861_100174323
973 Ga0068861_101343100
974 Ga0068863_100305864
975 Ga0068858_100002104
976 Ga0068858_100012612
977 Ga0068862_100430158
978 Ga0068862_101007505
979 Ga0081455_10000808
980 Ga0081455_10007587
981 Ga0081455_10010606
982 Ga0081455_10016117
983 Ga0081455_10119701
984 Ga0081455_10693523
985 Ga0081455_10704012
986 Ga0081538_10001042
987 Ga0081538_10001329
988 Ga0081538_10012427
989 Ga0081538_10063331
990 Ga0081538_10102882
991 Ga0081539_10032539
992 Ga0070717_10208475
993 Ga0075365_10033194
994 Ga0075365_10036801
995 Ga0075365_10104167
996 Ga0075365_10318722
997 Ga0075365_10547043
998 Ga0075363_100027300
999 Ga0075363_100949554
1000 Ga0075364_10068563
1001 Ga0075364_10172821
1002 Ga0070712_100063315
1003 Ga0070712_100323685
1004 Ga0075367_10143504
1005 Ga0075367_10244784
1006 Ga0097621_100975847
1007 Ga0075370_10023357
1008 Ga0068871_100533587
1009 Ga0068871_100976695
1010 Ga0068871_100995613
1011 Ga0068871_101458214
1012 Ga0075428_100079211
1013 Ga0075428_100100341
1014 Ga0075428_100120734
1015 Ga0075428_100582229
1016 Ga0075428_100968810
1017 Ga0075430_100017380
1018 Ga0075430_100254627
1019 Ga0075431_100004688
1020 Ga0075431_100234119
1021 Ga0075433_10120575
1022 Ga0075434_101115792
1023 Ga0075429_100003834
1024 Ga0075429_100884663
1025 Ga0075429_100885330
1026 Ga0068865_101439414
1027 Ga0097620_100012311
1028 Ga0097620_100103355
1029 Ga0097620_100996182
1030 Ga0075435_100580304
1031 Ga0105244_10038217
1032 Ga0105240_10000641
1033 Ga0105240_10016966
1034 Ga0105240_10116607
1035 Ga0111539_10047002
1036 Ga0111539_10119091
1037 Ga0111539_10215436
1038 Ga0111539_10306198
1039 Ga0111539_10369689
1040 Ga0111539_10603141
1041 Ga0111539_10952265
1042 Ga0111539_11915035
1043 Ga0105245_10847896
1044 Ga0105245_12154196
1045 Ga0105245_12932703
1046 Ga0105247_10088531
1047 Ga0105247_10310716
1048 Ga0114129_10074437
1049 Ga0114129_10138056
1050 Ga0114129_11275092
1051 Ga0114129_12288796
1052 Ga0105243_10061765
1053 Ga0105243_10144371
1054 Ga0105243_10563343
1055 Ga0105243_10955806
1056 Ga0105243_11515430
1057 Ga0105241_10002139
1058 Ga0105242_10283102
1059 Ga0105242_10513472
1060 Ga0105242_10706121
1061 Ga0105242_10971204
1062 Ga0105242_12890707
1063 Ga0105248_10003497
1064 Ga0105248_10003633
1065 Ga0105248_10069413
1066 Ga0105248_10127550
1067 Ga0105248_10324711
1068 Ga0105248_12427336
1069 Ga0105237_10000140
1070 Ga0105238_10001905
1071 Ga0105238_10488424
1072 Ga0105238_11779529
1073 Ga0105249_10054537
1074 Ga0105249_10057608
1075 Ga0105249_10226620
1076 Ga0105249_10319879
1077 Ga0105249_11091463
1078 Ga0105249_11175011
1079 Ga0105249_12852397
1080 Ga0105239_10008109
1081 Ga0105239_10109599
1082 Ga0105239_10349448
1083 Ga0105246_10037104
1084 Ga0105246_10641270
1085 Ga0105246_10759391
1086 Ga0105246_11089644
1087 Ga0157371_11038161
1088 Ga0157369_10021702
1089 Ga0157369_10439449
1090 Ga0157374_10020221
1091 Ga0157374_10847574
1092 Ga0157378_10150504
1093 Ga0157378_10387065
1094 Ga0157378_12278379
1095 Ga0163162_10017607
1096 Ga0163162_10142939
1097 Ga0163162_10196254
1098 Ga0163162_13230417
1099 Ga0157375_10026412
1100 Ga0157375_10408822
1101 Ga0157375_10568511
1102 Ga0157375_10721536
1103 Ga0157375_10730040
1104 Ga0157375_11156309
1105 Ga0163163_10080145
1106 Ga0163163_10218194
1107 Ga0163163_10404973
1108 Ga0163163_10520729
1109 Ga0163163_11194014
1110 Ga0157380_10030805
1111 Ga0157380_10483515
1112 Ga0157380_12102062
1113 Ga0157377_10261212
1114 Ga0157379_10003007
1115 Ga0157379_10051570
1116 Ga0157376_10004176
1117 Ga0157376_11827314
1118 Ga0163161_11174451
1119 Ga0224712_10057224
1120 Ga0209130_1000804
1121 Ga0209025_1000779
1122 Ga0209758_1004105
1123 Ga0207426_1000066
1124 Ga0207655_1075011
1125 Ga0207642_10262180
1126 Ga0207642_10583579
1127 Ga0207710_10059530
1128 Ga0207710_10160625
1129 Ga0207688_10007997
1130 Ga0207688_10216647
1131 Ga0207680_10636150
1132 Ga0207699_10006318
1133 Ga0207645_10976357
1134 Ga0207643_10595911
1135 Ga0207643_11070423
1136 Ga0207705_10410074
1137 Ga0207654_10002695
1138 Ga0207695_10000018
1139 Ga0207695_10009948
1140 Ga0207695_10027506
1141 Ga0207695_10086674
1142 Ga0207695_11098488
1143 Ga0207671_10000004
1144 Ga0207693_10008141
1145 Ga0207693_10017763
1146 Ga0207663_10259243
1147 Ga0207663_10757355
1148 Ga0207662_10965898
1149 Ga0207657_10052367
1150 Ga0207657_10112951
1151 Ga0207657_11256251
1152 Ga0207649_10289974
1153 Ga0207649_10610555
1154 Ga0207681_10041126
1155 Ga0207681_10641982
1156 Ga0207694_10000018
1157 Ga0207694_10713901
1158 Ga0207694_11447604
1159 Ga0207650_10167836
1160 Ga0207687_10311706
1161 Ga0207687_10495599
1162 Ga0207700_10008372
1163 Ga0207700_10117542
1164 Ga0207700_10764170
1165 Ga0207700_11171280
1166 Ga0207664_10022079
1167 Ga0207664_10416553
1168 Ga0207664_11416638
1169 Ga0207664_11727083
1170 Ga0207644_10235955
1171 Ga0207644_10754642
1172 Ga0207690_10892567
1173 Ga0207706_10028053
1174 Ga0207706_10030213
1175 Ga0207686_10874872
1176 Ga0207709_10073351
1177 Ga0207709_10119926
1178 Ga0207709_10397127
1179 Ga0207709_10953969
1180 Ga0207709_11331822
1181 Ga0207669_10007642
1182 Ga0207669_10882954
1183 Ga0207669_11398205
1184 Ga0207704_10116776
1185 Ga0207704_10392071
1186 Ga0207704_11241014
1187 Ga0207665_10007671
1188 Ga0207665_10772280
1189 Ga0207691_10121356
1190 Ga0207691_10544619
1191 Ga0207711_10052272
1192 Ga0207711_10098923
1193 Ga0207711_10331062
1194 Ga0207711_10459436
1195 Ga0207711_10688669
1196 Ga0207689_10543814
1197 Ga0207667_10000052
1198 Ga0207667_10182402
1199 Ga0207651_10152949
1200 Ga0207651_10258164
1201 Ga0207651_10548763
1202 Ga0207712_10103305
1203 Ga0207712_10409712
1204 Ga0207712_10923942
1205 Ga0207668_10085193
1206 Ga0207668_10672684
1207 Ga0207640_11989700
1208 Ga0207658_10148297
1209 Ga0207677_10691408
1210 Ga0207703_10016843
1211 Ga0207703_10074337
1212 Ga0207703_10490061
1213 Ga0207639_10046103
1214 Ga0207639_10641178
1215 Ga0207639_11729479
1216 Ga0207678_10861478
1217 Ga0207708_10020026
1218 Ga0207702_10064611
1219 Ga0207702_10645220
1220 Ga0207702_11101224
1221 Ga0207702_11951538
1222 Ga0207641_10222610
1223 Ga0207641_10490646
1224 Ga0207641_10701273
1225 Ga0207641_10792243
1226 Ga0207648_11103348
1227 Ga0207676_10136164
1228 Ga0207676_10468289
1229 Ga0207676_12584912
1230 Ga0207674_10510239
1231 Ga0207675_100010405
1232 Ga0207675_100063013
1233 Ga0207675_100129837
1234 Ga0207675_100802534
1235 Ga0207675_100914613
1236 Ga0207683_10096608
1237 Ga0207683_10395615
1238 Ga0207683_10824151
1239 Ga0207683_11436957
1240 Ga0207698_10006059
1241 Ga0207698_10469509
1242 Ga0207428_10194775
1243 Ga0207428_10372526
1244 Ga0207428_10439723
1245 Ga0207428_10477777
1246 Ga0268266_10000003
1247 Ga0268266_10009433
1248 Ga0268266_10190403
1249 Ga0268266_10395635
1250 Ga0268266_11125076
1251 Ga0268265_10145363
1252 Ga0268265_10388558
1253 Ga0268265_11829649
1254 Ga0268264_12196650
1255 Ga0265338_10145512
1256 Ga0316177_1191492
1257 Ga0316176_1104526
1258 Ga0314311_1125258
1259 Ga0316178_1067458
1260 Ga0316180_1183703
1261 Ga0265332_10051096
1262 Ga0265325_10004200
1263 Ga0265339_10014044
1264 Ga0265327_10107128
1265 Ga0265316_10015415
1266 Ga0307513_10191703
1267 Ga0307509_10258945
1268 Ga0307408_100328032
1269 Ga0307408_100547580
1270 Ga0307408_100739585
1271 Ga0265313_10001633
1272 Ga0265342_10099577
1273 Ga0307516_10088210
1274 Ga0307405_10050511
1275 Ga0307405_10059878
1276 Ga0307405_10135358
1277 Ga0307405_10360100
1278 Ga0307405_10985663
1279 Ga0307405_11516216
1280 Ga0307405_11766642
1281 Ga0307413_10014653
1282 Ga0307413_10105174
1283 Ga0307413_10124587
1284 Ga0307413_10174180
1285 Ga0307413_10992891
1286 Ga0307410_10006028
1287 Ga0307410_10026662
1288 Ga0307410_10054643
1289 Ga0307410_10088432
1290 Ga0307410_10109083
1291 Ga0307410_10283700
1292 Ga0307410_10378826
1293 Ga0307410_10635578
1294 Ga0307406_10041354
1295 Ga0307406_10082497
1296 Ga0307406_10088635
1297 Ga0307406_10128428
1298 Ga0307406_10463308
1299 Ga0307406_10801031
1300 Ga0307406_11590299
1301 Ga0307407_10026487
1302 Ga0307407_10034790
1303 Ga0307407_10055705
1304 Ga0307407_10450287
1305 Ga0307407_10629642
1306 Ga0307407_11333931
1307 Ga0307412_10133191
1308 Ga0307412_10205474
1309 Ga0307412_10208500
1310 Ga0307412_10590348
1311 Ga0307412_11940696
1312 Ga0307409_100038617
1313 Ga0307409_100059222
1314 Ga0307409_100211724
1315 Ga0307409_100290318
1316 Ga0307409_100484107
1317 Ga0307409_100528799
1318 Ga0307409_100654889
1319 Ga0307409_101369047
1320 Ga0307416_100019190
1321 Ga0307416_100050386
1322 Ga0307416_100061548
1323 Ga0307416_100082931
1324 Ga0307416_100120549
1325 Ga0307416_100261582
1326 Ga0307416_100474554
1327 Ga0307416_100486760
1328 Ga0307416_103315573
1329 Ga0307414_10085541
1330 Ga0307414_10543652
1331 Ga0307414_11439189
1332 Ga0307411_10007307
1333 Ga0307411_11593108
1334 Ga0307415_100000674
1335 Ga0307415_100033197
1336 Ga0307415_100039148
1337 Ga0307415_100059419
1338 Ga0307415_100065630
1339 Ga0307415_100107037
1340 Ga0307415_100292951
1341 Ga0307415_100375005
1342 Ga0307415_100630680
1343 Ga0307415_100903346
1344 Ga0307415_101064047
1345 Ga0307415_101127486
1346 Ga0373940_0159917
1347 Ga0373936_0009520
1348 Ga0373939_0429855
1349 Ga0373945_0333492
1350 Ga0373956_0193093
1351 Ga0373946_0275116
1352 Ga0373955_0189360
1353 Ga0373955_0951876
1354 Ga0373924_0032626
1355 Ga0373931_0080892
1356 Ga0373935_0519857
1357 Ga0373935_0623084
1358 Ga0373935_1350604
1359 Ga0373927_0174025
1360 Ga0373927_0453773
1361 Ga0373933_0226159
1362 Ga0373947_0002654
1363 Ga0373947_0548167
1364 Ga0373937_0152493
1365 Ga0373937_0193324
1366 Ga0373937_0239102
1367 Ga0373937_0394633
1368 Ga0373937_1044643
1369 Ga0373925_1147047
1370 Ga0395899_0042212
1371 Ga0395899_0397259
1372 Ga0395899_0801607
1373 Ga0395900_0032165
1374 Ga0395900_0044946
1375 Ga0395900_1638487
1376 Ga0395898_0088529
1377 Ga0395905_0060705
1378 Ga0395905_0165909
1379 Ga0395905_0406631
1380 Ga0395901_0041377
1381 Ga0395901_0070061
1382 Ga0395901_0495709
1383 Ga0395901_1281577
1384 Ga0400483_134154
1385 Ga0439436_0002892
1386 Ga0439439_0015600
1387 Ga0439447_060393
1388 Ga0439466_0017615
1389 Ga0439465_0380326
1390 Ga0439465_0399789
1391 Ga0451802_1922017
1392 Ga0439433_0011215
1393 Ga0439442_006061
1394 Ga0439449_0030225
1395 Ga0439449_0192680
1396 Ga0439449_0312301
1397 Ga0439457_074057
1398 Ga0439462_0017164
1399 Ga0450920_060075
1400 Ga0450907_043173
1401 Ga0450908_108217
1402 Ga0439434_0007779
1403 Ga0439434_0039777
1404 Ga0439459_0019852
1405 Ga0466972_0001513
1406 Ga0466965_0025726
1407 Ga0466963_0784682
1408 Ga0466968_0050943
1409 Ga0466960_0006797
1410 Ga0451576_1743417
1411 Ga0466967_0089920
1412 Ga0466967_0436129
1413 Ga0495592_0218420
1414 Ga0495603_0192546
1415 Ga0495590_0063840
1416 Ga0495641_0118026
1417 Ga0495641_0584761
1418 Ga0495651_0087773
1419 Ga0495651_0593423
1420 Ga0495651_0717131
1421 Ga0495653_0104958
1422 Ga0495653_0835476
1423 Ga0495580_0017644
1424 Ga0495662_0198798
1425 Ga0495664_0177606
1426 Ga0495664_0400367
1427 Ga0495664_0509738
1428 Ga0495664_0659944
1429 Ga0495594_0650171
1430 Ga0495596_0188406
1431 Ga0495606_0007347
1432 Ga0495608_0067083
1433 Ga0495608_0333664
1434 Ga0495618_0172270
1435 Ga0495628_0042385
1436 Ga0495628_0352692
1437 Ga0495630_0004600
1438 Ga0495630_0029180
1439 Ga0495630_1348491
1440 Ga0495631_0092243
1441 Ga0495631_0113002
1442 Ga0495663_0052576
1443 Ga0495663_0185465
1444 Ga0495663_0251678
1445 Ga0495652_0033827
1446 Ga0495652_0066597
1447 Ga0495640_0015991
1448 Ga0495640_0164916
1449 Ga0495586_0023488
1450 Ga0495586_0096041
1451 Ga0495586_0112126
1452 Ga0495586_0205261
1453 Ga0495587_0111884
1454 Ga0495598_0429295
1455 Ga0495645_0091643
1456 Ga0495645_0131883
1457 Ga0495645_0263546
1458 Ga0495645_0940334
1459 Ga0495667_0060184
1460 Ga0495667_0235605
1461 Ga0495656_0002130
1462 Ga0495656_0193353
1463 Ga0495656_0615329
1464 Ga0495668_0000255
1465 Ga0495668_0195468
1466 Ga0495634_0158143
1467 Ga0495625_0002407
1468 Ga0495625_0278204
1469 Ga0495635_0282848
1470 Ga0495635_0336182
1471 Ga0495635_0962047
1472 Ga0495659_0002974
1473 Ga0495659_0363964
1474 Ga0495659_0365825
1475 Ga0495588_0090196
1476 Ga0495588_0158349
1477 Ga0495588_0258773
1478 Ga0495657_0097573
1479 Ga0495599_0133673
1480 Ga0495658_0157210
1481 Ga0495669_0005032
1482 Ga0495669_0206198
1483 Ga0495613_0098323
1484 Ga0495624_0006892
1485 Ga0495624_0612189
1486 Ga0495670_0003596
1487 Ga0495670_0261628
1488 Ga0495604_0288784
1489 Ga0495604_0535549
1490 Ga0495636_0299098
1491 Ga0495636_0454614
1492 Ga0495674_0033658
1493 Ga0495676_0331972
1494 Ga0495680_0050033
1495 Ga0495680_0068193
1496 Ga0495680_0547245
1497 Ga0495683_0033031
1498 Ga0495675_0517301
1499 Ga0495685_093035
1500 Ga0495684_0371725
1501 Ga0495684_0987288
1502 Ga0495593_0060921
1503 Ga0495602_0248647
1504 Ga0495602_0434481
1505 Ga0495626_0000764
1506 Ga0495626_0071291
1507 Ga0496100_0008690
1508 Ga0496100_0037762
1509 Ga0496100_0071563
1510 Ga0496100_0172557
1511 Ga0496100_1057668
1512 Ga0496100_1537277
1513 Ga0496101_0005580
1514 Ga0496101_0190026
1515 Ga0496101_0289043
1516 Ga0496101_0305717
1517 Ga0496101_1215798
1518 Ga0496102_0112020
1519 Ga0496102_0134019
1520 Ga0496102_0312594
1521 Ga0496102_0485848
1522 Ga0496102_1119145
1523 Ga0496103_0009030
1524 Ga0496103_0324542
1525 Ga0496104_0019890
1526 Ga0496104_0145831
1527 Ga0496104_0233804
1528 Ga0496104_0375943
1529 Ga0496104_0720420
1530 Ga0496104_1325371
1531 Ga0496105_0009334
1532 Ga0496105_0084139
1533 Ga0496105_0117886
1534 Ga0496105_0363800
1535 Ga0496105_0373395
1536 Ga0496106_0025488
1537 Ga0496106_0145998
1538 Ga0496106_0390442
1539 Ga0496106_0798489
1540 Ga0496106_0985690
1541 Ga0496107_0006066
1542 Ga0496107_0060871
1543 Ga0496108_0082811
1544 Ga0496108_0172947
1545 Ga0496108_0349011
1546 Ga0496108_0822514
1547 Ga0496108_1047569
1548 Ga0496109_0087913
1549 Ga0496109_0209434
1550 Ga0496109_0220810
1551 Ga0496109_0245611
1552 Ga0496109_0257373
1553 Ga0496109_0424544
1554 Ga0496109_0631071
1555 Ga0496109_0660402
1556 Ga0496109_0802148
1557 Ga0496110_0022249
1558 Ga0496110_0055077
1559 Ga0496110_0090081
1560 Ga0496110_0176104
1561 Ga0496110_1499265
1562 Ga0496111_0018949
1563 Ga0496111_0027403
1564 Ga0496111_0279432
1565 Ga0496111_0372082
1566 Ga0496111_0421208
1567 Ga0496111_0464331
1568 Ga0496112_0130959
1569 Ga0496112_0406019
1570 Ga0496112_0627059
1571 Ga0496112_0849333
1572 Ga0496112_0901848
1573 Ga0496112_0997500
1574 Ga0496113_0349611
1575 Ga0496113_0747541
1576 Ga0496113_0877631
1577 Ga0496113_1087276
1578 Ga0496113_1189904
1579 Ga0496114_0222098
1580 Ga0496114_0459684
1581 Ga0496114_1308842
1582 Ga0496115_0022278
1583 Ga0496115_0036751
1584 Ga0496115_0226871
1585 Ga0496115_0444260
1586 Ga0496115_0488398
1587 Ga0496115_0649594
1588 Ga0496119_0016355
1589 Ga0496119_0022918
1590 Ga0496120_0011175
1591 Ga0496120_0202641
1592 Ga0496121_0010886
1593 Ga0496121_0299101
1594 Ga0496125_0078166
1595 Ga0496125_0763780
1596 Ga0495682_0062825
1597 Ga0501031_0032965
1598 Ga0501031_0038115
1599 Ga0501031_0058687
1600 Ga0501032_0277071
1601 Ga0501033_0239648
1602 Ga0501033_0277168
1603 Ga0501033_0485883
1604 Ga0501034_1158261
1605 Ga0501036_0029124
1606 Ga0501036_0123197
1607 Ga0501036_0439140
1608 Ga0501036_0636709
1609 Ga0501036_0869778
1610 Ga0501037_0090394
1611 Ga0501037_0203087
1612 Ga0501038_0085531
1613 Ga0501038_0150834
1614 Ga0501038_0302978
1615 Ga0501039_0003839
1616 Ga0501039_0110259
1617 Ga0501039_0226326
1618 Ga0501039_0372654
1619 Ga0501040_0002378
1620 Ga0501040_0184353
1621 Ga0501040_0436019
1622 Ga0501041_0007664
1623 Ga0501041_0044616
1624 Ga0501041_0163752
1625 Ga0501041_0341626
1626 Ga0501042_0069835
1627 Ga0501042_0376551
1628 Ga0501042_0404713
1629 Ga0501042_0724087
1630 Ga0501043_0167024
1631 Ga0501043_0256259
1632 Ga0501046_0022194
1633 Ga0501046_0472896
1634 Ga0501046_0485139
1635 Ga0501046_0497906
1636 Ga0501046_0654105
1637 Ga0501047_0405583
1638 Ga0501047_0781724
1639 Ga0501047_1383562
1640 Ga0501048_0245530
1641 Ga0501048_0339177
1642 Ga0501048_0425049
1643 Ga0501048_0443981
1644 Ga0501048_0890677
1645 Ga0501068_0129833
1646 Ga0501068_0381552
1647 Ga0501068_0929835
1648 Ga0501069_0058796
1649 Ga0501069_0670362
1650 Ga0501070_0869103
1651 Ga0501070_0940340
1652 Ga0501070_1343072
1653 Ga0501071_0110802
1654 Ga0501071_0119763
1655 Ga0501071_0238813
1656 Ga0501071_0481477
1657 Ga0501071_0490695
1658 Ga0501071_0665839
1659 Ga0501072_0049296
1660 Ga0501072_0156589
1661 Ga0501072_0175880
1662 Ga0501073_0243428
1663 Ga0501073_0300650
1664 Ga0501073_0393275
1665 Ga0501074_0027540
1666 Ga0501074_0147480
1667 Ga0501074_0257657
1668 Ga0501074_0487572
1669 Ga0501074_0543029
1670 Ga0501075_0005211
1671 Ga0501075_0036916
1672 Ga0501075_0332660
1673 Ga0501075_0484792
1674 Ga0501075_0908177
1675 Ga0501075_1245041
1676 Ga0501076_0003685
1677 Ga0501076_0152781
1678 Ga0501076_1306770
1679 Ga0501077_0008224
1680 Ga0501077_0274083
1681 Ga0501077_0548216
1682 Ga0501077_0825859
1683 Ga0501079_0001681
1684 Ga0501079_0097332
1685 Ga0501079_0141149
1686 Ga0501080_0682651
1687 Ga0501080_1231421
1688 Ga0501081_0004461
1689 Ga0501081_0038829
1690 Ga0501081_1003260
1691 Ga0501081_1015761
1692 Ga0501083_0274676
1693 Ga0501083_0484069
1694 Ga0501035_0444727
1695 Ga0501044_1188162
1696 Ga0501044_1284455
1697 Ga0501044_1547254
1698 Ga0501045_0067138
1699 Ga0501045_0498640
1700 Ga0501045_1057880
1701 Ga0501045_1331268
1702 nmdc:mga03n38_25099_c1
1703 nmdc:mga00v17_140026_c1
1704 nmdc:mga00v17_277712_c1
1705 nmdc:mga00v17_498877_c1
1706 nmdc:mga00v17_78932_c1
1707 nmdc:mga0yw44_160426_c1
1708 nmdc:mga0yw44_250863_c1
1709 nmdc:mga0yw44_328183_c1
1710 nmdc:mga0yw44_57589_c1
1711 nmdc:mga0yw44_84550_c1
1712 nmdc:mga0yw44_889998_c1
1713 nmdc:mga06z11_262595_c1
1714 nmdc:mga06z11_70830_c1
1715 nmdc:mga06z11_85423_c1
1716 nmdc:mga07m45_62172_c1
1717 nmdc:mga07m45_78763_c1
1718 nmdc:mga05p37_19536_c1
1719 nmdc:mga05p37_833437_c1
1720 nmdc:mga09592_1116129_c1
1721 nmdc:mga09592_206266_c1
1722 nmdc:mga09592_68077_c1
1723 nmdc:mga0qj67_110604_c1
1724 nmdc:mga0qj67_6873_c1
1725 nmdc:mga06r32_2060_c1
1726 nmdc:mga06r32_328252_c1
1727 nmdc:mga08y16_1528832_c1
1728 nmdc:mga08y16_894109_c1
1729 nmdc:mga0n895_2035536_c1
1730 nmdc:mga0rr50_228310_c1
1731 nmdc:mga0a205_173805_c1
1732 Ga0495601_0201244
1733 Ga0495612_0325849
1734 Ga0495655_0089087
1735 Ga0495619_0624100
1736 Ga0500644_0000019
1737 Ga0500594_0130390
1738 Ga0500655_037329
1739 Ga0500655_060376
1740 Ga0500568_0000264
1741 Ga0500568_0102030
1742 Ga0501084_0033243
1743 Ga0501084_0168684
1744 Ga0501084_0173424
1745 Ga0501084_0606492
1746 Ga0501084_1159127
1747 Ga0501082_0033259
1748 Ga0501082_0538785
1749 Ga0501082_0596515
1750 Ga0501082_1513970
1751 Ga0530510_0038764
1752 Ga0530510_0356325
1753 Ga0530510_0469374
1754 Ga0530510_0745570
1755 2821449084
1756 2870784693
1757 2919393606
1758 8054109405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

12

50

0.9

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

127

0.82

PF18029

Glyoxalase_6

Glyoxalase-like domain

12

128

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8417 4 123
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8316 4 123
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8239 1 123
2kjz-assembly1.cif.gz_B solution nmr structure of protein atc0852 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att2. 0.8208 5 124
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8205 1 123
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8931 72 119 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8819 72 123 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8348 68 123 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8232 71 125 3.30.720.110
3r4qE01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8137 4 121 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A538JBW9-F1-model_v4 VOC family protein 0.9947 2 125 GO:0004493
GO:0046491
GO:0046872
AF-A0A538D3E7-F1-model_v4 VOC family protein 0.9941 7 123 GO:0004493
GO:0046491
GO:0046872
AF-A0A495K2E6-F1-model_v4 merged 0.9923 3 123
AF-A0A1G9MVT2-F1-model_v4 VOC domain-containing protein 0.9904 2 125 GO:0004493
GO:0046491
AF-A0A7G1KL74-F1-model_v4 Glyoxalase 0.9894 2 125 GO:0004493
GO:0046491

Map