F484467

General Info

Members Datasets Scaffolds Average Seq Length
879 319 879 248

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0032001|Ga0451577_0032001_2194_2934
Length 246
Sequence MNLKGVVLAGGMGTRLSPLTRVTNKHLLPIYDEPMVYYPIRSLVEAGVRDIMVVSGGESAGHFLKLLGNGEDFGLEHLEYGYQKGAGGIAEALGLTRYFIGNDPVVVILGDNILEKPIAGAVDRFRRQGGGARVLLKKVPDPGRFGVAEVDGAGKVLSIEEKPRQPKSDLAVIGVYMYDNDVFRIIDGLQRSARGELEITDVNNAYRNLGKLHAEVIDGWWTDAGTFESLFHASSLVRDLKRSRKG

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
173 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
212 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
252 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
253 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
254 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
272 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
273 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
274 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
275 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
276 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
277 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
278 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
279 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
280 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
281 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
282 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
283 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
284 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
285 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
286 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
287 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
288 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
289 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
290 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
295 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
296 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
297 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
298 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
303 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 1.37
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000001 3300002074 Bacteria 444271
2 JGI24034J26672_10000001 3300002239 Bacteria 1118280
3 JGI25406J46586_10005418 3300003203 Bacteria 5921
4 JGI25406J46586_10016199 3300003203 Unclassified 3114
5 Ga0065714_10064445 3300005288 Bacteria 90891
6 Ga0065704_10001951 3300005289 Bacteria 11456
7 Ga0065704_10007121 3300005289 Bacteria 3146
8 Ga0065704_10150020 3300005289 Unclassified 1437
9 Ga0065704_10240525 3300005289 Bacteria 1016
10 Ga0065712_10000114 3300005290 Bacteria 191810
11 Ga0065712_10002363 3300005290 Bacteria 6297
12 Ga0065712_10068601 3300005290 Bacteria 9684
13 Ga0065712_10083656 3300005290 Bacteria 2820
14 Ga0065712_10096352 3300005290 Bacteria 2181
15 Ga0065712_10149654 3300005290 Bacteria 1379
16 Ga0065715_10001707 3300005293 Bacteria 9858
17 Ga0065715_10005851 3300005293 Bacteria 6117
18 Ga0065715_10023552 3300005293 Bacteria 2088
19 Ga0065715_10109661 3300005293 Bacteria 2658
20 Ga0065715_10217063 3300005293 Unclassified 1288
21 Ga0065707_10001745 3300005295 Bacteria 10122
22 Ga0065707_10002540 3300005295 Unclassified 4465
23 Ga0065707_10095984 3300005295 Unclassified 3316
24 Ga0070683_100330323 3300005329 Unclassified 1452
25 Ga0070690_100003652 3300005330 Bacteria 8470
26 Ga0070690_100019914 3300005330 Bacteria 4082
27 Ga0070690_100022292 3300005330 Bacteria 3873
28 Ga0070690_100050501 3300005330 Bacteria 2654
29 Ga0070677_10056251 3300005333 Bacteria 1608
30 Ga0068869_100031699 3300005334 Bacteria 3719
31 Ga0068869_100086868 3300005334 Bacteria 2345
32 Ga0068869_100123941 3300005334 Bacteria 1979
33 Ga0070666_10146995 3300005335 Bacteria 1643
34 Ga0070680_100212745 3300005336 Bacteria 1631
35 Ga0070682_100068715 3300005337 Unclassified 2261
36 Ga0070682_100589518 3300005337 Bacteria 876
37 Ga0068868_100017053 3300005338 Bacteria 5404
38 Ga0068868_100329023 3300005338 Bacteria 1304
39 Ga0070689_100009432 3300005340 Bacteria 6919
40 Ga0070689_100027225 3300005340 Bacteria 4309
41 Ga0070687_100010363 3300005343 Bacteria 4029
42 Ga0070687_100024212 3300005343 Unclassified 2895
43 Ga0070687_100060050 3300005343 Bacteria 2004
44 Ga0070661_100271867 3300005344 Bacteria 1313
45 Ga0070661_100348728 3300005344 Unclassified 1161
46 Ga0070692_10023252 3300005345 Bacteria 3035
47 Ga0070692_10304276 3300005345 Bacteria 974
48 Ga0070668_100488770 3300005347 Bacteria 1064
49 Ga0070668_100572633 3300005347 Bacteria 985
50 Ga0070669_100027093 3300005353 Unclassified 4125
51 Ga0070669_100058546 3300005353 Unclassified 2828
52 Ga0070669_100101798 3300005353 Bacteria 2168
53 Ga0070669_100117100 3300005353 Bacteria 2028
54 Ga0070669_100275584 3300005353 Bacteria 1346
55 Ga0070669_100300504 3300005353 Bacteria 1291
56 Ga0070675_100353457 3300005354 Bacteria 1303
57 Ga0070671_100003741 3300005355 Bacteria 11943
58 Ga0070671_100004147 3300005355 Bacteria 11444
59 Ga0070671_100017451 3300005355 Bacteria 5814
60 Ga0070671_100055850 3300005355 Bacteria 3285
61 Ga0070671_100074615 3300005355 Unclassified 2834
62 Ga0070673_100000494 3300005364 Bacteria 21008
63 Ga0070673_100027151 3300005364 Bacteria 4240
64 Ga0070673_100284413 3300005364 Bacteria 1451
65 Ga0070673_100313635 3300005364 Bacteria 1384
66 Ga0070673_100318856 3300005364 Bacteria 1372
67 Ga0070688_100170509 3300005365 Bacteria 1501
68 Ga0070688_100270045 3300005365 Bacteria 1218
69 Ga0070688_100441915 3300005365 Unclassified 971
70 Ga0070667_100144584 3300005367 Unclassified 2085
71 Ga0070667_100542033 3300005367 Bacteria 1069
72 Ga0070703_10000169 3300005406 Bacteria 32165
73 Ga0070703_10001965 3300005406 Bacteria 6016
74 Ga0070703_10021364 3300005406 Bacteria 1891
75 Ga0070703_10043098 3300005406 Bacteria 1414
76 Ga0070709_10000145 3300005434 Bacteria 47402
77 Ga0070709_10050176 3300005434 Bacteria 2613
78 Ga0070714_100008928 3300005435 Bacteria 7843
79 Ga0070701_10029425 3300005438 Bacteria 2709
80 Ga0070701_10121120 3300005438 Bacteria 1474
81 Ga0070701_10131294 3300005438 Unclassified 1423
82 Ga0070701_10138704 3300005438 Bacteria 1388
83 Ga0070701_10157239 3300005438 Bacteria 1314
84 Ga0070701_10313976 3300005438 Bacteria 968
85 Ga0070705_100004461 3300005440 Bacteria 6816
86 Ga0070705_100018954 3300005440 Bacteria 3614
87 Ga0070705_100156621 3300005440 Bacteria 1518
88 Ga0070700_100000122 3300005441 Bacteria 47908
89 Ga0070700_100004436 3300005441 Bacteria 7333
90 Ga0070700_100013304 3300005441 Bacteria 4621
91 Ga0070700_100156833 3300005441 Bacteria 1563
92 Ga0070700_100361794 3300005441 Bacteria 1079
93 Ga0070700_100379352 3300005441 Bacteria 1057
94 Ga0070694_100000497 3300005444 Bacteria 21582
95 Ga0070694_100002515 3300005444 Bacteria 10828
96 Ga0070694_100010103 3300005444 Bacteria 5807
97 Ga0070694_100012009 3300005444 Bacteria 5376
98 Ga0070694_100025490 3300005444 Bacteria 3826
99 Ga0070694_100058320 3300005444 Bacteria 2626
100 Ga0070694_100124946 3300005444 Bacteria 1851
101 Ga0070694_100136256 3300005444 Bacteria 1779
102 Ga0070694_100283957 3300005444 Bacteria 1263
103 Ga0070694_100442347 3300005444 Bacteria 1025
104 Ga0070708_100009886 3300005445 Bacteria 7708
105 Ga0070708_100042703 3300005445 Bacteria 3982
106 Ga0070708_100063815 3300005445 Bacteria 3298
107 Ga0070678_100000362 3300005456 Bacteria 21123
108 Ga0070678_100033270 3300005456 Bacteria 3577
109 Ga0070678_100146352 3300005456 Unclassified 1897
110 Ga0070662_100145255 3300005457 Bacteria 1842
111 Ga0070662_100247555 3300005457 Unclassified 1432
112 Ga0070662_100467317 3300005457 Unclassified 1049
113 Ga0070681_10125016 3300005458 Bacteria 2505
114 Ga0070681_10440486 3300005458 Bacteria 1215
115 Ga0070681_10472221 3300005458 Bacteria 1167
116 Ga0068867_100032731 3300005459 Bacteria 3762
117 Ga0068867_100125133 3300005459 Bacteria 1991
118 Ga0068867_100533769 3300005459 Bacteria 1014
119 Ga0068867_100652796 3300005459 Bacteria 923
120 Ga0070706_100008713 3300005467 Bacteria 9454
121 Ga0070706_100008898 3300005467 Bacteria 9350
122 Ga0070706_100009122 3300005467 Bacteria 9238
123 Ga0070706_100063507 3300005467 Bacteria 3413
124 Ga0070706_100088496 3300005467 Bacteria 2871
125 Ga0070706_100112848 3300005467 Bacteria 2531
126 Ga0070706_100509789 3300005467 Bacteria 1119
127 Ga0070707_100000020 3300005468 Bacteria 130967
128 Ga0070707_100000456 3300005468 Bacteria 40527
129 Ga0070707_100000556 3300005468 Bacteria 37476
130 Ga0070707_100007732 3300005468 Bacteria 9987
131 Ga0070707_100709309 3300005468 Bacteria 969
132 Ga0070698_100019542 3300005471 Bacteria 7111
133 Ga0070698_100045461 3300005471 Bacteria 4494
134 Ga0070698_100055975 3300005471 Bacteria 3997
135 Ga0070698_100065817 3300005471 Bacteria 3649
136 Ga0070698_100154735 3300005471 Bacteria 2238
137 Ga0070698_100423685 3300005471 Bacteria 1266
138 Ga0070699_100005039 3300005518 Bacteria 11627
139 Ga0070699_100005655 3300005518 Bacteria 10946
140 Ga0070699_100005760 3300005518 Bacteria 10840
141 Ga0070699_100032091 3300005518 Bacteria 4536
142 Ga0070699_100155740 3300005518 Bacteria 2022
143 Ga0070699_100237326 3300005518 Bacteria 1626
144 Ga0070699_100473722 3300005518 Bacteria 1136
145 Ga0070679_100031421 3300005530 Bacteria 5245
146 Ga0070679_100126043 3300005530 Bacteria 2543
147 Ga0070679_100174323 3300005530 Bacteria 2123
148 Ga0070679_100503685 3300005530 Bacteria 1155
149 Ga0070684_100603427 3300005535 Unclassified 1021
150 Ga0070697_100001443 3300005536 Bacteria 18068
151 Ga0070697_100012754 3300005536 Bacteria 6582
152 Ga0070697_100018631 3300005536 Bacteria 5475
153 Ga0070697_100075678 3300005536 Bacteria 2768
154 Ga0070697_100076477 3300005536 Bacteria 2753
155 Ga0070697_100089016 3300005536 Bacteria 2550
156 Ga0070697_100117501 3300005536 Bacteria 2222
157 Ga0068853_100116933 3300005539 Bacteria 2375
158 Ga0068853_100378625 3300005539 Bacteria 1321
159 Ga0070672_100055206 3300005543 Bacteria 3111
160 Ga0070672_100170098 3300005543 Bacteria 1812
161 Ga0070672_100565713 3300005543 Bacteria 988
162 Ga0070686_100087615 3300005544 Bacteria 2076
163 Ga0070686_100094373 3300005544 Bacteria 2008
164 Ga0070695_100001424 3300005545 Bacteria 13255
165 Ga0070695_100088508 3300005545 Bacteria 2062
166 Ga0070695_100134565 3300005545 Bacteria 1707
167 Ga0070695_100247436 3300005545 Unclassified 1296
168 Ga0070695_100361806 3300005545 Bacteria 1090
169 Ga0070695_100559032 3300005545 Unclassified 893
170 Ga0070696_100002349 3300005546 Bacteria 12491
171 Ga0070696_100005110 3300005546 Bacteria 8768
172 Ga0070696_100006993 3300005546 Bacteria 7529
173 Ga0070696_100012215 3300005546 Bacteria 5755
174 Ga0070696_100048890 3300005546 Bacteria 2936
175 Ga0070696_100292687 3300005546 Bacteria 1244
176 Ga0070696_100471192 3300005546 Bacteria 994
177 Ga0070696_100568590 3300005546 Bacteria 910
178 Ga0070693_100000120 3300005547 Bacteria 35065
179 Ga0070693_100002084 3300005547 Bacteria 9151
180 Ga0070693_100057601 3300005547 Bacteria 2247
181 Ga0070693_100076437 3300005547 Bacteria 1985
182 Ga0070665_100000060 3300005548 Bacteria 222524
183 Ga0070665_100104625 3300005548 Bacteria 2833
184 Ga0070665_100428194 3300005548 Bacteria 1332
185 Ga0070704_100001083 3300005549 Bacteria 14113
186 Ga0070704_100021552 3300005549 Unclassified 4181
187 Ga0070704_100078227 3300005549 Bacteria 2426
188 Ga0070704_100107395 3300005549 Unclassified 2117
189 Ga0070664_100007758 3300005564 Bacteria 8664
190 Ga0070664_100322538 3300005564 Unclassified 1400
191 Ga0070664_100435051 3300005564 Bacteria 1203
192 Ga0068857_100113314 3300005577 Bacteria 2438
193 Ga0068857_100206718 3300005577 Bacteria 1791
194 Ga0068854_100029189 3300005578 Bacteria 3817
195 Ga0068854_100076161 3300005578 Bacteria 2465
196 Ga0070702_100021283 3300005615 Bacteria 3410
197 Ga0070702_100068106 3300005615 Bacteria 2094
198 Ga0070702_100097684 3300005615 Bacteria 1795
199 Ga0068852_100073151 3300005616 Unclassified 3015
200 Ga0068852_100143959 3300005616 Bacteria 2209
201 Ga0068859_100022372 3300005617 Bacteria 6338
202 Ga0068859_100028814 3300005617 Bacteria 5568
203 Ga0068859_100049326 3300005617 Bacteria 4228
204 Ga0068859_100087485 3300005617 Unclassified 3164
205 Ga0068859_100098812 3300005617 Bacteria 2973
206 Ga0068859_100109287 3300005617 Bacteria 2826
207 Ga0068859_100111141 3300005617 Bacteria 2802
208 Ga0068859_100200012 3300005617 Bacteria 2083
209 Ga0068859_100261377 3300005617 Bacteria 1822
210 Ga0068859_100286436 3300005617 Unclassified 1740
211 Ga0068859_100349749 3300005617 Bacteria 1573
212 Ga0068859_100837585 3300005617 Unclassified 1006
213 Ga0068864_100007174 3300005618 Bacteria 9152
214 Ga0068864_100010461 3300005618 Bacteria 7666
215 Ga0068864_100075146 3300005618 Bacteria 2950
216 Ga0068864_100129471 3300005618 Bacteria 2265
217 Ga0068864_100530300 3300005618 Bacteria 1136
218 Ga0068864_100852721 3300005618 Bacteria 898
219 Ga0068866_10018871 3300005718 Bacteria 3128
220 Ga0068866_10152582 3300005718 Unclassified 1339
221 Ga0068861_100016775 3300005719 Bacteria 5189
222 Ga0068861_100187626 3300005719 Bacteria 1726
223 Ga0068851_10047508 3300005834 Bacteria 2174
224 Ga0068851_10112492 3300005834 Bacteria 1455
225 Ga0068870_10022762 3300005840 Bacteria 3082
226 Ga0068863_100072812 3300005841 Bacteria 3251
227 Ga0068863_100081003 3300005841 Bacteria 3075
228 Ga0068863_100165629 3300005841 Bacteria 2119
229 Ga0068863_100219577 3300005841 Bacteria 1831
230 Ga0068863_100262665 3300005841 Bacteria 1669
231 Ga0068863_100478601 3300005841 Bacteria 1224
232 Ga0068858_100000044 3300005842 Bacteria 128977
233 Ga0068858_100327659 3300005842 Bacteria 1464
234 Ga0068858_100399432 3300005842 Bacteria 1320
235 Ga0068858_100407305 3300005842 Unclassified 1307
236 Ga0068858_100408252 3300005842 Bacteria 1305
237 Ga0068860_100002648 3300005843 Bacteria 18629
238 Ga0068860_100006967 3300005843 Bacteria 11331
239 Ga0068860_100007291 3300005843 Bacteria 11059
240 Ga0068860_100046420 3300005843 Bacteria 4141
241 Ga0068860_100184222 3300005843 Unclassified 2019
242 Ga0068860_100453840 3300005843 Bacteria 1275
243 Ga0068862_100008996 3300005844 Bacteria 8266
244 Ga0068862_100016042 3300005844 Bacteria 6230
245 Ga0068862_100068954 3300005844 Bacteria 3051
246 Ga0068862_100143069 3300005844 Bacteria 2124
247 Ga0068862_100793972 3300005844 Unclassified 924
248 Ga0081455_10009173 3300005937 Bacteria 10196
249 Ga0081539_10000428 3300005985 Bacteria 89485
250 Ga0081539_10000652 3300005985 Bacteria 69804
251 Ga0081539_10000654 3300005985 Bacteria 69664
252 Ga0081539_10001420 3300005985 Bacteria 41183
253 Ga0081539_10109872 3300005985 Bacteria 1390
254 Ga0070716_100061008 3300006173 Bacteria 2181
255 Ga0070716_100130284 3300006173 Bacteria 1589
256 Ga0070716_100211555 3300006173 Bacteria 1296
257 Ga0097621_100168148 3300006237 Bacteria 1888
258 Ga0097621_100179541 3300006237 Bacteria 1829
259 Ga0068871_100011376 3300006358 Bacteria 6525
260 Ga0075428_100016191 3300006844 Bacteria 8242
261 Ga0075428_100034515 3300006844 Bacteria 5579
262 Ga0075428_100039862 3300006844 Bacteria 5170
263 Ga0075428_100040929 3300006844 Bacteria 5096
264 Ga0075428_100097092 3300006844 Bacteria 3212
265 Ga0075428_100102473 3300006844 Bacteria 3121
266 Ga0075428_100115401 3300006844 Bacteria 2925
267 Ga0075428_100264774 3300006844 Bacteria 1850
268 Ga0075428_100684829 3300006844 Unclassified 1092
269 Ga0075428_100768847 3300006844 Bacteria 1024
270 Ga0075430_100053938 3300006846 Bacteria 3383
271 Ga0075430_100054026 3300006846 Bacteria 3380
272 Ga0075430_100136164 3300006846 Bacteria 2046
273 Ga0075431_100015521 3300006847 Bacteria 7719
274 Ga0075431_100113184 3300006847 Bacteria 2801
275 Ga0075431_100195358 3300006847 Unclassified 2072
276 Ga0075431_100230617 3300006847 Bacteria 1887
277 Ga0075433_10019208 3300006852 Bacteria 5689
278 Ga0075433_10035192 3300006852 Bacteria 4305
279 Ga0075433_10035892 3300006852 Bacteria 4267
280 Ga0075433_10081560 3300006852 Unclassified 2852
281 Ga0075433_10090867 3300006852 Bacteria 2699
282 Ga0075433_10250231 3300006852 Bacteria 1572
283 Ga0075433_10286765 3300006852 Bacteria 1458
284 Ga0075433_10525299 3300006852 Bacteria 1041
285 Ga0075434_100029949 3300006871 Bacteria 5358
286 Ga0075434_100105034 3300006871 Bacteria 2835
287 Ga0075434_100215076 3300006871 Bacteria 1942
288 Ga0075434_100228789 3300006871 Bacteria 1879
289 Ga0075434_100404689 3300006871 Bacteria 1386
290 Ga0075434_100750045 3300006871 Bacteria 993
291 Ga0075434_101032209 3300006871 Bacteria 836
292 Ga0075429_100003364 3300006880 Bacteria 13629
293 Ga0075429_100015685 3300006880 Bacteria 6565
294 Ga0075429_100067799 3300006880 Bacteria 3106
295 Ga0075429_100171091 3300006880 Unclassified 1903
296 Ga0075429_100265678 3300006880 Bacteria 1502
297 Ga0068865_100532640 3300006881 Bacteria 984
298 Ga0075436_100017099 3300006914 Bacteria 4964
299 Ga0075436_100019380 3300006914 Bacteria 4662
300 Ga0075436_100143438 3300006914 Unclassified 1679
301 Ga0075436_100216534 3300006914 Bacteria 1358
302 Ga0097620_100022371 3300006931 Bacteria 6338
303 Ga0097620_100028817 3300006931 Bacteria 5568
304 Ga0097620_100049325 3300006931 Bacteria 4228
305 Ga0097620_100087487 3300006931 Unclassified 3164
306 Ga0097620_100098818 3300006931 Bacteria 2973
307 Ga0097620_100109290 3300006931 Bacteria 2826
308 Ga0097620_100111153 3300006931 Bacteria 2802
309 Ga0097620_100200015 3300006931 Bacteria 2083
310 Ga0097620_100261379 3300006931 Bacteria 1822
311 Ga0097620_100286443 3300006931 Unclassified 1740
312 Ga0097620_100349708 3300006931 Bacteria 1573
313 Ga0097620_100454623 3300006931 Bacteria 1377
314 Ga0097620_100837677 3300006931 Unclassified 1006
315 Ga0075435_100050247 3300007076 Bacteria 3355
316 Ga0099794_10069046 3300007265 Bacteria 1729
317 Ga0105240_10568392 3300009093 Bacteria 1252
318 Ga0111539_10005372 3300009094 Bacteria 16565
319 Ga0111539_10009392 3300009094 Bacteria 12346
320 Ga0111539_10017738 3300009094 Bacteria 8813
321 Ga0111539_10031255 3300009094 Bacteria 6469
322 Ga0111539_10054426 3300009094 Bacteria 4761
323 Ga0111539_10194061 3300009094 Bacteria 2369
324 Ga0111539_10223318 3300009094 Bacteria 2194
325 Ga0105245_10364776 3300009098 Bacteria 1434
326 Ga0105247_10000004 3300009101 Bacteria 455497
327 Ga0105247_10000951 3300009101 Bacteria 21864
328 Ga0105247_10039404 3300009101 Bacteria 2887
329 Ga0105247_10058770 3300009101 Bacteria 2379
330 Ga0114129_10000340 3300009147 Bacteria 54409
331 Ga0114129_10003845 3300009147 Bacteria 21167
332 Ga0114129_10006667 3300009147 Bacteria 16398
333 Ga0114129_10021260 3300009147 Bacteria 9213
334 Ga0114129_10027759 3300009147 Bacteria 8014
335 Ga0114129_10073463 3300009147 Bacteria 4765
336 Ga0114129_10085764 3300009147 Bacteria 4368
337 Ga0114129_10122452 3300009147 Bacteria 3579
338 Ga0114129_10147692 3300009147 Bacteria 3219
339 Ga0114129_10173571 3300009147 Unclassified 2937
340 Ga0114129_10221713 3300009147 Bacteria 2550
341 Ga0114129_10234049 3300009147 Bacteria 2473
342 Ga0114129_10237940 3300009147 Bacteria 2449
343 Ga0114129_10314479 3300009147 Unclassified 2084
344 Ga0114129_10391021 3300009147 Bacteria 1834
345 Ga0114129_10399201 3300009147 Bacteria 1812
346 Ga0114129_10774507 3300009147 Unclassified 1226
347 Ga0114129_11158916 3300009147 Bacteria 965
348 Ga0105243_10000029 3300009148 Bacteria 190577
349 Ga0105243_10138308 3300009148 Bacteria 2075
350 Ga0105243_10219003 3300009148 Unclassified 1681
351 Ga0105243_10341298 3300009148 Unclassified 1372
352 Ga0105241_10117684 3300009174 Bacteria 2136
353 Ga0105241_10448197 3300009174 Bacteria 1141
354 Ga0105242_10000009 3300009176 Bacteria 162286
355 Ga0105242_10148012 3300009176 Bacteria 2045
356 Ga0105242_10397950 3300009176 Bacteria 1285
357 Ga0105248_10002691 3300009177 Bacteria 19736
358 Ga0105248_10012314 3300009177 Bacteria 9433
359 Ga0105248_10033498 3300009177 Bacteria 5739
360 Ga0105248_10121188 3300009177 Bacteria 2950
361 Ga0105248_10555829 3300009177 Bacteria 1295
362 Ga0105248_11447854 3300009177 Bacteria 777
363 Ga0105237_10024354 3300009545 Bacteria 6193
364 Ga0105238_10001850 3300009551 Bacteria 21213
365 Ga0105249_10042577 3300009553 Bacteria 4131
366 Ga0105249_10372351 3300009553 Bacteria 1452
367 Ga0105249_10394013 3300009553 Bacteria 1414
368 Ga0105239_10021391 3300010375 Bacteria 7132
369 Ga0105239_10402291 3300010375 Bacteria 1549
370 Ga0105246_10313261 3300011119 Bacteria 1272
371 Ga0157373_10219458 3300013100 Bacteria 1341
372 Ga0157369_10073275 3300013105 Bacteria 3674
373 Ga0157374_10006823 3300013296 Bacteria 9712
374 Ga0157374_10007893 3300013296 Bacteria 9085
375 Ga0157374_10201650 3300013296 Bacteria 1948
376 Ga0157378_10002420 3300013297 Bacteria 16596
377 Ga0157378_10005237 3300013297 Bacteria 11388
378 Ga0157378_10037174 3300013297 Bacteria 4311
379 Ga0157378_10045898 3300013297 Bacteria 3884
380 Ga0157378_10088325 3300013297 Bacteria 2813
381 Ga0157378_10202258 3300013297 Bacteria 1879
382 Ga0163162_10000217 3300013306 Bacteria 52537
383 Ga0163162_10009762 3300013306 Bacteria 9344
384 Ga0163162_10030482 3300013306 Bacteria 5344
385 Ga0163162_10100308 3300013306 Unclassified 2986
386 Ga0163162_10194076 3300013306 Bacteria 2159
387 Ga0163162_10308950 3300013306 Bacteria 1713
388 Ga0157372_10006128 3300013307 Bacteria 12780
389 Ga0157372_10235884 3300013307 Bacteria 2122
390 Ga0157372_10445694 3300013307 Bacteria 1509
391 Ga0157372_10693862 3300013307 Unclassified 1185
392 Ga0157375_10024889 3300013308 Bacteria 5549
393 Ga0157375_10030714 3300013308 Bacteria 5070
394 Ga0157375_10030926 3300013308 Bacteria 5053
395 Ga0157375_10052578 3300013308 Bacteria 4005
396 Ga0157375_10105442 3300013308 Bacteria 2909
397 Ga0157375_10252937 3300013308 Bacteria 1923
398 Ga0157375_10414957 3300013308 Bacteria 1512
399 Ga0157375_10435580 3300013308 Bacteria 1477
400 Ga0157375_10959226 3300013308 Bacteria 996
401 Ga0163163_10011974 3300014325 Bacteria 7893
402 Ga0163163_10052684 3300014325 Bacteria 4015
403 Ga0163163_10058380 3300014325 Bacteria 3815
404 Ga0163163_10092602 3300014325 Bacteria 3038
405 Ga0157380_10000079 3300014326 Bacteria 53933
406 Ga0157380_10006509 3300014326 Bacteria 8236
407 Ga0157380_10513312 3300014326 Bacteria 1167
408 Ga0157380_10674419 3300014326 Unclassified 1035
409 Ga0157379_10000101 3300014968 Bacteria 58702
410 Ga0157379_10080070 3300014968 Bacteria 2926
411 Ga0157379_10500422 3300014968 Bacteria 1126
412 Ga0157376_10023461 3300014969 Bacteria 4828
413 Ga0157376_10054933 3300014969 Bacteria 3322
414 Ga0157376_10087295 3300014969 Bacteria 2692
415 Ga0157376_10143025 3300014969 Bacteria 2148
416 Ga0157376_10764336 3300014969 Bacteria 976
417 Ga0157376_10982947 3300014969 Bacteria 866
418 Ga0163161_10182506 3300017792 Bacteria 1610
419 Ga0163161_10235858 3300017792 Unclassified 1421
420 Ga0213876_10000006 3300021384 Bacteria 700803
421 Ga0213876_10025569 3300021384 Bacteria 3114
422 Ga0213875_10031147 3300021388 Bacteria 2524
423 Ga0213875_10036253 3300021388 Bacteria 2326
424 Ga0207672_1000079 3300025223 Bacteria 13006
425 Ga0207697_10054007 3300025315 Bacteria 1664
426 Ga0207656_10052562 3300025321 Bacteria 1765
427 Ga0207656_10099798 3300025321 Bacteria 1329
428 Ga0207653_10000117 3300025885 Bacteria 55842
429 Ga0207653_10001139 3300025885 Bacteria 8702
430 Ga0207653_10035550 3300025885 Bacteria 1621
431 Ga0207653_10035990 3300025885 Bacteria 1612
432 Ga0207642_10185131 3300025899 Bacteria 1138
433 Ga0207710_10000002 3300025900 Bacteria 1251998
434 Ga0207710_10001685 3300025900 Bacteria 10735
435 Ga0207710_10004144 3300025900 Bacteria 6364
436 Ga0207710_10204565 3300025900 Bacteria 976
437 Ga0207680_10072611 3300025903 Bacteria 2137
438 Ga0207680_10150126 3300025903 Bacteria 1553
439 Ga0207647_10261654 3300025904 Bacteria 991
440 Ga0207699_10000031 3300025906 Bacteria 137708
441 Ga0207699_10239448 3300025906 Bacteria 1246
442 Ga0207645_10095202 3300025907 Bacteria 1917
443 Ga0207645_10118821 3300025907 Bacteria 1715
444 Ga0207643_10001907 3300025908 Bacteria 11502
445 Ga0207643_10083367 3300025908 Bacteria 1855
446 Ga0207684_10000030 3300025910 Bacteria 300037
447 Ga0207684_10000220 3300025910 Bacteria 88359
448 Ga0207684_10001056 3300025910 Bacteria 30828
449 Ga0207684_10008349 3300025910 Bacteria 9211
450 Ga0207684_10015129 3300025910 Bacteria 6643
451 Ga0207684_10096684 3300025910 Bacteria 2521
452 Ga0207684_10172291 3300025910 Bacteria 1865
453 Ga0207684_10226283 3300025910 Bacteria 1614
454 Ga0207684_10271355 3300025910 Bacteria 1464
455 Ga0207684_10512521 3300025910 Bacteria 1028
456 Ga0207654_10222501 3300025911 Bacteria 1253
457 Ga0207707_10077234 3300025912 Bacteria 2907
458 Ga0207707_10325683 3300025912 Bacteria 1326
459 Ga0207707_10404333 3300025912 Bacteria 1172
460 Ga0207695_10290559 3300025913 Bacteria 1527
461 Ga0207695_10312626 3300025913 Bacteria 1461
462 Ga0207671_10001345 3300025914 Bacteria 28739
463 Ga0207671_10180929 3300025914 Bacteria 1641
464 Ga0207671_10279548 3300025914 Bacteria 1316
465 Ga0207663_10406271 3300025916 Bacteria 1042
466 Ga0207660_10145220 3300025917 Bacteria 1818
467 Ga0207660_10604422 3300025917 Unclassified 893
468 Ga0207662_10005761 3300025918 Bacteria 6631
469 Ga0207662_10145966 3300025918 Bacteria 1502
470 Ga0207662_10337509 3300025918 Bacteria 1009
471 Ga0207652_10057983 3300025921 Bacteria 3336
472 Ga0207652_10231851 3300025921 Bacteria 1664
473 Ga0207652_10350387 3300025921 Bacteria 1332
474 Ga0207646_10000008 3300025922 Bacteria 457143
475 Ga0207646_10000009 3300025922 Bacteria 453146
476 Ga0207646_10000078 3300025922 Bacteria 133416
477 Ga0207646_10000338 3300025922 Bacteria 63455
478 Ga0207646_10000480 3300025922 Bacteria 53452
479 Ga0207646_10065064 3300025922 Bacteria 3254
480 Ga0207681_10176863 3300025923 Bacteria 1622
481 Ga0207681_10291375 3300025923 Unclassified 1288
482 Ga0207694_10009360 3300025924 Bacteria 7389
483 Ga0207650_10000001 3300025925 Bacteria 1545726
484 Ga0207650_10009116 3300025925 Bacteria 6780
485 Ga0207650_10029390 3300025925 Bacteria 3951
486 Ga0207650_10126272 3300025925 Bacteria 1997
487 Ga0207659_10176617 3300025926 Bacteria 1688
488 Ga0207644_10000961 3300025931 Bacteria 18372
489 Ga0207644_10003009 3300025931 Bacteria 10844
490 Ga0207644_10003149 3300025931 Bacteria 10625
491 Ga0207644_10011976 3300025931 Bacteria 5751
492 Ga0207644_10086041 3300025931 Bacteria 2333
493 Ga0207706_10330319 3300025933 Unclassified 1327
494 Ga0207686_10000010 3300025934 Bacteria 227471
495 Ga0207686_10240884 3300025934 Bacteria 1316
496 Ga0207709_10000052 3300025935 Bacteria 227471
497 Ga0207709_10057770 3300025935 Bacteria 2408
498 Ga0207709_10576352 3300025935 Bacteria 888
499 Ga0207670_10241598 3300025936 Bacteria 1391
500 Ga0207670_10299364 3300025936 Bacteria 1259
501 Ga0207704_10029521 3300025938 Bacteria 3060
502 Ga0207704_10292329 3300025938 Bacteria 1244
503 Ga0207704_10709599 3300025938 Bacteria 833
504 Ga0207665_10134195 3300025939 Bacteria 1760
505 Ga0207665_10155425 3300025939 Bacteria 1641
506 Ga0207665_10183027 3300025939 Unclassified 1518
507 Ga0207665_10317404 3300025939 Bacteria 1168
508 Ga0207691_10000150 3300025940 Bacteria 64536
509 Ga0207691_10000666 3300025940 Bacteria 33938
510 Ga0207691_10076975 3300025940 Bacteria 3006
511 Ga0207711_10008812 3300025941 Bacteria 8434
512 Ga0207711_10010137 3300025941 Bacteria 7826
513 Ga0207689_10028027 3300025942 Bacteria 4712
514 Ga0207689_10042068 3300025942 Bacteria 3782
515 Ga0207689_10061273 3300025942 Bacteria 3094
516 Ga0207689_10117270 3300025942 Bacteria 2189
517 Ga0207689_10267573 3300025942 Bacteria 1415
518 Ga0207661_10447589 3300025944 Bacteria 1176
519 Ga0207679_10009282 3300025945 Bacteria 6293
520 Ga0207651_10000592 3300025960 Bacteria 15262
521 Ga0207651_10011455 3300025960 Bacteria 4967
522 Ga0207651_10183114 3300025960 Bacteria 1664
523 Ga0207651_10233761 3300025960 Bacteria 1494
524 Ga0207712_10000584 3300025961 Bacteria 29466
525 Ga0207712_10003892 3300025961 Bacteria 9438
526 Ga0207712_10033127 3300025961 Unclassified 3491
527 Ga0207712_10047870 3300025961 Bacteria 2971
528 Ga0207712_10241090 3300025961 Bacteria 1456
529 Ga0207712_10411799 3300025961 Bacteria 1139
530 Ga0207668_10235250 3300025972 Bacteria 1479
531 Ga0207640_10104195 3300025981 Bacteria 1996
532 Ga0207640_10155434 3300025981 Unclassified 1685
533 Ga0207640_10230299 3300025981 Unclassified 1425
534 Ga0207658_10542030 3300025986 Bacteria 1040
535 Ga0207677_10215974 3300026023 Bacteria 1535
536 Ga0207703_10000032 3300026035 Bacteria 188472
537 Ga0207703_10090531 3300026035 Bacteria 2571
538 Ga0207703_10161078 3300026035 Bacteria 1965
539 Ga0207703_10320865 3300026035 Bacteria 1418
540 Ga0207703_10501722 3300026035 Bacteria 1139
541 Ga0207639_10087998 3300026041 Bacteria 2477
542 Ga0207639_10202526 3300026041 Bacteria 1703
543 Ga0207708_10000201 3300026075 Bacteria 47331
544 Ga0207708_10045170 3300026075 Bacteria 3357
545 Ga0207708_10059405 3300026075 Bacteria 2919
546 Ga0207708_10256994 3300026075 Bacteria 1409
547 Ga0207708_10320648 3300026075 Bacteria 1264
548 Ga0207708_10327495 3300026075 Bacteria 1251
549 Ga0207708_10662428 3300026075 Bacteria 889
550 Ga0207702_10347310 3300026078 Bacteria 1419
551 Ga0207641_10005828 3300026088 Bacteria 10454
552 Ga0207641_10092122 3300026088 Bacteria 2654
553 Ga0207641_10164308 3300026088 Bacteria 2020
554 Ga0207641_10267337 3300026088 Bacteria 1603
555 Ga0207641_10321283 3300026088 Bacteria 1468
556 Ga0207641_10333910 3300026088 Bacteria 1441
557 Ga0207641_10385378 3300026088 Bacteria 1343
558 Ga0207641_10501538 3300026088 Bacteria 1179
559 Ga0207641_10708566 3300026088 Bacteria 992
560 Ga0207648_10102318 3300026089 Bacteria 2511
561 Ga0207648_10106756 3300026089 Bacteria 2457
562 Ga0207648_10208251 3300026089 Bacteria 1735
563 Ga0207648_10610540 3300026089 Bacteria 1006
564 Ga0207676_10003860 3300026095 Bacteria 10584
565 Ga0207676_10075024 3300026095 Bacteria 2727
566 Ga0207676_10107844 3300026095 Bacteria 2324
567 Ga0207676_10200655 3300026095 Bacteria 1762
568 Ga0207674_10042576 3300026116 Bacteria 4689
569 Ga0207674_10066777 3300026116 Bacteria 3622
570 Ga0207674_10185035 3300026116 Bacteria 2034
571 Ga0207674_10440546 3300026116 Bacteria 1259
572 Ga0207674_10519068 3300026116 Bacteria 1151
573 Ga0207675_100000467 3300026118 Bacteria 39445
574 Ga0207675_100015379 3300026118 Bacteria 7137
575 Ga0207675_100016702 3300026118 Bacteria 6854
576 Ga0207675_100019220 3300026118 Bacteria 6375
577 Ga0207675_100042468 3300026118 Bacteria 4246
578 Ga0207675_100108812 3300026118 Bacteria 2614
579 Ga0207675_100179262 3300026118 Bacteria 2028
580 Ga0207675_100250274 3300026118 Unclassified 1715
581 Ga0207675_100367280 3300026118 Bacteria 1413
582 Ga0207683_10001350 3300026121 Bacteria 22159
583 Ga0209588_1008957 3300027671 Unclassified 2979
584 Ga0207428_10000767 3300027907 Bacteria 36545
585 Ga0207428_10007143 3300027907 Bacteria 10217
586 Ga0207428_10014358 3300027907 Bacteria 6887
587 Ga0207428_10050986 3300027907 Bacteria 3309
588 Ga0207428_10159224 3300027907 Bacteria 1715
589 Ga0207428_10268052 3300027907 Bacteria 1270
590 Ga0268266_10000328 3300028379 Bacteria 74632
591 Ga0268266_10012462 3300028379 Bacteria 7348
592 Ga0268265_10028649 3300028380 Bacteria 3990
593 Ga0268265_10075195 3300028380 Bacteria 2645
594 Ga0268265_10154289 3300028380 Bacteria 1941
595 Ga0268265_10198737 3300028380 Bacteria 1737
596 Ga0268265_10801829 3300028380 Bacteria 918
597 Ga0268264_10001611 3300028381 Bacteria 20868
598 Ga0268264_10007459 3300028381 Bacteria 9127
599 Ga0268264_10008460 3300028381 Bacteria 8558
600 Ga0268264_10163216 3300028381 Bacteria 2009
601 Ga0268264_10218368 3300028381 Unclassified 1754
602 Ga0268264_10369045 3300028381 Bacteria 1371
603 Ga0265337_1022226 3300028556 Bacteria 1967
604 Ga0265334_10094912 3300028573 Bacteria 1085
605 Ga0265338_10071265 3300028800 Bacteria 2974
606 Ga0265338_10102574 3300028800 Bacteria 2326
607 Ga0265338_10525265 3300028800 Bacteria 831
608 Ga0265330_10012136 3300031235 Bacteria 4031
609 Ga0265332_10010411 3300031238 Bacteria 4138
610 Ga0265328_10074129 3300031239 Bacteria 1252
611 Ga0265320_10002223 3300031240 Bacteria 13608
612 Ga0265325_10019926 3300031241 Bacteria 3702
613 Ga0265331_10001396 3300031250 Bacteria 17743
614 Ga0265316_10003614 3300031344 Bacteria 15594
615 Ga0265316_10029083 3300031344 Bacteria 4549
616 Ga0307408_100251747 3300031548 Bacteria 1457
617 Ga0265342_10126973 3300031712 Bacteria 1431
618 Ga0265342_10179988 3300031712 Bacteria 1158
619 Ga0316576_10018651 3300031727 Bacteria 4741
620 Ga0307405_10056646 3300031731 Bacteria 2459
621 Ga0307405_10520992 3300031731 Bacteria 957
622 Ga0307413_10109766 3300031824 Bacteria 1844
623 Ga0307410_10016981 3300031852 Bacteria 4356
624 Ga0307406_10026621 3300031901 Bacteria 3476
625 Ga0307406_10082184 3300031901 Bacteria 2144
626 Ga0307406_10655039 3300031901 Bacteria 872
627 Ga0307407_10072696 3300031903 Bacteria 2052
628 Ga0307407_10488522 3300031903 Bacteria 900
629 Ga0307412_10145489 3300031911 Bacteria 1741
630 Ga0307409_100110810 3300031995 Bacteria 2301
631 Ga0307409_100223358 3300031995 Bacteria 1702
632 Ga0307416_100037712 3300032002 Bacteria 3722
633 Ga0307416_100210934 3300032002 Bacteria 1853
634 Ga0307416_100429714 3300032002 Bacteria 1368
635 Ga0307416_100468500 3300032002 Bacteria 1317
636 Ga0307416_101098266 3300032002 Unclassified 900
637 Ga0307416_101346756 3300032002 Bacteria 820
638 Ga0307414_10022236 3300032004 Bacteria 3995
639 Ga0307414_10764910 3300032004 Bacteria 879
640 Ga0307411_10133152 3300032005 Bacteria 1820
641 Ga0307415_100117942 3300032126 Bacteria 1983
642 Ga0307415_100207953 3300032126 Unclassified 1559
643 Ga0373936_0152612 3300035113 Bacteria 1002
644 Ga0373941_0033286 3300035115 Bacteria 1548
645 Ga0373946_0028782 3300035171 Bacteria 2206
646 Ga0373931_0197726 3300035691 Bacteria 1199
647 Ga0373935_0015645 3300035692 Bacteria 4588
648 Ga0373933_0133742 3300035724 Bacteria 1561
649 Ga0373937_0630786 3300036401 Unclassified 1017
650 Ga0316582_0191563 3300036647 Bacteria 1393
651 Ga0316584_0003658 3300036712 Bacteria 10062
652 Ga0373925_0000505 3300037068 Bacteria 39364
653 Ga0373925_0009911 3300037068 Bacteria 6921
654 Ga0373925_0334357 3300037068 Bacteria 1227
655 Ga0436364_0141999 3300037853 Bacteria 16846
656 Ga0436364_0236212 3300037853 Bacteria 8899
657 Ga0436364_0296140 3300037853 Bacteria 8752
658 Ga0436364_1285749 3300037853 Bacteria 4815
659 Ga0400489_20133 3300039093 Bacteria 96058
660 Ga0436365_0167452 3300039437 Bacteria 2391
661 Ga0436365_0635847 3300039437 Bacteria 1383
662 Ga0436365_0695157 3300039437 Bacteria 511493
663 Ga0436365_1385458 3300039437 Unclassified 2335
664 Ga0436360_0838659 3300039438 Bacteria 1208
665 Ga0436360_0923887 3300039438 Bacteria 8201
666 Ga0436360_1120397 3300039438 Bacteria 1038
667 Ga0436361_0863641 3300039447 Bacteria 83672
668 Ga0439450_006233 3300042008 Bacteria 2140
669 Ga0439458_0005662 3300042157 Unclassified 2804
670 Ga0451577_0032001 3300042876 Bacteria 4740
671 Ga0451577_0125579 3300042876 Unclassified 2299
672 Ga0451577_1193330 3300042876 Bacteria 679
673 Ga0453683_0006975 3300044673 Bacteria 7703
674 Ga0453683_0034959 3300044673 Bacteria 3168
675 Ga0453684_0000814 3300044712 Bacteria 105915
676 Ga0453684_0191313 3300044712 Bacteria 2393
677 Ga0453684_0205342 3300044712 Bacteria 2294
678 Ga0453684_0406333 3300044712 Bacteria 1524
679 Ga0453684_0631051 3300044712 Bacteria 1171
680 Ga0453684_0638449 3300044712 Bacteria 1163
681 Ga0451576_0001923 3300045051 Bacteria 33277
682 Ga0451576_0060696 3300045051 Bacteria 3944
683 Ga0466967_0789858 3300045976 Bacteria 942
684 Ga0495592_0304077 3300046454 Bacteria 1036
685 Ga0495629_0000010 3300046459 Bacteria 340114
686 Ga0495629_0090652 3300046459 Bacteria 2133
687 Ga0495651_0000564 3300046462 Bacteria 28657
688 Ga0495580_0004284 3300046472 Bacteria 12000
689 Ga0495639_0000036 3300046475 Bacteria 60447
690 Ga0495664_0027998 3300046477 Bacteria 3289
691 Ga0495594_0002765 3300046499 Bacteria 9104
692 Ga0495594_0023354 3300046499 Bacteria 3313
693 Ga0495594_0027656 3300046499 Bacteria 3057
694 Ga0495666_0000171 3300046526 Bacteria 27416
695 Ga0495586_0000747 3300046535 Bacteria 18690
696 Ga0495598_0037142 3300046537 Bacteria 1404
697 Ga0495667_0000245 3300046559 Bacteria 35362
698 Ga0495635_0000403 3300046663 Bacteria 27473
699 Ga0495635_0014836 3300046663 Bacteria 5450
700 Ga0495588_0133528 3300046674 Bacteria 1310
701 Ga0495657_0112840 3300046675 Unclassified 1720
702 Ga0495599_0275102 3300046678 Bacteria 1021
703 Ga0495647_0020929 3300046681 Bacteria 2352
704 Ga0495658_0072986 3300046683 Bacteria 1997
705 Ga0495658_0074232 3300046683 Bacteria 1981
706 Ga0495613_0091031 3300046689 Bacteria 2209
707 Ga0495613_0316096 3300046689 Bacteria 1079
708 Ga0495624_0033999 3300046690 Bacteria 3301
709 Ga0495600_0078811 3300046809 Bacteria 2151
710 Ga0495581_0113688 3300047315 Bacteria 1574
711 Ga0495676_0001556 3300047321 Bacteria 19887
712 Ga0495676_0079848 3300047321 Bacteria 2486
713 Ga0495680_0000371 3300047322 Bacteria 50251
714 Ga0495680_0000604 3300047322 Bacteria 40524
715 Ga0495680_0266528 3300047322 Unclassified 1210
716 Ga0495675_0036155 3300047444 Bacteria 3151
717 Ga0495684_0169396 3300047471 Bacteria 1625
718 Ga0496104_0062560 3300048907 Bacteria 3529
719 Ga0496105_0467096 3300048908 Bacteria 994
720 Ga0496108_0615229 3300048911 Bacteria 946
721 Ga0496109_0148871 3300048912 Bacteria 2191
722 Ga0496110_0168957 3300048913 Bacteria 1984
723 Ga0496112_0084077 3300048915 Bacteria 3148
724 Ga0496112_0128242 3300048915 Bacteria 2508
725 Ga0496112_0212342 3300048915 Bacteria 1892
726 Ga0496112_0411665 3300048915 Bacteria 1291
727 Ga0496113_0144073 3300048916 Bacteria 1876
728 Ga0496113_0287631 3300048916 Bacteria 1315
729 Ga0496114_0127082 3300048917 Bacteria 2198
730 Ga0501291_001452 3300049514 Bacteria 2750
731 Ga0501292_003457 3300049515 Bacteria 2112
732 Ga0501292_011859 3300049515 Bacteria 1324
733 Ga0501297_011044 3300049520 Bacteria 1030
734 Ga0501298_003875 3300049521 Bacteria 2335
735 Ga0501298_018868 3300049521 Bacteria 1273
736 Ga0501031_0003318 3300049568 Bacteria 10326
737 Ga0501036_0070201 3300049572 Bacteria 2962
738 Ga0501037_0007939 3300049573 Bacteria 7775
739 Ga0501037_0472884 3300049573 Bacteria 853
740 Ga0501038_0003771 3300049574 Bacteria 14103
741 Ga0501038_0444846 3300049574 Bacteria 997
742 Ga0501039_0000324 3300049575 Bacteria 33955
743 Ga0501039_0388754 3300049575 Bacteria 1096
744 Ga0501041_0005866 3300049577 Bacteria 7181
745 Ga0501042_0010084 3300049578 Bacteria 6317
746 Ga0501042_0107867 3300049578 Bacteria 2005
747 Ga0501046_0003690 3300049580 Bacteria 14028
748 Ga0501046_0092592 3300049580 Bacteria 2324
749 Ga0501047_0000970 3300049581 Bacteria 28911
750 Ga0501068_0029589 3300049584 Bacteria 3244
751 Ga0501071_0534442 3300049587 Bacteria 900
752 Ga0501072_0064166 3300049588 Bacteria 2897
753 Ga0501074_0023152 3300049590 Bacteria 4517
754 Ga0501075_0005441 3300049591 Bacteria 8709
755 Ga0501075_0094379 3300049591 Bacteria 2271
756 Ga0501076_0017046 3300049592 Bacteria 5516
757 Ga0501076_0037424 3300049592 Bacteria 3805
758 Ga0501077_0000975 3300049593 Bacteria 17225
759 Ga0501199_007105 3300049650 Bacteria 1153
760 Ga0501201_003862 3300049651 Bacteria 1383
761 Ga0501201_006228 3300049651 Bacteria 1127
762 Ga0501202_007477 3300049652 Bacteria 1975
763 Ga0501202_018631 3300049652 Bacteria 1365
764 Ga0501206_020614 3300049653 Bacteria 938
765 Ga0501207_011933 3300049654 Bacteria 1300
766 Ga0501214_000610 3300049659 Bacteria 2485
767 Ga0501216_005115 3300049660 Bacteria 1967
768 Ga0501216_013165 3300049660 Bacteria 1368
769 Ga0501217_010116 3300049661 Bacteria 2061
770 Ga0501217_011281 3300049661 Bacteria 1974
771 Ga0501223_002174 3300049663 Bacteria 4397
772 Ga0501223_014916 3300049663 Bacteria 1540
773 Ga0501224_006070 3300049664 Bacteria 1748
774 Ga0501224_006194 3300049664 Bacteria 1731
775 Ga0501227_008949 3300049665 Bacteria 2153
776 Ga0501227_031336 3300049665 Bacteria 1277
777 Ga0501230_010270 3300049667 Bacteria 1458
778 Ga0501230_027476 3300049667 Bacteria 1040
779 Ga0501233_020057 3300049668 Bacteria 1423
780 Ga0501233_020966 3300049668 Bacteria 1399
781 Ga0501233_027182 3300049668 Bacteria 1269
782 Ga0501235_001072 3300049669 Bacteria 5699
783 Ga0501235_011402 3300049669 Bacteria 1950
784 Ga0501251_017519 3300049681 Bacteria 921
785 Ga0501259_003056 3300049688 Bacteria 2682
786 Ga0501260_001390 3300049689 Bacteria 1991
787 Ga0501260_005604 3300049689 Bacteria 1186
788 Ga0501221_008006 3300049704 Bacteria 1827
789 Ga0501221_054671 3300049704 Bacteria 908
790 Ga0501225_0004027 3300049705 Bacteria 4397
791 Ga0501225_0009168 3300049705 Bacteria 2825
792 Ga0501225_0012870 3300049705 Bacteria 2345
793 Ga0501225_0067088 3300049705 Bacteria 1015
794 Ga0501234_012994 3300049707 Bacteria 1306
795 Ga0501079_0008022 3300049741 Bacteria 8001
796 Ga0501079_0151199 3300049741 Bacteria 1810
797 Ga0501079_0164881 3300049741 Bacteria 1728
798 Ga0501080_0769299 3300049742 Bacteria 846
799 Ga0501081_0100032 3300049743 Bacteria 2049
800 Ga0501081_0158097 3300049743 Bacteria 1632
801 Ga0501081_0382740 3300049743 Bacteria 1040
802 Ga0501241_049675 3300049758 Bacteria 827
803 Ga0501265_009070 3300049762 Bacteria 1197
804 Ga0501272_002646 3300049769 Bacteria 1780
805 Ga0501272_004542 3300049769 Bacteria 1444
806 Ga0501273_007509 3300049770 Bacteria 1284
807 Ga0501273_018883 3300049770 Unclassified 921
808 Ga0501279_007885 3300049775 Bacteria 1416
809 Ga0501035_0002599 3300049822 Bacteria 17634
810 Ga0501044_0005388 3300049823 Bacteria 14205
811 Ga0501045_0015541 3300049824 Bacteria 5400
812 Ga0501212_000634 3300049851 Bacteria 3535
813 Ga0501212_003475 3300049851 Bacteria 1981
814 Ga0501226_000413 3300049853 Bacteria 6075
815 nmdc:mga05p37_10646_c1 3300050507 Bacteria 10913
816 nmdc:mga05p37_1085999_c1 3300050507 Bacteria 840
817 nmdc:mga05p37_11102_c1 3300050507 Bacteria 10704
818 nmdc:mga05p37_132952_c1 3300050507 Bacteria 3052
819 nmdc:mga05p37_151752_c1 3300050507 Bacteria 2833
820 nmdc:mga05p37_168016_c1 3300050507 Bacteria 2676
821 nmdc:mga05p37_199919_c1 3300050507 Bacteria 2421
822 nmdc:mga05p37_214881_c1 3300050507 Bacteria 2323
823 nmdc:mga05p37_29170_c1 3300050507 Bacteria 6735
824 nmdc:mga05p37_330531_c1 3300050507 Bacteria 1801
825 nmdc:mga05p37_332480_c1 3300050507 Bacteria 1794
826 nmdc:mga05p37_396983_c1 3300050507 Bacteria 1611
827 nmdc:mga05p37_52504_c1 3300050507 Bacteria 5012
828 nmdc:mga05p37_591062_c1 3300050507 Bacteria 1255
829 nmdc:mga05p37_73665_c1 3300050507 Bacteria 4203
830 nmdc:mga05p37_918563_c1 3300050507 Bacteria 941
831 nmdc:mga09592_12165_c1 3300050508 Bacteria 7002
832 nmdc:mga09592_223732_c1 3300050508 Bacteria 1630
833 nmdc:mga09592_448357_c1 3300050508 Bacteria 1113
834 nmdc:mga09592_708899_c1 3300050508 Bacteria 856
835 nmdc:mga09592_7180_c1 3300050508 Bacteria 9055
836 nmdc:mga0qj67_182866_c1 3300050509 Bacteria 1703
837 nmdc:mga0qj67_234585_c1 3300050509 Bacteria 1489
838 nmdc:mga0qj67_241080_c1 3300050509 Bacteria 1467
839 nmdc:mga0qj67_43819_c1 3300050509 Bacteria 3524
840 nmdc:mga06r32_14433_c1 3300050510 Bacteria 7171
841 nmdc:mga06r32_160811_c1 3300050510 Unclassified 2228
842 nmdc:mga06r32_207790_c1 3300050510 Bacteria 1946
843 nmdc:mga06r32_237747_c1 3300050510 Bacteria 1809
844 nmdc:mga06r32_35225_c1 3300050510 Bacteria 4723
845 nmdc:mga06r32_80291_c1 3300050510 Unclassified 3174
846 nmdc:mga08y16_11109_c1 3300050511 Bacteria 9457
847 nmdc:mga08y16_11963_c1 3300050511 Bacteria 9113
848 nmdc:mga08y16_125105_c1 3300050511 Bacteria 2675
849 nmdc:mga08y16_12577_c1 3300050511 Bacteria 8904
850 nmdc:mga08y16_212996_c1 3300050511 Bacteria 2001
851 nmdc:mga08y16_33846_c1 3300050511 Bacteria 5367
852 nmdc:mga08y16_36782_c1 3300050511 Bacteria 5140
853 nmdc:mga08y16_63519_c1 3300050511 Bacteria 3856
854 nmdc:mga0n895_157985_c1 3300050512 Bacteria 2298
855 nmdc:mga0n895_189892_c1 3300050512 Unclassified 2085
856 nmdc:mga0n895_412365_c1 3300050512 Bacteria 1366
857 nmdc:mga0n895_631446_c1 3300050512 Bacteria 1071
858 nmdc:mga0rr50_44203_c1 3300050513 Bacteria 3265
859 nmdc:mga08x19_106624_c1 3300050514 Bacteria 1865
860 nmdc:mga08x19_112742_c1 3300050514 Bacteria 1815
861 nmdc:mga08x19_13355_c1 3300050514 Bacteria 4963
862 nmdc:mga08x19_1730_c1 3300050514 Bacteria 13435
863 nmdc:mga08x19_51624_c1 3300050514 Unclassified 2642
864 nmdc:mga0a205_15245_c1 3300050515 Bacteria 7181
865 nmdc:mga0a205_26_c2 3300050515 Bacteria 68852
866 nmdc:mga0a205_276151_c1 3300050515 Bacteria 1556
867 nmdc:mga0a205_62173_c1 3300050515 Bacteria 3607
868 nmdc:mga0a205_638135_c1 3300050515 Bacteria 917
869 nmdc:mga0a205_94964_c1 3300050515 Unclassified 2881
870 Ga0495601_0073124 3300053077 Bacteria 2191
871 Ga0495619_0037048 3300053085 Unclassified 3177
872 Ga0495619_0047458 3300053085 Bacteria 2828
873 Ga0500566_0122223 3300053094 Bacteria 1402
874 Ga0500616_0002625 3300053153 Bacteria 14673
875 Ga0501084_0046045 3300054114 Bacteria 3653
876 Ga0501084_0107978 3300054114 Bacteria 2338
877 Ga0501084_0273604 3300054114 Bacteria 1426
878 Ga0501082_0396646 3300060353 Bacteria 1204
879 Ga0530510_0139208 3300061734 Bacteria 1787

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_1193330 Ga0451577_1193330_14_610 197
2 3300009094 Ga0111539_10009392 Ga0111539_100093926 228
3 3300005329 Ga0070683_100330323 Ga0070683_1003303231 231
4 3300005344 Ga0070661_100271867 Ga0070661_1002718672 231
5 3300005456 Ga0070678_100146352 Ga0070678_1001463522 231
6 3300005535 Ga0070684_100603427 Ga0070684_1006034272 231
7 3300005543 Ga0070672_100170098 Ga0070672_1001700982 231
8 3300005564 Ga0070664_100322538 Ga0070664_1003225382 231
9 3300013296 Ga0157374_10201650 Ga0157374_102016502 231
10 3300013306 Ga0163162_10308950 Ga0163162_103089501 231
11 3300013308 Ga0157375_10414957 Ga0157375_104149572 231
12 3300005518 Ga0070699_100155740 Ga0070699_1001557402 232
13 3300005617 Ga0068859_100111141 Ga0068859_1001111413 232
14 3300006931 Ga0097620_100111153 Ga0097620_1001111533 232
15 3300009094 Ga0111539_10054426 Ga0111539_100544265 232
16 3300009147 Ga0114129_10221713 Ga0114129_102217133 232
17 3300014325 Ga0163163_10092602 Ga0163163_100926022 232
18 3300025907 Ga0207645_10095202 Ga0207645_100952022 232
19 3300027907 Ga0207428_10050986 Ga0207428_100509862 232
20 3300050511 nmdc:mga08y16_125105_c1 nmdc:mga08y16_125105_c1_210_1016 232
21 3300005353 Ga0070669_100275584 Ga0070669_1002755842 233
22 3300005457 Ga0070662_100467317 Ga0070662_1004673172 234
23 3300013306 Ga0163162_10100308 Ga0163162_101003082 234
24 3300005467 Ga0070706_100509789 Ga0070706_1005097892 235
25 3300009147 Ga0114129_11158916 Ga0114129_111589161 235
26 3300025910 Ga0207684_10512521 Ga0207684_105125212 235
27 3300042157 Ga0439458_0005662 Ga0439458_0005662_1852_2559 235
28 3300048915 Ga0496112_0411665 Ga0496112_0411665_500_1207 235
29 3300050507 nmdc:mga05p37_918563_c1 nmdc:mga05p37_918563_c1_182_889 235
30 3300009094 Ga0111539_10017738 Ga0111539_100177385 236
31 3300009147 Ga0114129_10027759 Ga0114129_100277596 236
32 3300009147 Ga0114129_10122452 Ga0114129_101224522 236
33 3300026089 Ga0207648_10106756 Ga0207648_101067563 236
34 3300050507 nmdc:mga05p37_396983_c1 nmdc:mga05p37_396983_c1_391_1101 236
35 3300050507 nmdc:mga05p37_591062_c1 nmdc:mga05p37_591062_c1_519_1229 236
36 3300050508 nmdc:mga09592_223732_c1 nmdc:mga09592_223732_c1_836_1546 236
37 3300050508 nmdc:mga09592_448357_c1 nmdc:mga09592_448357_c1_378_1088 236
38 3300050509 nmdc:mga0qj67_234585_c1 nmdc:mga0qj67_234585_c1_526_1236 236
39 3300050511 nmdc:mga08y16_212996_c1 nmdc:mga08y16_212996_c1_467_1177 236
40 3300009176 Ga0105242_10148012 Ga0105242_101480122 237
41 3300009177 Ga0105248_10033498 Ga0105248_100334982 237
42 3300013296 Ga0157374_10006823 Ga0157374_100068238 237
43 3300013297 Ga0157378_10005237 Ga0157378_100052377 237
44 3300013306 Ga0163162_10000217 Ga0163162_1000021742 237
45 3300013308 Ga0157375_10030714 Ga0157375_100307142 237
46 3300014325 Ga0163163_10052684 Ga0163163_100526842 237
47 3300014325 Ga0163163_10058380 Ga0163163_100583802 237
48 3300014969 Ga0157376_10023461 Ga0157376_100234614 237
49 3300044712 Ga0453684_0000814 Ga0453684_0000814_74840_75556 237
50 3300048911 Ga0496108_0615229 Ga0496108_0615229_24_746 237
51 3300005343 Ga0070687_100024212 Ga0070687_1000242123 238
52 3300005353 Ga0070669_100027093 Ga0070669_1000270933 238
53 3300005353 Ga0070669_100117100 Ga0070669_1001171002 238
54 3300005457 Ga0070662_100247555 Ga0070662_1002475552 238
55 3300005616 Ga0068852_100143959 Ga0068852_1001439591 238
56 3300005841 Ga0068863_100262665 Ga0068863_1002626652 238
57 3300005844 Ga0068862_100008996 Ga0068862_1000089963 238
58 3300013100 Ga0157373_10219458 Ga0157373_102194582 238
59 3300025923 Ga0207681_10176863 Ga0207681_101768632 238
60 3300025925 Ga0207650_10126272 Ga0207650_101262722 238
61 3300025933 Ga0207706_10330319 Ga0207706_103303191 238
62 3300025961 Ga0207712_10033127 Ga0207712_100331272 238
63 3300026089 Ga0207648_10208251 Ga0207648_102082512 238
64 3300026118 Ga0207675_100015379 Ga0207675_1000153795 238
65 3300028380 Ga0268265_10028649 Ga0268265_100286492 238
66 3300048915 Ga0496112_0084077 Ga0496112_0084077_1228_1944 238
67 3300005617 Ga0068859_100022372 Ga0068859_1000223726 239
68 3300006931 Ga0097620_100022371 Ga0097620_1000223716 239
69 3300005288 Ga0065714_10064445 Ga0065714_1006444510 240
70 3300005289 Ga0065704_10240525 Ga0065704_102405251 240
71 3300005290 Ga0065712_10000114 Ga0065712_1000011498 240
72 3300005577 Ga0068857_100113314 Ga0068857_1001133142 240
73 3300006844 Ga0075428_100034515 Ga0075428_1000345156 240
74 3300006844 Ga0075428_100040929 Ga0075428_1000409296 240
75 3300006880 Ga0075429_100015685 Ga0075429_1000156854 240
76 3300009147 Ga0114129_10173571 Ga0114129_101735712 240
77 3300009177 Ga0105248_10012314 Ga0105248_100123148 240
78 3300026116 Ga0207674_10066777 Ga0207674_100667773 240
79 3300044712 Ga0453684_0191313 Ga0453684_0191313_1415_2143 240
80 3300048915 Ga0496112_0128242 Ga0496112_0128242_79_810 240
81 3300049578 Ga0501042_0107867 Ga0501042_0107867_281_1012 240
82 3300049652 Ga0501202_007477 Ga0501202_007477_847_1578 240
83 3300049653 Ga0501206_020614 Ga0501206_020614_128_859 240
84 3300049659 Ga0501214_000610 Ga0501214_000610_128_859 240
85 3300049660 Ga0501216_005115 Ga0501216_005115_366_1097 240
86 3300049661 Ga0501217_010116 Ga0501217_010116_834_1565 240
87 3300049663 Ga0501223_002174 Ga0501223_002174_3261_3992 240
88 3300049664 Ga0501224_006194 Ga0501224_006194_856_1587 240
89 3300049665 Ga0501227_008949 Ga0501227_008949_953_1684 240
90 3300049668 Ga0501233_020057 Ga0501233_020057_340_1071 240
91 3300049669 Ga0501235_001072 Ga0501235_001072_4476_5207 240
92 3300049681 Ga0501251_017519 Ga0501251_017519_14_745 240
93 3300049689 Ga0501260_001390 Ga0501260_001390_824_1555 240
94 3300049704 Ga0501221_008006 Ga0501221_008006_953_1684 240
95 3300049705 Ga0501225_0004027 Ga0501225_0004027_514_1245 240
96 3300049707 Ga0501234_012994 Ga0501234_012994_538_1269 240
97 3300049769 Ga0501272_002646 Ga0501272_002646_943_1665 240
98 3300049851 Ga0501212_000634 Ga0501212_000634_2345_3076 240
99 3300049853 Ga0501226_000413 Ga0501226_000413_497_1228 240
100 3300050507 nmdc:mga05p37_1085999_c1 nmdc:mga05p37_1085999_c1_15_737 240
101 3300050508 nmdc:mga09592_12165_c1 nmdc:mga09592_12165_c1_4381_5103 240
102 3300050511 nmdc:mga08y16_11963_c1 nmdc:mga08y16_11963_c1_1424_2146 240
103 3300054114 Ga0501084_0046045 Ga0501084_0046045_2231_2962 240
104 3300060353 Ga0501082_0396646 Ga0501082_0396646_224_955 240
105 3300005441 Ga0070700_100004436 Ga0070700_1000044365 241
106 3300005719 Ga0068861_100187626 Ga0068861_1001876262 241
107 3300006844 Ga0075428_100768847 Ga0075428_1007688471 241
108 3300006846 Ga0075430_100053938 Ga0075430_1000539384 241
109 3300006852 Ga0075433_10019208 Ga0075433_100192085 241
110 3300006852 Ga0075433_10250231 Ga0075433_102502312 241
111 3300006871 Ga0075434_101032209 Ga0075434_1010322091 241
112 3300009094 Ga0111539_10223318 Ga0111539_102233184 241
113 3300009147 Ga0114129_10147692 Ga0114129_101476922 241
114 3300014326 Ga0157380_10674419 Ga0157380_106744191 241
115 3300026075 Ga0207708_10045170 Ga0207708_100451703 241
116 3300027907 Ga0207428_10268052 Ga0207428_102680522 241
117 3300028381 Ga0268264_10008460 Ga0268264_100084604 241
118 3300028556 Ga0265337_1022226 Ga0265337_10222261 241
119 3300028800 Ga0265338_10102574 Ga0265338_101025742 241
120 3300031727 Ga0316576_10018651 Ga0316576_100186512 241
121 3300036647 Ga0316582_0191563 Ga0316582_0191563_427_1161 241
122 3300036712 Ga0316584_0003658 Ga0316584_0003658_2048_2782 241
123 3300039437 Ga0436365_0167452 Ga0436365_0167452_65_799 241
124 3300044673 Ga0453683_0006975 Ga0453683_0006975_994_1737 241
125 3300046454 Ga0495592_0304077 Ga0495592_0304077_23_757 241
126 3300046689 Ga0495613_0091031 Ga0495613_0091031_1175_1909 241
127 3300050507 nmdc:mga05p37_10646_c1 nmdc:mga05p37_10646_c1_6464_7189 241
128 3300050507 nmdc:mga05p37_151752_c1 nmdc:mga05p37_151752_c1_1417_2142 241
129 3300050509 nmdc:mga0qj67_241080_c1 nmdc:mga0qj67_241080_c1_615_1352 241
130 3300050511 nmdc:mga08y16_33846_c1 nmdc:mga08y16_33846_c1_433_1167 241
131 3300050512 nmdc:mga0n895_157985_c1 nmdc:mga0n895_157985_c1_1265_1990 241
132 3300050515 nmdc:mga0a205_26_c2 nmdc:mga0a205_26_c2_14387_15124 241
133 3300050515 nmdc:mga0a205_638135_c1 nmdc:mga0a205_638135_c1_12_749 241
134 3300005293 Ga0065715_10023552 Ga0065715_100235522 242
135 3300005344 Ga0070661_100348728 Ga0070661_1003487282 242
136 3300005345 Ga0070692_10023252 Ga0070692_100232522 242
137 3300005347 Ga0070668_100572633 Ga0070668_1005726332 242
138 3300005364 Ga0070673_100318856 Ga0070673_1003188562 242
139 3300005406 Ga0070703_10001965 Ga0070703_100019653 242
140 3300005440 Ga0070705_100018954 Ga0070705_1000189542 242
141 3300005444 Ga0070694_100058320 Ga0070694_1000583202 242
142 3300005444 Ga0070694_100124946 Ga0070694_1001249462 242
143 3300005445 Ga0070708_100042703 Ga0070708_1000427035 242
144 3300005458 Ga0070681_10125016 Ga0070681_101250162 242
145 3300005467 Ga0070706_100008713 Ga0070706_10000871310 242
146 3300005468 Ga0070707_100007732 Ga0070707_1000077322 242
147 3300005471 Ga0070698_100055975 Ga0070698_1000559755 242
148 3300005518 Ga0070699_100005760 Ga0070699_10000576010 242
149 3300005518 Ga0070699_100473722 Ga0070699_1004737221 242
150 3300005530 Ga0070679_100126043 Ga0070679_1001260432 242
151 3300005536 Ga0070697_100076477 Ga0070697_1000764772 242
152 3300005539 Ga0068853_100378625 Ga0068853_1003786252 242
153 3300005547 Ga0070693_100002084 Ga0070693_1000020846 242
154 3300005547 Ga0070693_100057601 Ga0070693_1000576012 242
155 3300005548 Ga0070665_100000060 Ga0070665_1000000606 242
156 3300005549 Ga0070704_100078227 Ga0070704_1000782272 242
157 3300005615 Ga0070702_100068106 Ga0070702_1000681062 242
158 3300005615 Ga0070702_100097684 Ga0070702_1000976841 242
159 3300005617 Ga0068859_100098812 Ga0068859_1000988122 242
160 3300005617 Ga0068859_100286436 Ga0068859_1002864362 242
161 3300005617 Ga0068859_100349749 Ga0068859_1003497492 242
162 3300005618 Ga0068864_100007174 Ga0068864_1000071742 242
163 3300005834 Ga0068851_10047508 Ga0068851_100475082 242
164 3300005834 Ga0068851_10112492 Ga0068851_101124921 242
165 3300005841 Ga0068863_100219577 Ga0068863_1002195771 242
166 3300005841 Ga0068863_100478601 Ga0068863_1004786012 242
167 3300005842 Ga0068858_100327659 Ga0068858_1003276592 242
168 3300005842 Ga0068858_100399432 Ga0068858_1003994321 242
169 3300005843 Ga0068860_100006967 Ga0068860_1000069672 242
170 3300005843 Ga0068860_100046420 Ga0068860_1000464202 242
171 3300005844 Ga0068862_100016042 Ga0068862_1000160424 242
172 3300006844 Ga0075428_100684829 Ga0075428_1006848292 242
173 3300006871 Ga0075434_100404689 Ga0075434_1004046892 242
174 3300006931 Ga0097620_100098818 Ga0097620_1000988182 242
175 3300006931 Ga0097620_100286443 Ga0097620_1002864433 242
176 3300006931 Ga0097620_100349708 Ga0097620_1003497082 242
177 3300009093 Ga0105240_10568392 Ga0105240_105683922 242
178 3300009101 Ga0105247_10000951 Ga0105247_100009514 242
179 3300009101 Ga0105247_10039404 Ga0105247_100394042 242
180 3300009147 Ga0114129_10085764 Ga0114129_100857642 242
181 3300009148 Ga0105243_10219003 Ga0105243_102190032 242
182 3300009174 Ga0105241_10448197 Ga0105241_104481972 242
183 3300009177 Ga0105248_11447854 Ga0105248_114478541 242
184 3300009545 Ga0105237_10024354 Ga0105237_100243542 242
185 3300009551 Ga0105238_10001850 Ga0105238_100018508 242
186 3300009553 Ga0105249_10394013 Ga0105249_103940132 242
187 3300010375 Ga0105239_10021391 Ga0105239_100213912 242
188 3300010375 Ga0105239_10402291 Ga0105239_104022912 242
189 3300013306 Ga0163162_10009762 Ga0163162_100097628 242
190 3300013306 Ga0163162_10194076 Ga0163162_101940762 242
191 3300013307 Ga0157372_10006128 Ga0157372_100061285 242
192 3300013307 Ga0157372_10693862 Ga0157372_106938622 242
193 3300013308 Ga0157375_10252937 Ga0157375_102529371 242
194 3300014969 Ga0157376_10143025 Ga0157376_101430252 242
195 3300025321 Ga0207656_10052562 Ga0207656_100525622 242
196 3300025321 Ga0207656_10099798 Ga0207656_100997982 242
197 3300025885 Ga0207653_10001139 Ga0207653_100011395 242
198 3300025900 Ga0207710_10004144 Ga0207710_100041442 242
199 3300025910 Ga0207684_10000220 Ga0207684_1000022012 242
200 3300025910 Ga0207684_10001056 Ga0207684_100010564 242
201 3300025912 Ga0207707_10077234 Ga0207707_100772342 242
202 3300025912 Ga0207707_10325683 Ga0207707_103256832 242
203 3300025913 Ga0207695_10312626 Ga0207695_103126262 242
204 3300025914 Ga0207671_10001345 Ga0207671_1000134519 242
205 3300025914 Ga0207671_10180929 Ga0207671_101809292 242
206 3300025922 Ga0207646_10000338 Ga0207646_1000033814 242
207 3300025924 Ga0207694_10009360 Ga0207694_100093604 242
208 3300025925 Ga0207650_10000001 Ga0207650_10000001821 242
209 3300025935 Ga0207709_10576352 Ga0207709_105763521 242
210 3300025936 Ga0207670_10241598 Ga0207670_102415982 242
211 3300025936 Ga0207670_10299364 Ga0207670_102993642 242
212 3300025938 Ga0207704_10029521 Ga0207704_100295212 242
213 3300025941 Ga0207711_10008812 Ga0207711_100088122 242
214 3300025942 Ga0207689_10267573 Ga0207689_102675732 242
215 3300025961 Ga0207712_10000584 Ga0207712_100005847 242
216 3300025961 Ga0207712_10003892 Ga0207712_100038925 242
217 3300025972 Ga0207668_10235250 Ga0207668_102352502 242
218 3300026035 Ga0207703_10161078 Ga0207703_101610782 242
219 3300026035 Ga0207703_10501722 Ga0207703_105017221 242
220 3300026041 Ga0207639_10087998 Ga0207639_100879981 242
221 3300026088 Ga0207641_10005828 Ga0207641_100058282 242
222 3300026088 Ga0207641_10267337 Ga0207641_102673372 242
223 3300026088 Ga0207641_10321283 Ga0207641_103212831 242
224 3300026088 Ga0207641_10385378 Ga0207641_103853782 242
225 3300026095 Ga0207676_10003860 Ga0207676_100038608 242
226 3300026095 Ga0207676_10075024 Ga0207676_100750242 242
227 3300028379 Ga0268266_10000328 Ga0268266_1000032817 242
228 3300028380 Ga0268265_10198737 Ga0268265_101987372 242
229 3300028381 Ga0268264_10001611 Ga0268264_100016114 242
230 3300028381 Ga0268264_10163216 Ga0268264_101632162 242
231 3300031344 Ga0265316_10029083 Ga0265316_100290837 242
232 3300031731 Ga0307405_10520992 Ga0307405_105209922 242
233 3300031901 Ga0307406_10026621 Ga0307406_100266213 242
234 3300032002 Ga0307416_101346756 Ga0307416_1013467561 242
235 3300032126 Ga0307415_100207953 Ga0307415_1002079532 242
236 3300035115 Ga0373941_0033286 Ga0373941_0033286_752_1489 242
237 3300035692 Ga0373935_0015645 Ga0373935_0015645_2475_3203 242
238 3300035724 Ga0373933_0133742 Ga0373933_0133742_22_750 242
239 3300036401 Ga0373937_0630786 Ga0373937_0630786_178_906 242
240 3300037068 Ga0373925_0334357 Ga0373925_0334357_489_1217 242
241 3300042876 Ga0451577_0125579 Ga0451577_0125579_1421_2197 242
242 3300044712 Ga0453684_0205342 Ga0453684_0205342_700_1428 242
243 3300044712 Ga0453684_0631051 Ga0453684_0631051_411_1139 242
244 3300046459 Ga0495629_0090652 Ga0495629_0090652_844_1572 242
245 3300046499 Ga0495594_0002765 Ga0495594_0002765_3243_3971 242
246 3300046499 Ga0495594_0023354 Ga0495594_0023354_1392_2120 242
247 3300046663 Ga0495635_0014836 Ga0495635_0014836_1374_2102 242
248 3300046675 Ga0495657_0112840 Ga0495657_0112840_265_993 242
249 3300046689 Ga0495613_0316096 Ga0495613_0316096_259_987 242
250 3300047321 Ga0495676_0079848 Ga0495676_0079848_1359_2087 242
251 3300047322 Ga0495680_0266528 Ga0495680_0266528_437_1165 242
252 3300048907 Ga0496104_0062560 Ga0496104_0062560_1164_1892 242
253 3300048912 Ga0496109_0148871 Ga0496109_0148871_795_1523 242
254 3300048916 Ga0496113_0144073 Ga0496113_0144073_619_1347 242
255 3300049514 Ga0501291_001452 Ga0501291_001452_1651_2379 242
256 3300049521 Ga0501298_018868 Ga0501298_018868_499_1227 242
257 3300049654 Ga0501207_011933 Ga0501207_011933_246_974 242
258 3300049661 Ga0501217_011281 Ga0501217_011281_411_1139 242
259 3300049663 Ga0501223_014916 Ga0501223_014916_584_1312 242
260 3300049667 Ga0501230_027476 Ga0501230_027476_87_815 242
261 3300049669 Ga0501235_011402 Ga0501235_011402_851_1579 242
262 3300049689 Ga0501260_005604 Ga0501260_005604_271_999 242
263 3300049705 Ga0501225_0009168 Ga0501225_0009168_1780_2508 242
264 3300049770 Ga0501273_018883 Ga0501273_018883_177_905 242
265 3300050507 nmdc:mga05p37_330531_c1 nmdc:mga05p37_330531_c1_186_929 242
266 3300050507 nmdc:mga05p37_73665_c1 nmdc:mga05p37_73665_c1_1613_2389 242
267 3300050511 nmdc:mga08y16_63519_c1 nmdc:mga08y16_63519_c1_406_1182 242
268 3300050512 nmdc:mga0n895_631446_c1 nmdc:mga0n895_631446_c1_297_1025 242
269 3300053077 Ga0495601_0073124 Ga0495601_0073124_810_1538 242
270 3300053085 Ga0495619_0037048 Ga0495619_0037048_2314_3042 242
271 3300005330 Ga0070690_100003652 Ga0070690_1000036526 243
272 3300005333 Ga0070677_10056251 Ga0070677_100562512 243
273 3300005335 Ga0070666_10146995 Ga0070666_101469952 243
274 3300005338 Ga0068868_100329023 Ga0068868_1003290232 243
275 3300005353 Ga0070669_100300504 Ga0070669_1003005042 243
276 3300005355 Ga0070671_100003741 Ga0070671_1000037417 243
277 3300005355 Ga0070671_100074615 Ga0070671_1000746152 243
278 3300005364 Ga0070673_100000494 Ga0070673_1000004947 243
279 3300005367 Ga0070667_100542033 Ga0070667_1005420331 243
280 3300005438 Ga0070701_10138704 Ga0070701_101387041 243
281 3300005456 Ga0070678_100000362 Ga0070678_10000036214 243
282 3300005457 Ga0070662_100145255 Ga0070662_1001452552 243
283 3300005459 Ga0068867_100652796 Ga0068867_1006527961 243
284 3300005548 Ga0070665_100104625 Ga0070665_1001046252 243
285 3300005843 Ga0068860_100453840 Ga0068860_1004538402 243
286 3300006358 Ga0068871_100011376 Ga0068871_1000113765 243
287 3300006880 Ga0075429_100265678 Ga0075429_1002656782 243
288 3300006881 Ga0068865_100532640 Ga0068865_1005326401 243
289 3300009147 Ga0114129_10399201 Ga0114129_103992011 243
290 3300013296 Ga0157374_10007893 Ga0157374_100078932 243
291 3300013297 Ga0157378_10002420 Ga0157378_1000242017 243
292 3300013308 Ga0157375_10052578 Ga0157375_100525783 243
293 3300014969 Ga0157376_10764336 Ga0157376_107643362 243
294 3300025899 Ga0207642_10185131 Ga0207642_101851311 243
295 3300025903 Ga0207680_10072611 Ga0207680_100726112 243
296 3300025903 Ga0207680_10150126 Ga0207680_101501262 243
297 3300025907 Ga0207645_10118821 Ga0207645_101188212 243
298 3300025910 Ga0207684_10271355 Ga0207684_102713551 243
299 3300025925 Ga0207650_10009116 Ga0207650_100091164 243
300 3300025931 Ga0207644_10003149 Ga0207644_100031497 243
301 3300025931 Ga0207644_10086041 Ga0207644_100860412 243
302 3300025940 Ga0207691_10000150 Ga0207691_1000015050 243
303 3300025960 Ga0207651_10000592 Ga0207651_1000059216 243
304 3300025960 Ga0207651_10233761 Ga0207651_102337612 243
305 3300025986 Ga0207658_10542030 Ga0207658_105420302 243
306 3300026023 Ga0207677_10215974 Ga0207677_102159742 243
307 3300026088 Ga0207641_10333910 Ga0207641_103339101 243
308 3300026118 Ga0207675_100179262 Ga0207675_1001792623 243
309 3300026121 Ga0207683_10001350 Ga0207683_1000135014 243
310 3300027907 Ga0207428_10159224 Ga0207428_101592242 243
311 3300032002 Ga0307416_100468500 Ga0307416_1004685001 243
312 3300039438 Ga0436360_0838659 Ga0436360_0838659_371_1111 243
313 3300042876 Ga0451577_0032001 Ga0451577_0032001_2194_2934 243
314 3300044712 Ga0453684_0406333 Ga0453684_0406333_87_830 243
315 3300048908 Ga0496105_0467096 Ga0496105_0467096_178_909 243
316 3300048917 Ga0496114_0127082 Ga0496114_0127082_903_1634 243
317 3300049591 Ga0501075_0005441 Ga0501075_0005441_3196_3927 243
318 3300049592 Ga0501076_0037424 Ga0501076_0037424_3050_3781 243
319 3300049593 Ga0501077_0000975 Ga0501077_0000975_15827_16558 243
320 3300049741 Ga0501079_0008022 Ga0501079_0008022_6071_6802 243
321 3300049742 Ga0501080_0769299 Ga0501080_0769299_27_758 243
322 3300050508 nmdc:mga09592_708899_c1 nmdc:mga09592_708899_c1_105_836 243
323 3300050511 nmdc:mga08y16_36782_c1 nmdc:mga08y16_36782_c1_1713_2444 243
324 3300054114 Ga0501084_0107978 Ga0501084_0107978_271_1002 243
325 3300005293 Ga0065715_10001707 Ga0065715_100017077 244
326 3300005336 Ga0070680_100212745 Ga0070680_1002127452 244
327 3300005406 Ga0070703_10043098 Ga0070703_100430982 244
328 3300005434 Ga0070709_10000145 Ga0070709_100001453 244
329 3300005444 Ga0070694_100012009 Ga0070694_1000120094 244
330 3300005546 Ga0070696_100006993 Ga0070696_1000069935 244
331 3300006173 Ga0070716_100061008 Ga0070716_1000610082 244
332 3300006844 Ga0075428_100016191 Ga0075428_1000161913 244
333 3300006844 Ga0075428_100039862 Ga0075428_1000398626 244
334 3300006846 Ga0075430_100054026 Ga0075430_1000540263 244
335 3300006847 Ga0075431_100113184 Ga0075431_1001131844 244
336 3300006847 Ga0075431_100230617 Ga0075431_1002306173 244
337 3300006880 Ga0075429_100067799 Ga0075429_1000677993 244
338 3300009094 Ga0111539_10005372 Ga0111539_100053728 244
339 3300021384 Ga0213876_10000006 Ga0213876_10000006486 244
340 3300021388 Ga0213875_10031147 Ga0213875_100311472 244
341 3300025885 Ga0207653_10035990 Ga0207653_100359902 244
342 3300025906 Ga0207699_10000031 Ga0207699_100000313 244
343 3300025939 Ga0207665_10155425 Ga0207665_101554252 244
344 3300025939 Ga0207665_10183027 Ga0207665_101830272 244
345 3300027907 Ga0207428_10014358 Ga0207428_100143586 244
346 3300031901 Ga0307406_10655039 Ga0307406_106550391 244
347 3300031995 Ga0307409_100223358 Ga0307409_1002233582 244
348 3300032004 Ga0307414_10764910 Ga0307414_107649101 244
349 3300037853 Ga0436364_0141999 Ga0436364_0141999_15238_15978 244
350 3300039093 Ga0400489_20133 Ga0400489_20133_38470_39204 244
351 3300039437 Ga0436365_0635847 Ga0436365_0635847_449_1189 244
352 3300039437 Ga0436365_0695157 Ga0436365_0695157_76687_77421 244
353 3300039438 Ga0436360_1120397 Ga0436360_1120397_16_759 244
354 3300045051 Ga0451576_0060696 Ga0451576_0060696_273_1007 244
355 3300049568 Ga0501031_0003318 Ga0501031_0003318_6605_7339 244
356 3300049572 Ga0501036_0070201 Ga0501036_0070201_1766_2500 244
357 3300049573 Ga0501037_0007939 Ga0501037_0007939_4611_5345 244
358 3300049574 Ga0501038_0444846 Ga0501038_0444846_237_971 244
359 3300049575 Ga0501039_0000324 Ga0501039_0000324_7235_7969 244
360 3300049575 Ga0501039_0388754 Ga0501039_0388754_302_1036 244
361 3300049577 Ga0501041_0005866 Ga0501041_0005866_5702_6436 244
362 3300049578 Ga0501042_0010084 Ga0501042_0010084_3209_3943 244
363 3300049580 Ga0501046_0003690 Ga0501046_0003690_10154_10888 244
364 3300049592 Ga0501076_0017046 Ga0501076_0017046_2611_3345 244
365 3300049741 Ga0501079_0151199 Ga0501079_0151199_870_1604 244
366 3300049743 Ga0501081_0100032 Ga0501081_0100032_1124_1858 244
367 3300050509 nmdc:mga0qj67_43819_c1 nmdc:mga0qj67_43819_c1_1915_2649 244
368 3300050510 nmdc:mga06r32_14433_c1 nmdc:mga06r32_14433_c1_1929_2672 244
369 3300050510 nmdc:mga06r32_207790_c1 nmdc:mga06r32_207790_c1_706_1440 244
370 3300050510 nmdc:mga06r32_80291_c1 nmdc:mga06r32_80291_c1_136_894 244
371 3300050511 nmdc:mga08y16_12577_c1 nmdc:mga08y16_12577_c1_461_1195 244
372 3300050515 nmdc:mga0a205_15245_c1 nmdc:mga0a205_15245_c1_1634_2368 244
373 3300054114 Ga0501084_0273604 Ga0501084_0273604_350_1084 244
374 3300005290 Ga0065712_10083656 Ga0065712_100836564 245
375 3300005337 Ga0070682_100589518 Ga0070682_1005895181 245
376 3300005444 Ga0070694_100002515 Ga0070694_1000025154 245
377 3300005468 Ga0070707_100000020 Ga0070707_10000002034 245
378 3300005468 Ga0070707_100000456 Ga0070707_10000045615 245
379 3300005518 Ga0070699_100032091 Ga0070699_1000320916 245
380 3300005546 Ga0070696_100012215 Ga0070696_1000122157 245
381 3300005564 Ga0070664_100007758 Ga0070664_1000077584 245
382 3300005937 Ga0081455_10009173 Ga0081455_100091736 245
383 3300006847 Ga0075431_100015521 Ga0075431_1000155218 245
384 3300006871 Ga0075434_100029949 Ga0075434_1000299496 245
385 3300009094 Ga0111539_10031255 Ga0111539_100312555 245
386 3300009147 Ga0114129_10000340 Ga0114129_100003406 245
387 3300009147 Ga0114129_10006667 Ga0114129_1000666711 245
388 3300009147 Ga0114129_10021260 Ga0114129_100212602 245
389 3300009147 Ga0114129_10234049 Ga0114129_102340492 245
390 3300009147 Ga0114129_10774507 Ga0114129_107745071 245
391 3300014969 Ga0157376_10982947 Ga0157376_109829472 245
392 3300025917 Ga0207660_10604422 Ga0207660_106044222 245
393 3300025922 Ga0207646_10000008 Ga0207646_10000008371 245
394 3300025922 Ga0207646_10000009 Ga0207646_1000000985 245
395 3300025922 Ga0207646_10000480 Ga0207646_1000048011 245
396 3300025944 Ga0207661_10447589 Ga0207661_104475892 245
397 3300025945 Ga0207679_10009282 Ga0207679_100092823 245
398 3300026118 Ga0207675_100016702 Ga0207675_1000167024 245
399 3300035691 Ga0373931_0197726 Ga0373931_0197726_149_886 245
400 3300042008 Ga0439450_006233 Ga0439450_006233_1319_2056 245
401 3300044673 Ga0453683_0034959 Ga0453683_0034959_168_905 245
402 3300045051 Ga0451576_0001923 Ga0451576_0001923_14391_15128 245
403 3300049584 Ga0501068_0029589 Ga0501068_0029589_2468_3205 245
404 3300049587 Ga0501071_0534442 Ga0501071_0534442_142_879 245
405 3300049743 Ga0501081_0382740 Ga0501081_0382740_195_932 245
406 3300050507 nmdc:mga05p37_11102_c1 nmdc:mga05p37_11102_c1_9469_10260 245
407 3300050507 nmdc:mga05p37_132952_c1 nmdc:mga05p37_132952_c1_1850_2587 245
408 3300050507 nmdc:mga05p37_199919_c1 nmdc:mga05p37_199919_c1_1536_2273 245
409 3300050507 nmdc:mga05p37_29170_c1 nmdc:mga05p37_29170_c1_495_1232 245
410 3300050510 nmdc:mga06r32_35225_c1 nmdc:mga06r32_35225_c1_973_1758 245
411 3300050512 nmdc:mga0n895_412365_c1 nmdc:mga0n895_412365_c1_281_1072 245
412 3300005290 Ga0065712_10096352 Ga0065712_100963522 246
413 3300005293 Ga0065715_10109661 Ga0065715_101096612 246
414 3300005365 Ga0070688_100270045 Ga0070688_1002700452 246
415 3300005438 Ga0070701_10313976 Ga0070701_103139762 246
416 3300005458 Ga0070681_10440486 Ga0070681_104404862 246
417 3300005467 Ga0070706_100008898 Ga0070706_1000088986 246
418 3300005471 Ga0070698_100423685 Ga0070698_1004236851 246
419 3300005530 Ga0070679_100503685 Ga0070679_1005036852 246
420 3300005536 Ga0070697_100075678 Ga0070697_1000756781 246
421 3300005618 Ga0068864_100129471 Ga0068864_1001294712 246
422 3300006173 Ga0070716_100130284 Ga0070716_1001302842 246
423 3300006237 Ga0097621_100179541 Ga0097621_1001795411 246
424 3300006844 Ga0075428_100097092 Ga0075428_1000970923 246
425 3300013105 Ga0157369_10073275 Ga0157369_100732753 246
426 3300013307 Ga0157372_10445694 Ga0157372_104456942 246
427 3300013308 Ga0157375_10030926 Ga0157375_100309263 246
428 3300014969 Ga0157376_10087295 Ga0157376_100872953 246
429 3300025921 Ga0207652_10350387 Ga0207652_103503872 246
430 3300025939 Ga0207665_10134195 Ga0207665_101341952 246
431 3300026088 Ga0207641_10708566 Ga0207641_107085662 246
432 3300026095 Ga0207676_10107844 Ga0207676_101078442 246
433 3300026116 Ga0207674_10185035 Ga0207674_101850353 246
434 3300028380 Ga0268265_10801829 Ga0268265_108018291 246
435 3300032002 Ga0307416_100429714 Ga0307416_1004297142 246
436 3300035113 Ga0373936_0152612 Ga0373936_0152612_82_825 246
437 3300035171 Ga0373946_0028782 Ga0373946_0028782_719_1462 246
438 3300037068 Ga0373925_0000505 Ga0373925_0000505_970_1713 246
439 3300045976 Ga0466967_0789858 Ga0466967_0789858_146_886 246
440 3300046459 Ga0495629_0000010 Ga0495629_0000010_130558_131301 246
441 3300046475 Ga0495639_0000036 Ga0495639_0000036_53568_54311 246
442 3300046499 Ga0495594_0027656 Ga0495594_0027656_2023_2766 246
443 3300046526 Ga0495666_0000171 Ga0495666_0000171_25566_26309 246
444 3300046535 Ga0495586_0000747 Ga0495586_0000747_17412_18155 246
445 3300046663 Ga0495635_0000403 Ga0495635_0000403_22225_22968 246
446 3300046674 Ga0495588_0133528 Ga0495588_0133528_308_1051 246
447 3300046681 Ga0495647_0020929 Ga0495647_0020929_129_872 246
448 3300046683 Ga0495658_0072986 Ga0495658_0072986_1128_1868 246
449 3300046683 Ga0495658_0074232 Ga0495658_0074232_1204_1947 246
450 3300046690 Ga0495624_0033999 Ga0495624_0033999_471_1214 246
451 3300046809 Ga0495600_0078811 Ga0495600_0078811_511_1254 246
452 3300047315 Ga0495581_0113688 Ga0495581_0113688_122_865 246
453 3300047321 Ga0495676_0001556 Ga0495676_0001556_7693_8436 246
454 3300047322 Ga0495680_0000604 Ga0495680_0000604_16469_17212 246
455 3300047471 Ga0495684_0169396 Ga0495684_0169396_816_1559 246
456 3300049580 Ga0501046_0092592 Ga0501046_0092592_928_1677 246
457 3300049581 Ga0501047_0000970 Ga0501047_0000970_25917_26663 246
458 3300049588 Ga0501072_0064166 Ga0501072_0064166_832_1581 246
459 3300049590 Ga0501074_0023152 Ga0501074_0023152_619_1368 246
460 3300049591 Ga0501075_0094379 Ga0501075_0094379_1227_1976 246
461 3300049741 Ga0501079_0164881 Ga0501079_0164881_335_1084 246
462 3300049743 Ga0501081_0158097 Ga0501081_0158097_869_1618 246
463 3300049822 Ga0501035_0002599 Ga0501035_0002599_4659_5405 246
464 3300049823 Ga0501044_0005388 Ga0501044_0005388_5153_5899 246
465 3300049824 Ga0501045_0015541 Ga0501045_0015541_4154_4903 246
466 3300053085 Ga0495619_0047458 Ga0495619_0047458_1325_2068 246
467 3300053094 Ga0500566_0122223 Ga0500566_0122223_294_1037 246
468 3300061734 Ga0530510_0139208 Ga0530510_0139208_715_1464 246
469 3300025916 Ga0207663_10406271 Ga0207663_104062711 247
470 3300044712 Ga0453684_0638449 Ga0453684_0638449_386_1138 247
471 3300049573 Ga0501037_0472884 Ga0501037_0472884_91_834 247
472 3300005334 Ga0068869_100086868 Ga0068869_1000868682 248
473 3300005340 Ga0070689_100009432 Ga0070689_1000094327 248
474 3300005364 Ga0070673_100313635 Ga0070673_1003136352 248
475 3300005467 Ga0070706_100088496 Ga0070706_1000884963 248
476 3300005546 Ga0070696_100048890 Ga0070696_1000488901 248
477 3300005618 Ga0068864_100010461 Ga0068864_1000104616 248
478 3300005840 Ga0068870_10022762 Ga0068870_100227623 248
479 3300005841 Ga0068863_100081003 Ga0068863_1000810032 248
480 3300005841 Ga0068863_100165629 Ga0068863_1001656292 248
481 3300006852 Ga0075433_10035192 Ga0075433_100351923 248
482 3300006852 Ga0075433_10081560 Ga0075433_100815603 248
483 3300006914 Ga0075436_100143438 Ga0075436_1001434382 248
484 3300009147 Ga0114129_10391021 Ga0114129_103910211 248
485 3300009148 Ga0105243_10341298 Ga0105243_103412982 248
486 3300009174 Ga0105241_10117684 Ga0105241_101176842 248
487 3300009176 Ga0105242_10397950 Ga0105242_103979501 248
488 3300011119 Ga0105246_10313261 Ga0105246_103132612 248
489 3300013308 Ga0157375_10435580 Ga0157375_104355802 248
490 3300014326 Ga0157380_10513312 Ga0157380_105133121 248
491 3300025908 Ga0207643_10001907 Ga0207643_100019078 248
492 3300025925 Ga0207650_10029390 Ga0207650_100293903 248
493 3300025940 Ga0207691_10076975 Ga0207691_100769752 248
494 3300025942 Ga0207689_10061273 Ga0207689_100612732 248
495 3300026088 Ga0207641_10164308 Ga0207641_101643081 248
496 3300026116 Ga0207674_10440546 Ga0207674_104405462 248
497 3300026118 Ga0207675_100042468 Ga0207675_1000424682 248
498 3300028573 Ga0265334_10094912 Ga0265334_100949122 248
499 3300028800 Ga0265338_10071265 Ga0265338_100712652 248
500 3300028800 Ga0265338_10525265 Ga0265338_105252651 248
501 3300031548 Ga0307408_100251747 Ga0307408_1002517471 248
502 3300031903 Ga0307407_10072696 Ga0307407_100726962 248
503 3300032005 Ga0307411_10133152 Ga0307411_101331521 248
504 3300037853 Ga0436364_0296140 Ga0436364_0296140_102_854 248
505 3300049515 Ga0501292_003457 Ga0501292_003457_1299_2045 248
506 3300049650 Ga0501199_007105 Ga0501199_007105_340_1086 248
507 3300049651 Ga0501201_006228 Ga0501201_006228_346_1092 248
508 3300049664 Ga0501224_006070 Ga0501224_006070_77_823 248
509 3300049665 Ga0501227_031336 Ga0501227_031336_357_1103 248
510 3300049667 Ga0501230_010270 Ga0501230_010270_31_777 248
511 3300049668 Ga0501233_027182 Ga0501233_027182_346_1092 248
512 3300049704 Ga0501221_054671 Ga0501221_054671_46_792 248
513 3300049705 Ga0501225_0067088 Ga0501225_0067088_49_795 248
514 3300049769 Ga0501272_004542 Ga0501272_004542_619_1365 248
515 3300049770 Ga0501273_007509 Ga0501273_007509_56_802 248
516 3300049851 Ga0501212_003475 Ga0501212_003475_945_1691 248
517 3300050507 nmdc:mga05p37_52504_c1 nmdc:mga05p37_52504_c1_892_1638 248
518 3300050514 nmdc:mga08x19_51624_c1 nmdc:mga08x19_51624_c1_1336_2082 248
519 3300050515 nmdc:mga0a205_94964_c1 nmdc:mga0a205_94964_c1_929_1675 248
520 3300005330 Ga0070690_100019914 Ga0070690_1000199143 249
521 3300005345 Ga0070692_10304276 Ga0070692_103042761 249
522 3300005438 Ga0070701_10121120 Ga0070701_101211202 249
523 3300005441 Ga0070700_100000122 Ga0070700_1000001224 249
524 3300005444 Ga0070694_100283957 Ga0070694_1002839571 249
525 3300005444 Ga0070694_100442347 Ga0070694_1004423471 249
526 3300005459 Ga0068867_100533769 Ga0068867_1005337692 249
527 3300005467 Ga0070706_100063507 Ga0070706_1000635072 249
528 3300005468 Ga0070707_100000556 Ga0070707_1000005565 249
529 3300005471 Ga0070698_100019542 Ga0070698_1000195422 249
530 3300005518 Ga0070699_100005655 Ga0070699_1000056558 249
531 3300005536 Ga0070697_100012754 Ga0070697_1000127543 249
532 3300005578 Ga0068854_100029189 Ga0068854_1000291893 249
533 3300005617 Ga0068859_100261377 Ga0068859_1002613772 249
534 3300005844 Ga0068862_100143069 Ga0068862_1001430692 249
535 3300006931 Ga0097620_100261379 Ga0097620_1002613792 249
536 3300013297 Ga0157378_10088325 Ga0157378_100883252 249
537 3300013297 Ga0157378_10202258 Ga0157378_102022581 249
538 3300013308 Ga0157375_10959226 Ga0157375_109592262 249
539 3300014326 Ga0157380_10006509 Ga0157380_100065093 249
540 3300021384 Ga0213876_10025569 Ga0213876_100255693 249
541 3300021388 Ga0213875_10036253 Ga0213875_100362533 249
542 3300025910 Ga0207684_10096684 Ga0207684_100966842 249
543 3300025910 Ga0207684_10172291 Ga0207684_101722911 249
544 3300025918 Ga0207662_10145966 Ga0207662_101459662 249
545 3300025922 Ga0207646_10000078 Ga0207646_1000007835 249
546 3300025942 Ga0207689_10117270 Ga0207689_101172702 249
547 3300025960 Ga0207651_10183114 Ga0207651_101831142 249
548 3300025981 Ga0207640_10104195 Ga0207640_101041952 249
549 3300026075 Ga0207708_10327495 Ga0207708_103274952 249
550 3300026089 Ga0207648_10610540 Ga0207648_106105401 249
551 3300026116 Ga0207674_10519068 Ga0207674_105190682 249
552 3300028379 Ga0268266_10012462 Ga0268266_100124626 249
553 3300028380 Ga0268265_10154289 Ga0268265_101542892 249
554 3300028381 Ga0268264_10369045 Ga0268264_103690452 249
555 3300037853 Ga0436364_1285749 Ga0436364_1285749_3611_4372 249
556 3300039437 Ga0436365_1385458 Ga0436365_1385458_983_1744 249
557 3300046678 Ga0495599_0275102 Ga0495599_0275102_164_955 249
558 3300003203 JGI25406J46586_10005418 JGI25406J46586_100054181 250
559 3300005406 Ga0070703_10021364 Ga0070703_100213642 250
560 3300005434 Ga0070709_10050176 Ga0070709_100501762 250
561 3300005440 Ga0070705_100004461 Ga0070705_1000044613 250
562 3300005444 Ga0070694_100010103 Ga0070694_1000101032 250
563 3300005445 Ga0070708_100063815 Ga0070708_1000638153 250
564 3300005458 Ga0070681_10472221 Ga0070681_104722211 250
565 3300005467 Ga0070706_100009122 Ga0070706_1000091224 250
566 3300005518 Ga0070699_100005039 Ga0070699_1000050392 250
567 3300005530 Ga0070679_100031421 Ga0070679_1000314212 250
568 3300005536 Ga0070697_100001443 Ga0070697_1000014436 250
569 3300005545 Ga0070695_100001424 Ga0070695_1000014242 250
570 3300005546 Ga0070696_100002349 Ga0070696_10000234912 250
571 3300005547 Ga0070693_100000120 Ga0070693_10000012026 250
572 3300005549 Ga0070704_100001083 Ga0070704_1000010833 250
573 3300005618 Ga0068864_100530300 Ga0068864_1005303002 250
574 3300005985 Ga0081539_10000654 Ga0081539_1000065435 250
575 3300005985 Ga0081539_10109872 Ga0081539_101098722 250
576 3300007265 Ga0099794_10069046 Ga0099794_100690462 250
577 3300013297 Ga0157378_10045898 Ga0157378_100458983 250
578 3300014968 Ga0157379_10000101 Ga0157379_1000010150 250
579 3300014969 Ga0157376_10054933 Ga0157376_100549332 250
580 3300025885 Ga0207653_10035550 Ga0207653_100355501 250
581 3300025910 Ga0207684_10008349 Ga0207684_100083494 250
582 3300025912 Ga0207707_10404333 Ga0207707_104043332 250
583 3300025921 Ga0207652_10057983 Ga0207652_100579832 250
584 3300031235 Ga0265330_10012136 Ga0265330_100121365 250
585 3300031238 Ga0265332_10010411 Ga0265332_100104114 250
586 3300031239 Ga0265328_10074129 Ga0265328_100741292 250
587 3300031240 Ga0265320_10002223 Ga0265320_100022238 250
588 3300031241 Ga0265325_10019926 Ga0265325_100199265 250
589 3300031250 Ga0265331_10001396 Ga0265331_1000139615 250
590 3300031344 Ga0265316_10003614 Ga0265316_100036142 250
591 3300031712 Ga0265342_10126973 Ga0265342_101269731 250
592 3300031712 Ga0265342_10179988 Ga0265342_101799882 250
593 3300032002 Ga0307416_101098266 Ga0307416_1010982662 250
594 3300037068 Ga0373925_0009911 Ga0373925_0009911_4816_5574 250
595 3300046472 Ga0495580_0004284 Ga0495580_0004284_6707_7465 250
596 3300005441 Ga0070700_100361794 Ga0070700_1003617941 251
597 3300005468 Ga0070707_100709309 Ga0070707_1007093091 251
598 3300006914 Ga0075436_100017099 Ga0075436_1000170993 251
599 3300025917 Ga0207660_10145220 Ga0207660_101452202 251
600 3300026075 Ga0207708_10662428 Ga0207708_106624281 251
601 3300039438 Ga0436360_0923887 Ga0436360_0923887_7338_8102 251
602 3300039447 Ga0436361_0863641 Ga0436361_0863641_10382_11146 251
603 3300050514 nmdc:mga08x19_13355_c1 nmdc:mga08x19_13355_c1_2527_3300 251
604 3300005353 Ga0070669_100101798 Ga0070669_1001017981 252
605 3300005438 Ga0070701_10131294 Ga0070701_101312942 252
606 3300005459 Ga0068867_100125133 Ga0068867_1001251332 252
607 3300005578 Ga0068854_100076161 Ga0068854_1000761613 252
608 3300005617 Ga0068859_100837585 Ga0068859_1008375851 252
609 3300005718 Ga0068866_10152582 Ga0068866_101525821 252
610 3300005844 Ga0068862_100793972 Ga0068862_1007939721 252
611 3300006847 Ga0075431_100195358 Ga0075431_1001953582 252
612 3300006871 Ga0075434_100105034 Ga0075434_1001050344 252
613 3300006880 Ga0075429_100171091 Ga0075429_1001710912 252
614 3300006931 Ga0097620_100837677 Ga0097620_1008376771 252
615 3300009094 Ga0111539_10194061 Ga0111539_101940611 252
616 3300009147 Ga0114129_10237940 Ga0114129_102379403 252
617 3300009147 Ga0114129_10314479 Ga0114129_103144792 252
618 3300009553 Ga0105249_10042577 Ga0105249_100425772 252
619 3300013308 Ga0157375_10024889 Ga0157375_100248891 252
620 3300014326 Ga0157380_10000079 Ga0157380_1000007921 252
621 3300025923 Ga0207681_10291375 Ga0207681_102913751 252
622 3300025938 Ga0207704_10709599 Ga0207704_107095991 252
623 3300025961 Ga0207712_10047870 Ga0207712_100478703 252
624 3300025981 Ga0207640_10230299 Ga0207640_102302992 252
625 3300026075 Ga0207708_10059405 Ga0207708_100594051 252
626 3300026089 Ga0207648_10102318 Ga0207648_101023183 252
627 3300028380 Ga0268265_10075195 Ga0268265_100751951 252
628 3300049574 Ga0501038_0003771 Ga0501038_0003771_9569_10333 252
629 3300050507 nmdc:mga05p37_168016_c1 nmdc:mga05p37_168016_c1_105_863 252
630 3300050510 nmdc:mga06r32_160811_c1 nmdc:mga06r32_160811_c1_355_1113 252
631 3300003203 JGI25406J46586_10016199 JGI25406J46586_100161993 253
632 3300005289 Ga0065704_10001951 Ga0065704_100019518 253
633 3300005289 Ga0065704_10007121 Ga0065704_100071214 253
634 3300005290 Ga0065712_10002363 Ga0065712_100023634 253
635 3300005290 Ga0065712_10068601 Ga0065712_100686018 253
636 3300005290 Ga0065712_10149654 Ga0065712_101496542 253
637 3300005293 Ga0065715_10005851 Ga0065715_100058514 253
638 3300005293 Ga0065715_10217063 Ga0065715_102170632 253
639 3300005295 Ga0065707_10001745 Ga0065707_100017457 253
640 3300005295 Ga0065707_10002540 Ga0065707_100025404 253
641 3300005295 Ga0065707_10095984 Ga0065707_100959843 253
642 3300005330 Ga0070690_100022292 Ga0070690_1000222922 253
643 3300005334 Ga0068869_100031699 Ga0068869_1000316993 253
644 3300005334 Ga0068869_100123941 Ga0068869_1001239412 253
645 3300005337 Ga0070682_100068715 Ga0070682_1000687152 253
646 3300005338 Ga0068868_100017053 Ga0068868_1000170531 253
647 3300005340 Ga0070689_100027225 Ga0070689_1000272252 253
648 3300005343 Ga0070687_100010363 Ga0070687_1000103633 253
649 3300005347 Ga0070668_100488770 Ga0070668_1004887701 253
650 3300005354 Ga0070675_100353457 Ga0070675_1003534572 253
651 3300005355 Ga0070671_100004147 Ga0070671_1000041472 253
652 3300005355 Ga0070671_100017451 Ga0070671_1000174513 253
653 3300005364 Ga0070673_100027151 Ga0070673_1000271512 253
654 3300005364 Ga0070673_100284413 Ga0070673_1002844132 253
655 3300005365 Ga0070688_100170509 Ga0070688_1001705092 253
656 3300005365 Ga0070688_100441915 Ga0070688_1004419151 253
657 3300005367 Ga0070667_100144584 Ga0070667_1001445842 253
658 3300005406 Ga0070703_10000169 Ga0070703_1000016926 253
659 3300005435 Ga0070714_100008928 Ga0070714_1000089282 253
660 3300005438 Ga0070701_10029425 Ga0070701_100294253 253
661 3300005438 Ga0070701_10157239 Ga0070701_101572392 253
662 3300005441 Ga0070700_100013304 Ga0070700_1000133041 253
663 3300005441 Ga0070700_100379352 Ga0070700_1003793521 253
664 3300005444 Ga0070694_100000497 Ga0070694_10000049710 253
665 3300005444 Ga0070694_100025490 Ga0070694_1000254903 253
666 3300005444 Ga0070694_100136256 Ga0070694_1001362562 253
667 3300005445 Ga0070708_100009886 Ga0070708_1000098864 253
668 3300005456 Ga0070678_100033270 Ga0070678_1000332702 253
669 3300005459 Ga0068867_100032731 Ga0068867_1000327313 253
670 3300005467 Ga0070706_100112848 Ga0070706_1001128483 253
671 3300005471 Ga0070698_100045461 Ga0070698_1000454612 253
672 3300005471 Ga0070698_100065817 Ga0070698_1000658172 253
673 3300005471 Ga0070698_100154735 Ga0070698_1001547352 253
674 3300005530 Ga0070679_100174323 Ga0070679_1001743233 253
675 3300005536 Ga0070697_100117501 Ga0070697_1001175013 253
676 3300005539 Ga0068853_100116933 Ga0068853_1001169333 253
677 3300005543 Ga0070672_100055206 Ga0070672_1000552062 253
678 3300005543 Ga0070672_100565713 Ga0070672_1005657132 253
679 3300005545 Ga0070695_100134565 Ga0070695_1001345652 253
680 3300005545 Ga0070695_100247436 Ga0070695_1002474362 253
681 3300005545 Ga0070695_100361806 Ga0070695_1003618062 253
682 3300005545 Ga0070695_100559032 Ga0070695_1005590321 253
683 3300005546 Ga0070696_100292687 Ga0070696_1002926872 253
684 3300005547 Ga0070693_100076437 Ga0070693_1000764372 253
685 3300005548 Ga0070665_100428194 Ga0070665_1004281942 253
686 3300005549 Ga0070704_100021552 Ga0070704_1000215523 253
687 3300005549 Ga0070704_100107395 Ga0070704_1001073951 253
688 3300005564 Ga0070664_100435051 Ga0070664_1004350512 253
689 3300005577 Ga0068857_100206718 Ga0068857_1002067182 253
690 3300005615 Ga0070702_100021283 Ga0070702_1000212832 253
691 3300005616 Ga0068852_100073151 Ga0068852_1000731512 253
692 3300005617 Ga0068859_100028814 Ga0068859_1000288141 253
693 3300005617 Ga0068859_100049326 Ga0068859_1000493262 253
694 3300005617 Ga0068859_100087485 Ga0068859_1000874853 253
695 3300005617 Ga0068859_100109287 Ga0068859_1001092873 253
696 3300005617 Ga0068859_100200012 Ga0068859_1002000122 253
697 3300005618 Ga0068864_100075146 Ga0068864_1000751461 253
698 3300005618 Ga0068864_100852721 Ga0068864_1008527211 253
699 3300005718 Ga0068866_10018871 Ga0068866_100188713 253
700 3300005719 Ga0068861_100016775 Ga0068861_1000167754 253
701 3300005841 Ga0068863_100072812 Ga0068863_1000728123 253
702 3300005842 Ga0068858_100407305 Ga0068858_1004073052 253
703 3300005842 Ga0068858_100408252 Ga0068858_1004082522 253
704 3300005843 Ga0068860_100002648 Ga0068860_10000264811 253
705 3300005843 Ga0068860_100007291 Ga0068860_1000072915 253
706 3300005843 Ga0068860_100184222 Ga0068860_1001842223 253
707 3300005844 Ga0068862_100068954 Ga0068862_1000689542 253
708 3300005985 Ga0081539_10000428 Ga0081539_1000042832 253
709 3300005985 Ga0081539_10001420 Ga0081539_100014209 253
710 3300006237 Ga0097621_100168148 Ga0097621_1001681482 253
711 3300006844 Ga0075428_100102473 Ga0075428_1001024734 253
712 3300006844 Ga0075428_100115401 Ga0075428_1001154014 253
713 3300006844 Ga0075428_100264774 Ga0075428_1002647742 253
714 3300006846 Ga0075430_100136164 Ga0075430_1001361643 253
715 3300006852 Ga0075433_10090867 Ga0075433_100908672 253
716 3300006852 Ga0075433_10525299 Ga0075433_105252992 253
717 3300006871 Ga0075434_100215076 Ga0075434_1002150762 253
718 3300006871 Ga0075434_100750045 Ga0075434_1007500452 253
719 3300006880 Ga0075429_100003364 Ga0075429_1000033646 253
720 3300006914 Ga0075436_100216534 Ga0075436_1002165342 253
721 3300006931 Ga0097620_100028817 Ga0097620_1000288171 253
722 3300006931 Ga0097620_100049325 Ga0097620_1000493254 253
723 3300006931 Ga0097620_100087487 Ga0097620_1000874873 253
724 3300006931 Ga0097620_100109290 Ga0097620_1001092903 253
725 3300006931 Ga0097620_100200015 Ga0097620_1002000152 253
726 3300007076 Ga0075435_100050247 Ga0075435_1000502471 253
727 3300009101 Ga0105247_10058770 Ga0105247_100587703 253
728 3300009148 Ga0105243_10000029 Ga0105243_1000002999 253
729 3300009148 Ga0105243_10138308 Ga0105243_101383081 253
730 3300009176 Ga0105242_10000009 Ga0105242_1000000979 253
731 3300009177 Ga0105248_10002691 Ga0105248_1000269110 253
732 3300009177 Ga0105248_10121188 Ga0105248_101211882 253
733 3300009177 Ga0105248_10555829 Ga0105248_105558291 253
734 3300009553 Ga0105249_10372351 Ga0105249_103723513 253
735 3300013306 Ga0163162_10030482 Ga0163162_100304822 253
736 3300013308 Ga0157375_10105442 Ga0157375_101054422 253
737 3300014325 Ga0163163_10011974 Ga0163163_100119743 253
738 3300014968 Ga0157379_10500422 Ga0157379_105004222 253
739 3300017792 Ga0163161_10235858 Ga0163161_102358582 253
740 3300025315 Ga0207697_10054007 Ga0207697_100540072 253
741 3300025885 Ga0207653_10000117 Ga0207653_100001173 253
742 3300025900 Ga0207710_10001685 Ga0207710_100016857 253
743 3300025900 Ga0207710_10204565 Ga0207710_102045651 253
744 3300025904 Ga0207647_10261654 Ga0207647_102616542 253
745 3300025906 Ga0207699_10239448 Ga0207699_102394482 253
746 3300025908 Ga0207643_10083367 Ga0207643_100833672 253
747 3300025910 Ga0207684_10000030 Ga0207684_1000003095 253
748 3300025910 Ga0207684_10226283 Ga0207684_102262832 253
749 3300025911 Ga0207654_10222501 Ga0207654_102225011 253
750 3300025914 Ga0207671_10279548 Ga0207671_102795482 253
751 3300025918 Ga0207662_10005761 Ga0207662_100057617 253
752 3300025918 Ga0207662_10337509 Ga0207662_103375091 253
753 3300025921 Ga0207652_10231851 Ga0207652_102318512 253
754 3300025926 Ga0207659_10176617 Ga0207659_101766172 253
755 3300025931 Ga0207644_10003009 Ga0207644_100030092 253
756 3300025931 Ga0207644_10011976 Ga0207644_100119763 253
757 3300025934 Ga0207686_10000010 Ga0207686_1000001078 253
758 3300025935 Ga0207709_10000052 Ga0207709_1000005278 253
759 3300025935 Ga0207709_10057770 Ga0207709_100577702 253
760 3300025940 Ga0207691_10000666 Ga0207691_1000066621 253
761 3300025941 Ga0207711_10010137 Ga0207711_100101372 253
762 3300025942 Ga0207689_10028027 Ga0207689_100280273 253
763 3300025942 Ga0207689_10042068 Ga0207689_100420683 253
764 3300025961 Ga0207712_10241090 Ga0207712_102410902 253
765 3300025961 Ga0207712_10411799 Ga0207712_104117992 253
766 3300025981 Ga0207640_10155434 Ga0207640_101554342 253
767 3300026035 Ga0207703_10090531 Ga0207703_100905312 253
768 3300026035 Ga0207703_10320865 Ga0207703_103208652 253
769 3300026041 Ga0207639_10202526 Ga0207639_102025262 253
770 3300026075 Ga0207708_10000201 Ga0207708_100002014 253
771 3300026075 Ga0207708_10256994 Ga0207708_102569943 253
772 3300026075 Ga0207708_10320648 Ga0207708_103206482 253
773 3300026088 Ga0207641_10092122 Ga0207641_100921222 253
774 3300026088 Ga0207641_10501538 Ga0207641_105015382 253
775 3300026116 Ga0207674_10042576 Ga0207674_100425763 253
776 3300026118 Ga0207675_100000467 Ga0207675_10000046710 253
777 3300026118 Ga0207675_100019220 Ga0207675_1000192203 253
778 3300026118 Ga0207675_100250274 Ga0207675_1002502742 253
779 3300026118 Ga0207675_100367280 Ga0207675_1003672802 253
780 3300027907 Ga0207428_10000767 Ga0207428_1000076726 253
781 3300027907 Ga0207428_10007143 Ga0207428_100071437 253
782 3300028381 Ga0268264_10007459 Ga0268264_100074595 253
783 3300028381 Ga0268264_10218368 Ga0268264_102183682 253
784 3300031731 Ga0307405_10056646 Ga0307405_100566462 253
785 3300031824 Ga0307413_10109766 Ga0307413_101097662 253
786 3300031852 Ga0307410_10016981 Ga0307410_100169812 253
787 3300031901 Ga0307406_10082184 Ga0307406_100821842 253
788 3300031903 Ga0307407_10488522 Ga0307407_104885221 253
789 3300031911 Ga0307412_10145489 Ga0307412_101454892 253
790 3300031995 Ga0307409_100110810 Ga0307409_1001108102 253
791 3300032002 Ga0307416_100037712 Ga0307416_1000377122 253
792 3300032004 Ga0307414_10022236 Ga0307414_100222363 253
793 3300032126 Ga0307415_100117942 Ga0307415_1001179422 253
794 3300046537 Ga0495598_0037142 Ga0495598_0037142_536_1297 253
795 3300048913 Ga0496110_0168957 Ga0496110_0168957_464_1228 253
796 3300048915 Ga0496112_0212342 Ga0496112_0212342_700_1464 253
797 3300048916 Ga0496113_0287631 Ga0496113_0287631_207_971 253
798 3300049515 Ga0501292_011859 Ga0501292_011859_249_1010 253
799 3300049520 Ga0501297_011044 Ga0501297_011044_184_945 253
800 3300049521 Ga0501298_003875 Ga0501298_003875_633_1394 253
801 3300049651 Ga0501201_003862 Ga0501201_003862_466_1227 253
802 3300049652 Ga0501202_018631 Ga0501202_018631_98_859 253
803 3300049660 Ga0501216_013165 Ga0501216_013165_531_1292 253
804 3300049668 Ga0501233_020966 Ga0501233_020966_368_1129 253
805 3300049688 Ga0501259_003056 Ga0501259_003056_1148_1909 253
806 3300049705 Ga0501225_0012870 Ga0501225_0012870_399_1160 253
807 3300049758 Ga0501241_049675 Ga0501241_049675_12_773 253
808 3300049762 Ga0501265_009070 Ga0501265_009070_145_906 253
809 3300049775 Ga0501279_007885 Ga0501279_007885_41_802 253
810 3300050508 nmdc:mga09592_7180_c1 nmdc:mga09592_7180_c1_5002_5796 253
811 3300050509 nmdc:mga0qj67_182866_c1 nmdc:mga0qj67_182866_c1_571_1362 253
812 3300050510 nmdc:mga06r32_237747_c1 nmdc:mga06r32_237747_c1_27_821 253
813 3300050511 nmdc:mga08y16_11109_c1 nmdc:mga08y16_11109_c1_2530_3354 253
814 3300050512 nmdc:mga0n895_189892_c1 nmdc:mga0n895_189892_c1_1119_1883 253
815 3300050514 nmdc:mga08x19_106624_c1 nmdc:mga08x19_106624_c1_978_1760 253
816 3300050514 nmdc:mga08x19_112742_c1 nmdc:mga08x19_112742_c1_178_957 253
817 3300050515 nmdc:mga0a205_276151_c1 nmdc:mga0a205_276151_c1_485_1255 253
818 3300002074 JGI24748J21848_1000001 JGI24748J21848_1000001227 254
819 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001190 254
820 3300005289 Ga0065704_10150020 Ga0065704_101500202 254
821 3300005330 Ga0070690_100050501 Ga0070690_1000505012 254
822 3300005343 Ga0070687_100060050 Ga0070687_1000600502 254
823 3300005353 Ga0070669_100058546 Ga0070669_1000585462 254
824 3300005355 Ga0070671_100055850 Ga0070671_1000558503 254
825 3300005440 Ga0070705_100156621 Ga0070705_1001566212 254
826 3300005441 Ga0070700_100156833 Ga0070700_1001568331 254
827 3300005518 Ga0070699_100237326 Ga0070699_1002373263 254
828 3300005536 Ga0070697_100018631 Ga0070697_1000186314 254
829 3300005536 Ga0070697_100089016 Ga0070697_1000890162 254
830 3300005544 Ga0070686_100087615 Ga0070686_1000876152 254
831 3300005544 Ga0070686_100094373 Ga0070686_1000943732 254
832 3300005545 Ga0070695_100088508 Ga0070695_1000885081 254
833 3300005546 Ga0070696_100005110 Ga0070696_1000051106 254
834 3300005546 Ga0070696_100471192 Ga0070696_1004711921 254
835 3300005546 Ga0070696_100568590 Ga0070696_1005685901 254
836 3300005842 Ga0068858_100000044 Ga0068858_10000004486 254
837 3300005985 Ga0081539_10000652 Ga0081539_100006525 254
838 3300006173 Ga0070716_100211555 Ga0070716_1002115552 254
839 3300006852 Ga0075433_10035892 Ga0075433_100358924 254
840 3300006852 Ga0075433_10286765 Ga0075433_102867652 254
841 3300006871 Ga0075434_100228789 Ga0075434_1002287891 254
842 3300006914 Ga0075436_100019380 Ga0075436_1000193804 254
843 3300006931 Ga0097620_100454623 Ga0097620_1004546232 254
844 3300009098 Ga0105245_10364776 Ga0105245_103647762 254
845 3300009101 Ga0105247_10000004 Ga0105247_10000004229 254
846 3300009147 Ga0114129_10003845 Ga0114129_100038453 254
847 3300009147 Ga0114129_10073463 Ga0114129_100734633 254
848 3300013297 Ga0157378_10037174 Ga0157378_100371743 254
849 3300013307 Ga0157372_10235884 Ga0157372_102358841 254
850 3300014968 Ga0157379_10080070 Ga0157379_100800702 254
851 3300017792 Ga0163161_10182506 Ga0163161_101825062 254
852 3300025223 Ga0207672_1000079 Ga0207672_10000794 254
853 3300025900 Ga0207710_10000002 Ga0207710_10000002784 254
854 3300025910 Ga0207684_10015129 Ga0207684_100151295 254
855 3300025913 Ga0207695_10290559 Ga0207695_102905591 254
856 3300025922 Ga0207646_10065064 Ga0207646_100650642 254
857 3300025931 Ga0207644_10000961 Ga0207644_1000096113 254
858 3300025934 Ga0207686_10240884 Ga0207686_102408842 254
859 3300025938 Ga0207704_10292329 Ga0207704_102923292 254
860 3300025939 Ga0207665_10317404 Ga0207665_103174042 254
861 3300025960 Ga0207651_10011455 Ga0207651_100114554 254
862 3300026035 Ga0207703_10000032 Ga0207703_1000003268 254
863 3300026078 Ga0207702_10347310 Ga0207702_103473102 254
864 3300026095 Ga0207676_10200655 Ga0207676_102006552 254
865 3300026118 Ga0207675_100108812 Ga0207675_1001088123 254
866 3300027671 Ga0209588_1008957 Ga0209588_10089572 254
867 3300032002 Ga0307416_100210934 Ga0307416_1002109342 254
868 3300037853 Ga0436364_0236212 Ga0436364_0236212_5883_6659 254
869 3300046462 Ga0495651_0000564 Ga0495651_0000564_368_1144 254
870 3300046477 Ga0495664_0027998 Ga0495664_0027998_808_1584 254
871 3300046559 Ga0495667_0000245 Ga0495667_0000245_13692_14468 254
872 3300047322 Ga0495680_0000371 Ga0495680_0000371_14074_14850 254
873 3300047444 Ga0495675_0036155 Ga0495675_0036155_1212_1988 254
874 3300050507 nmdc:mga05p37_214881_c1 nmdc:mga05p37_214881_c1_1394_2158 254
875 3300050507 nmdc:mga05p37_332480_c1 nmdc:mga05p37_332480_c1_776_1540 254
876 3300050513 nmdc:mga0rr50_44203_c1 nmdc:mga0rr50_44203_c1_793_1557 254
877 3300050514 nmdc:mga08x19_1730_c1 nmdc:mga08x19_1730_c1_1843_2628 254
878 3300050515 nmdc:mga0a205_62173_c1 nmdc:mga0a205_62173_c1_563_1396 254
879 3300053153 Ga0500616_0002625 Ga0500616_0002625_6239_7003 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

4

239

0.94

PF12804

NTP_transf_3

MobA-like NTP transferase domain

5

142

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hl3-assembly1.cif.gz_A 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose. 0.9617 2 236
1mc3-assembly1.cif.gz_A crystal structure of rffh 0.948 1 235
1mp3-assembly1.cif.gz_A l89t variant of s. enterica rmla 0.946 2 235
1iim-assembly1.cif.gz_A thymidylyltransferase complexed with ttp 0.9451 2 235
1mp5-assembly1.cif.gz_D y177f variant of s. enterica rmla 0.9441 2 235
ID Description Score Start End Superfamily
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9484 1 220 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.948 2 249 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9353 1 220 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9302 2 235 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9251 2 249 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4P5WH85-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9941 14 241 GO:0008879
GO:0045226
AF-A0A2V9BEQ1-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9928 1 129 GO:0008879
GO:0045226
AF-A0A7C5UBV5-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9916 1 244 GO:0008879
GO:0045226
AF-A0A2V9BQR4-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9915 1 237 GO:0008879
GO:0045226
AF-A0A1V5J3E3-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9914 94 241 GO:0008879
GO:0045226

Feature Viewer

pLDDT pTM Quality
92.97 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map