F484467
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 879 | 319 | 879 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0032001|Ga0451577_0032001_2194_2934 |
| Length | 246 |
| Sequence | MNLKGVVLAGGMGTRLSPLTRVTNKHLLPIYDEPMVYYPIRSLVEAGVRDIMVVSGGESAGHFLKLLGNGEDFGLEHLEYGYQKGAGGIAEALGLTRYFIGNDPVVVILGDNILEKPIAGAVDRFRRQGGGARVLLKKVPDPGRFGVAEVDGAGKVLSIEEKPRQPKSDLAVIGVYMYDNDVFRIIDGLQRSARGELEITDVNNAYRNLGKLHAEVIDGWWTDAGTFESLFHASSLVRDLKRSRKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 204 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 211 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 212 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 213 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 214 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 215 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 252 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 253 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 254 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 255 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 272 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 273 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 274 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 275 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 276 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 277 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 278 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 279 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 281 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 283 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 285 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 286 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 287 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 288 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 289 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 295 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 296 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 297 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 298 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 299 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 303 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 317 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.23 |
| Nodule | 0 |
| Rhizoplane | 1.37 |
| Rhizosphere | 96.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000001 | 3300002074 | Bacteria | 444271 |
| 2 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 3 | JGI25406J46586_10005418 | 3300003203 | Bacteria | 5921 |
| 4 | JGI25406J46586_10016199 | 3300003203 | Unclassified | 3114 |
| 5 | Ga0065714_10064445 | 3300005288 | Bacteria | 90891 |
| 6 | Ga0065704_10001951 | 3300005289 | Bacteria | 11456 |
| 7 | Ga0065704_10007121 | 3300005289 | Bacteria | 3146 |
| 8 | Ga0065704_10150020 | 3300005289 | Unclassified | 1437 |
| 9 | Ga0065704_10240525 | 3300005289 | Bacteria | 1016 |
| 10 | Ga0065712_10000114 | 3300005290 | Bacteria | 191810 |
| 11 | Ga0065712_10002363 | 3300005290 | Bacteria | 6297 |
| 12 | Ga0065712_10068601 | 3300005290 | Bacteria | 9684 |
| 13 | Ga0065712_10083656 | 3300005290 | Bacteria | 2820 |
| 14 | Ga0065712_10096352 | 3300005290 | Bacteria | 2181 |
| 15 | Ga0065712_10149654 | 3300005290 | Bacteria | 1379 |
| 16 | Ga0065715_10001707 | 3300005293 | Bacteria | 9858 |
| 17 | Ga0065715_10005851 | 3300005293 | Bacteria | 6117 |
| 18 | Ga0065715_10023552 | 3300005293 | Bacteria | 2088 |
| 19 | Ga0065715_10109661 | 3300005293 | Bacteria | 2658 |
| 20 | Ga0065715_10217063 | 3300005293 | Unclassified | 1288 |
| 21 | Ga0065707_10001745 | 3300005295 | Bacteria | 10122 |
| 22 | Ga0065707_10002540 | 3300005295 | Unclassified | 4465 |
| 23 | Ga0065707_10095984 | 3300005295 | Unclassified | 3316 |
| 24 | Ga0070683_100330323 | 3300005329 | Unclassified | 1452 |
| 25 | Ga0070690_100003652 | 3300005330 | Bacteria | 8470 |
| 26 | Ga0070690_100019914 | 3300005330 | Bacteria | 4082 |
| 27 | Ga0070690_100022292 | 3300005330 | Bacteria | 3873 |
| 28 | Ga0070690_100050501 | 3300005330 | Bacteria | 2654 |
| 29 | Ga0070677_10056251 | 3300005333 | Bacteria | 1608 |
| 30 | Ga0068869_100031699 | 3300005334 | Bacteria | 3719 |
| 31 | Ga0068869_100086868 | 3300005334 | Bacteria | 2345 |
| 32 | Ga0068869_100123941 | 3300005334 | Bacteria | 1979 |
| 33 | Ga0070666_10146995 | 3300005335 | Bacteria | 1643 |
| 34 | Ga0070680_100212745 | 3300005336 | Bacteria | 1631 |
| 35 | Ga0070682_100068715 | 3300005337 | Unclassified | 2261 |
| 36 | Ga0070682_100589518 | 3300005337 | Bacteria | 876 |
| 37 | Ga0068868_100017053 | 3300005338 | Bacteria | 5404 |
| 38 | Ga0068868_100329023 | 3300005338 | Bacteria | 1304 |
| 39 | Ga0070689_100009432 | 3300005340 | Bacteria | 6919 |
| 40 | Ga0070689_100027225 | 3300005340 | Bacteria | 4309 |
| 41 | Ga0070687_100010363 | 3300005343 | Bacteria | 4029 |
| 42 | Ga0070687_100024212 | 3300005343 | Unclassified | 2895 |
| 43 | Ga0070687_100060050 | 3300005343 | Bacteria | 2004 |
| 44 | Ga0070661_100271867 | 3300005344 | Bacteria | 1313 |
| 45 | Ga0070661_100348728 | 3300005344 | Unclassified | 1161 |
| 46 | Ga0070692_10023252 | 3300005345 | Bacteria | 3035 |
| 47 | Ga0070692_10304276 | 3300005345 | Bacteria | 974 |
| 48 | Ga0070668_100488770 | 3300005347 | Bacteria | 1064 |
| 49 | Ga0070668_100572633 | 3300005347 | Bacteria | 985 |
| 50 | Ga0070669_100027093 | 3300005353 | Unclassified | 4125 |
| 51 | Ga0070669_100058546 | 3300005353 | Unclassified | 2828 |
| 52 | Ga0070669_100101798 | 3300005353 | Bacteria | 2168 |
| 53 | Ga0070669_100117100 | 3300005353 | Bacteria | 2028 |
| 54 | Ga0070669_100275584 | 3300005353 | Bacteria | 1346 |
| 55 | Ga0070669_100300504 | 3300005353 | Bacteria | 1291 |
| 56 | Ga0070675_100353457 | 3300005354 | Bacteria | 1303 |
| 57 | Ga0070671_100003741 | 3300005355 | Bacteria | 11943 |
| 58 | Ga0070671_100004147 | 3300005355 | Bacteria | 11444 |
| 59 | Ga0070671_100017451 | 3300005355 | Bacteria | 5814 |
| 60 | Ga0070671_100055850 | 3300005355 | Bacteria | 3285 |
| 61 | Ga0070671_100074615 | 3300005355 | Unclassified | 2834 |
| 62 | Ga0070673_100000494 | 3300005364 | Bacteria | 21008 |
| 63 | Ga0070673_100027151 | 3300005364 | Bacteria | 4240 |
| 64 | Ga0070673_100284413 | 3300005364 | Bacteria | 1451 |
| 65 | Ga0070673_100313635 | 3300005364 | Bacteria | 1384 |
| 66 | Ga0070673_100318856 | 3300005364 | Bacteria | 1372 |
| 67 | Ga0070688_100170509 | 3300005365 | Bacteria | 1501 |
| 68 | Ga0070688_100270045 | 3300005365 | Bacteria | 1218 |
| 69 | Ga0070688_100441915 | 3300005365 | Unclassified | 971 |
| 70 | Ga0070667_100144584 | 3300005367 | Unclassified | 2085 |
| 71 | Ga0070667_100542033 | 3300005367 | Bacteria | 1069 |
| 72 | Ga0070703_10000169 | 3300005406 | Bacteria | 32165 |
| 73 | Ga0070703_10001965 | 3300005406 | Bacteria | 6016 |
| 74 | Ga0070703_10021364 | 3300005406 | Bacteria | 1891 |
| 75 | Ga0070703_10043098 | 3300005406 | Bacteria | 1414 |
| 76 | Ga0070709_10000145 | 3300005434 | Bacteria | 47402 |
| 77 | Ga0070709_10050176 | 3300005434 | Bacteria | 2613 |
| 78 | Ga0070714_100008928 | 3300005435 | Bacteria | 7843 |
| 79 | Ga0070701_10029425 | 3300005438 | Bacteria | 2709 |
| 80 | Ga0070701_10121120 | 3300005438 | Bacteria | 1474 |
| 81 | Ga0070701_10131294 | 3300005438 | Unclassified | 1423 |
| 82 | Ga0070701_10138704 | 3300005438 | Bacteria | 1388 |
| 83 | Ga0070701_10157239 | 3300005438 | Bacteria | 1314 |
| 84 | Ga0070701_10313976 | 3300005438 | Bacteria | 968 |
| 85 | Ga0070705_100004461 | 3300005440 | Bacteria | 6816 |
| 86 | Ga0070705_100018954 | 3300005440 | Bacteria | 3614 |
| 87 | Ga0070705_100156621 | 3300005440 | Bacteria | 1518 |
| 88 | Ga0070700_100000122 | 3300005441 | Bacteria | 47908 |
| 89 | Ga0070700_100004436 | 3300005441 | Bacteria | 7333 |
| 90 | Ga0070700_100013304 | 3300005441 | Bacteria | 4621 |
| 91 | Ga0070700_100156833 | 3300005441 | Bacteria | 1563 |
| 92 | Ga0070700_100361794 | 3300005441 | Bacteria | 1079 |
| 93 | Ga0070700_100379352 | 3300005441 | Bacteria | 1057 |
| 94 | Ga0070694_100000497 | 3300005444 | Bacteria | 21582 |
| 95 | Ga0070694_100002515 | 3300005444 | Bacteria | 10828 |
| 96 | Ga0070694_100010103 | 3300005444 | Bacteria | 5807 |
| 97 | Ga0070694_100012009 | 3300005444 | Bacteria | 5376 |
| 98 | Ga0070694_100025490 | 3300005444 | Bacteria | 3826 |
| 99 | Ga0070694_100058320 | 3300005444 | Bacteria | 2626 |
| 100 | Ga0070694_100124946 | 3300005444 | Bacteria | 1851 |
| 101 | Ga0070694_100136256 | 3300005444 | Bacteria | 1779 |
| 102 | Ga0070694_100283957 | 3300005444 | Bacteria | 1263 |
| 103 | Ga0070694_100442347 | 3300005444 | Bacteria | 1025 |
| 104 | Ga0070708_100009886 | 3300005445 | Bacteria | 7708 |
| 105 | Ga0070708_100042703 | 3300005445 | Bacteria | 3982 |
| 106 | Ga0070708_100063815 | 3300005445 | Bacteria | 3298 |
| 107 | Ga0070678_100000362 | 3300005456 | Bacteria | 21123 |
| 108 | Ga0070678_100033270 | 3300005456 | Bacteria | 3577 |
| 109 | Ga0070678_100146352 | 3300005456 | Unclassified | 1897 |
| 110 | Ga0070662_100145255 | 3300005457 | Bacteria | 1842 |
| 111 | Ga0070662_100247555 | 3300005457 | Unclassified | 1432 |
| 112 | Ga0070662_100467317 | 3300005457 | Unclassified | 1049 |
| 113 | Ga0070681_10125016 | 3300005458 | Bacteria | 2505 |
| 114 | Ga0070681_10440486 | 3300005458 | Bacteria | 1215 |
| 115 | Ga0070681_10472221 | 3300005458 | Bacteria | 1167 |
| 116 | Ga0068867_100032731 | 3300005459 | Bacteria | 3762 |
| 117 | Ga0068867_100125133 | 3300005459 | Bacteria | 1991 |
| 118 | Ga0068867_100533769 | 3300005459 | Bacteria | 1014 |
| 119 | Ga0068867_100652796 | 3300005459 | Bacteria | 923 |
| 120 | Ga0070706_100008713 | 3300005467 | Bacteria | 9454 |
| 121 | Ga0070706_100008898 | 3300005467 | Bacteria | 9350 |
| 122 | Ga0070706_100009122 | 3300005467 | Bacteria | 9238 |
| 123 | Ga0070706_100063507 | 3300005467 | Bacteria | 3413 |
| 124 | Ga0070706_100088496 | 3300005467 | Bacteria | 2871 |
| 125 | Ga0070706_100112848 | 3300005467 | Bacteria | 2531 |
| 126 | Ga0070706_100509789 | 3300005467 | Bacteria | 1119 |
| 127 | Ga0070707_100000020 | 3300005468 | Bacteria | 130967 |
| 128 | Ga0070707_100000456 | 3300005468 | Bacteria | 40527 |
| 129 | Ga0070707_100000556 | 3300005468 | Bacteria | 37476 |
| 130 | Ga0070707_100007732 | 3300005468 | Bacteria | 9987 |
| 131 | Ga0070707_100709309 | 3300005468 | Bacteria | 969 |
| 132 | Ga0070698_100019542 | 3300005471 | Bacteria | 7111 |
| 133 | Ga0070698_100045461 | 3300005471 | Bacteria | 4494 |
| 134 | Ga0070698_100055975 | 3300005471 | Bacteria | 3997 |
| 135 | Ga0070698_100065817 | 3300005471 | Bacteria | 3649 |
| 136 | Ga0070698_100154735 | 3300005471 | Bacteria | 2238 |
| 137 | Ga0070698_100423685 | 3300005471 | Bacteria | 1266 |
| 138 | Ga0070699_100005039 | 3300005518 | Bacteria | 11627 |
| 139 | Ga0070699_100005655 | 3300005518 | Bacteria | 10946 |
| 140 | Ga0070699_100005760 | 3300005518 | Bacteria | 10840 |
| 141 | Ga0070699_100032091 | 3300005518 | Bacteria | 4536 |
| 142 | Ga0070699_100155740 | 3300005518 | Bacteria | 2022 |
| 143 | Ga0070699_100237326 | 3300005518 | Bacteria | 1626 |
| 144 | Ga0070699_100473722 | 3300005518 | Bacteria | 1136 |
| 145 | Ga0070679_100031421 | 3300005530 | Bacteria | 5245 |
| 146 | Ga0070679_100126043 | 3300005530 | Bacteria | 2543 |
| 147 | Ga0070679_100174323 | 3300005530 | Bacteria | 2123 |
| 148 | Ga0070679_100503685 | 3300005530 | Bacteria | 1155 |
| 149 | Ga0070684_100603427 | 3300005535 | Unclassified | 1021 |
| 150 | Ga0070697_100001443 | 3300005536 | Bacteria | 18068 |
| 151 | Ga0070697_100012754 | 3300005536 | Bacteria | 6582 |
| 152 | Ga0070697_100018631 | 3300005536 | Bacteria | 5475 |
| 153 | Ga0070697_100075678 | 3300005536 | Bacteria | 2768 |
| 154 | Ga0070697_100076477 | 3300005536 | Bacteria | 2753 |
| 155 | Ga0070697_100089016 | 3300005536 | Bacteria | 2550 |
| 156 | Ga0070697_100117501 | 3300005536 | Bacteria | 2222 |
| 157 | Ga0068853_100116933 | 3300005539 | Bacteria | 2375 |
| 158 | Ga0068853_100378625 | 3300005539 | Bacteria | 1321 |
| 159 | Ga0070672_100055206 | 3300005543 | Bacteria | 3111 |
| 160 | Ga0070672_100170098 | 3300005543 | Bacteria | 1812 |
| 161 | Ga0070672_100565713 | 3300005543 | Bacteria | 988 |
| 162 | Ga0070686_100087615 | 3300005544 | Bacteria | 2076 |
| 163 | Ga0070686_100094373 | 3300005544 | Bacteria | 2008 |
| 164 | Ga0070695_100001424 | 3300005545 | Bacteria | 13255 |
| 165 | Ga0070695_100088508 | 3300005545 | Bacteria | 2062 |
| 166 | Ga0070695_100134565 | 3300005545 | Bacteria | 1707 |
| 167 | Ga0070695_100247436 | 3300005545 | Unclassified | 1296 |
| 168 | Ga0070695_100361806 | 3300005545 | Bacteria | 1090 |
| 169 | Ga0070695_100559032 | 3300005545 | Unclassified | 893 |
| 170 | Ga0070696_100002349 | 3300005546 | Bacteria | 12491 |
| 171 | Ga0070696_100005110 | 3300005546 | Bacteria | 8768 |
| 172 | Ga0070696_100006993 | 3300005546 | Bacteria | 7529 |
| 173 | Ga0070696_100012215 | 3300005546 | Bacteria | 5755 |
| 174 | Ga0070696_100048890 | 3300005546 | Bacteria | 2936 |
| 175 | Ga0070696_100292687 | 3300005546 | Bacteria | 1244 |
| 176 | Ga0070696_100471192 | 3300005546 | Bacteria | 994 |
| 177 | Ga0070696_100568590 | 3300005546 | Bacteria | 910 |
| 178 | Ga0070693_100000120 | 3300005547 | Bacteria | 35065 |
| 179 | Ga0070693_100002084 | 3300005547 | Bacteria | 9151 |
| 180 | Ga0070693_100057601 | 3300005547 | Bacteria | 2247 |
| 181 | Ga0070693_100076437 | 3300005547 | Bacteria | 1985 |
| 182 | Ga0070665_100000060 | 3300005548 | Bacteria | 222524 |
| 183 | Ga0070665_100104625 | 3300005548 | Bacteria | 2833 |
| 184 | Ga0070665_100428194 | 3300005548 | Bacteria | 1332 |
| 185 | Ga0070704_100001083 | 3300005549 | Bacteria | 14113 |
| 186 | Ga0070704_100021552 | 3300005549 | Unclassified | 4181 |
| 187 | Ga0070704_100078227 | 3300005549 | Bacteria | 2426 |
| 188 | Ga0070704_100107395 | 3300005549 | Unclassified | 2117 |
| 189 | Ga0070664_100007758 | 3300005564 | Bacteria | 8664 |
| 190 | Ga0070664_100322538 | 3300005564 | Unclassified | 1400 |
| 191 | Ga0070664_100435051 | 3300005564 | Bacteria | 1203 |
| 192 | Ga0068857_100113314 | 3300005577 | Bacteria | 2438 |
| 193 | Ga0068857_100206718 | 3300005577 | Bacteria | 1791 |
| 194 | Ga0068854_100029189 | 3300005578 | Bacteria | 3817 |
| 195 | Ga0068854_100076161 | 3300005578 | Bacteria | 2465 |
| 196 | Ga0070702_100021283 | 3300005615 | Bacteria | 3410 |
| 197 | Ga0070702_100068106 | 3300005615 | Bacteria | 2094 |
| 198 | Ga0070702_100097684 | 3300005615 | Bacteria | 1795 |
| 199 | Ga0068852_100073151 | 3300005616 | Unclassified | 3015 |
| 200 | Ga0068852_100143959 | 3300005616 | Bacteria | 2209 |
| 201 | Ga0068859_100022372 | 3300005617 | Bacteria | 6338 |
| 202 | Ga0068859_100028814 | 3300005617 | Bacteria | 5568 |
| 203 | Ga0068859_100049326 | 3300005617 | Bacteria | 4228 |
| 204 | Ga0068859_100087485 | 3300005617 | Unclassified | 3164 |
| 205 | Ga0068859_100098812 | 3300005617 | Bacteria | 2973 |
| 206 | Ga0068859_100109287 | 3300005617 | Bacteria | 2826 |
| 207 | Ga0068859_100111141 | 3300005617 | Bacteria | 2802 |
| 208 | Ga0068859_100200012 | 3300005617 | Bacteria | 2083 |
| 209 | Ga0068859_100261377 | 3300005617 | Bacteria | 1822 |
| 210 | Ga0068859_100286436 | 3300005617 | Unclassified | 1740 |
| 211 | Ga0068859_100349749 | 3300005617 | Bacteria | 1573 |
| 212 | Ga0068859_100837585 | 3300005617 | Unclassified | 1006 |
| 213 | Ga0068864_100007174 | 3300005618 | Bacteria | 9152 |
| 214 | Ga0068864_100010461 | 3300005618 | Bacteria | 7666 |
| 215 | Ga0068864_100075146 | 3300005618 | Bacteria | 2950 |
| 216 | Ga0068864_100129471 | 3300005618 | Bacteria | 2265 |
| 217 | Ga0068864_100530300 | 3300005618 | Bacteria | 1136 |
| 218 | Ga0068864_100852721 | 3300005618 | Bacteria | 898 |
| 219 | Ga0068866_10018871 | 3300005718 | Bacteria | 3128 |
| 220 | Ga0068866_10152582 | 3300005718 | Unclassified | 1339 |
| 221 | Ga0068861_100016775 | 3300005719 | Bacteria | 5189 |
| 222 | Ga0068861_100187626 | 3300005719 | Bacteria | 1726 |
| 223 | Ga0068851_10047508 | 3300005834 | Bacteria | 2174 |
| 224 | Ga0068851_10112492 | 3300005834 | Bacteria | 1455 |
| 225 | Ga0068870_10022762 | 3300005840 | Bacteria | 3082 |
| 226 | Ga0068863_100072812 | 3300005841 | Bacteria | 3251 |
| 227 | Ga0068863_100081003 | 3300005841 | Bacteria | 3075 |
| 228 | Ga0068863_100165629 | 3300005841 | Bacteria | 2119 |
| 229 | Ga0068863_100219577 | 3300005841 | Bacteria | 1831 |
| 230 | Ga0068863_100262665 | 3300005841 | Bacteria | 1669 |
| 231 | Ga0068863_100478601 | 3300005841 | Bacteria | 1224 |
| 232 | Ga0068858_100000044 | 3300005842 | Bacteria | 128977 |
| 233 | Ga0068858_100327659 | 3300005842 | Bacteria | 1464 |
| 234 | Ga0068858_100399432 | 3300005842 | Bacteria | 1320 |
| 235 | Ga0068858_100407305 | 3300005842 | Unclassified | 1307 |
| 236 | Ga0068858_100408252 | 3300005842 | Bacteria | 1305 |
| 237 | Ga0068860_100002648 | 3300005843 | Bacteria | 18629 |
| 238 | Ga0068860_100006967 | 3300005843 | Bacteria | 11331 |
| 239 | Ga0068860_100007291 | 3300005843 | Bacteria | 11059 |
| 240 | Ga0068860_100046420 | 3300005843 | Bacteria | 4141 |
| 241 | Ga0068860_100184222 | 3300005843 | Unclassified | 2019 |
| 242 | Ga0068860_100453840 | 3300005843 | Bacteria | 1275 |
| 243 | Ga0068862_100008996 | 3300005844 | Bacteria | 8266 |
| 244 | Ga0068862_100016042 | 3300005844 | Bacteria | 6230 |
| 245 | Ga0068862_100068954 | 3300005844 | Bacteria | 3051 |
| 246 | Ga0068862_100143069 | 3300005844 | Bacteria | 2124 |
| 247 | Ga0068862_100793972 | 3300005844 | Unclassified | 924 |
| 248 | Ga0081455_10009173 | 3300005937 | Bacteria | 10196 |
| 249 | Ga0081539_10000428 | 3300005985 | Bacteria | 89485 |
| 250 | Ga0081539_10000652 | 3300005985 | Bacteria | 69804 |
| 251 | Ga0081539_10000654 | 3300005985 | Bacteria | 69664 |
| 252 | Ga0081539_10001420 | 3300005985 | Bacteria | 41183 |
| 253 | Ga0081539_10109872 | 3300005985 | Bacteria | 1390 |
| 254 | Ga0070716_100061008 | 3300006173 | Bacteria | 2181 |
| 255 | Ga0070716_100130284 | 3300006173 | Bacteria | 1589 |
| 256 | Ga0070716_100211555 | 3300006173 | Bacteria | 1296 |
| 257 | Ga0097621_100168148 | 3300006237 | Bacteria | 1888 |
| 258 | Ga0097621_100179541 | 3300006237 | Bacteria | 1829 |
| 259 | Ga0068871_100011376 | 3300006358 | Bacteria | 6525 |
| 260 | Ga0075428_100016191 | 3300006844 | Bacteria | 8242 |
| 261 | Ga0075428_100034515 | 3300006844 | Bacteria | 5579 |
| 262 | Ga0075428_100039862 | 3300006844 | Bacteria | 5170 |
| 263 | Ga0075428_100040929 | 3300006844 | Bacteria | 5096 |
| 264 | Ga0075428_100097092 | 3300006844 | Bacteria | 3212 |
| 265 | Ga0075428_100102473 | 3300006844 | Bacteria | 3121 |
| 266 | Ga0075428_100115401 | 3300006844 | Bacteria | 2925 |
| 267 | Ga0075428_100264774 | 3300006844 | Bacteria | 1850 |
| 268 | Ga0075428_100684829 | 3300006844 | Unclassified | 1092 |
| 269 | Ga0075428_100768847 | 3300006844 | Bacteria | 1024 |
| 270 | Ga0075430_100053938 | 3300006846 | Bacteria | 3383 |
| 271 | Ga0075430_100054026 | 3300006846 | Bacteria | 3380 |
| 272 | Ga0075430_100136164 | 3300006846 | Bacteria | 2046 |
| 273 | Ga0075431_100015521 | 3300006847 | Bacteria | 7719 |
| 274 | Ga0075431_100113184 | 3300006847 | Bacteria | 2801 |
| 275 | Ga0075431_100195358 | 3300006847 | Unclassified | 2072 |
| 276 | Ga0075431_100230617 | 3300006847 | Bacteria | 1887 |
| 277 | Ga0075433_10019208 | 3300006852 | Bacteria | 5689 |
| 278 | Ga0075433_10035192 | 3300006852 | Bacteria | 4305 |
| 279 | Ga0075433_10035892 | 3300006852 | Bacteria | 4267 |
| 280 | Ga0075433_10081560 | 3300006852 | Unclassified | 2852 |
| 281 | Ga0075433_10090867 | 3300006852 | Bacteria | 2699 |
| 282 | Ga0075433_10250231 | 3300006852 | Bacteria | 1572 |
| 283 | Ga0075433_10286765 | 3300006852 | Bacteria | 1458 |
| 284 | Ga0075433_10525299 | 3300006852 | Bacteria | 1041 |
| 285 | Ga0075434_100029949 | 3300006871 | Bacteria | 5358 |
| 286 | Ga0075434_100105034 | 3300006871 | Bacteria | 2835 |
| 287 | Ga0075434_100215076 | 3300006871 | Bacteria | 1942 |
| 288 | Ga0075434_100228789 | 3300006871 | Bacteria | 1879 |
| 289 | Ga0075434_100404689 | 3300006871 | Bacteria | 1386 |
| 290 | Ga0075434_100750045 | 3300006871 | Bacteria | 993 |
| 291 | Ga0075434_101032209 | 3300006871 | Bacteria | 836 |
| 292 | Ga0075429_100003364 | 3300006880 | Bacteria | 13629 |
| 293 | Ga0075429_100015685 | 3300006880 | Bacteria | 6565 |
| 294 | Ga0075429_100067799 | 3300006880 | Bacteria | 3106 |
| 295 | Ga0075429_100171091 | 3300006880 | Unclassified | 1903 |
| 296 | Ga0075429_100265678 | 3300006880 | Bacteria | 1502 |
| 297 | Ga0068865_100532640 | 3300006881 | Bacteria | 984 |
| 298 | Ga0075436_100017099 | 3300006914 | Bacteria | 4964 |
| 299 | Ga0075436_100019380 | 3300006914 | Bacteria | 4662 |
| 300 | Ga0075436_100143438 | 3300006914 | Unclassified | 1679 |
| 301 | Ga0075436_100216534 | 3300006914 | Bacteria | 1358 |
| 302 | Ga0097620_100022371 | 3300006931 | Bacteria | 6338 |
| 303 | Ga0097620_100028817 | 3300006931 | Bacteria | 5568 |
| 304 | Ga0097620_100049325 | 3300006931 | Bacteria | 4228 |
| 305 | Ga0097620_100087487 | 3300006931 | Unclassified | 3164 |
| 306 | Ga0097620_100098818 | 3300006931 | Bacteria | 2973 |
| 307 | Ga0097620_100109290 | 3300006931 | Bacteria | 2826 |
| 308 | Ga0097620_100111153 | 3300006931 | Bacteria | 2802 |
| 309 | Ga0097620_100200015 | 3300006931 | Bacteria | 2083 |
| 310 | Ga0097620_100261379 | 3300006931 | Bacteria | 1822 |
| 311 | Ga0097620_100286443 | 3300006931 | Unclassified | 1740 |
| 312 | Ga0097620_100349708 | 3300006931 | Bacteria | 1573 |
| 313 | Ga0097620_100454623 | 3300006931 | Bacteria | 1377 |
| 314 | Ga0097620_100837677 | 3300006931 | Unclassified | 1006 |
| 315 | Ga0075435_100050247 | 3300007076 | Bacteria | 3355 |
| 316 | Ga0099794_10069046 | 3300007265 | Bacteria | 1729 |
| 317 | Ga0105240_10568392 | 3300009093 | Bacteria | 1252 |
| 318 | Ga0111539_10005372 | 3300009094 | Bacteria | 16565 |
| 319 | Ga0111539_10009392 | 3300009094 | Bacteria | 12346 |
| 320 | Ga0111539_10017738 | 3300009094 | Bacteria | 8813 |
| 321 | Ga0111539_10031255 | 3300009094 | Bacteria | 6469 |
| 322 | Ga0111539_10054426 | 3300009094 | Bacteria | 4761 |
| 323 | Ga0111539_10194061 | 3300009094 | Bacteria | 2369 |
| 324 | Ga0111539_10223318 | 3300009094 | Bacteria | 2194 |
| 325 | Ga0105245_10364776 | 3300009098 | Bacteria | 1434 |
| 326 | Ga0105247_10000004 | 3300009101 | Bacteria | 455497 |
| 327 | Ga0105247_10000951 | 3300009101 | Bacteria | 21864 |
| 328 | Ga0105247_10039404 | 3300009101 | Bacteria | 2887 |
| 329 | Ga0105247_10058770 | 3300009101 | Bacteria | 2379 |
| 330 | Ga0114129_10000340 | 3300009147 | Bacteria | 54409 |
| 331 | Ga0114129_10003845 | 3300009147 | Bacteria | 21167 |
| 332 | Ga0114129_10006667 | 3300009147 | Bacteria | 16398 |
| 333 | Ga0114129_10021260 | 3300009147 | Bacteria | 9213 |
| 334 | Ga0114129_10027759 | 3300009147 | Bacteria | 8014 |
| 335 | Ga0114129_10073463 | 3300009147 | Bacteria | 4765 |
| 336 | Ga0114129_10085764 | 3300009147 | Bacteria | 4368 |
| 337 | Ga0114129_10122452 | 3300009147 | Bacteria | 3579 |
| 338 | Ga0114129_10147692 | 3300009147 | Bacteria | 3219 |
| 339 | Ga0114129_10173571 | 3300009147 | Unclassified | 2937 |
| 340 | Ga0114129_10221713 | 3300009147 | Bacteria | 2550 |
| 341 | Ga0114129_10234049 | 3300009147 | Bacteria | 2473 |
| 342 | Ga0114129_10237940 | 3300009147 | Bacteria | 2449 |
| 343 | Ga0114129_10314479 | 3300009147 | Unclassified | 2084 |
| 344 | Ga0114129_10391021 | 3300009147 | Bacteria | 1834 |
| 345 | Ga0114129_10399201 | 3300009147 | Bacteria | 1812 |
| 346 | Ga0114129_10774507 | 3300009147 | Unclassified | 1226 |
| 347 | Ga0114129_11158916 | 3300009147 | Bacteria | 965 |
| 348 | Ga0105243_10000029 | 3300009148 | Bacteria | 190577 |
| 349 | Ga0105243_10138308 | 3300009148 | Bacteria | 2075 |
| 350 | Ga0105243_10219003 | 3300009148 | Unclassified | 1681 |
| 351 | Ga0105243_10341298 | 3300009148 | Unclassified | 1372 |
| 352 | Ga0105241_10117684 | 3300009174 | Bacteria | 2136 |
| 353 | Ga0105241_10448197 | 3300009174 | Bacteria | 1141 |
| 354 | Ga0105242_10000009 | 3300009176 | Bacteria | 162286 |
| 355 | Ga0105242_10148012 | 3300009176 | Bacteria | 2045 |
| 356 | Ga0105242_10397950 | 3300009176 | Bacteria | 1285 |
| 357 | Ga0105248_10002691 | 3300009177 | Bacteria | 19736 |
| 358 | Ga0105248_10012314 | 3300009177 | Bacteria | 9433 |
| 359 | Ga0105248_10033498 | 3300009177 | Bacteria | 5739 |
| 360 | Ga0105248_10121188 | 3300009177 | Bacteria | 2950 |
| 361 | Ga0105248_10555829 | 3300009177 | Bacteria | 1295 |
| 362 | Ga0105248_11447854 | 3300009177 | Bacteria | 777 |
| 363 | Ga0105237_10024354 | 3300009545 | Bacteria | 6193 |
| 364 | Ga0105238_10001850 | 3300009551 | Bacteria | 21213 |
| 365 | Ga0105249_10042577 | 3300009553 | Bacteria | 4131 |
| 366 | Ga0105249_10372351 | 3300009553 | Bacteria | 1452 |
| 367 | Ga0105249_10394013 | 3300009553 | Bacteria | 1414 |
| 368 | Ga0105239_10021391 | 3300010375 | Bacteria | 7132 |
| 369 | Ga0105239_10402291 | 3300010375 | Bacteria | 1549 |
| 370 | Ga0105246_10313261 | 3300011119 | Bacteria | 1272 |
| 371 | Ga0157373_10219458 | 3300013100 | Bacteria | 1341 |
| 372 | Ga0157369_10073275 | 3300013105 | Bacteria | 3674 |
| 373 | Ga0157374_10006823 | 3300013296 | Bacteria | 9712 |
| 374 | Ga0157374_10007893 | 3300013296 | Bacteria | 9085 |
| 375 | Ga0157374_10201650 | 3300013296 | Bacteria | 1948 |
| 376 | Ga0157378_10002420 | 3300013297 | Bacteria | 16596 |
| 377 | Ga0157378_10005237 | 3300013297 | Bacteria | 11388 |
| 378 | Ga0157378_10037174 | 3300013297 | Bacteria | 4311 |
| 379 | Ga0157378_10045898 | 3300013297 | Bacteria | 3884 |
| 380 | Ga0157378_10088325 | 3300013297 | Bacteria | 2813 |
| 381 | Ga0157378_10202258 | 3300013297 | Bacteria | 1879 |
| 382 | Ga0163162_10000217 | 3300013306 | Bacteria | 52537 |
| 383 | Ga0163162_10009762 | 3300013306 | Bacteria | 9344 |
| 384 | Ga0163162_10030482 | 3300013306 | Bacteria | 5344 |
| 385 | Ga0163162_10100308 | 3300013306 | Unclassified | 2986 |
| 386 | Ga0163162_10194076 | 3300013306 | Bacteria | 2159 |
| 387 | Ga0163162_10308950 | 3300013306 | Bacteria | 1713 |
| 388 | Ga0157372_10006128 | 3300013307 | Bacteria | 12780 |
| 389 | Ga0157372_10235884 | 3300013307 | Bacteria | 2122 |
| 390 | Ga0157372_10445694 | 3300013307 | Bacteria | 1509 |
| 391 | Ga0157372_10693862 | 3300013307 | Unclassified | 1185 |
| 392 | Ga0157375_10024889 | 3300013308 | Bacteria | 5549 |
| 393 | Ga0157375_10030714 | 3300013308 | Bacteria | 5070 |
| 394 | Ga0157375_10030926 | 3300013308 | Bacteria | 5053 |
| 395 | Ga0157375_10052578 | 3300013308 | Bacteria | 4005 |
| 396 | Ga0157375_10105442 | 3300013308 | Bacteria | 2909 |
| 397 | Ga0157375_10252937 | 3300013308 | Bacteria | 1923 |
| 398 | Ga0157375_10414957 | 3300013308 | Bacteria | 1512 |
| 399 | Ga0157375_10435580 | 3300013308 | Bacteria | 1477 |
| 400 | Ga0157375_10959226 | 3300013308 | Bacteria | 996 |
| 401 | Ga0163163_10011974 | 3300014325 | Bacteria | 7893 |
| 402 | Ga0163163_10052684 | 3300014325 | Bacteria | 4015 |
| 403 | Ga0163163_10058380 | 3300014325 | Bacteria | 3815 |
| 404 | Ga0163163_10092602 | 3300014325 | Bacteria | 3038 |
| 405 | Ga0157380_10000079 | 3300014326 | Bacteria | 53933 |
| 406 | Ga0157380_10006509 | 3300014326 | Bacteria | 8236 |
| 407 | Ga0157380_10513312 | 3300014326 | Bacteria | 1167 |
| 408 | Ga0157380_10674419 | 3300014326 | Unclassified | 1035 |
| 409 | Ga0157379_10000101 | 3300014968 | Bacteria | 58702 |
| 410 | Ga0157379_10080070 | 3300014968 | Bacteria | 2926 |
| 411 | Ga0157379_10500422 | 3300014968 | Bacteria | 1126 |
| 412 | Ga0157376_10023461 | 3300014969 | Bacteria | 4828 |
| 413 | Ga0157376_10054933 | 3300014969 | Bacteria | 3322 |
| 414 | Ga0157376_10087295 | 3300014969 | Bacteria | 2692 |
| 415 | Ga0157376_10143025 | 3300014969 | Bacteria | 2148 |
| 416 | Ga0157376_10764336 | 3300014969 | Bacteria | 976 |
| 417 | Ga0157376_10982947 | 3300014969 | Bacteria | 866 |
| 418 | Ga0163161_10182506 | 3300017792 | Bacteria | 1610 |
| 419 | Ga0163161_10235858 | 3300017792 | Unclassified | 1421 |
| 420 | Ga0213876_10000006 | 3300021384 | Bacteria | 700803 |
| 421 | Ga0213876_10025569 | 3300021384 | Bacteria | 3114 |
| 422 | Ga0213875_10031147 | 3300021388 | Bacteria | 2524 |
| 423 | Ga0213875_10036253 | 3300021388 | Bacteria | 2326 |
| 424 | Ga0207672_1000079 | 3300025223 | Bacteria | 13006 |
| 425 | Ga0207697_10054007 | 3300025315 | Bacteria | 1664 |
| 426 | Ga0207656_10052562 | 3300025321 | Bacteria | 1765 |
| 427 | Ga0207656_10099798 | 3300025321 | Bacteria | 1329 |
| 428 | Ga0207653_10000117 | 3300025885 | Bacteria | 55842 |
| 429 | Ga0207653_10001139 | 3300025885 | Bacteria | 8702 |
| 430 | Ga0207653_10035550 | 3300025885 | Bacteria | 1621 |
| 431 | Ga0207653_10035990 | 3300025885 | Bacteria | 1612 |
| 432 | Ga0207642_10185131 | 3300025899 | Bacteria | 1138 |
| 433 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 434 | Ga0207710_10001685 | 3300025900 | Bacteria | 10735 |
| 435 | Ga0207710_10004144 | 3300025900 | Bacteria | 6364 |
| 436 | Ga0207710_10204565 | 3300025900 | Bacteria | 976 |
| 437 | Ga0207680_10072611 | 3300025903 | Bacteria | 2137 |
| 438 | Ga0207680_10150126 | 3300025903 | Bacteria | 1553 |
| 439 | Ga0207647_10261654 | 3300025904 | Bacteria | 991 |
| 440 | Ga0207699_10000031 | 3300025906 | Bacteria | 137708 |
| 441 | Ga0207699_10239448 | 3300025906 | Bacteria | 1246 |
| 442 | Ga0207645_10095202 | 3300025907 | Bacteria | 1917 |
| 443 | Ga0207645_10118821 | 3300025907 | Bacteria | 1715 |
| 444 | Ga0207643_10001907 | 3300025908 | Bacteria | 11502 |
| 445 | Ga0207643_10083367 | 3300025908 | Bacteria | 1855 |
| 446 | Ga0207684_10000030 | 3300025910 | Bacteria | 300037 |
| 447 | Ga0207684_10000220 | 3300025910 | Bacteria | 88359 |
| 448 | Ga0207684_10001056 | 3300025910 | Bacteria | 30828 |
| 449 | Ga0207684_10008349 | 3300025910 | Bacteria | 9211 |
| 450 | Ga0207684_10015129 | 3300025910 | Bacteria | 6643 |
| 451 | Ga0207684_10096684 | 3300025910 | Bacteria | 2521 |
| 452 | Ga0207684_10172291 | 3300025910 | Bacteria | 1865 |
| 453 | Ga0207684_10226283 | 3300025910 | Bacteria | 1614 |
| 454 | Ga0207684_10271355 | 3300025910 | Bacteria | 1464 |
| 455 | Ga0207684_10512521 | 3300025910 | Bacteria | 1028 |
| 456 | Ga0207654_10222501 | 3300025911 | Bacteria | 1253 |
| 457 | Ga0207707_10077234 | 3300025912 | Bacteria | 2907 |
| 458 | Ga0207707_10325683 | 3300025912 | Bacteria | 1326 |
| 459 | Ga0207707_10404333 | 3300025912 | Bacteria | 1172 |
| 460 | Ga0207695_10290559 | 3300025913 | Bacteria | 1527 |
| 461 | Ga0207695_10312626 | 3300025913 | Bacteria | 1461 |
| 462 | Ga0207671_10001345 | 3300025914 | Bacteria | 28739 |
| 463 | Ga0207671_10180929 | 3300025914 | Bacteria | 1641 |
| 464 | Ga0207671_10279548 | 3300025914 | Bacteria | 1316 |
| 465 | Ga0207663_10406271 | 3300025916 | Bacteria | 1042 |
| 466 | Ga0207660_10145220 | 3300025917 | Bacteria | 1818 |
| 467 | Ga0207660_10604422 | 3300025917 | Unclassified | 893 |
| 468 | Ga0207662_10005761 | 3300025918 | Bacteria | 6631 |
| 469 | Ga0207662_10145966 | 3300025918 | Bacteria | 1502 |
| 470 | Ga0207662_10337509 | 3300025918 | Bacteria | 1009 |
| 471 | Ga0207652_10057983 | 3300025921 | Bacteria | 3336 |
| 472 | Ga0207652_10231851 | 3300025921 | Bacteria | 1664 |
| 473 | Ga0207652_10350387 | 3300025921 | Bacteria | 1332 |
| 474 | Ga0207646_10000008 | 3300025922 | Bacteria | 457143 |
| 475 | Ga0207646_10000009 | 3300025922 | Bacteria | 453146 |
| 476 | Ga0207646_10000078 | 3300025922 | Bacteria | 133416 |
| 477 | Ga0207646_10000338 | 3300025922 | Bacteria | 63455 |
| 478 | Ga0207646_10000480 | 3300025922 | Bacteria | 53452 |
| 479 | Ga0207646_10065064 | 3300025922 | Bacteria | 3254 |
| 480 | Ga0207681_10176863 | 3300025923 | Bacteria | 1622 |
| 481 | Ga0207681_10291375 | 3300025923 | Unclassified | 1288 |
| 482 | Ga0207694_10009360 | 3300025924 | Bacteria | 7389 |
| 483 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 484 | Ga0207650_10009116 | 3300025925 | Bacteria | 6780 |
| 485 | Ga0207650_10029390 | 3300025925 | Bacteria | 3951 |
| 486 | Ga0207650_10126272 | 3300025925 | Bacteria | 1997 |
| 487 | Ga0207659_10176617 | 3300025926 | Bacteria | 1688 |
| 488 | Ga0207644_10000961 | 3300025931 | Bacteria | 18372 |
| 489 | Ga0207644_10003009 | 3300025931 | Bacteria | 10844 |
| 490 | Ga0207644_10003149 | 3300025931 | Bacteria | 10625 |
| 491 | Ga0207644_10011976 | 3300025931 | Bacteria | 5751 |
| 492 | Ga0207644_10086041 | 3300025931 | Bacteria | 2333 |
| 493 | Ga0207706_10330319 | 3300025933 | Unclassified | 1327 |
| 494 | Ga0207686_10000010 | 3300025934 | Bacteria | 227471 |
| 495 | Ga0207686_10240884 | 3300025934 | Bacteria | 1316 |
| 496 | Ga0207709_10000052 | 3300025935 | Bacteria | 227471 |
| 497 | Ga0207709_10057770 | 3300025935 | Bacteria | 2408 |
| 498 | Ga0207709_10576352 | 3300025935 | Bacteria | 888 |
| 499 | Ga0207670_10241598 | 3300025936 | Bacteria | 1391 |
| 500 | Ga0207670_10299364 | 3300025936 | Bacteria | 1259 |
| 501 | Ga0207704_10029521 | 3300025938 | Bacteria | 3060 |
| 502 | Ga0207704_10292329 | 3300025938 | Bacteria | 1244 |
| 503 | Ga0207704_10709599 | 3300025938 | Bacteria | 833 |
| 504 | Ga0207665_10134195 | 3300025939 | Bacteria | 1760 |
| 505 | Ga0207665_10155425 | 3300025939 | Bacteria | 1641 |
| 506 | Ga0207665_10183027 | 3300025939 | Unclassified | 1518 |
| 507 | Ga0207665_10317404 | 3300025939 | Bacteria | 1168 |
| 508 | Ga0207691_10000150 | 3300025940 | Bacteria | 64536 |
| 509 | Ga0207691_10000666 | 3300025940 | Bacteria | 33938 |
| 510 | Ga0207691_10076975 | 3300025940 | Bacteria | 3006 |
| 511 | Ga0207711_10008812 | 3300025941 | Bacteria | 8434 |
| 512 | Ga0207711_10010137 | 3300025941 | Bacteria | 7826 |
| 513 | Ga0207689_10028027 | 3300025942 | Bacteria | 4712 |
| 514 | Ga0207689_10042068 | 3300025942 | Bacteria | 3782 |
| 515 | Ga0207689_10061273 | 3300025942 | Bacteria | 3094 |
| 516 | Ga0207689_10117270 | 3300025942 | Bacteria | 2189 |
| 517 | Ga0207689_10267573 | 3300025942 | Bacteria | 1415 |
| 518 | Ga0207661_10447589 | 3300025944 | Bacteria | 1176 |
| 519 | Ga0207679_10009282 | 3300025945 | Bacteria | 6293 |
| 520 | Ga0207651_10000592 | 3300025960 | Bacteria | 15262 |
| 521 | Ga0207651_10011455 | 3300025960 | Bacteria | 4967 |
| 522 | Ga0207651_10183114 | 3300025960 | Bacteria | 1664 |
| 523 | Ga0207651_10233761 | 3300025960 | Bacteria | 1494 |
| 524 | Ga0207712_10000584 | 3300025961 | Bacteria | 29466 |
| 525 | Ga0207712_10003892 | 3300025961 | Bacteria | 9438 |
| 526 | Ga0207712_10033127 | 3300025961 | Unclassified | 3491 |
| 527 | Ga0207712_10047870 | 3300025961 | Bacteria | 2971 |
| 528 | Ga0207712_10241090 | 3300025961 | Bacteria | 1456 |
| 529 | Ga0207712_10411799 | 3300025961 | Bacteria | 1139 |
| 530 | Ga0207668_10235250 | 3300025972 | Bacteria | 1479 |
| 531 | Ga0207640_10104195 | 3300025981 | Bacteria | 1996 |
| 532 | Ga0207640_10155434 | 3300025981 | Unclassified | 1685 |
| 533 | Ga0207640_10230299 | 3300025981 | Unclassified | 1425 |
| 534 | Ga0207658_10542030 | 3300025986 | Bacteria | 1040 |
| 535 | Ga0207677_10215974 | 3300026023 | Bacteria | 1535 |
| 536 | Ga0207703_10000032 | 3300026035 | Bacteria | 188472 |
| 537 | Ga0207703_10090531 | 3300026035 | Bacteria | 2571 |
| 538 | Ga0207703_10161078 | 3300026035 | Bacteria | 1965 |
| 539 | Ga0207703_10320865 | 3300026035 | Bacteria | 1418 |
| 540 | Ga0207703_10501722 | 3300026035 | Bacteria | 1139 |
| 541 | Ga0207639_10087998 | 3300026041 | Bacteria | 2477 |
| 542 | Ga0207639_10202526 | 3300026041 | Bacteria | 1703 |
| 543 | Ga0207708_10000201 | 3300026075 | Bacteria | 47331 |
| 544 | Ga0207708_10045170 | 3300026075 | Bacteria | 3357 |
| 545 | Ga0207708_10059405 | 3300026075 | Bacteria | 2919 |
| 546 | Ga0207708_10256994 | 3300026075 | Bacteria | 1409 |
| 547 | Ga0207708_10320648 | 3300026075 | Bacteria | 1264 |
| 548 | Ga0207708_10327495 | 3300026075 | Bacteria | 1251 |
| 549 | Ga0207708_10662428 | 3300026075 | Bacteria | 889 |
| 550 | Ga0207702_10347310 | 3300026078 | Bacteria | 1419 |
| 551 | Ga0207641_10005828 | 3300026088 | Bacteria | 10454 |
| 552 | Ga0207641_10092122 | 3300026088 | Bacteria | 2654 |
| 553 | Ga0207641_10164308 | 3300026088 | Bacteria | 2020 |
| 554 | Ga0207641_10267337 | 3300026088 | Bacteria | 1603 |
| 555 | Ga0207641_10321283 | 3300026088 | Bacteria | 1468 |
| 556 | Ga0207641_10333910 | 3300026088 | Bacteria | 1441 |
| 557 | Ga0207641_10385378 | 3300026088 | Bacteria | 1343 |
| 558 | Ga0207641_10501538 | 3300026088 | Bacteria | 1179 |
| 559 | Ga0207641_10708566 | 3300026088 | Bacteria | 992 |
| 560 | Ga0207648_10102318 | 3300026089 | Bacteria | 2511 |
| 561 | Ga0207648_10106756 | 3300026089 | Bacteria | 2457 |
| 562 | Ga0207648_10208251 | 3300026089 | Bacteria | 1735 |
| 563 | Ga0207648_10610540 | 3300026089 | Bacteria | 1006 |
| 564 | Ga0207676_10003860 | 3300026095 | Bacteria | 10584 |
| 565 | Ga0207676_10075024 | 3300026095 | Bacteria | 2727 |
| 566 | Ga0207676_10107844 | 3300026095 | Bacteria | 2324 |
| 567 | Ga0207676_10200655 | 3300026095 | Bacteria | 1762 |
| 568 | Ga0207674_10042576 | 3300026116 | Bacteria | 4689 |
| 569 | Ga0207674_10066777 | 3300026116 | Bacteria | 3622 |
| 570 | Ga0207674_10185035 | 3300026116 | Bacteria | 2034 |
| 571 | Ga0207674_10440546 | 3300026116 | Bacteria | 1259 |
| 572 | Ga0207674_10519068 | 3300026116 | Bacteria | 1151 |
| 573 | Ga0207675_100000467 | 3300026118 | Bacteria | 39445 |
| 574 | Ga0207675_100015379 | 3300026118 | Bacteria | 7137 |
| 575 | Ga0207675_100016702 | 3300026118 | Bacteria | 6854 |
| 576 | Ga0207675_100019220 | 3300026118 | Bacteria | 6375 |
| 577 | Ga0207675_100042468 | 3300026118 | Bacteria | 4246 |
| 578 | Ga0207675_100108812 | 3300026118 | Bacteria | 2614 |
| 579 | Ga0207675_100179262 | 3300026118 | Bacteria | 2028 |
| 580 | Ga0207675_100250274 | 3300026118 | Unclassified | 1715 |
| 581 | Ga0207675_100367280 | 3300026118 | Bacteria | 1413 |
| 582 | Ga0207683_10001350 | 3300026121 | Bacteria | 22159 |
| 583 | Ga0209588_1008957 | 3300027671 | Unclassified | 2979 |
| 584 | Ga0207428_10000767 | 3300027907 | Bacteria | 36545 |
| 585 | Ga0207428_10007143 | 3300027907 | Bacteria | 10217 |
| 586 | Ga0207428_10014358 | 3300027907 | Bacteria | 6887 |
| 587 | Ga0207428_10050986 | 3300027907 | Bacteria | 3309 |
| 588 | Ga0207428_10159224 | 3300027907 | Bacteria | 1715 |
| 589 | Ga0207428_10268052 | 3300027907 | Bacteria | 1270 |
| 590 | Ga0268266_10000328 | 3300028379 | Bacteria | 74632 |
| 591 | Ga0268266_10012462 | 3300028379 | Bacteria | 7348 |
| 592 | Ga0268265_10028649 | 3300028380 | Bacteria | 3990 |
| 593 | Ga0268265_10075195 | 3300028380 | Bacteria | 2645 |
| 594 | Ga0268265_10154289 | 3300028380 | Bacteria | 1941 |
| 595 | Ga0268265_10198737 | 3300028380 | Bacteria | 1737 |
| 596 | Ga0268265_10801829 | 3300028380 | Bacteria | 918 |
| 597 | Ga0268264_10001611 | 3300028381 | Bacteria | 20868 |
| 598 | Ga0268264_10007459 | 3300028381 | Bacteria | 9127 |
| 599 | Ga0268264_10008460 | 3300028381 | Bacteria | 8558 |
| 600 | Ga0268264_10163216 | 3300028381 | Bacteria | 2009 |
| 601 | Ga0268264_10218368 | 3300028381 | Unclassified | 1754 |
| 602 | Ga0268264_10369045 | 3300028381 | Bacteria | 1371 |
| 603 | Ga0265337_1022226 | 3300028556 | Bacteria | 1967 |
| 604 | Ga0265334_10094912 | 3300028573 | Bacteria | 1085 |
| 605 | Ga0265338_10071265 | 3300028800 | Bacteria | 2974 |
| 606 | Ga0265338_10102574 | 3300028800 | Bacteria | 2326 |
| 607 | Ga0265338_10525265 | 3300028800 | Bacteria | 831 |
| 608 | Ga0265330_10012136 | 3300031235 | Bacteria | 4031 |
| 609 | Ga0265332_10010411 | 3300031238 | Bacteria | 4138 |
| 610 | Ga0265328_10074129 | 3300031239 | Bacteria | 1252 |
| 611 | Ga0265320_10002223 | 3300031240 | Bacteria | 13608 |
| 612 | Ga0265325_10019926 | 3300031241 | Bacteria | 3702 |
| 613 | Ga0265331_10001396 | 3300031250 | Bacteria | 17743 |
| 614 | Ga0265316_10003614 | 3300031344 | Bacteria | 15594 |
| 615 | Ga0265316_10029083 | 3300031344 | Bacteria | 4549 |
| 616 | Ga0307408_100251747 | 3300031548 | Bacteria | 1457 |
| 617 | Ga0265342_10126973 | 3300031712 | Bacteria | 1431 |
| 618 | Ga0265342_10179988 | 3300031712 | Bacteria | 1158 |
| 619 | Ga0316576_10018651 | 3300031727 | Bacteria | 4741 |
| 620 | Ga0307405_10056646 | 3300031731 | Bacteria | 2459 |
| 621 | Ga0307405_10520992 | 3300031731 | Bacteria | 957 |
| 622 | Ga0307413_10109766 | 3300031824 | Bacteria | 1844 |
| 623 | Ga0307410_10016981 | 3300031852 | Bacteria | 4356 |
| 624 | Ga0307406_10026621 | 3300031901 | Bacteria | 3476 |
| 625 | Ga0307406_10082184 | 3300031901 | Bacteria | 2144 |
| 626 | Ga0307406_10655039 | 3300031901 | Bacteria | 872 |
| 627 | Ga0307407_10072696 | 3300031903 | Bacteria | 2052 |
| 628 | Ga0307407_10488522 | 3300031903 | Bacteria | 900 |
| 629 | Ga0307412_10145489 | 3300031911 | Bacteria | 1741 |
| 630 | Ga0307409_100110810 | 3300031995 | Bacteria | 2301 |
| 631 | Ga0307409_100223358 | 3300031995 | Bacteria | 1702 |
| 632 | Ga0307416_100037712 | 3300032002 | Bacteria | 3722 |
| 633 | Ga0307416_100210934 | 3300032002 | Bacteria | 1853 |
| 634 | Ga0307416_100429714 | 3300032002 | Bacteria | 1368 |
| 635 | Ga0307416_100468500 | 3300032002 | Bacteria | 1317 |
| 636 | Ga0307416_101098266 | 3300032002 | Unclassified | 900 |
| 637 | Ga0307416_101346756 | 3300032002 | Bacteria | 820 |
| 638 | Ga0307414_10022236 | 3300032004 | Bacteria | 3995 |
| 639 | Ga0307414_10764910 | 3300032004 | Bacteria | 879 |
| 640 | Ga0307411_10133152 | 3300032005 | Bacteria | 1820 |
| 641 | Ga0307415_100117942 | 3300032126 | Bacteria | 1983 |
| 642 | Ga0307415_100207953 | 3300032126 | Unclassified | 1559 |
| 643 | Ga0373936_0152612 | 3300035113 | Bacteria | 1002 |
| 644 | Ga0373941_0033286 | 3300035115 | Bacteria | 1548 |
| 645 | Ga0373946_0028782 | 3300035171 | Bacteria | 2206 |
| 646 | Ga0373931_0197726 | 3300035691 | Bacteria | 1199 |
| 647 | Ga0373935_0015645 | 3300035692 | Bacteria | 4588 |
| 648 | Ga0373933_0133742 | 3300035724 | Bacteria | 1561 |
| 649 | Ga0373937_0630786 | 3300036401 | Unclassified | 1017 |
| 650 | Ga0316582_0191563 | 3300036647 | Bacteria | 1393 |
| 651 | Ga0316584_0003658 | 3300036712 | Bacteria | 10062 |
| 652 | Ga0373925_0000505 | 3300037068 | Bacteria | 39364 |
| 653 | Ga0373925_0009911 | 3300037068 | Bacteria | 6921 |
| 654 | Ga0373925_0334357 | 3300037068 | Bacteria | 1227 |
| 655 | Ga0436364_0141999 | 3300037853 | Bacteria | 16846 |
| 656 | Ga0436364_0236212 | 3300037853 | Bacteria | 8899 |
| 657 | Ga0436364_0296140 | 3300037853 | Bacteria | 8752 |
| 658 | Ga0436364_1285749 | 3300037853 | Bacteria | 4815 |
| 659 | Ga0400489_20133 | 3300039093 | Bacteria | 96058 |
| 660 | Ga0436365_0167452 | 3300039437 | Bacteria | 2391 |
| 661 | Ga0436365_0635847 | 3300039437 | Bacteria | 1383 |
| 662 | Ga0436365_0695157 | 3300039437 | Bacteria | 511493 |
| 663 | Ga0436365_1385458 | 3300039437 | Unclassified | 2335 |
| 664 | Ga0436360_0838659 | 3300039438 | Bacteria | 1208 |
| 665 | Ga0436360_0923887 | 3300039438 | Bacteria | 8201 |
| 666 | Ga0436360_1120397 | 3300039438 | Bacteria | 1038 |
| 667 | Ga0436361_0863641 | 3300039447 | Bacteria | 83672 |
| 668 | Ga0439450_006233 | 3300042008 | Bacteria | 2140 |
| 669 | Ga0439458_0005662 | 3300042157 | Unclassified | 2804 |
| 670 | Ga0451577_0032001 | 3300042876 | Bacteria | 4740 |
| 671 | Ga0451577_0125579 | 3300042876 | Unclassified | 2299 |
| 672 | Ga0451577_1193330 | 3300042876 | Bacteria | 679 |
| 673 | Ga0453683_0006975 | 3300044673 | Bacteria | 7703 |
| 674 | Ga0453683_0034959 | 3300044673 | Bacteria | 3168 |
| 675 | Ga0453684_0000814 | 3300044712 | Bacteria | 105915 |
| 676 | Ga0453684_0191313 | 3300044712 | Bacteria | 2393 |
| 677 | Ga0453684_0205342 | 3300044712 | Bacteria | 2294 |
| 678 | Ga0453684_0406333 | 3300044712 | Bacteria | 1524 |
| 679 | Ga0453684_0631051 | 3300044712 | Bacteria | 1171 |
| 680 | Ga0453684_0638449 | 3300044712 | Bacteria | 1163 |
| 681 | Ga0451576_0001923 | 3300045051 | Bacteria | 33277 |
| 682 | Ga0451576_0060696 | 3300045051 | Bacteria | 3944 |
| 683 | Ga0466967_0789858 | 3300045976 | Bacteria | 942 |
| 684 | Ga0495592_0304077 | 3300046454 | Bacteria | 1036 |
| 685 | Ga0495629_0000010 | 3300046459 | Bacteria | 340114 |
| 686 | Ga0495629_0090652 | 3300046459 | Bacteria | 2133 |
| 687 | Ga0495651_0000564 | 3300046462 | Bacteria | 28657 |
| 688 | Ga0495580_0004284 | 3300046472 | Bacteria | 12000 |
| 689 | Ga0495639_0000036 | 3300046475 | Bacteria | 60447 |
| 690 | Ga0495664_0027998 | 3300046477 | Bacteria | 3289 |
| 691 | Ga0495594_0002765 | 3300046499 | Bacteria | 9104 |
| 692 | Ga0495594_0023354 | 3300046499 | Bacteria | 3313 |
| 693 | Ga0495594_0027656 | 3300046499 | Bacteria | 3057 |
| 694 | Ga0495666_0000171 | 3300046526 | Bacteria | 27416 |
| 695 | Ga0495586_0000747 | 3300046535 | Bacteria | 18690 |
| 696 | Ga0495598_0037142 | 3300046537 | Bacteria | 1404 |
| 697 | Ga0495667_0000245 | 3300046559 | Bacteria | 35362 |
| 698 | Ga0495635_0000403 | 3300046663 | Bacteria | 27473 |
| 699 | Ga0495635_0014836 | 3300046663 | Bacteria | 5450 |
| 700 | Ga0495588_0133528 | 3300046674 | Bacteria | 1310 |
| 701 | Ga0495657_0112840 | 3300046675 | Unclassified | 1720 |
| 702 | Ga0495599_0275102 | 3300046678 | Bacteria | 1021 |
| 703 | Ga0495647_0020929 | 3300046681 | Bacteria | 2352 |
| 704 | Ga0495658_0072986 | 3300046683 | Bacteria | 1997 |
| 705 | Ga0495658_0074232 | 3300046683 | Bacteria | 1981 |
| 706 | Ga0495613_0091031 | 3300046689 | Bacteria | 2209 |
| 707 | Ga0495613_0316096 | 3300046689 | Bacteria | 1079 |
| 708 | Ga0495624_0033999 | 3300046690 | Bacteria | 3301 |
| 709 | Ga0495600_0078811 | 3300046809 | Bacteria | 2151 |
| 710 | Ga0495581_0113688 | 3300047315 | Bacteria | 1574 |
| 711 | Ga0495676_0001556 | 3300047321 | Bacteria | 19887 |
| 712 | Ga0495676_0079848 | 3300047321 | Bacteria | 2486 |
| 713 | Ga0495680_0000371 | 3300047322 | Bacteria | 50251 |
| 714 | Ga0495680_0000604 | 3300047322 | Bacteria | 40524 |
| 715 | Ga0495680_0266528 | 3300047322 | Unclassified | 1210 |
| 716 | Ga0495675_0036155 | 3300047444 | Bacteria | 3151 |
| 717 | Ga0495684_0169396 | 3300047471 | Bacteria | 1625 |
| 718 | Ga0496104_0062560 | 3300048907 | Bacteria | 3529 |
| 719 | Ga0496105_0467096 | 3300048908 | Bacteria | 994 |
| 720 | Ga0496108_0615229 | 3300048911 | Bacteria | 946 |
| 721 | Ga0496109_0148871 | 3300048912 | Bacteria | 2191 |
| 722 | Ga0496110_0168957 | 3300048913 | Bacteria | 1984 |
| 723 | Ga0496112_0084077 | 3300048915 | Bacteria | 3148 |
| 724 | Ga0496112_0128242 | 3300048915 | Bacteria | 2508 |
| 725 | Ga0496112_0212342 | 3300048915 | Bacteria | 1892 |
| 726 | Ga0496112_0411665 | 3300048915 | Bacteria | 1291 |
| 727 | Ga0496113_0144073 | 3300048916 | Bacteria | 1876 |
| 728 | Ga0496113_0287631 | 3300048916 | Bacteria | 1315 |
| 729 | Ga0496114_0127082 | 3300048917 | Bacteria | 2198 |
| 730 | Ga0501291_001452 | 3300049514 | Bacteria | 2750 |
| 731 | Ga0501292_003457 | 3300049515 | Bacteria | 2112 |
| 732 | Ga0501292_011859 | 3300049515 | Bacteria | 1324 |
| 733 | Ga0501297_011044 | 3300049520 | Bacteria | 1030 |
| 734 | Ga0501298_003875 | 3300049521 | Bacteria | 2335 |
| 735 | Ga0501298_018868 | 3300049521 | Bacteria | 1273 |
| 736 | Ga0501031_0003318 | 3300049568 | Bacteria | 10326 |
| 737 | Ga0501036_0070201 | 3300049572 | Bacteria | 2962 |
| 738 | Ga0501037_0007939 | 3300049573 | Bacteria | 7775 |
| 739 | Ga0501037_0472884 | 3300049573 | Bacteria | 853 |
| 740 | Ga0501038_0003771 | 3300049574 | Bacteria | 14103 |
| 741 | Ga0501038_0444846 | 3300049574 | Bacteria | 997 |
| 742 | Ga0501039_0000324 | 3300049575 | Bacteria | 33955 |
| 743 | Ga0501039_0388754 | 3300049575 | Bacteria | 1096 |
| 744 | Ga0501041_0005866 | 3300049577 | Bacteria | 7181 |
| 745 | Ga0501042_0010084 | 3300049578 | Bacteria | 6317 |
| 746 | Ga0501042_0107867 | 3300049578 | Bacteria | 2005 |
| 747 | Ga0501046_0003690 | 3300049580 | Bacteria | 14028 |
| 748 | Ga0501046_0092592 | 3300049580 | Bacteria | 2324 |
| 749 | Ga0501047_0000970 | 3300049581 | Bacteria | 28911 |
| 750 | Ga0501068_0029589 | 3300049584 | Bacteria | 3244 |
| 751 | Ga0501071_0534442 | 3300049587 | Bacteria | 900 |
| 752 | Ga0501072_0064166 | 3300049588 | Bacteria | 2897 |
| 753 | Ga0501074_0023152 | 3300049590 | Bacteria | 4517 |
| 754 | Ga0501075_0005441 | 3300049591 | Bacteria | 8709 |
| 755 | Ga0501075_0094379 | 3300049591 | Bacteria | 2271 |
| 756 | Ga0501076_0017046 | 3300049592 | Bacteria | 5516 |
| 757 | Ga0501076_0037424 | 3300049592 | Bacteria | 3805 |
| 758 | Ga0501077_0000975 | 3300049593 | Bacteria | 17225 |
| 759 | Ga0501199_007105 | 3300049650 | Bacteria | 1153 |
| 760 | Ga0501201_003862 | 3300049651 | Bacteria | 1383 |
| 761 | Ga0501201_006228 | 3300049651 | Bacteria | 1127 |
| 762 | Ga0501202_007477 | 3300049652 | Bacteria | 1975 |
| 763 | Ga0501202_018631 | 3300049652 | Bacteria | 1365 |
| 764 | Ga0501206_020614 | 3300049653 | Bacteria | 938 |
| 765 | Ga0501207_011933 | 3300049654 | Bacteria | 1300 |
| 766 | Ga0501214_000610 | 3300049659 | Bacteria | 2485 |
| 767 | Ga0501216_005115 | 3300049660 | Bacteria | 1967 |
| 768 | Ga0501216_013165 | 3300049660 | Bacteria | 1368 |
| 769 | Ga0501217_010116 | 3300049661 | Bacteria | 2061 |
| 770 | Ga0501217_011281 | 3300049661 | Bacteria | 1974 |
| 771 | Ga0501223_002174 | 3300049663 | Bacteria | 4397 |
| 772 | Ga0501223_014916 | 3300049663 | Bacteria | 1540 |
| 773 | Ga0501224_006070 | 3300049664 | Bacteria | 1748 |
| 774 | Ga0501224_006194 | 3300049664 | Bacteria | 1731 |
| 775 | Ga0501227_008949 | 3300049665 | Bacteria | 2153 |
| 776 | Ga0501227_031336 | 3300049665 | Bacteria | 1277 |
| 777 | Ga0501230_010270 | 3300049667 | Bacteria | 1458 |
| 778 | Ga0501230_027476 | 3300049667 | Bacteria | 1040 |
| 779 | Ga0501233_020057 | 3300049668 | Bacteria | 1423 |
| 780 | Ga0501233_020966 | 3300049668 | Bacteria | 1399 |
| 781 | Ga0501233_027182 | 3300049668 | Bacteria | 1269 |
| 782 | Ga0501235_001072 | 3300049669 | Bacteria | 5699 |
| 783 | Ga0501235_011402 | 3300049669 | Bacteria | 1950 |
| 784 | Ga0501251_017519 | 3300049681 | Bacteria | 921 |
| 785 | Ga0501259_003056 | 3300049688 | Bacteria | 2682 |
| 786 | Ga0501260_001390 | 3300049689 | Bacteria | 1991 |
| 787 | Ga0501260_005604 | 3300049689 | Bacteria | 1186 |
| 788 | Ga0501221_008006 | 3300049704 | Bacteria | 1827 |
| 789 | Ga0501221_054671 | 3300049704 | Bacteria | 908 |
| 790 | Ga0501225_0004027 | 3300049705 | Bacteria | 4397 |
| 791 | Ga0501225_0009168 | 3300049705 | Bacteria | 2825 |
| 792 | Ga0501225_0012870 | 3300049705 | Bacteria | 2345 |
| 793 | Ga0501225_0067088 | 3300049705 | Bacteria | 1015 |
| 794 | Ga0501234_012994 | 3300049707 | Bacteria | 1306 |
| 795 | Ga0501079_0008022 | 3300049741 | Bacteria | 8001 |
| 796 | Ga0501079_0151199 | 3300049741 | Bacteria | 1810 |
| 797 | Ga0501079_0164881 | 3300049741 | Bacteria | 1728 |
| 798 | Ga0501080_0769299 | 3300049742 | Bacteria | 846 |
| 799 | Ga0501081_0100032 | 3300049743 | Bacteria | 2049 |
| 800 | Ga0501081_0158097 | 3300049743 | Bacteria | 1632 |
| 801 | Ga0501081_0382740 | 3300049743 | Bacteria | 1040 |
| 802 | Ga0501241_049675 | 3300049758 | Bacteria | 827 |
| 803 | Ga0501265_009070 | 3300049762 | Bacteria | 1197 |
| 804 | Ga0501272_002646 | 3300049769 | Bacteria | 1780 |
| 805 | Ga0501272_004542 | 3300049769 | Bacteria | 1444 |
| 806 | Ga0501273_007509 | 3300049770 | Bacteria | 1284 |
| 807 | Ga0501273_018883 | 3300049770 | Unclassified | 921 |
| 808 | Ga0501279_007885 | 3300049775 | Bacteria | 1416 |
| 809 | Ga0501035_0002599 | 3300049822 | Bacteria | 17634 |
| 810 | Ga0501044_0005388 | 3300049823 | Bacteria | 14205 |
| 811 | Ga0501045_0015541 | 3300049824 | Bacteria | 5400 |
| 812 | Ga0501212_000634 | 3300049851 | Bacteria | 3535 |
| 813 | Ga0501212_003475 | 3300049851 | Bacteria | 1981 |
| 814 | Ga0501226_000413 | 3300049853 | Bacteria | 6075 |
| 815 | nmdc:mga05p37_10646_c1 | 3300050507 | Bacteria | 10913 |
| 816 | nmdc:mga05p37_1085999_c1 | 3300050507 | Bacteria | 840 |
| 817 | nmdc:mga05p37_11102_c1 | 3300050507 | Bacteria | 10704 |
| 818 | nmdc:mga05p37_132952_c1 | 3300050507 | Bacteria | 3052 |
| 819 | nmdc:mga05p37_151752_c1 | 3300050507 | Bacteria | 2833 |
| 820 | nmdc:mga05p37_168016_c1 | 3300050507 | Bacteria | 2676 |
| 821 | nmdc:mga05p37_199919_c1 | 3300050507 | Bacteria | 2421 |
| 822 | nmdc:mga05p37_214881_c1 | 3300050507 | Bacteria | 2323 |
| 823 | nmdc:mga05p37_29170_c1 | 3300050507 | Bacteria | 6735 |
| 824 | nmdc:mga05p37_330531_c1 | 3300050507 | Bacteria | 1801 |
| 825 | nmdc:mga05p37_332480_c1 | 3300050507 | Bacteria | 1794 |
| 826 | nmdc:mga05p37_396983_c1 | 3300050507 | Bacteria | 1611 |
| 827 | nmdc:mga05p37_52504_c1 | 3300050507 | Bacteria | 5012 |
| 828 | nmdc:mga05p37_591062_c1 | 3300050507 | Bacteria | 1255 |
| 829 | nmdc:mga05p37_73665_c1 | 3300050507 | Bacteria | 4203 |
| 830 | nmdc:mga05p37_918563_c1 | 3300050507 | Bacteria | 941 |
| 831 | nmdc:mga09592_12165_c1 | 3300050508 | Bacteria | 7002 |
| 832 | nmdc:mga09592_223732_c1 | 3300050508 | Bacteria | 1630 |
| 833 | nmdc:mga09592_448357_c1 | 3300050508 | Bacteria | 1113 |
| 834 | nmdc:mga09592_708899_c1 | 3300050508 | Bacteria | 856 |
| 835 | nmdc:mga09592_7180_c1 | 3300050508 | Bacteria | 9055 |
| 836 | nmdc:mga0qj67_182866_c1 | 3300050509 | Bacteria | 1703 |
| 837 | nmdc:mga0qj67_234585_c1 | 3300050509 | Bacteria | 1489 |
| 838 | nmdc:mga0qj67_241080_c1 | 3300050509 | Bacteria | 1467 |
| 839 | nmdc:mga0qj67_43819_c1 | 3300050509 | Bacteria | 3524 |
| 840 | nmdc:mga06r32_14433_c1 | 3300050510 | Bacteria | 7171 |
| 841 | nmdc:mga06r32_160811_c1 | 3300050510 | Unclassified | 2228 |
| 842 | nmdc:mga06r32_207790_c1 | 3300050510 | Bacteria | 1946 |
| 843 | nmdc:mga06r32_237747_c1 | 3300050510 | Bacteria | 1809 |
| 844 | nmdc:mga06r32_35225_c1 | 3300050510 | Bacteria | 4723 |
| 845 | nmdc:mga06r32_80291_c1 | 3300050510 | Unclassified | 3174 |
| 846 | nmdc:mga08y16_11109_c1 | 3300050511 | Bacteria | 9457 |
| 847 | nmdc:mga08y16_11963_c1 | 3300050511 | Bacteria | 9113 |
| 848 | nmdc:mga08y16_125105_c1 | 3300050511 | Bacteria | 2675 |
| 849 | nmdc:mga08y16_12577_c1 | 3300050511 | Bacteria | 8904 |
| 850 | nmdc:mga08y16_212996_c1 | 3300050511 | Bacteria | 2001 |
| 851 | nmdc:mga08y16_33846_c1 | 3300050511 | Bacteria | 5367 |
| 852 | nmdc:mga08y16_36782_c1 | 3300050511 | Bacteria | 5140 |
| 853 | nmdc:mga08y16_63519_c1 | 3300050511 | Bacteria | 3856 |
| 854 | nmdc:mga0n895_157985_c1 | 3300050512 | Bacteria | 2298 |
| 855 | nmdc:mga0n895_189892_c1 | 3300050512 | Unclassified | 2085 |
| 856 | nmdc:mga0n895_412365_c1 | 3300050512 | Bacteria | 1366 |
| 857 | nmdc:mga0n895_631446_c1 | 3300050512 | Bacteria | 1071 |
| 858 | nmdc:mga0rr50_44203_c1 | 3300050513 | Bacteria | 3265 |
| 859 | nmdc:mga08x19_106624_c1 | 3300050514 | Bacteria | 1865 |
| 860 | nmdc:mga08x19_112742_c1 | 3300050514 | Bacteria | 1815 |
| 861 | nmdc:mga08x19_13355_c1 | 3300050514 | Bacteria | 4963 |
| 862 | nmdc:mga08x19_1730_c1 | 3300050514 | Bacteria | 13435 |
| 863 | nmdc:mga08x19_51624_c1 | 3300050514 | Unclassified | 2642 |
| 864 | nmdc:mga0a205_15245_c1 | 3300050515 | Bacteria | 7181 |
| 865 | nmdc:mga0a205_26_c2 | 3300050515 | Bacteria | 68852 |
| 866 | nmdc:mga0a205_276151_c1 | 3300050515 | Bacteria | 1556 |
| 867 | nmdc:mga0a205_62173_c1 | 3300050515 | Bacteria | 3607 |
| 868 | nmdc:mga0a205_638135_c1 | 3300050515 | Bacteria | 917 |
| 869 | nmdc:mga0a205_94964_c1 | 3300050515 | Unclassified | 2881 |
| 870 | Ga0495601_0073124 | 3300053077 | Bacteria | 2191 |
| 871 | Ga0495619_0037048 | 3300053085 | Unclassified | 3177 |
| 872 | Ga0495619_0047458 | 3300053085 | Bacteria | 2828 |
| 873 | Ga0500566_0122223 | 3300053094 | Bacteria | 1402 |
| 874 | Ga0500616_0002625 | 3300053153 | Bacteria | 14673 |
| 875 | Ga0501084_0046045 | 3300054114 | Bacteria | 3653 |
| 876 | Ga0501084_0107978 | 3300054114 | Bacteria | 2338 |
| 877 | Ga0501084_0273604 | 3300054114 | Bacteria | 1426 |
| 878 | Ga0501082_0396646 | 3300060353 | Bacteria | 1204 |
| 879 | Ga0530510_0139208 | 3300061734 | Bacteria | 1787 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_1193330 | Ga0451577_1193330_14_610 | 197 |
| 2 | 3300009094 | Ga0111539_10009392 | Ga0111539_100093926 | 228 |
| 3 | 3300005329 | Ga0070683_100330323 | Ga0070683_1003303231 | 231 |
| 4 | 3300005344 | Ga0070661_100271867 | Ga0070661_1002718672 | 231 |
| 5 | 3300005456 | Ga0070678_100146352 | Ga0070678_1001463522 | 231 |
| 6 | 3300005535 | Ga0070684_100603427 | Ga0070684_1006034272 | 231 |
| 7 | 3300005543 | Ga0070672_100170098 | Ga0070672_1001700982 | 231 |
| 8 | 3300005564 | Ga0070664_100322538 | Ga0070664_1003225382 | 231 |
| 9 | 3300013296 | Ga0157374_10201650 | Ga0157374_102016502 | 231 |
| 10 | 3300013306 | Ga0163162_10308950 | Ga0163162_103089501 | 231 |
| 11 | 3300013308 | Ga0157375_10414957 | Ga0157375_104149572 | 231 |
| 12 | 3300005518 | Ga0070699_100155740 | Ga0070699_1001557402 | 232 |
| 13 | 3300005617 | Ga0068859_100111141 | Ga0068859_1001111413 | 232 |
| 14 | 3300006931 | Ga0097620_100111153 | Ga0097620_1001111533 | 232 |
| 15 | 3300009094 | Ga0111539_10054426 | Ga0111539_100544265 | 232 |
| 16 | 3300009147 | Ga0114129_10221713 | Ga0114129_102217133 | 232 |
| 17 | 3300014325 | Ga0163163_10092602 | Ga0163163_100926022 | 232 |
| 18 | 3300025907 | Ga0207645_10095202 | Ga0207645_100952022 | 232 |
| 19 | 3300027907 | Ga0207428_10050986 | Ga0207428_100509862 | 232 |
| 20 | 3300050511 | nmdc:mga08y16_125105_c1 | nmdc:mga08y16_125105_c1_210_1016 | 232 |
| 21 | 3300005353 | Ga0070669_100275584 | Ga0070669_1002755842 | 233 |
| 22 | 3300005457 | Ga0070662_100467317 | Ga0070662_1004673172 | 234 |
| 23 | 3300013306 | Ga0163162_10100308 | Ga0163162_101003082 | 234 |
| 24 | 3300005467 | Ga0070706_100509789 | Ga0070706_1005097892 | 235 |
| 25 | 3300009147 | Ga0114129_11158916 | Ga0114129_111589161 | 235 |
| 26 | 3300025910 | Ga0207684_10512521 | Ga0207684_105125212 | 235 |
| 27 | 3300042157 | Ga0439458_0005662 | Ga0439458_0005662_1852_2559 | 235 |
| 28 | 3300048915 | Ga0496112_0411665 | Ga0496112_0411665_500_1207 | 235 |
| 29 | 3300050507 | nmdc:mga05p37_918563_c1 | nmdc:mga05p37_918563_c1_182_889 | 235 |
| 30 | 3300009094 | Ga0111539_10017738 | Ga0111539_100177385 | 236 |
| 31 | 3300009147 | Ga0114129_10027759 | Ga0114129_100277596 | 236 |
| 32 | 3300009147 | Ga0114129_10122452 | Ga0114129_101224522 | 236 |
| 33 | 3300026089 | Ga0207648_10106756 | Ga0207648_101067563 | 236 |
| 34 | 3300050507 | nmdc:mga05p37_396983_c1 | nmdc:mga05p37_396983_c1_391_1101 | 236 |
| 35 | 3300050507 | nmdc:mga05p37_591062_c1 | nmdc:mga05p37_591062_c1_519_1229 | 236 |
| 36 | 3300050508 | nmdc:mga09592_223732_c1 | nmdc:mga09592_223732_c1_836_1546 | 236 |
| 37 | 3300050508 | nmdc:mga09592_448357_c1 | nmdc:mga09592_448357_c1_378_1088 | 236 |
| 38 | 3300050509 | nmdc:mga0qj67_234585_c1 | nmdc:mga0qj67_234585_c1_526_1236 | 236 |
| 39 | 3300050511 | nmdc:mga08y16_212996_c1 | nmdc:mga08y16_212996_c1_467_1177 | 236 |
| 40 | 3300009176 | Ga0105242_10148012 | Ga0105242_101480122 | 237 |
| 41 | 3300009177 | Ga0105248_10033498 | Ga0105248_100334982 | 237 |
| 42 | 3300013296 | Ga0157374_10006823 | Ga0157374_100068238 | 237 |
| 43 | 3300013297 | Ga0157378_10005237 | Ga0157378_100052377 | 237 |
| 44 | 3300013306 | Ga0163162_10000217 | Ga0163162_1000021742 | 237 |
| 45 | 3300013308 | Ga0157375_10030714 | Ga0157375_100307142 | 237 |
| 46 | 3300014325 | Ga0163163_10052684 | Ga0163163_100526842 | 237 |
| 47 | 3300014325 | Ga0163163_10058380 | Ga0163163_100583802 | 237 |
| 48 | 3300014969 | Ga0157376_10023461 | Ga0157376_100234614 | 237 |
| 49 | 3300044712 | Ga0453684_0000814 | Ga0453684_0000814_74840_75556 | 237 |
| 50 | 3300048911 | Ga0496108_0615229 | Ga0496108_0615229_24_746 | 237 |
| 51 | 3300005343 | Ga0070687_100024212 | Ga0070687_1000242123 | 238 |
| 52 | 3300005353 | Ga0070669_100027093 | Ga0070669_1000270933 | 238 |
| 53 | 3300005353 | Ga0070669_100117100 | Ga0070669_1001171002 | 238 |
| 54 | 3300005457 | Ga0070662_100247555 | Ga0070662_1002475552 | 238 |
| 55 | 3300005616 | Ga0068852_100143959 | Ga0068852_1001439591 | 238 |
| 56 | 3300005841 | Ga0068863_100262665 | Ga0068863_1002626652 | 238 |
| 57 | 3300005844 | Ga0068862_100008996 | Ga0068862_1000089963 | 238 |
| 58 | 3300013100 | Ga0157373_10219458 | Ga0157373_102194582 | 238 |
| 59 | 3300025923 | Ga0207681_10176863 | Ga0207681_101768632 | 238 |
| 60 | 3300025925 | Ga0207650_10126272 | Ga0207650_101262722 | 238 |
| 61 | 3300025933 | Ga0207706_10330319 | Ga0207706_103303191 | 238 |
| 62 | 3300025961 | Ga0207712_10033127 | Ga0207712_100331272 | 238 |
| 63 | 3300026089 | Ga0207648_10208251 | Ga0207648_102082512 | 238 |
| 64 | 3300026118 | Ga0207675_100015379 | Ga0207675_1000153795 | 238 |
| 65 | 3300028380 | Ga0268265_10028649 | Ga0268265_100286492 | 238 |
| 66 | 3300048915 | Ga0496112_0084077 | Ga0496112_0084077_1228_1944 | 238 |
| 67 | 3300005617 | Ga0068859_100022372 | Ga0068859_1000223726 | 239 |
| 68 | 3300006931 | Ga0097620_100022371 | Ga0097620_1000223716 | 239 |
| 69 | 3300005288 | Ga0065714_10064445 | Ga0065714_1006444510 | 240 |
| 70 | 3300005289 | Ga0065704_10240525 | Ga0065704_102405251 | 240 |
| 71 | 3300005290 | Ga0065712_10000114 | Ga0065712_1000011498 | 240 |
| 72 | 3300005577 | Ga0068857_100113314 | Ga0068857_1001133142 | 240 |
| 73 | 3300006844 | Ga0075428_100034515 | Ga0075428_1000345156 | 240 |
| 74 | 3300006844 | Ga0075428_100040929 | Ga0075428_1000409296 | 240 |
| 75 | 3300006880 | Ga0075429_100015685 | Ga0075429_1000156854 | 240 |
| 76 | 3300009147 | Ga0114129_10173571 | Ga0114129_101735712 | 240 |
| 77 | 3300009177 | Ga0105248_10012314 | Ga0105248_100123148 | 240 |
| 78 | 3300026116 | Ga0207674_10066777 | Ga0207674_100667773 | 240 |
| 79 | 3300044712 | Ga0453684_0191313 | Ga0453684_0191313_1415_2143 | 240 |
| 80 | 3300048915 | Ga0496112_0128242 | Ga0496112_0128242_79_810 | 240 |
| 81 | 3300049578 | Ga0501042_0107867 | Ga0501042_0107867_281_1012 | 240 |
| 82 | 3300049652 | Ga0501202_007477 | Ga0501202_007477_847_1578 | 240 |
| 83 | 3300049653 | Ga0501206_020614 | Ga0501206_020614_128_859 | 240 |
| 84 | 3300049659 | Ga0501214_000610 | Ga0501214_000610_128_859 | 240 |
| 85 | 3300049660 | Ga0501216_005115 | Ga0501216_005115_366_1097 | 240 |
| 86 | 3300049661 | Ga0501217_010116 | Ga0501217_010116_834_1565 | 240 |
| 87 | 3300049663 | Ga0501223_002174 | Ga0501223_002174_3261_3992 | 240 |
| 88 | 3300049664 | Ga0501224_006194 | Ga0501224_006194_856_1587 | 240 |
| 89 | 3300049665 | Ga0501227_008949 | Ga0501227_008949_953_1684 | 240 |
| 90 | 3300049668 | Ga0501233_020057 | Ga0501233_020057_340_1071 | 240 |
| 91 | 3300049669 | Ga0501235_001072 | Ga0501235_001072_4476_5207 | 240 |
| 92 | 3300049681 | Ga0501251_017519 | Ga0501251_017519_14_745 | 240 |
| 93 | 3300049689 | Ga0501260_001390 | Ga0501260_001390_824_1555 | 240 |
| 94 | 3300049704 | Ga0501221_008006 | Ga0501221_008006_953_1684 | 240 |
| 95 | 3300049705 | Ga0501225_0004027 | Ga0501225_0004027_514_1245 | 240 |
| 96 | 3300049707 | Ga0501234_012994 | Ga0501234_012994_538_1269 | 240 |
| 97 | 3300049769 | Ga0501272_002646 | Ga0501272_002646_943_1665 | 240 |
| 98 | 3300049851 | Ga0501212_000634 | Ga0501212_000634_2345_3076 | 240 |
| 99 | 3300049853 | Ga0501226_000413 | Ga0501226_000413_497_1228 | 240 |
| 100 | 3300050507 | nmdc:mga05p37_1085999_c1 | nmdc:mga05p37_1085999_c1_15_737 | 240 |
| 101 | 3300050508 | nmdc:mga09592_12165_c1 | nmdc:mga09592_12165_c1_4381_5103 | 240 |
| 102 | 3300050511 | nmdc:mga08y16_11963_c1 | nmdc:mga08y16_11963_c1_1424_2146 | 240 |
| 103 | 3300054114 | Ga0501084_0046045 | Ga0501084_0046045_2231_2962 | 240 |
| 104 | 3300060353 | Ga0501082_0396646 | Ga0501082_0396646_224_955 | 240 |
| 105 | 3300005441 | Ga0070700_100004436 | Ga0070700_1000044365 | 241 |
| 106 | 3300005719 | Ga0068861_100187626 | Ga0068861_1001876262 | 241 |
| 107 | 3300006844 | Ga0075428_100768847 | Ga0075428_1007688471 | 241 |
| 108 | 3300006846 | Ga0075430_100053938 | Ga0075430_1000539384 | 241 |
| 109 | 3300006852 | Ga0075433_10019208 | Ga0075433_100192085 | 241 |
| 110 | 3300006852 | Ga0075433_10250231 | Ga0075433_102502312 | 241 |
| 111 | 3300006871 | Ga0075434_101032209 | Ga0075434_1010322091 | 241 |
| 112 | 3300009094 | Ga0111539_10223318 | Ga0111539_102233184 | 241 |
| 113 | 3300009147 | Ga0114129_10147692 | Ga0114129_101476922 | 241 |
| 114 | 3300014326 | Ga0157380_10674419 | Ga0157380_106744191 | 241 |
| 115 | 3300026075 | Ga0207708_10045170 | Ga0207708_100451703 | 241 |
| 116 | 3300027907 | Ga0207428_10268052 | Ga0207428_102680522 | 241 |
| 117 | 3300028381 | Ga0268264_10008460 | Ga0268264_100084604 | 241 |
| 118 | 3300028556 | Ga0265337_1022226 | Ga0265337_10222261 | 241 |
| 119 | 3300028800 | Ga0265338_10102574 | Ga0265338_101025742 | 241 |
| 120 | 3300031727 | Ga0316576_10018651 | Ga0316576_100186512 | 241 |
| 121 | 3300036647 | Ga0316582_0191563 | Ga0316582_0191563_427_1161 | 241 |
| 122 | 3300036712 | Ga0316584_0003658 | Ga0316584_0003658_2048_2782 | 241 |
| 123 | 3300039437 | Ga0436365_0167452 | Ga0436365_0167452_65_799 | 241 |
| 124 | 3300044673 | Ga0453683_0006975 | Ga0453683_0006975_994_1737 | 241 |
| 125 | 3300046454 | Ga0495592_0304077 | Ga0495592_0304077_23_757 | 241 |
| 126 | 3300046689 | Ga0495613_0091031 | Ga0495613_0091031_1175_1909 | 241 |
| 127 | 3300050507 | nmdc:mga05p37_10646_c1 | nmdc:mga05p37_10646_c1_6464_7189 | 241 |
| 128 | 3300050507 | nmdc:mga05p37_151752_c1 | nmdc:mga05p37_151752_c1_1417_2142 | 241 |
| 129 | 3300050509 | nmdc:mga0qj67_241080_c1 | nmdc:mga0qj67_241080_c1_615_1352 | 241 |
| 130 | 3300050511 | nmdc:mga08y16_33846_c1 | nmdc:mga08y16_33846_c1_433_1167 | 241 |
| 131 | 3300050512 | nmdc:mga0n895_157985_c1 | nmdc:mga0n895_157985_c1_1265_1990 | 241 |
| 132 | 3300050515 | nmdc:mga0a205_26_c2 | nmdc:mga0a205_26_c2_14387_15124 | 241 |
| 133 | 3300050515 | nmdc:mga0a205_638135_c1 | nmdc:mga0a205_638135_c1_12_749 | 241 |
| 134 | 3300005293 | Ga0065715_10023552 | Ga0065715_100235522 | 242 |
| 135 | 3300005344 | Ga0070661_100348728 | Ga0070661_1003487282 | 242 |
| 136 | 3300005345 | Ga0070692_10023252 | Ga0070692_100232522 | 242 |
| 137 | 3300005347 | Ga0070668_100572633 | Ga0070668_1005726332 | 242 |
| 138 | 3300005364 | Ga0070673_100318856 | Ga0070673_1003188562 | 242 |
| 139 | 3300005406 | Ga0070703_10001965 | Ga0070703_100019653 | 242 |
| 140 | 3300005440 | Ga0070705_100018954 | Ga0070705_1000189542 | 242 |
| 141 | 3300005444 | Ga0070694_100058320 | Ga0070694_1000583202 | 242 |
| 142 | 3300005444 | Ga0070694_100124946 | Ga0070694_1001249462 | 242 |
| 143 | 3300005445 | Ga0070708_100042703 | Ga0070708_1000427035 | 242 |
| 144 | 3300005458 | Ga0070681_10125016 | Ga0070681_101250162 | 242 |
| 145 | 3300005467 | Ga0070706_100008713 | Ga0070706_10000871310 | 242 |
| 146 | 3300005468 | Ga0070707_100007732 | Ga0070707_1000077322 | 242 |
| 147 | 3300005471 | Ga0070698_100055975 | Ga0070698_1000559755 | 242 |
| 148 | 3300005518 | Ga0070699_100005760 | Ga0070699_10000576010 | 242 |
| 149 | 3300005518 | Ga0070699_100473722 | Ga0070699_1004737221 | 242 |
| 150 | 3300005530 | Ga0070679_100126043 | Ga0070679_1001260432 | 242 |
| 151 | 3300005536 | Ga0070697_100076477 | Ga0070697_1000764772 | 242 |
| 152 | 3300005539 | Ga0068853_100378625 | Ga0068853_1003786252 | 242 |
| 153 | 3300005547 | Ga0070693_100002084 | Ga0070693_1000020846 | 242 |
| 154 | 3300005547 | Ga0070693_100057601 | Ga0070693_1000576012 | 242 |
| 155 | 3300005548 | Ga0070665_100000060 | Ga0070665_1000000606 | 242 |
| 156 | 3300005549 | Ga0070704_100078227 | Ga0070704_1000782272 | 242 |
| 157 | 3300005615 | Ga0070702_100068106 | Ga0070702_1000681062 | 242 |
| 158 | 3300005615 | Ga0070702_100097684 | Ga0070702_1000976841 | 242 |
| 159 | 3300005617 | Ga0068859_100098812 | Ga0068859_1000988122 | 242 |
| 160 | 3300005617 | Ga0068859_100286436 | Ga0068859_1002864362 | 242 |
| 161 | 3300005617 | Ga0068859_100349749 | Ga0068859_1003497492 | 242 |
| 162 | 3300005618 | Ga0068864_100007174 | Ga0068864_1000071742 | 242 |
| 163 | 3300005834 | Ga0068851_10047508 | Ga0068851_100475082 | 242 |
| 164 | 3300005834 | Ga0068851_10112492 | Ga0068851_101124921 | 242 |
| 165 | 3300005841 | Ga0068863_100219577 | Ga0068863_1002195771 | 242 |
| 166 | 3300005841 | Ga0068863_100478601 | Ga0068863_1004786012 | 242 |
| 167 | 3300005842 | Ga0068858_100327659 | Ga0068858_1003276592 | 242 |
| 168 | 3300005842 | Ga0068858_100399432 | Ga0068858_1003994321 | 242 |
| 169 | 3300005843 | Ga0068860_100006967 | Ga0068860_1000069672 | 242 |
| 170 | 3300005843 | Ga0068860_100046420 | Ga0068860_1000464202 | 242 |
| 171 | 3300005844 | Ga0068862_100016042 | Ga0068862_1000160424 | 242 |
| 172 | 3300006844 | Ga0075428_100684829 | Ga0075428_1006848292 | 242 |
| 173 | 3300006871 | Ga0075434_100404689 | Ga0075434_1004046892 | 242 |
| 174 | 3300006931 | Ga0097620_100098818 | Ga0097620_1000988182 | 242 |
| 175 | 3300006931 | Ga0097620_100286443 | Ga0097620_1002864433 | 242 |
| 176 | 3300006931 | Ga0097620_100349708 | Ga0097620_1003497082 | 242 |
| 177 | 3300009093 | Ga0105240_10568392 | Ga0105240_105683922 | 242 |
| 178 | 3300009101 | Ga0105247_10000951 | Ga0105247_100009514 | 242 |
| 179 | 3300009101 | Ga0105247_10039404 | Ga0105247_100394042 | 242 |
| 180 | 3300009147 | Ga0114129_10085764 | Ga0114129_100857642 | 242 |
| 181 | 3300009148 | Ga0105243_10219003 | Ga0105243_102190032 | 242 |
| 182 | 3300009174 | Ga0105241_10448197 | Ga0105241_104481972 | 242 |
| 183 | 3300009177 | Ga0105248_11447854 | Ga0105248_114478541 | 242 |
| 184 | 3300009545 | Ga0105237_10024354 | Ga0105237_100243542 | 242 |
| 185 | 3300009551 | Ga0105238_10001850 | Ga0105238_100018508 | 242 |
| 186 | 3300009553 | Ga0105249_10394013 | Ga0105249_103940132 | 242 |
| 187 | 3300010375 | Ga0105239_10021391 | Ga0105239_100213912 | 242 |
| 188 | 3300010375 | Ga0105239_10402291 | Ga0105239_104022912 | 242 |
| 189 | 3300013306 | Ga0163162_10009762 | Ga0163162_100097628 | 242 |
| 190 | 3300013306 | Ga0163162_10194076 | Ga0163162_101940762 | 242 |
| 191 | 3300013307 | Ga0157372_10006128 | Ga0157372_100061285 | 242 |
| 192 | 3300013307 | Ga0157372_10693862 | Ga0157372_106938622 | 242 |
| 193 | 3300013308 | Ga0157375_10252937 | Ga0157375_102529371 | 242 |
| 194 | 3300014969 | Ga0157376_10143025 | Ga0157376_101430252 | 242 |
| 195 | 3300025321 | Ga0207656_10052562 | Ga0207656_100525622 | 242 |
| 196 | 3300025321 | Ga0207656_10099798 | Ga0207656_100997982 | 242 |
| 197 | 3300025885 | Ga0207653_10001139 | Ga0207653_100011395 | 242 |
| 198 | 3300025900 | Ga0207710_10004144 | Ga0207710_100041442 | 242 |
| 199 | 3300025910 | Ga0207684_10000220 | Ga0207684_1000022012 | 242 |
| 200 | 3300025910 | Ga0207684_10001056 | Ga0207684_100010564 | 242 |
| 201 | 3300025912 | Ga0207707_10077234 | Ga0207707_100772342 | 242 |
| 202 | 3300025912 | Ga0207707_10325683 | Ga0207707_103256832 | 242 |
| 203 | 3300025913 | Ga0207695_10312626 | Ga0207695_103126262 | 242 |
| 204 | 3300025914 | Ga0207671_10001345 | Ga0207671_1000134519 | 242 |
| 205 | 3300025914 | Ga0207671_10180929 | Ga0207671_101809292 | 242 |
| 206 | 3300025922 | Ga0207646_10000338 | Ga0207646_1000033814 | 242 |
| 207 | 3300025924 | Ga0207694_10009360 | Ga0207694_100093604 | 242 |
| 208 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001821 | 242 |
| 209 | 3300025935 | Ga0207709_10576352 | Ga0207709_105763521 | 242 |
| 210 | 3300025936 | Ga0207670_10241598 | Ga0207670_102415982 | 242 |
| 211 | 3300025936 | Ga0207670_10299364 | Ga0207670_102993642 | 242 |
| 212 | 3300025938 | Ga0207704_10029521 | Ga0207704_100295212 | 242 |
| 213 | 3300025941 | Ga0207711_10008812 | Ga0207711_100088122 | 242 |
| 214 | 3300025942 | Ga0207689_10267573 | Ga0207689_102675732 | 242 |
| 215 | 3300025961 | Ga0207712_10000584 | Ga0207712_100005847 | 242 |
| 216 | 3300025961 | Ga0207712_10003892 | Ga0207712_100038925 | 242 |
| 217 | 3300025972 | Ga0207668_10235250 | Ga0207668_102352502 | 242 |
| 218 | 3300026035 | Ga0207703_10161078 | Ga0207703_101610782 | 242 |
| 219 | 3300026035 | Ga0207703_10501722 | Ga0207703_105017221 | 242 |
| 220 | 3300026041 | Ga0207639_10087998 | Ga0207639_100879981 | 242 |
| 221 | 3300026088 | Ga0207641_10005828 | Ga0207641_100058282 | 242 |
| 222 | 3300026088 | Ga0207641_10267337 | Ga0207641_102673372 | 242 |
| 223 | 3300026088 | Ga0207641_10321283 | Ga0207641_103212831 | 242 |
| 224 | 3300026088 | Ga0207641_10385378 | Ga0207641_103853782 | 242 |
| 225 | 3300026095 | Ga0207676_10003860 | Ga0207676_100038608 | 242 |
| 226 | 3300026095 | Ga0207676_10075024 | Ga0207676_100750242 | 242 |
| 227 | 3300028379 | Ga0268266_10000328 | Ga0268266_1000032817 | 242 |
| 228 | 3300028380 | Ga0268265_10198737 | Ga0268265_101987372 | 242 |
| 229 | 3300028381 | Ga0268264_10001611 | Ga0268264_100016114 | 242 |
| 230 | 3300028381 | Ga0268264_10163216 | Ga0268264_101632162 | 242 |
| 231 | 3300031344 | Ga0265316_10029083 | Ga0265316_100290837 | 242 |
| 232 | 3300031731 | Ga0307405_10520992 | Ga0307405_105209922 | 242 |
| 233 | 3300031901 | Ga0307406_10026621 | Ga0307406_100266213 | 242 |
| 234 | 3300032002 | Ga0307416_101346756 | Ga0307416_1013467561 | 242 |
| 235 | 3300032126 | Ga0307415_100207953 | Ga0307415_1002079532 | 242 |
| 236 | 3300035115 | Ga0373941_0033286 | Ga0373941_0033286_752_1489 | 242 |
| 237 | 3300035692 | Ga0373935_0015645 | Ga0373935_0015645_2475_3203 | 242 |
| 238 | 3300035724 | Ga0373933_0133742 | Ga0373933_0133742_22_750 | 242 |
| 239 | 3300036401 | Ga0373937_0630786 | Ga0373937_0630786_178_906 | 242 |
| 240 | 3300037068 | Ga0373925_0334357 | Ga0373925_0334357_489_1217 | 242 |
| 241 | 3300042876 | Ga0451577_0125579 | Ga0451577_0125579_1421_2197 | 242 |
| 242 | 3300044712 | Ga0453684_0205342 | Ga0453684_0205342_700_1428 | 242 |
| 243 | 3300044712 | Ga0453684_0631051 | Ga0453684_0631051_411_1139 | 242 |
| 244 | 3300046459 | Ga0495629_0090652 | Ga0495629_0090652_844_1572 | 242 |
| 245 | 3300046499 | Ga0495594_0002765 | Ga0495594_0002765_3243_3971 | 242 |
| 246 | 3300046499 | Ga0495594_0023354 | Ga0495594_0023354_1392_2120 | 242 |
| 247 | 3300046663 | Ga0495635_0014836 | Ga0495635_0014836_1374_2102 | 242 |
| 248 | 3300046675 | Ga0495657_0112840 | Ga0495657_0112840_265_993 | 242 |
| 249 | 3300046689 | Ga0495613_0316096 | Ga0495613_0316096_259_987 | 242 |
| 250 | 3300047321 | Ga0495676_0079848 | Ga0495676_0079848_1359_2087 | 242 |
| 251 | 3300047322 | Ga0495680_0266528 | Ga0495680_0266528_437_1165 | 242 |
| 252 | 3300048907 | Ga0496104_0062560 | Ga0496104_0062560_1164_1892 | 242 |
| 253 | 3300048912 | Ga0496109_0148871 | Ga0496109_0148871_795_1523 | 242 |
| 254 | 3300048916 | Ga0496113_0144073 | Ga0496113_0144073_619_1347 | 242 |
| 255 | 3300049514 | Ga0501291_001452 | Ga0501291_001452_1651_2379 | 242 |
| 256 | 3300049521 | Ga0501298_018868 | Ga0501298_018868_499_1227 | 242 |
| 257 | 3300049654 | Ga0501207_011933 | Ga0501207_011933_246_974 | 242 |
| 258 | 3300049661 | Ga0501217_011281 | Ga0501217_011281_411_1139 | 242 |
| 259 | 3300049663 | Ga0501223_014916 | Ga0501223_014916_584_1312 | 242 |
| 260 | 3300049667 | Ga0501230_027476 | Ga0501230_027476_87_815 | 242 |
| 261 | 3300049669 | Ga0501235_011402 | Ga0501235_011402_851_1579 | 242 |
| 262 | 3300049689 | Ga0501260_005604 | Ga0501260_005604_271_999 | 242 |
| 263 | 3300049705 | Ga0501225_0009168 | Ga0501225_0009168_1780_2508 | 242 |
| 264 | 3300049770 | Ga0501273_018883 | Ga0501273_018883_177_905 | 242 |
| 265 | 3300050507 | nmdc:mga05p37_330531_c1 | nmdc:mga05p37_330531_c1_186_929 | 242 |
| 266 | 3300050507 | nmdc:mga05p37_73665_c1 | nmdc:mga05p37_73665_c1_1613_2389 | 242 |
| 267 | 3300050511 | nmdc:mga08y16_63519_c1 | nmdc:mga08y16_63519_c1_406_1182 | 242 |
| 268 | 3300050512 | nmdc:mga0n895_631446_c1 | nmdc:mga0n895_631446_c1_297_1025 | 242 |
| 269 | 3300053077 | Ga0495601_0073124 | Ga0495601_0073124_810_1538 | 242 |
| 270 | 3300053085 | Ga0495619_0037048 | Ga0495619_0037048_2314_3042 | 242 |
| 271 | 3300005330 | Ga0070690_100003652 | Ga0070690_1000036526 | 243 |
| 272 | 3300005333 | Ga0070677_10056251 | Ga0070677_100562512 | 243 |
| 273 | 3300005335 | Ga0070666_10146995 | Ga0070666_101469952 | 243 |
| 274 | 3300005338 | Ga0068868_100329023 | Ga0068868_1003290232 | 243 |
| 275 | 3300005353 | Ga0070669_100300504 | Ga0070669_1003005042 | 243 |
| 276 | 3300005355 | Ga0070671_100003741 | Ga0070671_1000037417 | 243 |
| 277 | 3300005355 | Ga0070671_100074615 | Ga0070671_1000746152 | 243 |
| 278 | 3300005364 | Ga0070673_100000494 | Ga0070673_1000004947 | 243 |
| 279 | 3300005367 | Ga0070667_100542033 | Ga0070667_1005420331 | 243 |
| 280 | 3300005438 | Ga0070701_10138704 | Ga0070701_101387041 | 243 |
| 281 | 3300005456 | Ga0070678_100000362 | Ga0070678_10000036214 | 243 |
| 282 | 3300005457 | Ga0070662_100145255 | Ga0070662_1001452552 | 243 |
| 283 | 3300005459 | Ga0068867_100652796 | Ga0068867_1006527961 | 243 |
| 284 | 3300005548 | Ga0070665_100104625 | Ga0070665_1001046252 | 243 |
| 285 | 3300005843 | Ga0068860_100453840 | Ga0068860_1004538402 | 243 |
| 286 | 3300006358 | Ga0068871_100011376 | Ga0068871_1000113765 | 243 |
| 287 | 3300006880 | Ga0075429_100265678 | Ga0075429_1002656782 | 243 |
| 288 | 3300006881 | Ga0068865_100532640 | Ga0068865_1005326401 | 243 |
| 289 | 3300009147 | Ga0114129_10399201 | Ga0114129_103992011 | 243 |
| 290 | 3300013296 | Ga0157374_10007893 | Ga0157374_100078932 | 243 |
| 291 | 3300013297 | Ga0157378_10002420 | Ga0157378_1000242017 | 243 |
| 292 | 3300013308 | Ga0157375_10052578 | Ga0157375_100525783 | 243 |
| 293 | 3300014969 | Ga0157376_10764336 | Ga0157376_107643362 | 243 |
| 294 | 3300025899 | Ga0207642_10185131 | Ga0207642_101851311 | 243 |
| 295 | 3300025903 | Ga0207680_10072611 | Ga0207680_100726112 | 243 |
| 296 | 3300025903 | Ga0207680_10150126 | Ga0207680_101501262 | 243 |
| 297 | 3300025907 | Ga0207645_10118821 | Ga0207645_101188212 | 243 |
| 298 | 3300025910 | Ga0207684_10271355 | Ga0207684_102713551 | 243 |
| 299 | 3300025925 | Ga0207650_10009116 | Ga0207650_100091164 | 243 |
| 300 | 3300025931 | Ga0207644_10003149 | Ga0207644_100031497 | 243 |
| 301 | 3300025931 | Ga0207644_10086041 | Ga0207644_100860412 | 243 |
| 302 | 3300025940 | Ga0207691_10000150 | Ga0207691_1000015050 | 243 |
| 303 | 3300025960 | Ga0207651_10000592 | Ga0207651_1000059216 | 243 |
| 304 | 3300025960 | Ga0207651_10233761 | Ga0207651_102337612 | 243 |
| 305 | 3300025986 | Ga0207658_10542030 | Ga0207658_105420302 | 243 |
| 306 | 3300026023 | Ga0207677_10215974 | Ga0207677_102159742 | 243 |
| 307 | 3300026088 | Ga0207641_10333910 | Ga0207641_103339101 | 243 |
| 308 | 3300026118 | Ga0207675_100179262 | Ga0207675_1001792623 | 243 |
| 309 | 3300026121 | Ga0207683_10001350 | Ga0207683_1000135014 | 243 |
| 310 | 3300027907 | Ga0207428_10159224 | Ga0207428_101592242 | 243 |
| 311 | 3300032002 | Ga0307416_100468500 | Ga0307416_1004685001 | 243 |
| 312 | 3300039438 | Ga0436360_0838659 | Ga0436360_0838659_371_1111 | 243 |
| 313 | 3300042876 | Ga0451577_0032001 | Ga0451577_0032001_2194_2934 | 243 |
| 314 | 3300044712 | Ga0453684_0406333 | Ga0453684_0406333_87_830 | 243 |
| 315 | 3300048908 | Ga0496105_0467096 | Ga0496105_0467096_178_909 | 243 |
| 316 | 3300048917 | Ga0496114_0127082 | Ga0496114_0127082_903_1634 | 243 |
| 317 | 3300049591 | Ga0501075_0005441 | Ga0501075_0005441_3196_3927 | 243 |
| 318 | 3300049592 | Ga0501076_0037424 | Ga0501076_0037424_3050_3781 | 243 |
| 319 | 3300049593 | Ga0501077_0000975 | Ga0501077_0000975_15827_16558 | 243 |
| 320 | 3300049741 | Ga0501079_0008022 | Ga0501079_0008022_6071_6802 | 243 |
| 321 | 3300049742 | Ga0501080_0769299 | Ga0501080_0769299_27_758 | 243 |
| 322 | 3300050508 | nmdc:mga09592_708899_c1 | nmdc:mga09592_708899_c1_105_836 | 243 |
| 323 | 3300050511 | nmdc:mga08y16_36782_c1 | nmdc:mga08y16_36782_c1_1713_2444 | 243 |
| 324 | 3300054114 | Ga0501084_0107978 | Ga0501084_0107978_271_1002 | 243 |
| 325 | 3300005293 | Ga0065715_10001707 | Ga0065715_100017077 | 244 |
| 326 | 3300005336 | Ga0070680_100212745 | Ga0070680_1002127452 | 244 |
| 327 | 3300005406 | Ga0070703_10043098 | Ga0070703_100430982 | 244 |
| 328 | 3300005434 | Ga0070709_10000145 | Ga0070709_100001453 | 244 |
| 329 | 3300005444 | Ga0070694_100012009 | Ga0070694_1000120094 | 244 |
| 330 | 3300005546 | Ga0070696_100006993 | Ga0070696_1000069935 | 244 |
| 331 | 3300006173 | Ga0070716_100061008 | Ga0070716_1000610082 | 244 |
| 332 | 3300006844 | Ga0075428_100016191 | Ga0075428_1000161913 | 244 |
| 333 | 3300006844 | Ga0075428_100039862 | Ga0075428_1000398626 | 244 |
| 334 | 3300006846 | Ga0075430_100054026 | Ga0075430_1000540263 | 244 |
| 335 | 3300006847 | Ga0075431_100113184 | Ga0075431_1001131844 | 244 |
| 336 | 3300006847 | Ga0075431_100230617 | Ga0075431_1002306173 | 244 |
| 337 | 3300006880 | Ga0075429_100067799 | Ga0075429_1000677993 | 244 |
| 338 | 3300009094 | Ga0111539_10005372 | Ga0111539_100053728 | 244 |
| 339 | 3300021384 | Ga0213876_10000006 | Ga0213876_10000006486 | 244 |
| 340 | 3300021388 | Ga0213875_10031147 | Ga0213875_100311472 | 244 |
| 341 | 3300025885 | Ga0207653_10035990 | Ga0207653_100359902 | 244 |
| 342 | 3300025906 | Ga0207699_10000031 | Ga0207699_100000313 | 244 |
| 343 | 3300025939 | Ga0207665_10155425 | Ga0207665_101554252 | 244 |
| 344 | 3300025939 | Ga0207665_10183027 | Ga0207665_101830272 | 244 |
| 345 | 3300027907 | Ga0207428_10014358 | Ga0207428_100143586 | 244 |
| 346 | 3300031901 | Ga0307406_10655039 | Ga0307406_106550391 | 244 |
| 347 | 3300031995 | Ga0307409_100223358 | Ga0307409_1002233582 | 244 |
| 348 | 3300032004 | Ga0307414_10764910 | Ga0307414_107649101 | 244 |
| 349 | 3300037853 | Ga0436364_0141999 | Ga0436364_0141999_15238_15978 | 244 |
| 350 | 3300039093 | Ga0400489_20133 | Ga0400489_20133_38470_39204 | 244 |
| 351 | 3300039437 | Ga0436365_0635847 | Ga0436365_0635847_449_1189 | 244 |
| 352 | 3300039437 | Ga0436365_0695157 | Ga0436365_0695157_76687_77421 | 244 |
| 353 | 3300039438 | Ga0436360_1120397 | Ga0436360_1120397_16_759 | 244 |
| 354 | 3300045051 | Ga0451576_0060696 | Ga0451576_0060696_273_1007 | 244 |
| 355 | 3300049568 | Ga0501031_0003318 | Ga0501031_0003318_6605_7339 | 244 |
| 356 | 3300049572 | Ga0501036_0070201 | Ga0501036_0070201_1766_2500 | 244 |
| 357 | 3300049573 | Ga0501037_0007939 | Ga0501037_0007939_4611_5345 | 244 |
| 358 | 3300049574 | Ga0501038_0444846 | Ga0501038_0444846_237_971 | 244 |
| 359 | 3300049575 | Ga0501039_0000324 | Ga0501039_0000324_7235_7969 | 244 |
| 360 | 3300049575 | Ga0501039_0388754 | Ga0501039_0388754_302_1036 | 244 |
| 361 | 3300049577 | Ga0501041_0005866 | Ga0501041_0005866_5702_6436 | 244 |
| 362 | 3300049578 | Ga0501042_0010084 | Ga0501042_0010084_3209_3943 | 244 |
| 363 | 3300049580 | Ga0501046_0003690 | Ga0501046_0003690_10154_10888 | 244 |
| 364 | 3300049592 | Ga0501076_0017046 | Ga0501076_0017046_2611_3345 | 244 |
| 365 | 3300049741 | Ga0501079_0151199 | Ga0501079_0151199_870_1604 | 244 |
| 366 | 3300049743 | Ga0501081_0100032 | Ga0501081_0100032_1124_1858 | 244 |
| 367 | 3300050509 | nmdc:mga0qj67_43819_c1 | nmdc:mga0qj67_43819_c1_1915_2649 | 244 |
| 368 | 3300050510 | nmdc:mga06r32_14433_c1 | nmdc:mga06r32_14433_c1_1929_2672 | 244 |
| 369 | 3300050510 | nmdc:mga06r32_207790_c1 | nmdc:mga06r32_207790_c1_706_1440 | 244 |
| 370 | 3300050510 | nmdc:mga06r32_80291_c1 | nmdc:mga06r32_80291_c1_136_894 | 244 |
| 371 | 3300050511 | nmdc:mga08y16_12577_c1 | nmdc:mga08y16_12577_c1_461_1195 | 244 |
| 372 | 3300050515 | nmdc:mga0a205_15245_c1 | nmdc:mga0a205_15245_c1_1634_2368 | 244 |
| 373 | 3300054114 | Ga0501084_0273604 | Ga0501084_0273604_350_1084 | 244 |
| 374 | 3300005290 | Ga0065712_10083656 | Ga0065712_100836564 | 245 |
| 375 | 3300005337 | Ga0070682_100589518 | Ga0070682_1005895181 | 245 |
| 376 | 3300005444 | Ga0070694_100002515 | Ga0070694_1000025154 | 245 |
| 377 | 3300005468 | Ga0070707_100000020 | Ga0070707_10000002034 | 245 |
| 378 | 3300005468 | Ga0070707_100000456 | Ga0070707_10000045615 | 245 |
| 379 | 3300005518 | Ga0070699_100032091 | Ga0070699_1000320916 | 245 |
| 380 | 3300005546 | Ga0070696_100012215 | Ga0070696_1000122157 | 245 |
| 381 | 3300005564 | Ga0070664_100007758 | Ga0070664_1000077584 | 245 |
| 382 | 3300005937 | Ga0081455_10009173 | Ga0081455_100091736 | 245 |
| 383 | 3300006847 | Ga0075431_100015521 | Ga0075431_1000155218 | 245 |
| 384 | 3300006871 | Ga0075434_100029949 | Ga0075434_1000299496 | 245 |
| 385 | 3300009094 | Ga0111539_10031255 | Ga0111539_100312555 | 245 |
| 386 | 3300009147 | Ga0114129_10000340 | Ga0114129_100003406 | 245 |
| 387 | 3300009147 | Ga0114129_10006667 | Ga0114129_1000666711 | 245 |
| 388 | 3300009147 | Ga0114129_10021260 | Ga0114129_100212602 | 245 |
| 389 | 3300009147 | Ga0114129_10234049 | Ga0114129_102340492 | 245 |
| 390 | 3300009147 | Ga0114129_10774507 | Ga0114129_107745071 | 245 |
| 391 | 3300014969 | Ga0157376_10982947 | Ga0157376_109829472 | 245 |
| 392 | 3300025917 | Ga0207660_10604422 | Ga0207660_106044222 | 245 |
| 393 | 3300025922 | Ga0207646_10000008 | Ga0207646_10000008371 | 245 |
| 394 | 3300025922 | Ga0207646_10000009 | Ga0207646_1000000985 | 245 |
| 395 | 3300025922 | Ga0207646_10000480 | Ga0207646_1000048011 | 245 |
| 396 | 3300025944 | Ga0207661_10447589 | Ga0207661_104475892 | 245 |
| 397 | 3300025945 | Ga0207679_10009282 | Ga0207679_100092823 | 245 |
| 398 | 3300026118 | Ga0207675_100016702 | Ga0207675_1000167024 | 245 |
| 399 | 3300035691 | Ga0373931_0197726 | Ga0373931_0197726_149_886 | 245 |
| 400 | 3300042008 | Ga0439450_006233 | Ga0439450_006233_1319_2056 | 245 |
| 401 | 3300044673 | Ga0453683_0034959 | Ga0453683_0034959_168_905 | 245 |
| 402 | 3300045051 | Ga0451576_0001923 | Ga0451576_0001923_14391_15128 | 245 |
| 403 | 3300049584 | Ga0501068_0029589 | Ga0501068_0029589_2468_3205 | 245 |
| 404 | 3300049587 | Ga0501071_0534442 | Ga0501071_0534442_142_879 | 245 |
| 405 | 3300049743 | Ga0501081_0382740 | Ga0501081_0382740_195_932 | 245 |
| 406 | 3300050507 | nmdc:mga05p37_11102_c1 | nmdc:mga05p37_11102_c1_9469_10260 | 245 |
| 407 | 3300050507 | nmdc:mga05p37_132952_c1 | nmdc:mga05p37_132952_c1_1850_2587 | 245 |
| 408 | 3300050507 | nmdc:mga05p37_199919_c1 | nmdc:mga05p37_199919_c1_1536_2273 | 245 |
| 409 | 3300050507 | nmdc:mga05p37_29170_c1 | nmdc:mga05p37_29170_c1_495_1232 | 245 |
| 410 | 3300050510 | nmdc:mga06r32_35225_c1 | nmdc:mga06r32_35225_c1_973_1758 | 245 |
| 411 | 3300050512 | nmdc:mga0n895_412365_c1 | nmdc:mga0n895_412365_c1_281_1072 | 245 |
| 412 | 3300005290 | Ga0065712_10096352 | Ga0065712_100963522 | 246 |
| 413 | 3300005293 | Ga0065715_10109661 | Ga0065715_101096612 | 246 |
| 414 | 3300005365 | Ga0070688_100270045 | Ga0070688_1002700452 | 246 |
| 415 | 3300005438 | Ga0070701_10313976 | Ga0070701_103139762 | 246 |
| 416 | 3300005458 | Ga0070681_10440486 | Ga0070681_104404862 | 246 |
| 417 | 3300005467 | Ga0070706_100008898 | Ga0070706_1000088986 | 246 |
| 418 | 3300005471 | Ga0070698_100423685 | Ga0070698_1004236851 | 246 |
| 419 | 3300005530 | Ga0070679_100503685 | Ga0070679_1005036852 | 246 |
| 420 | 3300005536 | Ga0070697_100075678 | Ga0070697_1000756781 | 246 |
| 421 | 3300005618 | Ga0068864_100129471 | Ga0068864_1001294712 | 246 |
| 422 | 3300006173 | Ga0070716_100130284 | Ga0070716_1001302842 | 246 |
| 423 | 3300006237 | Ga0097621_100179541 | Ga0097621_1001795411 | 246 |
| 424 | 3300006844 | Ga0075428_100097092 | Ga0075428_1000970923 | 246 |
| 425 | 3300013105 | Ga0157369_10073275 | Ga0157369_100732753 | 246 |
| 426 | 3300013307 | Ga0157372_10445694 | Ga0157372_104456942 | 246 |
| 427 | 3300013308 | Ga0157375_10030926 | Ga0157375_100309263 | 246 |
| 428 | 3300014969 | Ga0157376_10087295 | Ga0157376_100872953 | 246 |
| 429 | 3300025921 | Ga0207652_10350387 | Ga0207652_103503872 | 246 |
| 430 | 3300025939 | Ga0207665_10134195 | Ga0207665_101341952 | 246 |
| 431 | 3300026088 | Ga0207641_10708566 | Ga0207641_107085662 | 246 |
| 432 | 3300026095 | Ga0207676_10107844 | Ga0207676_101078442 | 246 |
| 433 | 3300026116 | Ga0207674_10185035 | Ga0207674_101850353 | 246 |
| 434 | 3300028380 | Ga0268265_10801829 | Ga0268265_108018291 | 246 |
| 435 | 3300032002 | Ga0307416_100429714 | Ga0307416_1004297142 | 246 |
| 436 | 3300035113 | Ga0373936_0152612 | Ga0373936_0152612_82_825 | 246 |
| 437 | 3300035171 | Ga0373946_0028782 | Ga0373946_0028782_719_1462 | 246 |
| 438 | 3300037068 | Ga0373925_0000505 | Ga0373925_0000505_970_1713 | 246 |
| 439 | 3300045976 | Ga0466967_0789858 | Ga0466967_0789858_146_886 | 246 |
| 440 | 3300046459 | Ga0495629_0000010 | Ga0495629_0000010_130558_131301 | 246 |
| 441 | 3300046475 | Ga0495639_0000036 | Ga0495639_0000036_53568_54311 | 246 |
| 442 | 3300046499 | Ga0495594_0027656 | Ga0495594_0027656_2023_2766 | 246 |
| 443 | 3300046526 | Ga0495666_0000171 | Ga0495666_0000171_25566_26309 | 246 |
| 444 | 3300046535 | Ga0495586_0000747 | Ga0495586_0000747_17412_18155 | 246 |
| 445 | 3300046663 | Ga0495635_0000403 | Ga0495635_0000403_22225_22968 | 246 |
| 446 | 3300046674 | Ga0495588_0133528 | Ga0495588_0133528_308_1051 | 246 |
| 447 | 3300046681 | Ga0495647_0020929 | Ga0495647_0020929_129_872 | 246 |
| 448 | 3300046683 | Ga0495658_0072986 | Ga0495658_0072986_1128_1868 | 246 |
| 449 | 3300046683 | Ga0495658_0074232 | Ga0495658_0074232_1204_1947 | 246 |
| 450 | 3300046690 | Ga0495624_0033999 | Ga0495624_0033999_471_1214 | 246 |
| 451 | 3300046809 | Ga0495600_0078811 | Ga0495600_0078811_511_1254 | 246 |
| 452 | 3300047315 | Ga0495581_0113688 | Ga0495581_0113688_122_865 | 246 |
| 453 | 3300047321 | Ga0495676_0001556 | Ga0495676_0001556_7693_8436 | 246 |
| 454 | 3300047322 | Ga0495680_0000604 | Ga0495680_0000604_16469_17212 | 246 |
| 455 | 3300047471 | Ga0495684_0169396 | Ga0495684_0169396_816_1559 | 246 |
| 456 | 3300049580 | Ga0501046_0092592 | Ga0501046_0092592_928_1677 | 246 |
| 457 | 3300049581 | Ga0501047_0000970 | Ga0501047_0000970_25917_26663 | 246 |
| 458 | 3300049588 | Ga0501072_0064166 | Ga0501072_0064166_832_1581 | 246 |
| 459 | 3300049590 | Ga0501074_0023152 | Ga0501074_0023152_619_1368 | 246 |
| 460 | 3300049591 | Ga0501075_0094379 | Ga0501075_0094379_1227_1976 | 246 |
| 461 | 3300049741 | Ga0501079_0164881 | Ga0501079_0164881_335_1084 | 246 |
| 462 | 3300049743 | Ga0501081_0158097 | Ga0501081_0158097_869_1618 | 246 |
| 463 | 3300049822 | Ga0501035_0002599 | Ga0501035_0002599_4659_5405 | 246 |
| 464 | 3300049823 | Ga0501044_0005388 | Ga0501044_0005388_5153_5899 | 246 |
| 465 | 3300049824 | Ga0501045_0015541 | Ga0501045_0015541_4154_4903 | 246 |
| 466 | 3300053085 | Ga0495619_0047458 | Ga0495619_0047458_1325_2068 | 246 |
| 467 | 3300053094 | Ga0500566_0122223 | Ga0500566_0122223_294_1037 | 246 |
| 468 | 3300061734 | Ga0530510_0139208 | Ga0530510_0139208_715_1464 | 246 |
| 469 | 3300025916 | Ga0207663_10406271 | Ga0207663_104062711 | 247 |
| 470 | 3300044712 | Ga0453684_0638449 | Ga0453684_0638449_386_1138 | 247 |
| 471 | 3300049573 | Ga0501037_0472884 | Ga0501037_0472884_91_834 | 247 |
| 472 | 3300005334 | Ga0068869_100086868 | Ga0068869_1000868682 | 248 |
| 473 | 3300005340 | Ga0070689_100009432 | Ga0070689_1000094327 | 248 |
| 474 | 3300005364 | Ga0070673_100313635 | Ga0070673_1003136352 | 248 |
| 475 | 3300005467 | Ga0070706_100088496 | Ga0070706_1000884963 | 248 |
| 476 | 3300005546 | Ga0070696_100048890 | Ga0070696_1000488901 | 248 |
| 477 | 3300005618 | Ga0068864_100010461 | Ga0068864_1000104616 | 248 |
| 478 | 3300005840 | Ga0068870_10022762 | Ga0068870_100227623 | 248 |
| 479 | 3300005841 | Ga0068863_100081003 | Ga0068863_1000810032 | 248 |
| 480 | 3300005841 | Ga0068863_100165629 | Ga0068863_1001656292 | 248 |
| 481 | 3300006852 | Ga0075433_10035192 | Ga0075433_100351923 | 248 |
| 482 | 3300006852 | Ga0075433_10081560 | Ga0075433_100815603 | 248 |
| 483 | 3300006914 | Ga0075436_100143438 | Ga0075436_1001434382 | 248 |
| 484 | 3300009147 | Ga0114129_10391021 | Ga0114129_103910211 | 248 |
| 485 | 3300009148 | Ga0105243_10341298 | Ga0105243_103412982 | 248 |
| 486 | 3300009174 | Ga0105241_10117684 | Ga0105241_101176842 | 248 |
| 487 | 3300009176 | Ga0105242_10397950 | Ga0105242_103979501 | 248 |
| 488 | 3300011119 | Ga0105246_10313261 | Ga0105246_103132612 | 248 |
| 489 | 3300013308 | Ga0157375_10435580 | Ga0157375_104355802 | 248 |
| 490 | 3300014326 | Ga0157380_10513312 | Ga0157380_105133121 | 248 |
| 491 | 3300025908 | Ga0207643_10001907 | Ga0207643_100019078 | 248 |
| 492 | 3300025925 | Ga0207650_10029390 | Ga0207650_100293903 | 248 |
| 493 | 3300025940 | Ga0207691_10076975 | Ga0207691_100769752 | 248 |
| 494 | 3300025942 | Ga0207689_10061273 | Ga0207689_100612732 | 248 |
| 495 | 3300026088 | Ga0207641_10164308 | Ga0207641_101643081 | 248 |
| 496 | 3300026116 | Ga0207674_10440546 | Ga0207674_104405462 | 248 |
| 497 | 3300026118 | Ga0207675_100042468 | Ga0207675_1000424682 | 248 |
| 498 | 3300028573 | Ga0265334_10094912 | Ga0265334_100949122 | 248 |
| 499 | 3300028800 | Ga0265338_10071265 | Ga0265338_100712652 | 248 |
| 500 | 3300028800 | Ga0265338_10525265 | Ga0265338_105252651 | 248 |
| 501 | 3300031548 | Ga0307408_100251747 | Ga0307408_1002517471 | 248 |
| 502 | 3300031903 | Ga0307407_10072696 | Ga0307407_100726962 | 248 |
| 503 | 3300032005 | Ga0307411_10133152 | Ga0307411_101331521 | 248 |
| 504 | 3300037853 | Ga0436364_0296140 | Ga0436364_0296140_102_854 | 248 |
| 505 | 3300049515 | Ga0501292_003457 | Ga0501292_003457_1299_2045 | 248 |
| 506 | 3300049650 | Ga0501199_007105 | Ga0501199_007105_340_1086 | 248 |
| 507 | 3300049651 | Ga0501201_006228 | Ga0501201_006228_346_1092 | 248 |
| 508 | 3300049664 | Ga0501224_006070 | Ga0501224_006070_77_823 | 248 |
| 509 | 3300049665 | Ga0501227_031336 | Ga0501227_031336_357_1103 | 248 |
| 510 | 3300049667 | Ga0501230_010270 | Ga0501230_010270_31_777 | 248 |
| 511 | 3300049668 | Ga0501233_027182 | Ga0501233_027182_346_1092 | 248 |
| 512 | 3300049704 | Ga0501221_054671 | Ga0501221_054671_46_792 | 248 |
| 513 | 3300049705 | Ga0501225_0067088 | Ga0501225_0067088_49_795 | 248 |
| 514 | 3300049769 | Ga0501272_004542 | Ga0501272_004542_619_1365 | 248 |
| 515 | 3300049770 | Ga0501273_007509 | Ga0501273_007509_56_802 | 248 |
| 516 | 3300049851 | Ga0501212_003475 | Ga0501212_003475_945_1691 | 248 |
| 517 | 3300050507 | nmdc:mga05p37_52504_c1 | nmdc:mga05p37_52504_c1_892_1638 | 248 |
| 518 | 3300050514 | nmdc:mga08x19_51624_c1 | nmdc:mga08x19_51624_c1_1336_2082 | 248 |
| 519 | 3300050515 | nmdc:mga0a205_94964_c1 | nmdc:mga0a205_94964_c1_929_1675 | 248 |
| 520 | 3300005330 | Ga0070690_100019914 | Ga0070690_1000199143 | 249 |
| 521 | 3300005345 | Ga0070692_10304276 | Ga0070692_103042761 | 249 |
| 522 | 3300005438 | Ga0070701_10121120 | Ga0070701_101211202 | 249 |
| 523 | 3300005441 | Ga0070700_100000122 | Ga0070700_1000001224 | 249 |
| 524 | 3300005444 | Ga0070694_100283957 | Ga0070694_1002839571 | 249 |
| 525 | 3300005444 | Ga0070694_100442347 | Ga0070694_1004423471 | 249 |
| 526 | 3300005459 | Ga0068867_100533769 | Ga0068867_1005337692 | 249 |
| 527 | 3300005467 | Ga0070706_100063507 | Ga0070706_1000635072 | 249 |
| 528 | 3300005468 | Ga0070707_100000556 | Ga0070707_1000005565 | 249 |
| 529 | 3300005471 | Ga0070698_100019542 | Ga0070698_1000195422 | 249 |
| 530 | 3300005518 | Ga0070699_100005655 | Ga0070699_1000056558 | 249 |
| 531 | 3300005536 | Ga0070697_100012754 | Ga0070697_1000127543 | 249 |
| 532 | 3300005578 | Ga0068854_100029189 | Ga0068854_1000291893 | 249 |
| 533 | 3300005617 | Ga0068859_100261377 | Ga0068859_1002613772 | 249 |
| 534 | 3300005844 | Ga0068862_100143069 | Ga0068862_1001430692 | 249 |
| 535 | 3300006931 | Ga0097620_100261379 | Ga0097620_1002613792 | 249 |
| 536 | 3300013297 | Ga0157378_10088325 | Ga0157378_100883252 | 249 |
| 537 | 3300013297 | Ga0157378_10202258 | Ga0157378_102022581 | 249 |
| 538 | 3300013308 | Ga0157375_10959226 | Ga0157375_109592262 | 249 |
| 539 | 3300014326 | Ga0157380_10006509 | Ga0157380_100065093 | 249 |
| 540 | 3300021384 | Ga0213876_10025569 | Ga0213876_100255693 | 249 |
| 541 | 3300021388 | Ga0213875_10036253 | Ga0213875_100362533 | 249 |
| 542 | 3300025910 | Ga0207684_10096684 | Ga0207684_100966842 | 249 |
| 543 | 3300025910 | Ga0207684_10172291 | Ga0207684_101722911 | 249 |
| 544 | 3300025918 | Ga0207662_10145966 | Ga0207662_101459662 | 249 |
| 545 | 3300025922 | Ga0207646_10000078 | Ga0207646_1000007835 | 249 |
| 546 | 3300025942 | Ga0207689_10117270 | Ga0207689_101172702 | 249 |
| 547 | 3300025960 | Ga0207651_10183114 | Ga0207651_101831142 | 249 |
| 548 | 3300025981 | Ga0207640_10104195 | Ga0207640_101041952 | 249 |
| 549 | 3300026075 | Ga0207708_10327495 | Ga0207708_103274952 | 249 |
| 550 | 3300026089 | Ga0207648_10610540 | Ga0207648_106105401 | 249 |
| 551 | 3300026116 | Ga0207674_10519068 | Ga0207674_105190682 | 249 |
| 552 | 3300028379 | Ga0268266_10012462 | Ga0268266_100124626 | 249 |
| 553 | 3300028380 | Ga0268265_10154289 | Ga0268265_101542892 | 249 |
| 554 | 3300028381 | Ga0268264_10369045 | Ga0268264_103690452 | 249 |
| 555 | 3300037853 | Ga0436364_1285749 | Ga0436364_1285749_3611_4372 | 249 |
| 556 | 3300039437 | Ga0436365_1385458 | Ga0436365_1385458_983_1744 | 249 |
| 557 | 3300046678 | Ga0495599_0275102 | Ga0495599_0275102_164_955 | 249 |
| 558 | 3300003203 | JGI25406J46586_10005418 | JGI25406J46586_100054181 | 250 |
| 559 | 3300005406 | Ga0070703_10021364 | Ga0070703_100213642 | 250 |
| 560 | 3300005434 | Ga0070709_10050176 | Ga0070709_100501762 | 250 |
| 561 | 3300005440 | Ga0070705_100004461 | Ga0070705_1000044613 | 250 |
| 562 | 3300005444 | Ga0070694_100010103 | Ga0070694_1000101032 | 250 |
| 563 | 3300005445 | Ga0070708_100063815 | Ga0070708_1000638153 | 250 |
| 564 | 3300005458 | Ga0070681_10472221 | Ga0070681_104722211 | 250 |
| 565 | 3300005467 | Ga0070706_100009122 | Ga0070706_1000091224 | 250 |
| 566 | 3300005518 | Ga0070699_100005039 | Ga0070699_1000050392 | 250 |
| 567 | 3300005530 | Ga0070679_100031421 | Ga0070679_1000314212 | 250 |
| 568 | 3300005536 | Ga0070697_100001443 | Ga0070697_1000014436 | 250 |
| 569 | 3300005545 | Ga0070695_100001424 | Ga0070695_1000014242 | 250 |
| 570 | 3300005546 | Ga0070696_100002349 | Ga0070696_10000234912 | 250 |
| 571 | 3300005547 | Ga0070693_100000120 | Ga0070693_10000012026 | 250 |
| 572 | 3300005549 | Ga0070704_100001083 | Ga0070704_1000010833 | 250 |
| 573 | 3300005618 | Ga0068864_100530300 | Ga0068864_1005303002 | 250 |
| 574 | 3300005985 | Ga0081539_10000654 | Ga0081539_1000065435 | 250 |
| 575 | 3300005985 | Ga0081539_10109872 | Ga0081539_101098722 | 250 |
| 576 | 3300007265 | Ga0099794_10069046 | Ga0099794_100690462 | 250 |
| 577 | 3300013297 | Ga0157378_10045898 | Ga0157378_100458983 | 250 |
| 578 | 3300014968 | Ga0157379_10000101 | Ga0157379_1000010150 | 250 |
| 579 | 3300014969 | Ga0157376_10054933 | Ga0157376_100549332 | 250 |
| 580 | 3300025885 | Ga0207653_10035550 | Ga0207653_100355501 | 250 |
| 581 | 3300025910 | Ga0207684_10008349 | Ga0207684_100083494 | 250 |
| 582 | 3300025912 | Ga0207707_10404333 | Ga0207707_104043332 | 250 |
| 583 | 3300025921 | Ga0207652_10057983 | Ga0207652_100579832 | 250 |
| 584 | 3300031235 | Ga0265330_10012136 | Ga0265330_100121365 | 250 |
| 585 | 3300031238 | Ga0265332_10010411 | Ga0265332_100104114 | 250 |
| 586 | 3300031239 | Ga0265328_10074129 | Ga0265328_100741292 | 250 |
| 587 | 3300031240 | Ga0265320_10002223 | Ga0265320_100022238 | 250 |
| 588 | 3300031241 | Ga0265325_10019926 | Ga0265325_100199265 | 250 |
| 589 | 3300031250 | Ga0265331_10001396 | Ga0265331_1000139615 | 250 |
| 590 | 3300031344 | Ga0265316_10003614 | Ga0265316_100036142 | 250 |
| 591 | 3300031712 | Ga0265342_10126973 | Ga0265342_101269731 | 250 |
| 592 | 3300031712 | Ga0265342_10179988 | Ga0265342_101799882 | 250 |
| 593 | 3300032002 | Ga0307416_101098266 | Ga0307416_1010982662 | 250 |
| 594 | 3300037068 | Ga0373925_0009911 | Ga0373925_0009911_4816_5574 | 250 |
| 595 | 3300046472 | Ga0495580_0004284 | Ga0495580_0004284_6707_7465 | 250 |
| 596 | 3300005441 | Ga0070700_100361794 | Ga0070700_1003617941 | 251 |
| 597 | 3300005468 | Ga0070707_100709309 | Ga0070707_1007093091 | 251 |
| 598 | 3300006914 | Ga0075436_100017099 | Ga0075436_1000170993 | 251 |
| 599 | 3300025917 | Ga0207660_10145220 | Ga0207660_101452202 | 251 |
| 600 | 3300026075 | Ga0207708_10662428 | Ga0207708_106624281 | 251 |
| 601 | 3300039438 | Ga0436360_0923887 | Ga0436360_0923887_7338_8102 | 251 |
| 602 | 3300039447 | Ga0436361_0863641 | Ga0436361_0863641_10382_11146 | 251 |
| 603 | 3300050514 | nmdc:mga08x19_13355_c1 | nmdc:mga08x19_13355_c1_2527_3300 | 251 |
| 604 | 3300005353 | Ga0070669_100101798 | Ga0070669_1001017981 | 252 |
| 605 | 3300005438 | Ga0070701_10131294 | Ga0070701_101312942 | 252 |
| 606 | 3300005459 | Ga0068867_100125133 | Ga0068867_1001251332 | 252 |
| 607 | 3300005578 | Ga0068854_100076161 | Ga0068854_1000761613 | 252 |
| 608 | 3300005617 | Ga0068859_100837585 | Ga0068859_1008375851 | 252 |
| 609 | 3300005718 | Ga0068866_10152582 | Ga0068866_101525821 | 252 |
| 610 | 3300005844 | Ga0068862_100793972 | Ga0068862_1007939721 | 252 |
| 611 | 3300006847 | Ga0075431_100195358 | Ga0075431_1001953582 | 252 |
| 612 | 3300006871 | Ga0075434_100105034 | Ga0075434_1001050344 | 252 |
| 613 | 3300006880 | Ga0075429_100171091 | Ga0075429_1001710912 | 252 |
| 614 | 3300006931 | Ga0097620_100837677 | Ga0097620_1008376771 | 252 |
| 615 | 3300009094 | Ga0111539_10194061 | Ga0111539_101940611 | 252 |
| 616 | 3300009147 | Ga0114129_10237940 | Ga0114129_102379403 | 252 |
| 617 | 3300009147 | Ga0114129_10314479 | Ga0114129_103144792 | 252 |
| 618 | 3300009553 | Ga0105249_10042577 | Ga0105249_100425772 | 252 |
| 619 | 3300013308 | Ga0157375_10024889 | Ga0157375_100248891 | 252 |
| 620 | 3300014326 | Ga0157380_10000079 | Ga0157380_1000007921 | 252 |
| 621 | 3300025923 | Ga0207681_10291375 | Ga0207681_102913751 | 252 |
| 622 | 3300025938 | Ga0207704_10709599 | Ga0207704_107095991 | 252 |
| 623 | 3300025961 | Ga0207712_10047870 | Ga0207712_100478703 | 252 |
| 624 | 3300025981 | Ga0207640_10230299 | Ga0207640_102302992 | 252 |
| 625 | 3300026075 | Ga0207708_10059405 | Ga0207708_100594051 | 252 |
| 626 | 3300026089 | Ga0207648_10102318 | Ga0207648_101023183 | 252 |
| 627 | 3300028380 | Ga0268265_10075195 | Ga0268265_100751951 | 252 |
| 628 | 3300049574 | Ga0501038_0003771 | Ga0501038_0003771_9569_10333 | 252 |
| 629 | 3300050507 | nmdc:mga05p37_168016_c1 | nmdc:mga05p37_168016_c1_105_863 | 252 |
| 630 | 3300050510 | nmdc:mga06r32_160811_c1 | nmdc:mga06r32_160811_c1_355_1113 | 252 |
| 631 | 3300003203 | JGI25406J46586_10016199 | JGI25406J46586_100161993 | 253 |
| 632 | 3300005289 | Ga0065704_10001951 | Ga0065704_100019518 | 253 |
| 633 | 3300005289 | Ga0065704_10007121 | Ga0065704_100071214 | 253 |
| 634 | 3300005290 | Ga0065712_10002363 | Ga0065712_100023634 | 253 |
| 635 | 3300005290 | Ga0065712_10068601 | Ga0065712_100686018 | 253 |
| 636 | 3300005290 | Ga0065712_10149654 | Ga0065712_101496542 | 253 |
| 637 | 3300005293 | Ga0065715_10005851 | Ga0065715_100058514 | 253 |
| 638 | 3300005293 | Ga0065715_10217063 | Ga0065715_102170632 | 253 |
| 639 | 3300005295 | Ga0065707_10001745 | Ga0065707_100017457 | 253 |
| 640 | 3300005295 | Ga0065707_10002540 | Ga0065707_100025404 | 253 |
| 641 | 3300005295 | Ga0065707_10095984 | Ga0065707_100959843 | 253 |
| 642 | 3300005330 | Ga0070690_100022292 | Ga0070690_1000222922 | 253 |
| 643 | 3300005334 | Ga0068869_100031699 | Ga0068869_1000316993 | 253 |
| 644 | 3300005334 | Ga0068869_100123941 | Ga0068869_1001239412 | 253 |
| 645 | 3300005337 | Ga0070682_100068715 | Ga0070682_1000687152 | 253 |
| 646 | 3300005338 | Ga0068868_100017053 | Ga0068868_1000170531 | 253 |
| 647 | 3300005340 | Ga0070689_100027225 | Ga0070689_1000272252 | 253 |
| 648 | 3300005343 | Ga0070687_100010363 | Ga0070687_1000103633 | 253 |
| 649 | 3300005347 | Ga0070668_100488770 | Ga0070668_1004887701 | 253 |
| 650 | 3300005354 | Ga0070675_100353457 | Ga0070675_1003534572 | 253 |
| 651 | 3300005355 | Ga0070671_100004147 | Ga0070671_1000041472 | 253 |
| 652 | 3300005355 | Ga0070671_100017451 | Ga0070671_1000174513 | 253 |
| 653 | 3300005364 | Ga0070673_100027151 | Ga0070673_1000271512 | 253 |
| 654 | 3300005364 | Ga0070673_100284413 | Ga0070673_1002844132 | 253 |
| 655 | 3300005365 | Ga0070688_100170509 | Ga0070688_1001705092 | 253 |
| 656 | 3300005365 | Ga0070688_100441915 | Ga0070688_1004419151 | 253 |
| 657 | 3300005367 | Ga0070667_100144584 | Ga0070667_1001445842 | 253 |
| 658 | 3300005406 | Ga0070703_10000169 | Ga0070703_1000016926 | 253 |
| 659 | 3300005435 | Ga0070714_100008928 | Ga0070714_1000089282 | 253 |
| 660 | 3300005438 | Ga0070701_10029425 | Ga0070701_100294253 | 253 |
| 661 | 3300005438 | Ga0070701_10157239 | Ga0070701_101572392 | 253 |
| 662 | 3300005441 | Ga0070700_100013304 | Ga0070700_1000133041 | 253 |
| 663 | 3300005441 | Ga0070700_100379352 | Ga0070700_1003793521 | 253 |
| 664 | 3300005444 | Ga0070694_100000497 | Ga0070694_10000049710 | 253 |
| 665 | 3300005444 | Ga0070694_100025490 | Ga0070694_1000254903 | 253 |
| 666 | 3300005444 | Ga0070694_100136256 | Ga0070694_1001362562 | 253 |
| 667 | 3300005445 | Ga0070708_100009886 | Ga0070708_1000098864 | 253 |
| 668 | 3300005456 | Ga0070678_100033270 | Ga0070678_1000332702 | 253 |
| 669 | 3300005459 | Ga0068867_100032731 | Ga0068867_1000327313 | 253 |
| 670 | 3300005467 | Ga0070706_100112848 | Ga0070706_1001128483 | 253 |
| 671 | 3300005471 | Ga0070698_100045461 | Ga0070698_1000454612 | 253 |
| 672 | 3300005471 | Ga0070698_100065817 | Ga0070698_1000658172 | 253 |
| 673 | 3300005471 | Ga0070698_100154735 | Ga0070698_1001547352 | 253 |
| 674 | 3300005530 | Ga0070679_100174323 | Ga0070679_1001743233 | 253 |
| 675 | 3300005536 | Ga0070697_100117501 | Ga0070697_1001175013 | 253 |
| 676 | 3300005539 | Ga0068853_100116933 | Ga0068853_1001169333 | 253 |
| 677 | 3300005543 | Ga0070672_100055206 | Ga0070672_1000552062 | 253 |
| 678 | 3300005543 | Ga0070672_100565713 | Ga0070672_1005657132 | 253 |
| 679 | 3300005545 | Ga0070695_100134565 | Ga0070695_1001345652 | 253 |
| 680 | 3300005545 | Ga0070695_100247436 | Ga0070695_1002474362 | 253 |
| 681 | 3300005545 | Ga0070695_100361806 | Ga0070695_1003618062 | 253 |
| 682 | 3300005545 | Ga0070695_100559032 | Ga0070695_1005590321 | 253 |
| 683 | 3300005546 | Ga0070696_100292687 | Ga0070696_1002926872 | 253 |
| 684 | 3300005547 | Ga0070693_100076437 | Ga0070693_1000764372 | 253 |
| 685 | 3300005548 | Ga0070665_100428194 | Ga0070665_1004281942 | 253 |
| 686 | 3300005549 | Ga0070704_100021552 | Ga0070704_1000215523 | 253 |
| 687 | 3300005549 | Ga0070704_100107395 | Ga0070704_1001073951 | 253 |
| 688 | 3300005564 | Ga0070664_100435051 | Ga0070664_1004350512 | 253 |
| 689 | 3300005577 | Ga0068857_100206718 | Ga0068857_1002067182 | 253 |
| 690 | 3300005615 | Ga0070702_100021283 | Ga0070702_1000212832 | 253 |
| 691 | 3300005616 | Ga0068852_100073151 | Ga0068852_1000731512 | 253 |
| 692 | 3300005617 | Ga0068859_100028814 | Ga0068859_1000288141 | 253 |
| 693 | 3300005617 | Ga0068859_100049326 | Ga0068859_1000493262 | 253 |
| 694 | 3300005617 | Ga0068859_100087485 | Ga0068859_1000874853 | 253 |
| 695 | 3300005617 | Ga0068859_100109287 | Ga0068859_1001092873 | 253 |
| 696 | 3300005617 | Ga0068859_100200012 | Ga0068859_1002000122 | 253 |
| 697 | 3300005618 | Ga0068864_100075146 | Ga0068864_1000751461 | 253 |
| 698 | 3300005618 | Ga0068864_100852721 | Ga0068864_1008527211 | 253 |
| 699 | 3300005718 | Ga0068866_10018871 | Ga0068866_100188713 | 253 |
| 700 | 3300005719 | Ga0068861_100016775 | Ga0068861_1000167754 | 253 |
| 701 | 3300005841 | Ga0068863_100072812 | Ga0068863_1000728123 | 253 |
| 702 | 3300005842 | Ga0068858_100407305 | Ga0068858_1004073052 | 253 |
| 703 | 3300005842 | Ga0068858_100408252 | Ga0068858_1004082522 | 253 |
| 704 | 3300005843 | Ga0068860_100002648 | Ga0068860_10000264811 | 253 |
| 705 | 3300005843 | Ga0068860_100007291 | Ga0068860_1000072915 | 253 |
| 706 | 3300005843 | Ga0068860_100184222 | Ga0068860_1001842223 | 253 |
| 707 | 3300005844 | Ga0068862_100068954 | Ga0068862_1000689542 | 253 |
| 708 | 3300005985 | Ga0081539_10000428 | Ga0081539_1000042832 | 253 |
| 709 | 3300005985 | Ga0081539_10001420 | Ga0081539_100014209 | 253 |
| 710 | 3300006237 | Ga0097621_100168148 | Ga0097621_1001681482 | 253 |
| 711 | 3300006844 | Ga0075428_100102473 | Ga0075428_1001024734 | 253 |
| 712 | 3300006844 | Ga0075428_100115401 | Ga0075428_1001154014 | 253 |
| 713 | 3300006844 | Ga0075428_100264774 | Ga0075428_1002647742 | 253 |
| 714 | 3300006846 | Ga0075430_100136164 | Ga0075430_1001361643 | 253 |
| 715 | 3300006852 | Ga0075433_10090867 | Ga0075433_100908672 | 253 |
| 716 | 3300006852 | Ga0075433_10525299 | Ga0075433_105252992 | 253 |
| 717 | 3300006871 | Ga0075434_100215076 | Ga0075434_1002150762 | 253 |
| 718 | 3300006871 | Ga0075434_100750045 | Ga0075434_1007500452 | 253 |
| 719 | 3300006880 | Ga0075429_100003364 | Ga0075429_1000033646 | 253 |
| 720 | 3300006914 | Ga0075436_100216534 | Ga0075436_1002165342 | 253 |
| 721 | 3300006931 | Ga0097620_100028817 | Ga0097620_1000288171 | 253 |
| 722 | 3300006931 | Ga0097620_100049325 | Ga0097620_1000493254 | 253 |
| 723 | 3300006931 | Ga0097620_100087487 | Ga0097620_1000874873 | 253 |
| 724 | 3300006931 | Ga0097620_100109290 | Ga0097620_1001092903 | 253 |
| 725 | 3300006931 | Ga0097620_100200015 | Ga0097620_1002000152 | 253 |
| 726 | 3300007076 | Ga0075435_100050247 | Ga0075435_1000502471 | 253 |
| 727 | 3300009101 | Ga0105247_10058770 | Ga0105247_100587703 | 253 |
| 728 | 3300009148 | Ga0105243_10000029 | Ga0105243_1000002999 | 253 |
| 729 | 3300009148 | Ga0105243_10138308 | Ga0105243_101383081 | 253 |
| 730 | 3300009176 | Ga0105242_10000009 | Ga0105242_1000000979 | 253 |
| 731 | 3300009177 | Ga0105248_10002691 | Ga0105248_1000269110 | 253 |
| 732 | 3300009177 | Ga0105248_10121188 | Ga0105248_101211882 | 253 |
| 733 | 3300009177 | Ga0105248_10555829 | Ga0105248_105558291 | 253 |
| 734 | 3300009553 | Ga0105249_10372351 | Ga0105249_103723513 | 253 |
| 735 | 3300013306 | Ga0163162_10030482 | Ga0163162_100304822 | 253 |
| 736 | 3300013308 | Ga0157375_10105442 | Ga0157375_101054422 | 253 |
| 737 | 3300014325 | Ga0163163_10011974 | Ga0163163_100119743 | 253 |
| 738 | 3300014968 | Ga0157379_10500422 | Ga0157379_105004222 | 253 |
| 739 | 3300017792 | Ga0163161_10235858 | Ga0163161_102358582 | 253 |
| 740 | 3300025315 | Ga0207697_10054007 | Ga0207697_100540072 | 253 |
| 741 | 3300025885 | Ga0207653_10000117 | Ga0207653_100001173 | 253 |
| 742 | 3300025900 | Ga0207710_10001685 | Ga0207710_100016857 | 253 |
| 743 | 3300025900 | Ga0207710_10204565 | Ga0207710_102045651 | 253 |
| 744 | 3300025904 | Ga0207647_10261654 | Ga0207647_102616542 | 253 |
| 745 | 3300025906 | Ga0207699_10239448 | Ga0207699_102394482 | 253 |
| 746 | 3300025908 | Ga0207643_10083367 | Ga0207643_100833672 | 253 |
| 747 | 3300025910 | Ga0207684_10000030 | Ga0207684_1000003095 | 253 |
| 748 | 3300025910 | Ga0207684_10226283 | Ga0207684_102262832 | 253 |
| 749 | 3300025911 | Ga0207654_10222501 | Ga0207654_102225011 | 253 |
| 750 | 3300025914 | Ga0207671_10279548 | Ga0207671_102795482 | 253 |
| 751 | 3300025918 | Ga0207662_10005761 | Ga0207662_100057617 | 253 |
| 752 | 3300025918 | Ga0207662_10337509 | Ga0207662_103375091 | 253 |
| 753 | 3300025921 | Ga0207652_10231851 | Ga0207652_102318512 | 253 |
| 754 | 3300025926 | Ga0207659_10176617 | Ga0207659_101766172 | 253 |
| 755 | 3300025931 | Ga0207644_10003009 | Ga0207644_100030092 | 253 |
| 756 | 3300025931 | Ga0207644_10011976 | Ga0207644_100119763 | 253 |
| 757 | 3300025934 | Ga0207686_10000010 | Ga0207686_1000001078 | 253 |
| 758 | 3300025935 | Ga0207709_10000052 | Ga0207709_1000005278 | 253 |
| 759 | 3300025935 | Ga0207709_10057770 | Ga0207709_100577702 | 253 |
| 760 | 3300025940 | Ga0207691_10000666 | Ga0207691_1000066621 | 253 |
| 761 | 3300025941 | Ga0207711_10010137 | Ga0207711_100101372 | 253 |
| 762 | 3300025942 | Ga0207689_10028027 | Ga0207689_100280273 | 253 |
| 763 | 3300025942 | Ga0207689_10042068 | Ga0207689_100420683 | 253 |
| 764 | 3300025961 | Ga0207712_10241090 | Ga0207712_102410902 | 253 |
| 765 | 3300025961 | Ga0207712_10411799 | Ga0207712_104117992 | 253 |
| 766 | 3300025981 | Ga0207640_10155434 | Ga0207640_101554342 | 253 |
| 767 | 3300026035 | Ga0207703_10090531 | Ga0207703_100905312 | 253 |
| 768 | 3300026035 | Ga0207703_10320865 | Ga0207703_103208652 | 253 |
| 769 | 3300026041 | Ga0207639_10202526 | Ga0207639_102025262 | 253 |
| 770 | 3300026075 | Ga0207708_10000201 | Ga0207708_100002014 | 253 |
| 771 | 3300026075 | Ga0207708_10256994 | Ga0207708_102569943 | 253 |
| 772 | 3300026075 | Ga0207708_10320648 | Ga0207708_103206482 | 253 |
| 773 | 3300026088 | Ga0207641_10092122 | Ga0207641_100921222 | 253 |
| 774 | 3300026088 | Ga0207641_10501538 | Ga0207641_105015382 | 253 |
| 775 | 3300026116 | Ga0207674_10042576 | Ga0207674_100425763 | 253 |
| 776 | 3300026118 | Ga0207675_100000467 | Ga0207675_10000046710 | 253 |
| 777 | 3300026118 | Ga0207675_100019220 | Ga0207675_1000192203 | 253 |
| 778 | 3300026118 | Ga0207675_100250274 | Ga0207675_1002502742 | 253 |
| 779 | 3300026118 | Ga0207675_100367280 | Ga0207675_1003672802 | 253 |
| 780 | 3300027907 | Ga0207428_10000767 | Ga0207428_1000076726 | 253 |
| 781 | 3300027907 | Ga0207428_10007143 | Ga0207428_100071437 | 253 |
| 782 | 3300028381 | Ga0268264_10007459 | Ga0268264_100074595 | 253 |
| 783 | 3300028381 | Ga0268264_10218368 | Ga0268264_102183682 | 253 |
| 784 | 3300031731 | Ga0307405_10056646 | Ga0307405_100566462 | 253 |
| 785 | 3300031824 | Ga0307413_10109766 | Ga0307413_101097662 | 253 |
| 786 | 3300031852 | Ga0307410_10016981 | Ga0307410_100169812 | 253 |
| 787 | 3300031901 | Ga0307406_10082184 | Ga0307406_100821842 | 253 |
| 788 | 3300031903 | Ga0307407_10488522 | Ga0307407_104885221 | 253 |
| 789 | 3300031911 | Ga0307412_10145489 | Ga0307412_101454892 | 253 |
| 790 | 3300031995 | Ga0307409_100110810 | Ga0307409_1001108102 | 253 |
| 791 | 3300032002 | Ga0307416_100037712 | Ga0307416_1000377122 | 253 |
| 792 | 3300032004 | Ga0307414_10022236 | Ga0307414_100222363 | 253 |
| 793 | 3300032126 | Ga0307415_100117942 | Ga0307415_1001179422 | 253 |
| 794 | 3300046537 | Ga0495598_0037142 | Ga0495598_0037142_536_1297 | 253 |
| 795 | 3300048913 | Ga0496110_0168957 | Ga0496110_0168957_464_1228 | 253 |
| 796 | 3300048915 | Ga0496112_0212342 | Ga0496112_0212342_700_1464 | 253 |
| 797 | 3300048916 | Ga0496113_0287631 | Ga0496113_0287631_207_971 | 253 |
| 798 | 3300049515 | Ga0501292_011859 | Ga0501292_011859_249_1010 | 253 |
| 799 | 3300049520 | Ga0501297_011044 | Ga0501297_011044_184_945 | 253 |
| 800 | 3300049521 | Ga0501298_003875 | Ga0501298_003875_633_1394 | 253 |
| 801 | 3300049651 | Ga0501201_003862 | Ga0501201_003862_466_1227 | 253 |
| 802 | 3300049652 | Ga0501202_018631 | Ga0501202_018631_98_859 | 253 |
| 803 | 3300049660 | Ga0501216_013165 | Ga0501216_013165_531_1292 | 253 |
| 804 | 3300049668 | Ga0501233_020966 | Ga0501233_020966_368_1129 | 253 |
| 805 | 3300049688 | Ga0501259_003056 | Ga0501259_003056_1148_1909 | 253 |
| 806 | 3300049705 | Ga0501225_0012870 | Ga0501225_0012870_399_1160 | 253 |
| 807 | 3300049758 | Ga0501241_049675 | Ga0501241_049675_12_773 | 253 |
| 808 | 3300049762 | Ga0501265_009070 | Ga0501265_009070_145_906 | 253 |
| 809 | 3300049775 | Ga0501279_007885 | Ga0501279_007885_41_802 | 253 |
| 810 | 3300050508 | nmdc:mga09592_7180_c1 | nmdc:mga09592_7180_c1_5002_5796 | 253 |
| 811 | 3300050509 | nmdc:mga0qj67_182866_c1 | nmdc:mga0qj67_182866_c1_571_1362 | 253 |
| 812 | 3300050510 | nmdc:mga06r32_237747_c1 | nmdc:mga06r32_237747_c1_27_821 | 253 |
| 813 | 3300050511 | nmdc:mga08y16_11109_c1 | nmdc:mga08y16_11109_c1_2530_3354 | 253 |
| 814 | 3300050512 | nmdc:mga0n895_189892_c1 | nmdc:mga0n895_189892_c1_1119_1883 | 253 |
| 815 | 3300050514 | nmdc:mga08x19_106624_c1 | nmdc:mga08x19_106624_c1_978_1760 | 253 |
| 816 | 3300050514 | nmdc:mga08x19_112742_c1 | nmdc:mga08x19_112742_c1_178_957 | 253 |
| 817 | 3300050515 | nmdc:mga0a205_276151_c1 | nmdc:mga0a205_276151_c1_485_1255 | 253 |
| 818 | 3300002074 | JGI24748J21848_1000001 | JGI24748J21848_1000001227 | 254 |
| 819 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_10000001190 | 254 |
| 820 | 3300005289 | Ga0065704_10150020 | Ga0065704_101500202 | 254 |
| 821 | 3300005330 | Ga0070690_100050501 | Ga0070690_1000505012 | 254 |
| 822 | 3300005343 | Ga0070687_100060050 | Ga0070687_1000600502 | 254 |
| 823 | 3300005353 | Ga0070669_100058546 | Ga0070669_1000585462 | 254 |
| 824 | 3300005355 | Ga0070671_100055850 | Ga0070671_1000558503 | 254 |
| 825 | 3300005440 | Ga0070705_100156621 | Ga0070705_1001566212 | 254 |
| 826 | 3300005441 | Ga0070700_100156833 | Ga0070700_1001568331 | 254 |
| 827 | 3300005518 | Ga0070699_100237326 | Ga0070699_1002373263 | 254 |
| 828 | 3300005536 | Ga0070697_100018631 | Ga0070697_1000186314 | 254 |
| 829 | 3300005536 | Ga0070697_100089016 | Ga0070697_1000890162 | 254 |
| 830 | 3300005544 | Ga0070686_100087615 | Ga0070686_1000876152 | 254 |
| 831 | 3300005544 | Ga0070686_100094373 | Ga0070686_1000943732 | 254 |
| 832 | 3300005545 | Ga0070695_100088508 | Ga0070695_1000885081 | 254 |
| 833 | 3300005546 | Ga0070696_100005110 | Ga0070696_1000051106 | 254 |
| 834 | 3300005546 | Ga0070696_100471192 | Ga0070696_1004711921 | 254 |
| 835 | 3300005546 | Ga0070696_100568590 | Ga0070696_1005685901 | 254 |
| 836 | 3300005842 | Ga0068858_100000044 | Ga0068858_10000004486 | 254 |
| 837 | 3300005985 | Ga0081539_10000652 | Ga0081539_100006525 | 254 |
| 838 | 3300006173 | Ga0070716_100211555 | Ga0070716_1002115552 | 254 |
| 839 | 3300006852 | Ga0075433_10035892 | Ga0075433_100358924 | 254 |
| 840 | 3300006852 | Ga0075433_10286765 | Ga0075433_102867652 | 254 |
| 841 | 3300006871 | Ga0075434_100228789 | Ga0075434_1002287891 | 254 |
| 842 | 3300006914 | Ga0075436_100019380 | Ga0075436_1000193804 | 254 |
| 843 | 3300006931 | Ga0097620_100454623 | Ga0097620_1004546232 | 254 |
| 844 | 3300009098 | Ga0105245_10364776 | Ga0105245_103647762 | 254 |
| 845 | 3300009101 | Ga0105247_10000004 | Ga0105247_10000004229 | 254 |
| 846 | 3300009147 | Ga0114129_10003845 | Ga0114129_100038453 | 254 |
| 847 | 3300009147 | Ga0114129_10073463 | Ga0114129_100734633 | 254 |
| 848 | 3300013297 | Ga0157378_10037174 | Ga0157378_100371743 | 254 |
| 849 | 3300013307 | Ga0157372_10235884 | Ga0157372_102358841 | 254 |
| 850 | 3300014968 | Ga0157379_10080070 | Ga0157379_100800702 | 254 |
| 851 | 3300017792 | Ga0163161_10182506 | Ga0163161_101825062 | 254 |
| 852 | 3300025223 | Ga0207672_1000079 | Ga0207672_10000794 | 254 |
| 853 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002784 | 254 |
| 854 | 3300025910 | Ga0207684_10015129 | Ga0207684_100151295 | 254 |
| 855 | 3300025913 | Ga0207695_10290559 | Ga0207695_102905591 | 254 |
| 856 | 3300025922 | Ga0207646_10065064 | Ga0207646_100650642 | 254 |
| 857 | 3300025931 | Ga0207644_10000961 | Ga0207644_1000096113 | 254 |
| 858 | 3300025934 | Ga0207686_10240884 | Ga0207686_102408842 | 254 |
| 859 | 3300025938 | Ga0207704_10292329 | Ga0207704_102923292 | 254 |
| 860 | 3300025939 | Ga0207665_10317404 | Ga0207665_103174042 | 254 |
| 861 | 3300025960 | Ga0207651_10011455 | Ga0207651_100114554 | 254 |
| 862 | 3300026035 | Ga0207703_10000032 | Ga0207703_1000003268 | 254 |
| 863 | 3300026078 | Ga0207702_10347310 | Ga0207702_103473102 | 254 |
| 864 | 3300026095 | Ga0207676_10200655 | Ga0207676_102006552 | 254 |
| 865 | 3300026118 | Ga0207675_100108812 | Ga0207675_1001088123 | 254 |
| 866 | 3300027671 | Ga0209588_1008957 | Ga0209588_10089572 | 254 |
| 867 | 3300032002 | Ga0307416_100210934 | Ga0307416_1002109342 | 254 |
| 868 | 3300037853 | Ga0436364_0236212 | Ga0436364_0236212_5883_6659 | 254 |
| 869 | 3300046462 | Ga0495651_0000564 | Ga0495651_0000564_368_1144 | 254 |
| 870 | 3300046477 | Ga0495664_0027998 | Ga0495664_0027998_808_1584 | 254 |
| 871 | 3300046559 | Ga0495667_0000245 | Ga0495667_0000245_13692_14468 | 254 |
| 872 | 3300047322 | Ga0495680_0000371 | Ga0495680_0000371_14074_14850 | 254 |
| 873 | 3300047444 | Ga0495675_0036155 | Ga0495675_0036155_1212_1988 | 254 |
| 874 | 3300050507 | nmdc:mga05p37_214881_c1 | nmdc:mga05p37_214881_c1_1394_2158 | 254 |
| 875 | 3300050507 | nmdc:mga05p37_332480_c1 | nmdc:mga05p37_332480_c1_776_1540 | 254 |
| 876 | 3300050513 | nmdc:mga0rr50_44203_c1 | nmdc:mga0rr50_44203_c1_793_1557 | 254 |
| 877 | 3300050514 | nmdc:mga08x19_1730_c1 | nmdc:mga08x19_1730_c1_1843_2628 | 254 |
| 878 | 3300050515 | nmdc:mga0a205_62173_c1 | nmdc:mga0a205_62173_c1_563_1396 | 254 |
| 879 | 3300053153 | Ga0500616_0002625 | Ga0500616_0002625_6239_7003 | 254 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hl3-assembly1.cif.gz_A | 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose. | 0.9617 | 2 | 236 |
| 1mc3-assembly1.cif.gz_A | crystal structure of rffh | 0.948 | 1 | 235 |
| 1mp3-assembly1.cif.gz_A | l89t variant of s. enterica rmla | 0.946 | 2 | 235 |
| 1iim-assembly1.cif.gz_A | thymidylyltransferase complexed with ttp | 0.9451 | 2 | 235 |
| 1mp5-assembly1.cif.gz_D | y177f variant of s. enterica rmla | 0.9441 | 2 | 235 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9484 | 1 | 220 | 3.90.550.10 |
| 4ecmA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.948 | 2 | 249 | 3.90.550.10 |
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9353 | 1 | 220 | 3.90.550.10 |
| 4b2xA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9302 | 2 | 235 | 3.90.550.10 |
| 4ecmA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9251 | 2 | 249 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P5WH85-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9941 | 14 | 241 |
GO:0008879
GO:0045226 |
| AF-A0A2V9BEQ1-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9928 | 1 | 129 |
GO:0008879
GO:0045226 |
| AF-A0A7C5UBV5-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9916 | 1 | 244 |
GO:0008879
GO:0045226 |
| AF-A0A2V9BQR4-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9915 | 1 | 237 |
GO:0008879
GO:0045226 |
| AF-A0A1V5J3E3-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9914 | 94 | 241 |
GO:0008879
GO:0045226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar