F484459
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 879 | 505 | 706 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300021377|Ga0213874_10002639|Ga0213874_100026393 |
| Length | 321 |
| Sequence | MCARAGSLGDGRPMPRLSVREMSFAAIIVVALAAALPFFVSDYVLGVLTPGFYIAVFAMAWDLLFGFANEVNFGPTFLIGLGAYAAGIIDNRLGWAIWLCVAAGTAAAVAGGLVLALPALRVRGPYFGLTTLVAVLILSNLIVVFADLTGGEIGLTVPDVISIDAHANYWIALGFMSASGAILFALSRSPMGLILQASGQDAVQAGALGFNVTKHKLAAFTISAFFSGLAGALYVFYLGAASVGTLVDVTVGVQVIIAAVLGGRRTILGAALGAIFLIGATEALRPLGELATLVVSAVALLIVLFFPNGLLALIARIGGRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 9 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 10 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 11 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 12 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 15 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 16 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 17 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 18 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 19 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 20 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 21 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 22 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 23 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 24 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 25 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 26 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 27 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 28 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 29 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 30 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 31 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 32 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 33 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 34 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 35 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 36 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 37 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 38 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 39 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 40 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 41 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 42 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 43 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 44 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 45 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 46 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 47 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 48 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 49 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 50 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 51 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 52 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 53 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 54 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 55 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 56 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 57 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 58 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 59 | 2904699407 | |||
| 60 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 61 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 62 | 2906610324 | |||
| 63 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 64 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 65 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 66 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 67 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 68 | 2922368715 | |||
| 69 | 2922425934 | |||
| 70 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 71 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 72 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 73 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 74 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 75 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 76 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 77 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 78 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 79 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 80 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 81 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 82 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 83 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 84 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 85 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 86 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 87 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 88 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 89 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 90 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 91 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 92 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 93 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 94 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 95 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 96 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 97 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 98 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 99 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 100 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 101 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 102 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 103 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 104 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 105 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 106 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 107 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 108 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 109 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 110 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 111 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 112 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 113 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 114 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 115 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 116 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 117 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 118 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 119 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 120 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 121 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 122 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 123 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 124 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 125 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 126 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 127 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 128 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 129 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 130 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 131 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 132 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 133 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 134 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 135 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 136 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 137 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 138 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 139 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 140 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 141 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 142 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 143 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 144 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 147 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 148 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 149 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 150 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 151 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 152 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 153 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 160 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 162 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 166 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 167 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 168 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 169 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 170 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 171 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 172 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 173 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 175 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 177 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 178 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 179 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 180 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 181 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 182 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 183 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 184 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 185 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 186 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 187 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 188 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 190 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 191 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 192 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 193 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 194 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 195 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 197 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 198 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 199 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 200 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 201 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 202 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 204 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 205 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 215 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 228 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 229 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 230 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 231 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 232 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 233 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 238 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 284 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 285 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 286 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 287 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 291 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 295 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 296 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 297 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 298 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 299 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 300 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 301 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 302 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 303 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 304 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 305 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 306 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 307 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 308 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 309 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 310 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 311 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 312 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 313 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 314 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 315 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 316 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 317 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 318 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 319 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 321 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 323 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 324 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 325 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 326 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 327 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 328 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 329 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 330 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 331 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 332 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 333 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 334 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 335 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 336 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 337 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 338 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 339 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 340 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 341 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 342 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 343 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 344 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 345 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 390 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 391 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 392 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 393 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 394 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 397 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 398 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 399 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 400 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 401 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 402 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 403 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 404 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 405 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 406 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 407 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 408 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 409 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 438 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 439 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 440 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 441 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 442 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 443 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 446 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 452 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 453 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 454 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 456 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 457 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 458 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 459 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 460 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 461 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 462 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 463 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 464 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 465 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 466 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 467 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 468 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 469 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 470 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 471 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 473 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 474 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 475 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 476 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 477 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 478 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 479 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 480 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 481 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 482 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 483 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 484 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 485 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 486 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 487 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 488 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 489 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 490 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 491 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 492 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 493 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 494 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 495 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 496 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 497 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 498 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 499 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 500 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 501 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 502 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 503 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 504 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 505 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.23 |
| Metatranscriptomes | 0.46 |
| Isolates | 19.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.28 |
| Nodule | 16.95 |
| Rhizoplane | 3.64 |
| Rhizosphere | 60.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1006767 | 3300003214 | Bacteria | 1992 |
| 2 | JGI25160J50197_1007582 | 3300003354 | Bacteria | 4232 |
| 3 | Ga0055543_1013756 | 3300004625 | Bacteria | 1592 |
| 4 | Ga0065165_1004374 | 3300005262 | Bacteria | 8825 |
| 5 | Ga0070658_10056239 | 3300005327 | Bacteria | 3197 |
| 6 | Ga0070676_10289184 | 3300005328 | Bacteria | 1107 |
| 7 | Ga0070683_100001891 | 3300005329 | Bacteria | 16357 |
| 8 | Ga0070683_100019924 | 3300005329 | Bacteria | 5963 |
| 9 | Ga0070683_100072047 | 3300005329 | Bacteria | 3225 |
| 10 | Ga0070683_100658453 | 3300005329 | Bacteria | 1003 |
| 11 | Ga0068869_100001186 | 3300005334 | Bacteria | 15287 |
| 12 | Ga0070680_100016775 | 3300005336 | Bacteria | 5763 |
| 13 | Ga0070680_100195987 | 3300005336 | Bacteria | 1703 |
| 14 | Ga0070680_100312437 | 3300005336 | Bacteria | 1334 |
| 15 | Ga0070682_100056630 | 3300005337 | Bacteria | 2466 |
| 16 | Ga0070682_100316334 | 3300005337 | Bacteria | 1151 |
| 17 | Ga0068868_100002380 | 3300005338 | Bacteria | 13017 |
| 18 | Ga0070689_100090026 | 3300005340 | Bacteria | 2417 |
| 19 | Ga0070691_10186651 | 3300005341 | Bacteria | 1082 |
| 20 | Ga0070668_100008952 | 3300005347 | Bacteria | 7432 |
| 21 | Ga0070674_100161557 | 3300005356 | Bacteria | 1700 |
| 22 | Ga0070659_100051334 | 3300005366 | Bacteria | 3243 |
| 23 | Ga0070659_100256937 | 3300005366 | Bacteria | 1449 |
| 24 | Ga0070667_100362682 | 3300005367 | Bacteria | 1314 |
| 25 | Ga0070709_10002013 | 3300005434 | Bacteria | 11043 |
| 26 | Ga0070709_10005865 | 3300005434 | Bacteria | 6660 |
| 27 | Ga0070714_100006313 | 3300005435 | Bacteria | 9137 |
| 28 | Ga0070714_100041770 | 3300005435 | Bacteria | 3872 |
| 29 | Ga0070714_100173398 | 3300005435 | Bacteria | 1958 |
| 30 | Ga0070713_100004655 | 3300005436 | Bacteria | 9259 |
| 31 | Ga0070713_100039500 | 3300005436 | Bacteria | 3831 |
| 32 | Ga0070713_100164699 | 3300005436 | Bacteria | 1982 |
| 33 | Ga0070710_10000896 | 3300005437 | Bacteria | 14247 |
| 34 | Ga0070710_10002832 | 3300005437 | Bacteria | 8268 |
| 35 | Ga0070701_10083906 | 3300005438 | Bacteria | 1731 |
| 36 | Ga0070711_100007213 | 3300005439 | Bacteria | 6752 |
| 37 | Ga0070711_100008957 | 3300005439 | Bacteria | 6142 |
| 38 | Ga0070711_100093101 | 3300005439 | Bacteria | 2175 |
| 39 | Ga0070711_100119075 | 3300005439 | Bacteria | 1950 |
| 40 | Ga0070663_100033127 | 3300005455 | Bacteria | 3567 |
| 41 | Ga0070663_100036834 | 3300005455 | Bacteria | 3401 |
| 42 | Ga0070662_100132585 | 3300005457 | Bacteria | 1923 |
| 43 | Ga0070681_10076300 | 3300005458 | Bacteria | 3310 |
| 44 | Ga0070681_10146085 | 3300005458 | Bacteria | 2294 |
| 45 | Ga0070681_10315190 | 3300005458 | Bacteria | 1473 |
| 46 | Ga0070681_10493869 | 3300005458 | Bacteria | 1137 |
| 47 | Ga0070681_10511038 | 3300005458 | Bacteria | 1115 |
| 48 | Ga0070706_100118744 | 3300005467 | Bacteria | 2464 |
| 49 | Ga0070707_100171685 | 3300005468 | Bacteria | 2113 |
| 50 | Ga0070679_100029796 | 3300005530 | Bacteria | 5384 |
| 51 | Ga0070679_100291008 | 3300005530 | Bacteria | 1585 |
| 52 | Ga0070679_100316505 | 3300005530 | Bacteria | 1510 |
| 53 | Ga0070684_100010920 | 3300005535 | Bacteria | 7217 |
| 54 | Ga0070684_100052866 | 3300005535 | Bacteria | 3534 |
| 55 | Ga0070697_100093961 | 3300005536 | Bacteria | 2484 |
| 56 | Ga0068853_100035551 | 3300005539 | Bacteria | 4232 |
| 57 | Ga0068853_100169342 | 3300005539 | Bacteria | 1975 |
| 58 | Ga0070686_100053425 | 3300005544 | Bacteria | 2580 |
| 59 | Ga0070665_100012340 | 3300005548 | Bacteria | 8611 |
| 60 | Ga0070665_100035823 | 3300005548 | Bacteria | 4992 |
| 61 | Ga0068855_100040104 | 3300005563 | Bacteria | 5558 |
| 62 | Ga0068855_100072657 | 3300005563 | Bacteria | 3998 |
| 63 | Ga0068855_100077687 | 3300005563 | Bacteria | 3852 |
| 64 | Ga0068855_100097896 | 3300005563 | Bacteria | 3379 |
| 65 | Ga0068855_100328828 | 3300005563 | Bacteria | 1688 |
| 66 | Ga0068855_100342315 | 3300005563 | Bacteria | 1649 |
| 67 | Ga0068855_100425519 | 3300005563 | Bacteria | 1452 |
| 68 | Ga0070664_100026724 | 3300005564 | Bacteria | 4791 |
| 69 | Ga0070664_100152168 | 3300005564 | Bacteria | 2043 |
| 70 | Ga0070664_100410739 | 3300005564 | Bacteria | 1239 |
| 71 | Ga0068857_100017610 | 3300005577 | Bacteria | 6264 |
| 72 | Ga0068857_100028282 | 3300005577 | Bacteria | 4946 |
| 73 | Ga0068854_100097839 | 3300005578 | Bacteria | 2194 |
| 74 | Ga0068856_100000183 | 3300005614 | Bacteria | 65005 |
| 75 | Ga0068856_100029563 | 3300005614 | Bacteria | 5352 |
| 76 | Ga0068856_100063430 | 3300005614 | Bacteria | 3651 |
| 77 | Ga0068852_100053488 | 3300005616 | Bacteria | 3475 |
| 78 | Ga0068852_100230989 | 3300005616 | Bacteria | 1763 |
| 79 | Ga0068859_100063595 | 3300005617 | Bacteria | 3721 |
| 80 | Ga0068864_100049226 | 3300005618 | Bacteria | 3625 |
| 81 | Ga0068864_100122039 | 3300005618 | Bacteria | 2331 |
| 82 | Ga0068861_100042059 | 3300005719 | Bacteria | 3424 |
| 83 | Ga0068870_10004287 | 3300005840 | Bacteria | 6137 |
| 84 | Ga0068863_100027853 | 3300005841 | Bacteria | 5394 |
| 85 | Ga0068858_100041385 | 3300005842 | Bacteria | 4272 |
| 86 | Ga0068858_100589553 | 3300005842 | Bacteria | 1078 |
| 87 | Ga0068860_100093295 | 3300005843 | Bacteria | 2869 |
| 88 | Ga0081540_1002227 | 3300005983 | Bacteria | 15974 |
| 89 | Ga0081540_1005198 | 3300005983 | Bacteria | 9740 |
| 90 | Ga0081540_1006571 | 3300005983 | Bacteria | 8437 |
| 91 | Ga0081540_1006785 | 3300005983 | Bacteria | 8274 |
| 92 | Ga0081540_1018573 | 3300005983 | Bacteria | 4259 |
| 93 | Ga0070717_10087311 | 3300006028 | Bacteria | 2627 |
| 94 | Ga0070717_10429945 | 3300006028 | Bacteria | 1188 |
| 95 | Ga0075365_10059561 | 3300006038 | Bacteria | 2545 |
| 96 | Ga0075368_10019062 | 3300006042 | Bacteria | 2587 |
| 97 | Ga0075363_100010158 | 3300006048 | Bacteria | 4453 |
| 98 | Ga0075363_100048514 | 3300006048 | Bacteria | 2258 |
| 99 | Ga0075364_10024619 | 3300006051 | Bacteria | 3824 |
| 100 | Ga0075364_10295801 | 3300006051 | Bacteria | 1102 |
| 101 | Ga0070715_10000456 | 3300006163 | Bacteria | 10562 |
| 102 | Ga0070716_100011137 | 3300006173 | Bacteria | 4526 |
| 103 | Ga0070716_100023798 | 3300006173 | Bacteria | 3253 |
| 104 | Ga0070712_100015504 | 3300006175 | Bacteria | 4912 |
| 105 | Ga0075367_10001130 | 3300006178 | Bacteria | 11093 |
| 106 | Ga0075369_10005353 | 3300006186 | Bacteria | 4787 |
| 107 | Ga0075366_10016316 | 3300006195 | Bacteria | 4268 |
| 108 | Ga0075370_10009564 | 3300006353 | Bacteria | 5039 |
| 109 | Ga0075370_10017687 | 3300006353 | Bacteria | 3854 |
| 110 | Ga0068865_100055253 | 3300006881 | Bacteria | 2762 |
| 111 | Ga0075436_100088588 | 3300006914 | Bacteria | 2150 |
| 112 | Ga0097620_100063592 | 3300006931 | Bacteria | 3721 |
| 113 | Ga0099824_1021709 | 3300006942 | Bacteria | 4410 |
| 114 | Ga0099824_1033210 | 3300006942 | Bacteria | 1768 |
| 115 | Ga0099822_1024226 | 3300006943 | Bacteria | 5463 |
| 116 | Ga0105240_10039694 | 3300009093 | Bacteria | 6026 |
| 117 | Ga0105240_10109427 | 3300009093 | Bacteria | 3346 |
| 118 | Ga0105240_10121920 | 3300009093 | Bacteria | 3138 |
| 119 | Ga0105240_10135701 | 3300009093 | Bacteria | 2947 |
| 120 | Ga0105240_10276799 | 3300009093 | Bacteria | 1930 |
| 121 | Ga0111539_10714684 | 3300009094 | Bacteria | 1166 |
| 122 | Ga0105245_10005441 | 3300009098 | Bacteria | 11187 |
| 123 | Ga0105245_10038994 | 3300009098 | Bacteria | 4228 |
| 124 | Ga0105247_10005785 | 3300009101 | Bacteria | 7742 |
| 125 | Ga0105247_10240256 | 3300009101 | Bacteria | 1234 |
| 126 | Ga0105243_10042185 | 3300009148 | Bacteria | 3571 |
| 127 | Ga0105241_10037493 | 3300009174 | Bacteria | 3652 |
| 128 | Ga0105241_10211105 | 3300009174 | Bacteria | 1626 |
| 129 | Ga0105248_10646336 | 3300009177 | Bacteria | 1193 |
| 130 | Ga0105237_10017339 | 3300009545 | Bacteria | 7466 |
| 131 | Ga0105237_10095319 | 3300009545 | Bacteria | 2965 |
| 132 | Ga0105237_10138567 | 3300009545 | Bacteria | 2427 |
| 133 | Ga0105237_10298145 | 3300009545 | Bacteria | 1615 |
| 134 | Ga0105238_10142049 | 3300009551 | Bacteria | 2377 |
| 135 | Ga0105238_10398268 | 3300009551 | Bacteria | 1370 |
| 136 | Ga0099796_10010555 | 3300010159 | Bacteria | 2543 |
| 137 | Ga0105239_10003963 | 3300010375 | Bacteria | 17936 |
| 138 | Ga0105239_10109809 | 3300010375 | Bacteria | 3057 |
| 139 | Ga0105239_10546926 | 3300010375 | Bacteria | 1318 |
| 140 | Ga0105246_10379968 | 3300011119 | Bacteria | 1167 |
| 141 | Ga0157371_10237967 | 3300013102 | Bacteria | 1309 |
| 142 | Ga0157370_10097584 | 3300013104 | Bacteria | 2756 |
| 143 | Ga0157370_10205900 | 3300013104 | Bacteria | 1824 |
| 144 | Ga0157370_10338421 | 3300013104 | Bacteria | 1387 |
| 145 | Ga0157370_10357736 | 3300013104 | Bacteria | 1345 |
| 146 | Ga0157369_10012373 | 3300013105 | Bacteria | 9688 |
| 147 | Ga0157369_10026071 | 3300013105 | Bacteria | 6485 |
| 148 | Ga0157369_10083698 | 3300013105 | Bacteria | 3411 |
| 149 | Ga0157374_10634738 | 3300013296 | Bacteria | 1079 |
| 150 | Ga0157378_10172127 | 3300013297 | Bacteria | 2031 |
| 151 | Ga0163162_10025402 | 3300013306 | Bacteria | 5853 |
| 152 | Ga0163162_10146465 | 3300013306 | Bacteria | 2478 |
| 153 | Ga0157372_10034737 | 3300013307 | Bacteria | 5546 |
| 154 | Ga0157372_10048052 | 3300013307 | Bacteria | 4743 |
| 155 | Ga0157372_10326057 | 3300013307 | Bacteria | 1788 |
| 156 | Ga0157375_10011636 | 3300013308 | Bacteria | 7774 |
| 157 | Ga0163163_10007610 | 3300014325 | Bacteria | 9569 |
| 158 | Ga0163163_10073797 | 3300014325 | Bacteria | 3403 |
| 159 | Ga0157376_10153431 | 3300014969 | Bacteria | 2080 |
| 160 | Ga0213873_10000846 | 3300021358 | Bacteria | 4931 |
| 161 | Ga0213872_10000429 | 3300021361 | Bacteria | 34403 |
| 162 | Ga0213872_10004083 | 3300021361 | Bacteria | 7859 |
| 163 | Ga0213872_10004694 | 3300021361 | Bacteria | 7180 |
| 164 | Ga0213872_10016051 | 3300021361 | Bacteria | 3478 |
| 165 | Ga0213874_10002580 | 3300021377 | Bacteria | 3917 |
| 166 | Ga0213874_10002639 | 3300021377 | Bacteria | 3888 |
| 167 | Ga0213874_10005128 | 3300021377 | Bacteria | 3035 |
| 168 | Ga0213876_10001306 | 3300021384 | Bacteria | 15675 |
| 169 | Ga0213876_10001630 | 3300021384 | Bacteria | 13688 |
| 170 | Ga0213876_10134690 | 3300021384 | Bacteria | 1314 |
| 171 | Ga0213875_10000030 | 3300021388 | Bacteria | 178500 |
| 172 | Ga0213875_10003482 | 3300021388 | Bacteria | 8959 |
| 173 | Ga0213875_10003821 | 3300021388 | Bacteria | 8464 |
| 174 | Ga0213875_10007291 | 3300021388 | Bacteria | 5723 |
| 175 | Ga0213875_10010083 | 3300021388 | Bacteria | 4749 |
| 176 | Ga0213875_10014477 | 3300021388 | Bacteria | 3848 |
| 177 | Ga0213875_10019616 | 3300021388 | Bacteria | 3252 |
| 178 | Ga0213875_10046437 | 3300021388 | Bacteria | 2038 |
| 179 | Ga0213875_10077961 | 3300021388 | Bacteria | 1546 |
| 180 | Ga0213875_10091232 | 3300021388 | Bacteria | 1421 |
| 181 | Ga0213871_10068475 | 3300021441 | Bacteria | 999 |
| 182 | Ga0209677_100749 | 3300025253 | Bacteria | 16460 |
| 183 | Ga0209148_1000773 | 3300025254 | Bacteria | 23969 |
| 184 | Ga0209233_1003148 | 3300025261 | Bacteria | 5852 |
| 185 | Ga0209233_1004858 | 3300025261 | Bacteria | 4525 |
| 186 | Ga0209233_1005292 | 3300025261 | Bacteria | 4301 |
| 187 | Ga0209233_1005946 | 3300025261 | Bacteria | 3993 |
| 188 | Ga0209455_1001728 | 3300025272 | Bacteria | 9312 |
| 189 | Ga0209455_1008216 | 3300025272 | Bacteria | 2858 |
| 190 | Ga0209564_1003916 | 3300025295 | Bacteria | 9529 |
| 191 | Ga0209758_1000282 | 3300025297 | Bacteria | 100746 |
| 192 | Ga0209758_1004003 | 3300025297 | Bacteria | 12747 |
| 193 | Ga0209758_1027779 | 3300025297 | Bacteria | 2410 |
| 194 | Ga0207426_1000437 | 3300025302 | Bacteria | 67439 |
| 195 | Ga0207426_1001098 | 3300025302 | Bacteria | 24902 |
| 196 | Ga0207426_1012310 | 3300025302 | Bacteria | 3218 |
| 197 | Ga0207692_10002885 | 3300025898 | Bacteria | 6655 |
| 198 | Ga0207692_10005756 | 3300025898 | Bacteria | 4986 |
| 199 | Ga0207692_10009200 | 3300025898 | Bacteria | 4116 |
| 200 | Ga0207710_10018346 | 3300025900 | Bacteria | 2975 |
| 201 | Ga0207688_10019965 | 3300025901 | Bacteria | 3655 |
| 202 | Ga0207685_10000267 | 3300025905 | Bacteria | 8260 |
| 203 | Ga0207699_10002339 | 3300025906 | Bacteria | 8949 |
| 204 | Ga0207699_10003537 | 3300025906 | Bacteria | 7456 |
| 205 | Ga0207643_10025498 | 3300025908 | Bacteria | 3267 |
| 206 | Ga0207705_10082672 | 3300025909 | Bacteria | 2342 |
| 207 | Ga0207654_10021751 | 3300025911 | Bacteria | 3414 |
| 208 | Ga0207654_10029110 | 3300025911 | Bacteria | 3019 |
| 209 | Ga0207707_10018073 | 3300025912 | Bacteria | 6143 |
| 210 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 211 | Ga0207695_10019960 | 3300025913 | Bacteria | 7695 |
| 212 | Ga0207695_10078563 | 3300025913 | Bacteria | 3348 |
| 213 | Ga0207695_10133694 | 3300025913 | Bacteria | 2435 |
| 214 | Ga0207695_10251375 | 3300025913 | Bacteria | 1667 |
| 215 | Ga0207671_10008251 | 3300025914 | Bacteria | 8862 |
| 216 | Ga0207671_10051920 | 3300025914 | Bacteria | 3037 |
| 217 | Ga0207671_10092336 | 3300025914 | Bacteria | 2282 |
| 218 | Ga0207671_10139497 | 3300025914 | Bacteria | 1867 |
| 219 | Ga0207671_10223517 | 3300025914 | Bacteria | 1476 |
| 220 | Ga0207693_10000326 | 3300025915 | Bacteria | 44051 |
| 221 | Ga0207693_10003223 | 3300025915 | Bacteria | 14005 |
| 222 | Ga0207693_10015787 | 3300025915 | Bacteria | 6050 |
| 223 | Ga0207663_10000225 | 3300025916 | Bacteria | 25184 |
| 224 | Ga0207663_10009124 | 3300025916 | Bacteria | 5229 |
| 225 | Ga0207663_10096713 | 3300025916 | Bacteria | 1973 |
| 226 | Ga0207663_10116539 | 3300025916 | Bacteria | 1821 |
| 227 | Ga0207663_10132455 | 3300025916 | Bacteria | 1724 |
| 228 | Ga0207660_10228682 | 3300025917 | Bacteria | 1462 |
| 229 | Ga0207657_10004806 | 3300025919 | Bacteria | 14248 |
| 230 | Ga0207649_10102875 | 3300025920 | Bacteria | 1894 |
| 231 | Ga0207652_10013842 | 3300025921 | Bacteria | 6527 |
| 232 | Ga0207652_10023687 | 3300025921 | Bacteria | 5088 |
| 233 | Ga0207652_10084661 | 3300025921 | Bacteria | 2778 |
| 234 | Ga0207652_10525394 | 3300025921 | Bacteria | 1065 |
| 235 | Ga0207694_10132083 | 3300025924 | Bacteria | 2002 |
| 236 | Ga0207694_10525114 | 3300025924 | Bacteria | 992 |
| 237 | Ga0207664_10014435 | 3300025929 | Bacteria | 5704 |
| 238 | Ga0207664_10031784 | 3300025929 | Bacteria | 4042 |
| 239 | Ga0207664_10109709 | 3300025929 | Bacteria | 2293 |
| 240 | Ga0207644_10016717 | 3300025931 | Bacteria | 4940 |
| 241 | Ga0207690_10025298 | 3300025932 | Bacteria | 3725 |
| 242 | Ga0207706_10199961 | 3300025933 | Bacteria | 1753 |
| 243 | Ga0207709_10203375 | 3300025935 | Bacteria | 1416 |
| 244 | Ga0207704_10048142 | 3300025938 | Bacteria | 2554 |
| 245 | Ga0207665_10001364 | 3300025939 | Bacteria | 16457 |
| 246 | Ga0207665_10015528 | 3300025939 | Bacteria | 4997 |
| 247 | Ga0207665_10036269 | 3300025939 | Bacteria | 3278 |
| 248 | Ga0207711_10054778 | 3300025941 | Bacteria | 3423 |
| 249 | Ga0207689_10014080 | 3300025942 | Bacteria | 6807 |
| 250 | Ga0207661_10001182 | 3300025944 | Bacteria | 17455 |
| 251 | Ga0207661_10203221 | 3300025944 | Bacteria | 1743 |
| 252 | Ga0207679_10363881 | 3300025945 | Bacteria | 1264 |
| 253 | Ga0207679_10489006 | 3300025945 | Bacteria | 1097 |
| 254 | Ga0207712_10125479 | 3300025961 | Bacteria | 1948 |
| 255 | Ga0207668_10004125 | 3300025972 | Bacteria | 8524 |
| 256 | Ga0207658_10093472 | 3300025986 | Bacteria | 2338 |
| 257 | Ga0207677_10038130 | 3300026023 | Bacteria | 3148 |
| 258 | Ga0207639_10010102 | 3300026041 | Bacteria | 6528 |
| 259 | Ga0207639_10196860 | 3300026041 | Bacteria | 1725 |
| 260 | Ga0207639_10311422 | 3300026041 | Bacteria | 1395 |
| 261 | Ga0207678_10014454 | 3300026067 | Bacteria | 6941 |
| 262 | Ga0207678_10021795 | 3300026067 | Bacteria | 5619 |
| 263 | Ga0207678_10023002 | 3300026067 | Bacteria | 5454 |
| 264 | Ga0207678_10054764 | 3300026067 | Bacteria | 3436 |
| 265 | Ga0207702_10000197 | 3300026078 | Bacteria | 71667 |
| 266 | Ga0207702_10018501 | 3300026078 | Bacteria | 5764 |
| 267 | Ga0207641_10238720 | 3300026088 | Bacteria | 1693 |
| 268 | Ga0207648_10219239 | 3300026089 | Bacteria | 1690 |
| 269 | Ga0207676_10106108 | 3300026095 | Bacteria | 2340 |
| 270 | Ga0207674_10464147 | 3300026116 | Bacteria | 1224 |
| 271 | Ga0207675_100041364 | 3300026118 | Bacteria | 4304 |
| 272 | Ga0207683_10011087 | 3300026121 | Bacteria | 7681 |
| 273 | Ga0207698_10105090 | 3300026142 | Bacteria | 2352 |
| 274 | Ga0207698_10200930 | 3300026142 | Bacteria | 1785 |
| 275 | Ga0207698_10314938 | 3300026142 | Bacteria | 1463 |
| 276 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 277 | Ga0209389_1001618 | 3300027296 | Bacteria | 16174 |
| 278 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 279 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 280 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 281 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 282 | Ga0209489_100777 | 3300027361 | Bacteria | 63061 |
| 283 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 284 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 285 | Ga0209813_10002203 | 3300027866 | Bacteria | 4450 |
| 286 | Ga0268266_10001413 | 3300028379 | Bacteria | 28643 |
| 287 | Ga0268266_10087585 | 3300028379 | Bacteria | 2724 |
| 288 | Ga0268264_10062341 | 3300028381 | Bacteria | 3130 |
| 289 | Ga0265334_10054565 | 3300028573 | Bacteria | 1524 |
| 290 | Ga0265770_1014959 | 3300030878 | Bacteria | 1176 |
| 291 | Ga0265773_1001012 | 3300031018 | Bacteria | 1387 |
| 292 | Ga0265760_10051491 | 3300031090 | Bacteria | 1240 |
| 293 | Ga0265330_10035799 | 3300031235 | Bacteria | 2214 |
| 294 | Ga0265325_10012959 | 3300031241 | Bacteria | 4755 |
| 295 | Ga0265340_10011608 | 3300031247 | Bacteria | 4676 |
| 296 | Ga0265339_10000016 | 3300031249 | Bacteria | 185313 |
| 297 | Ga0265339_10006455 | 3300031249 | Bacteria | 7692 |
| 298 | Ga0265339_10016353 | 3300031249 | Bacteria | 4424 |
| 299 | Ga0265339_10110791 | 3300031249 | Bacteria | 1420 |
| 300 | Ga0265316_10387288 | 3300031344 | Bacteria | 1008 |
| 301 | Ga0307513_10018286 | 3300031456 | Bacteria | 8378 |
| 302 | Ga0265313_10000060 | 3300031595 | Bacteria | 107224 |
| 303 | Ga0265314_10016312 | 3300031711 | Bacteria | 5871 |
| 304 | Ga0265314_10069850 | 3300031711 | Bacteria | 2356 |
| 305 | Ga0265342_10010600 | 3300031712 | Bacteria | 6375 |
| 306 | Ga0307516_10092521 | 3300031730 | Bacteria | 2851 |
| 307 | Ga0316583_10027407 | 3300032133 | Bacteria | 2034 |
| 308 | Ga0307510_10019799 | 3300033180 | Bacteria | 7881 |
| 309 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 310 | Ga0316215_1001104 | 3300033544 | Bacteria | 2623 |
| 311 | Ga0373934_0002405 | 3300035086 | Bacteria | 6890 |
| 312 | Ga0373923_0022547 | 3300035111 | Bacteria | 2470 |
| 313 | Ga0373936_0018479 | 3300035113 | Bacteria | 2693 |
| 314 | Ga0373953_0000409 | 3300035117 | Bacteria | 11662 |
| 315 | Ga0373953_0009941 | 3300035117 | Bacteria | 3296 |
| 316 | Ga0373954_0002776 | 3300035118 | Bacteria | 7375 |
| 317 | Ga0373954_0029995 | 3300035118 | Bacteria | 2507 |
| 318 | Ga0373956_0004736 | 3300035119 | Bacteria | 5443 |
| 319 | Ga0373956_0005250 | 3300035119 | Bacteria | 5184 |
| 320 | Ga0373957_0014177 | 3300035120 | Bacteria | 2720 |
| 321 | Ga0373955_0002711 | 3300035172 | Bacteria | 7754 |
| 322 | Ga0373955_0003550 | 3300035172 | Bacteria | 6865 |
| 323 | Ga0373924_0006225 | 3300035410 | Bacteria | 4267 |
| 324 | Ga0373927_0004054 | 3300035695 | Bacteria | 10349 |
| 325 | Ga0373933_0002107 | 3300035724 | Bacteria | 11423 |
| 326 | Ga0373937_0008396 | 3300036401 | Bacteria | 8974 |
| 327 | Ga0373937_0021312 | 3300036401 | Bacteria | 5816 |
| 328 | Ga0373937_0324402 | 3300036401 | Bacteria | 1457 |
| 329 | Ga0372808_001074 | 3300036459 | Bacteria | 2661 |
| 330 | Ga0373925_0024876 | 3300037068 | Bacteria | 4374 |
| 331 | Ga0395899_0122972 | 3300037312 | Bacteria | 1857 |
| 332 | Ga0395900_0000660 | 3300037418 | Bacteria | 46104 |
| 333 | Ga0395900_0002114 | 3300037418 | Bacteria | 22253 |
| 334 | Ga0395900_0008707 | 3300037418 | Bacteria | 10423 |
| 335 | Ga0395900_0199262 | 3300037418 | Bacteria | 2027 |
| 336 | Ga0395900_0378614 | 3300037418 | Bacteria | 1384 |
| 337 | Ga0395898_0003200 | 3300037466 | Bacteria | 18438 |
| 338 | Ga0395898_0006500 | 3300037466 | Bacteria | 12485 |
| 339 | Ga0395898_0007107 | 3300037466 | Bacteria | 11890 |
| 340 | Ga0395898_0064826 | 3300037466 | Bacteria | 3543 |
| 341 | Ga0395905_0021700 | 3300037471 | Bacteria | 6074 |
| 342 | Ga0395905_0259473 | 3300037471 | Bacteria | 1622 |
| 343 | Ga0436364_0051975 | 3300037853 | Bacteria | 3739 |
| 344 | Ga0436364_0102033 | 3300037853 | Bacteria | 1689 |
| 345 | Ga0436364_0134493 | 3300037853 | Bacteria | 6192 |
| 346 | Ga0436364_0178729 | 3300037853 | Bacteria | 19908 |
| 347 | Ga0436364_0240938 | 3300037853 | Bacteria | 2811 |
| 348 | Ga0436364_0294887 | 3300037853 | Bacteria | 20599 |
| 349 | Ga0436364_0330571 | 3300037853 | Bacteria | 2928 |
| 350 | Ga0436364_0341833 | 3300037853 | Bacteria | 5349 |
| 351 | Ga0436364_0425317 | 3300037853 | Bacteria | 2884 |
| 352 | Ga0436364_0480253 | 3300037853 | Bacteria | 2172 |
| 353 | Ga0436364_0629092 | 3300037853 | Bacteria | 6792 |
| 354 | Ga0436364_0654054 | 3300037853 | Bacteria | 1462 |
| 355 | Ga0436364_1015733 | 3300037853 | Bacteria | 2723 |
| 356 | Ga0436364_1040604 | 3300037853 | Bacteria | 60326 |
| 357 | Ga0436364_1401270 | 3300037853 | Bacteria | 10880 |
| 358 | Ga0436364_1503331 | 3300037853 | Bacteria | 31628 |
| 359 | Ga0436364_1527859 | 3300037853 | Bacteria | 20905 |
| 360 | Ga0395901_0034087 | 3300038443 | Bacteria | 5257 |
| 361 | Ga0395901_0063663 | 3300038443 | Bacteria | 3839 |
| 362 | Ga0395901_0101488 | 3300038443 | Bacteria | 3019 |
| 363 | Ga0395901_0437117 | 3300038443 | Bacteria | 1340 |
| 364 | Ga0395901_0515459 | 3300038443 | Bacteria | 1215 |
| 365 | Ga0436365_0151043 | 3300039437 | Bacteria | 1380 |
| 366 | Ga0436365_0159409 | 3300039437 | Bacteria | 2110 |
| 367 | Ga0436365_0459588 | 3300039437 | Bacteria | 1325 |
| 368 | Ga0436365_0510188 | 3300039437 | Bacteria | 12764 |
| 369 | Ga0436365_0697045 | 3300039437 | Bacteria | 35162 |
| 370 | Ga0436365_0917056 | 3300039437 | Bacteria | 16389 |
| 371 | Ga0436365_1047663 | 3300039437 | Bacteria | 2746 |
| 372 | Ga0436360_0202427 | 3300039438 | Bacteria | 4987 |
| 373 | Ga0436360_0480010 | 3300039438 | Bacteria | 3604 |
| 374 | Ga0436360_0545523 | 3300039438 | Bacteria | 2119 |
| 375 | Ga0436360_1060729 | 3300039438 | Bacteria | 1128 |
| 376 | Ga0436360_1101828 | 3300039438 | Bacteria | 2281 |
| 377 | Ga0436361_0200283 | 3300039447 | Bacteria | 2300 |
| 378 | Ga0436361_0512286 | 3300039447 | Bacteria | 5516 |
| 379 | Ga0436361_0638445 | 3300039447 | Bacteria | 9354 |
| 380 | Ga0436361_0838125 | 3300039447 | Bacteria | 5115 |
| 381 | Ga0436361_1054672 | 3300039447 | Bacteria | 3969 |
| 382 | Ga0436361_1159707 | 3300039447 | Bacteria | 1567 |
| 383 | Ga0436363_0121554 | 3300039450 | Bacteria | 5905 |
| 384 | Ga0436363_0274569 | 3300039450 | Bacteria | 2779 |
| 385 | Ga0436363_0454820 | 3300039450 | Bacteria | 3677 |
| 386 | Ga0436363_0627803 | 3300039450 | Bacteria | 1682 |
| 387 | Ga0436363_0700194 | 3300039450 | Bacteria | 1499 |
| 388 | Ga0436363_0761127 | 3300039450 | Bacteria | 1785 |
| 389 | Ga0436363_1022276 | 3300039450 | Bacteria | 10376 |
| 390 | Ga0436363_1499575 | 3300039450 | Bacteria | 4582 |
| 391 | Ga0436362_0278148 | 3300039453 | Bacteria | 2371 |
| 392 | Ga0436362_0842308 | 3300039453 | Bacteria | 1254 |
| 393 | Ga0436362_0895327 | 3300039453 | Bacteria | 9610 |
| 394 | Ga0436362_0983233 | 3300039453 | Bacteria | 2080 |
| 395 | Ga0466969_0100925 | 3300044656 | Bacteria | 1358 |
| 396 | Ga0466972_0000079 | 3300044658 | Bacteria | 90348 |
| 397 | Ga0466972_0004644 | 3300044658 | Bacteria | 6881 |
| 398 | Ga0466966_0001208 | 3300044684 | Bacteria | 16568 |
| 399 | Ga0466966_0006229 | 3300044684 | Bacteria | 7887 |
| 400 | Ga0466961_0000020 | 3300044693 | Bacteria | 107610 |
| 401 | Ga0466961_0039468 | 3300044693 | Bacteria | 3027 |
| 402 | Ga0466961_0049669 | 3300044693 | Bacteria | 2680 |
| 403 | Ga0466963_0031974 | 3300044694 | Bacteria | 3404 |
| 404 | Ga0466963_0209438 | 3300044694 | Bacteria | 1364 |
| 405 | Ga0466971_0051755 | 3300044719 | Bacteria | 1849 |
| 406 | Ga0466968_0011964 | 3300044735 | Bacteria | 3389 |
| 407 | Ga0466970_0026083 | 3300044765 | Bacteria | 3063 |
| 408 | Ga0466970_0087989 | 3300044765 | Bacteria | 1685 |
| 409 | Ga0466957_0041896 | 3300044842 | Bacteria | 2769 |
| 410 | Ga0466957_0165300 | 3300044842 | Bacteria | 1439 |
| 411 | Ga0466960_0000424 | 3300044901 | Bacteria | 14510 |
| 412 | Ga0466959_0004294 | 3300045049 | Bacteria | 9508 |
| 413 | Ga0466959_0245173 | 3300045049 | Bacteria | 1236 |
| 414 | Ga0466967_0063821 | 3300045976 | Bacteria | 3274 |
| 415 | Ga0466967_0377060 | 3300045976 | Bacteria | 1377 |
| 416 | Ga0466967_0549232 | 3300045976 | Bacteria | 1137 |
| 417 | Ga0495592_0003202 | 3300046454 | Bacteria | 11732 |
| 418 | Ga0495592_0036190 | 3300046454 | Bacteria | 3718 |
| 419 | Ga0495603_0139262 | 3300046455 | Bacteria | 1412 |
| 420 | Ga0495629_0001830 | 3300046459 | Bacteria | 16661 |
| 421 | Ga0495629_0006153 | 3300046459 | Bacteria | 8909 |
| 422 | Ga0495629_0107512 | 3300046459 | Bacteria | 1946 |
| 423 | Ga0495641_0144258 | 3300046461 | Bacteria | 1064 |
| 424 | Ga0495651_0002500 | 3300046462 | Bacteria | 14218 |
| 425 | Ga0495651_0041294 | 3300046462 | Bacteria | 3583 |
| 426 | Ga0495651_0041839 | 3300046462 | Bacteria | 3558 |
| 427 | Ga0495651_0140950 | 3300046462 | Bacteria | 1748 |
| 428 | Ga0495653_0001471 | 3300046463 | Bacteria | 18364 |
| 429 | Ga0495653_0050752 | 3300046463 | Bacteria | 3189 |
| 430 | Ga0495653_0159296 | 3300046463 | Bacteria | 1568 |
| 431 | Ga0495582_0214523 | 3300046473 | Bacteria | 1101 |
| 432 | Ga0495639_0114838 | 3300046475 | Bacteria | 1280 |
| 433 | Ga0495662_0108284 | 3300046476 | Bacteria | 1361 |
| 434 | Ga0495664_0007676 | 3300046477 | Bacteria | 6001 |
| 435 | Ga0495664_0007911 | 3300046477 | Bacteria | 5917 |
| 436 | Ga0495664_0087653 | 3300046477 | Bacteria | 1870 |
| 437 | Ga0495596_0068738 | 3300046500 | Bacteria | 1377 |
| 438 | Ga0495606_0005210 | 3300046507 | Bacteria | 12548 |
| 439 | Ga0495608_0002191 | 3300046511 | Bacteria | 14103 |
| 440 | Ga0495608_0036131 | 3300046511 | Bacteria | 3328 |
| 441 | Ga0495608_0060094 | 3300046511 | Bacteria | 2502 |
| 442 | Ga0495618_0079959 | 3300046514 | Bacteria | 2085 |
| 443 | Ga0495618_0279140 | 3300046514 | Bacteria | 1042 |
| 444 | Ga0495620_0060077 | 3300046515 | Bacteria | 1586 |
| 445 | Ga0495628_0030883 | 3300046516 | Bacteria | 4335 |
| 446 | Ga0495628_0033600 | 3300046516 | Bacteria | 4131 |
| 447 | Ga0495628_0064783 | 3300046516 | Bacteria | 2860 |
| 448 | Ga0495630_0022407 | 3300046517 | Bacteria | 4664 |
| 449 | Ga0495648_0003767 | 3300046524 | Bacteria | 13191 |
| 450 | Ga0495648_0007614 | 3300046524 | Bacteria | 8644 |
| 451 | Ga0495652_0006321 | 3300046529 | Bacteria | 11036 |
| 452 | Ga0495652_0031923 | 3300046529 | Bacteria | 4609 |
| 453 | Ga0495640_0002348 | 3300046533 | Bacteria | 15175 |
| 454 | Ga0495640_0026198 | 3300046533 | Bacteria | 4216 |
| 455 | Ga0495586_0022337 | 3300046535 | Bacteria | 3377 |
| 456 | Ga0495587_0004728 | 3300046536 | Bacteria | 8935 |
| 457 | Ga0495587_0015523 | 3300046536 | Bacteria | 4754 |
| 458 | Ga0495587_0027948 | 3300046536 | Bacteria | 3434 |
| 459 | Ga0495645_0014837 | 3300046543 | Bacteria | 5536 |
| 460 | Ga0495645_0040372 | 3300046543 | Bacteria | 3404 |
| 461 | Ga0495645_0221128 | 3300046543 | Bacteria | 1274 |
| 462 | Ga0495667_0002963 | 3300046559 | Bacteria | 11387 |
| 463 | Ga0495667_0013368 | 3300046559 | Bacteria | 5555 |
| 464 | Ga0495667_0016179 | 3300046559 | Bacteria | 5039 |
| 465 | Ga0495634_0089901 | 3300046642 | Bacteria | 1995 |
| 466 | Ga0495634_0197772 | 3300046642 | Bacteria | 1250 |
| 467 | Ga0495625_0039696 | 3300046660 | Bacteria | 3436 |
| 468 | Ga0495635_0000636 | 3300046663 | Bacteria | 22538 |
| 469 | Ga0495635_0002205 | 3300046663 | Bacteria | 13252 |
| 470 | Ga0495657_0002552 | 3300046675 | Bacteria | 15277 |
| 471 | Ga0495657_0014012 | 3300046675 | Bacteria | 5889 |
| 472 | Ga0495599_0001077 | 3300046678 | Bacteria | 15369 |
| 473 | Ga0495599_0010332 | 3300046678 | Bacteria | 5708 |
| 474 | Ga0495599_0060861 | 3300046678 | Bacteria | 2360 |
| 475 | Ga0495623_0004268 | 3300046679 | Bacteria | 9412 |
| 476 | Ga0495623_0006526 | 3300046679 | Bacteria | 7595 |
| 477 | Ga0495623_0048527 | 3300046679 | Bacteria | 2692 |
| 478 | Ga0495646_0025871 | 3300046680 | Bacteria | 3687 |
| 479 | Ga0495613_0033951 | 3300046689 | Bacteria | 3790 |
| 480 | Ga0495613_0120524 | 3300046689 | Bacteria | 1884 |
| 481 | Ga0495624_0058576 | 3300046690 | Bacteria | 2418 |
| 482 | Ga0495624_0091302 | 3300046690 | Bacteria | 1879 |
| 483 | Ga0495624_0111238 | 3300046690 | Bacteria | 1684 |
| 484 | Ga0495600_0000873 | 3300046809 | Bacteria | 16122 |
| 485 | Ga0495600_0001010 | 3300046809 | Bacteria | 15188 |
| 486 | Ga0495604_0008420 | 3300047317 | Bacteria | 8146 |
| 487 | Ga0495604_0038621 | 3300047317 | Bacteria | 3755 |
| 488 | Ga0495604_0052467 | 3300047317 | Bacteria | 3157 |
| 489 | Ga0495604_0063576 | 3300047317 | Bacteria | 2814 |
| 490 | Ga0495674_0028066 | 3300047319 | Bacteria | 5137 |
| 491 | Ga0495674_0065255 | 3300047319 | Bacteria | 3163 |
| 492 | Ga0495674_0242918 | 3300047319 | Bacteria | 1483 |
| 493 | Ga0495676_0103736 | 3300047321 | Bacteria | 2099 |
| 494 | Ga0495680_0001037 | 3300047322 | Bacteria | 30809 |
| 495 | Ga0495680_0001883 | 3300047322 | Bacteria | 22052 |
| 496 | Ga0495680_0043083 | 3300047322 | Bacteria | 3576 |
| 497 | Ga0495675_0001800 | 3300047444 | Bacteria | 12774 |
| 498 | Ga0495675_0037092 | 3300047444 | Bacteria | 3105 |
| 499 | Ga0495684_0000666 | 3300047471 | Bacteria | 27678 |
| 500 | Ga0495684_0036531 | 3300047471 | Bacteria | 3765 |
| 501 | Ga0495684_0096515 | 3300047471 | Bacteria | 2237 |
| 502 | Ga0495684_0184941 | 3300047471 | Bacteria | 1543 |
| 503 | Ga0495686_0046711 | 3300047472 | Bacteria | 2736 |
| 504 | Ga0495686_0107093 | 3300047472 | Bacteria | 1680 |
| 505 | Ga0495593_0008032 | 3300047673 | Bacteria | 6139 |
| 506 | Ga0495602_0004340 | 3300048088 | Bacteria | 14780 |
| 507 | Ga0495602_0012996 | 3300048088 | Bacteria | 8521 |
| 508 | Ga0495602_0196647 | 3300048088 | Bacteria | 1541 |
| 509 | Ga0495602_0201081 | 3300048088 | Bacteria | 1520 |
| 510 | Ga0496100_0029945 | 3300048903 | Bacteria | 3372 |
| 511 | Ga0496102_0567391 | 3300048905 | Bacteria | 1058 |
| 512 | Ga0496104_0001245 | 3300048907 | Bacteria | 21918 |
| 513 | Ga0496104_0005309 | 3300048907 | Bacteria | 11271 |
| 514 | Ga0496104_0082198 | 3300048907 | Bacteria | 3072 |
| 515 | Ga0496104_0283502 | 3300048907 | Bacteria | 1569 |
| 516 | Ga0496105_0003657 | 3300048908 | Bacteria | 11428 |
| 517 | Ga0496105_0093356 | 3300048908 | Bacteria | 2485 |
| 518 | Ga0496106_0013957 | 3300048909 | Bacteria | 5941 |
| 519 | Ga0496107_0130771 | 3300048910 | Bacteria | 1853 |
| 520 | Ga0496108_0001861 | 3300048911 | Bacteria | 16875 |
| 521 | Ga0496108_0218656 | 3300048911 | Bacteria | 1655 |
| 522 | Ga0496109_0001073 | 3300048912 | Bacteria | 22672 |
| 523 | Ga0496109_0155295 | 3300048912 | Bacteria | 2143 |
| 524 | Ga0496110_0002479 | 3300048913 | Bacteria | 13828 |
| 525 | Ga0496111_0028004 | 3300048914 | Bacteria | 3991 |
| 526 | Ga0496111_0061970 | 3300048914 | Bacteria | 2712 |
| 527 | Ga0496111_0215505 | 3300048914 | Bacteria | 1426 |
| 528 | Ga0496112_0002061 | 3300048915 | Bacteria | 15937 |
| 529 | Ga0496112_0005807 | 3300048915 | Bacteria | 10736 |
| 530 | Ga0496112_0008838 | 3300048915 | Bacteria | 9038 |
| 531 | Ga0496112_0107427 | 3300048915 | Bacteria | 2761 |
| 532 | Ga0496112_0119654 | 3300048915 | Bacteria | 2603 |
| 533 | Ga0496112_0223868 | 3300048915 | Bacteria | 1837 |
| 534 | Ga0496112_0440495 | 3300048915 | Bacteria | 1241 |
| 535 | Ga0496113_0000095 | 3300048916 | Bacteria | 37445 |
| 536 | Ga0496113_0156636 | 3300048916 | Bacteria | 1799 |
| 537 | Ga0496114_0200299 | 3300048917 | Bacteria | 1749 |
| 538 | Ga0496115_0003952 | 3300048918 | Bacteria | 10689 |
| 539 | Ga0496115_0042478 | 3300048918 | Bacteria | 3621 |
| 540 | Ga0496115_0314357 | 3300048918 | Bacteria | 1282 |
| 541 | Ga0496116_0140996 | 3300048919 | Bacteria | 1356 |
| 542 | Ga0496118_0016456 | 3300048921 | Bacteria | 6783 |
| 543 | Ga0496118_0130626 | 3300048921 | Bacteria | 1614 |
| 544 | Ga0496119_0003004 | 3300048922 | Bacteria | 17875 |
| 545 | Ga0496119_0080481 | 3300048922 | Bacteria | 1879 |
| 546 | Ga0496121_0008659 | 3300048924 | Bacteria | 11890 |
| 547 | Ga0496121_0021131 | 3300048924 | Bacteria | 6392 |
| 548 | Ga0496121_0032677 | 3300048924 | Bacteria | 4725 |
| 549 | Ga0496121_0066895 | 3300048924 | Bacteria | 2915 |
| 550 | Ga0496121_0103413 | 3300048924 | Bacteria | 2191 |
| 551 | Ga0496124_0209458 | 3300048927 | Bacteria | 1476 |
| 552 | Ga0496125_0000237 | 3300048928 | Bacteria | 113322 |
| 553 | Ga0496125_0001822 | 3300048928 | Bacteria | 29443 |
| 554 | Ga0496126_0011267 | 3300048929 | Bacteria | 9277 |
| 555 | Ga0496126_0158354 | 3300048929 | Bacteria | 1936 |
| 556 | Ga0496126_0174038 | 3300048929 | Bacteria | 1832 |
| 557 | Ga0496126_0338736 | 3300048929 | Bacteria | 1232 |
| 558 | Ga0501031_0001197 | 3300049568 | Bacteria | 15831 |
| 559 | Ga0501031_0003032 | 3300049568 | Bacteria | 10740 |
| 560 | Ga0501031_0118857 | 3300049568 | Bacteria | 1727 |
| 561 | Ga0501032_0000358 | 3300049569 | Bacteria | 38004 |
| 562 | Ga0501032_0000696 | 3300049569 | Bacteria | 27371 |
| 563 | Ga0501032_0036140 | 3300049569 | Bacteria | 3373 |
| 564 | Ga0501032_0086541 | 3300049569 | Bacteria | 2083 |
| 565 | Ga0501033_0000232 | 3300049570 | Bacteria | 53703 |
| 566 | Ga0501033_0000601 | 3300049570 | Bacteria | 33366 |
| 567 | Ga0501033_0001532 | 3300049570 | Bacteria | 20415 |
| 568 | Ga0501033_0006726 | 3300049570 | Bacteria | 8984 |
| 569 | Ga0501033_0037684 | 3300049570 | Bacteria | 3618 |
| 570 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 571 | Ga0501034_0000704 | 3300049571 | Bacteria | 50735 |
| 572 | Ga0501034_0193399 | 3300049571 | Bacteria | 1996 |
| 573 | Ga0501036_0000007 | 3300049572 | Bacteria | 240500 |
| 574 | Ga0501036_0000052 | 3300049572 | Bacteria | 74795 |
| 575 | Ga0501036_0301604 | 3300049572 | Bacteria | 1340 |
| 576 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 577 | Ga0501037_0001450 | 3300049573 | Bacteria | 17426 |
| 578 | Ga0501037_0020087 | 3300049573 | Bacteria | 4931 |
| 579 | Ga0501037_0149374 | 3300049573 | Bacteria | 1671 |
| 580 | Ga0501038_0000026 | 3300049574 | Bacteria | 146493 |
| 581 | Ga0501038_0000168 | 3300049574 | Bacteria | 55496 |
| 582 | Ga0501038_0119167 | 3300049574 | Bacteria | 2179 |
| 583 | Ga0501038_0177296 | 3300049574 | Bacteria | 1722 |
| 584 | Ga0501038_0275468 | 3300049574 | Bacteria | 1326 |
| 585 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 586 | Ga0501039_0003632 | 3300049575 | Bacteria | 11560 |
| 587 | Ga0501039_0156253 | 3300049575 | Bacteria | 1792 |
| 588 | Ga0501042_0118124 | 3300049578 | Bacteria | 1909 |
| 589 | Ga0501043_0000007 | 3300049579 | Bacteria | 224595 |
| 590 | Ga0501043_0000036 | 3300049579 | Bacteria | 132959 |
| 591 | Ga0501043_0002042 | 3300049579 | Bacteria | 17221 |
| 592 | Ga0501043_0133440 | 3300049579 | Bacteria | 1946 |
| 593 | Ga0501046_0000147 | 3300049580 | Bacteria | 74186 |
| 594 | Ga0501046_0000231 | 3300049580 | Bacteria | 57655 |
| 595 | Ga0501046_0070614 | 3300049580 | Bacteria | 2715 |
| 596 | Ga0501046_0171712 | 3300049580 | Bacteria | 1627 |
| 597 | Ga0501046_0304341 | 3300049580 | Bacteria | 1164 |
| 598 | Ga0501047_0000209 | 3300049581 | Bacteria | 70658 |
| 599 | Ga0501047_0000457 | 3300049581 | Bacteria | 45136 |
| 600 | Ga0501047_0009482 | 3300049581 | Bacteria | 9198 |
| 601 | Ga0501047_0012842 | 3300049581 | Bacteria | 7935 |
| 602 | Ga0501047_0071155 | 3300049581 | Bacteria | 3348 |
| 603 | Ga0501047_0102930 | 3300049581 | Bacteria | 2735 |
| 604 | Ga0501047_0145750 | 3300049581 | Bacteria | 2245 |
| 605 | Ga0501047_0223123 | 3300049581 | Bacteria | 1740 |
| 606 | Ga0501048_0000585 | 3300049582 | Bacteria | 25849 |
| 607 | Ga0501048_0020451 | 3300049582 | Bacteria | 4850 |
| 608 | Ga0501067_0000025 | 3300049583 | Bacteria | 91481 |
| 609 | Ga0501067_0063143 | 3300049583 | Bacteria | 2051 |
| 610 | Ga0501067_0087364 | 3300049583 | Bacteria | 1730 |
| 611 | Ga0501068_0002387 | 3300049584 | Bacteria | 9984 |
| 612 | Ga0501068_0004030 | 3300049584 | Bacteria | 7988 |
| 613 | Ga0501069_0000001 | 3300049585 | Bacteria | 289100 |
| 614 | Ga0501069_0133516 | 3300049585 | Bacteria | 1422 |
| 615 | Ga0501070_0000071 | 3300049586 | Bacteria | 86669 |
| 616 | Ga0501070_0000824 | 3300049586 | Bacteria | 28140 |
| 617 | Ga0501070_0001839 | 3300049586 | Bacteria | 18710 |
| 618 | Ga0501070_0024940 | 3300049586 | Bacteria | 5015 |
| 619 | Ga0501070_0178591 | 3300049586 | Bacteria | 1747 |
| 620 | Ga0501070_0178612 | 3300049586 | Bacteria | 1747 |
| 621 | Ga0501071_0010530 | 3300049587 | Bacteria | 6202 |
| 622 | Ga0501071_0022185 | 3300049587 | Bacteria | 4425 |
| 623 | Ga0501072_0003385 | 3300049588 | Bacteria | 11997 |
| 624 | Ga0501072_0051510 | 3300049588 | Bacteria | 3241 |
| 625 | Ga0501073_0000135 | 3300049589 | Bacteria | 47869 |
| 626 | Ga0501073_0011727 | 3300049589 | Bacteria | 6399 |
| 627 | Ga0501073_0013905 | 3300049589 | Bacteria | 5849 |
| 628 | Ga0501073_0032984 | 3300049589 | Bacteria | 3690 |
| 629 | Ga0501074_0000003 | 3300049590 | Bacteria | 116101 |
| 630 | Ga0501074_0000443 | 3300049590 | Bacteria | 24761 |
| 631 | Ga0501074_0019268 | 3300049590 | Bacteria | 4956 |
| 632 | Ga0501074_0023253 | 3300049590 | Bacteria | 4508 |
| 633 | Ga0501076_0332905 | 3300049592 | Bacteria | 1246 |
| 634 | Ga0501079_0003407 | 3300049741 | Bacteria | 11674 |
| 635 | Ga0501080_0000382 | 3300049742 | Bacteria | 34121 |
| 636 | Ga0501080_0000470 | 3300049742 | Bacteria | 31361 |
| 637 | Ga0501080_0000669 | 3300049742 | Bacteria | 27250 |
| 638 | Ga0501080_0005657 | 3300049742 | Bacteria | 11171 |
| 639 | Ga0501081_0326335 | 3300049743 | Bacteria | 1129 |
| 640 | Ga0501083_0000080 | 3300049744 | Bacteria | 64705 |
| 641 | Ga0501083_0003054 | 3300049744 | Bacteria | 11634 |
| 642 | Ga0501083_0101325 | 3300049744 | Bacteria | 1899 |
| 643 | Ga0501035_0000037 | 3300049822 | Bacteria | 160921 |
| 644 | Ga0501035_0000052 | 3300049822 | Bacteria | 143038 |
| 645 | Ga0501035_0001237 | 3300049822 | Bacteria | 26512 |
| 646 | Ga0501035_0001584 | 3300049822 | Bacteria | 23082 |
| 647 | Ga0501035_0002187 | 3300049822 | Bacteria | 19401 |
| 648 | Ga0501035_0070539 | 3300049822 | Bacteria | 3095 |
| 649 | Ga0501035_0121270 | 3300049822 | Bacteria | 2285 |
| 650 | Ga0501035_0175161 | 3300049822 | Bacteria | 1851 |
| 651 | Ga0501044_0000018 | 3300049823 | Bacteria | 225885 |
| 652 | Ga0501044_0000217 | 3300049823 | Bacteria | 73242 |
| 653 | Ga0501044_0000366 | 3300049823 | Bacteria | 56832 |
| 654 | Ga0501044_0046984 | 3300049823 | Bacteria | 4467 |
| 655 | Ga0501044_0072305 | 3300049823 | Bacteria | 3506 |
| 656 | Ga0501044_0085781 | 3300049823 | Bacteria | 3181 |
| 657 | Ga0501044_0087528 | 3300049823 | Bacteria | 3146 |
| 658 | Ga0501044_0091284 | 3300049823 | Bacteria | 3072 |
| 659 | Ga0501044_0147382 | 3300049823 | Bacteria | 2338 |
| 660 | nmdc:mga03n38_14660_c1 | 3300050490 | Bacteria | 3010 |
| 661 | nmdc:mga03n38_224_c1 | 3300050490 | Bacteria | 13138 |
| 662 | nmdc:mga00v17_205002_c1 | 3300050491 | Bacteria | 1275 |
| 663 | nmdc:mga00v17_9386_c1 | 3300050491 | Bacteria | 5292 |
| 664 | nmdc:mga0yw44_52563_c1 | 3300050492 | Bacteria | 2470 |
| 665 | nmdc:mga0yw44_72837_c1 | 3300050492 | Bacteria | 2136 |
| 666 | nmdc:mga0k408_5979_c1 | 3300050493 | Bacteria | 6497 |
| 667 | nmdc:mga04h51_6775_c1 | 3300050495 | Bacteria | 2992 |
| 668 | nmdc:mga07m45_6074_c1 | 3300050496 | Bacteria | 6081 |
| 669 | nmdc:mga0n895_64214_c1 | 3300050512 | Bacteria | 3631 |
| 670 | nmdc:mga08x19_79614_c1 | 3300050514 | Bacteria | 2149 |
| 671 | nmdc:mga0sz30_55309_c1 | 3300050516 | Bacteria | 1689 |
| 672 | nmdc:mga0sz30_9528_c1 | 3300050516 | Bacteria | 3699 |
| 673 | Ga0495601_0014819 | 3300053077 | Bacteria | 4705 |
| 674 | Ga0495601_0041332 | 3300053077 | Bacteria | 2889 |
| 675 | Ga0495601_0185195 | 3300053077 | Bacteria | 1361 |
| 676 | Ga0495601_0239203 | 3300053077 | Bacteria | 1185 |
| 677 | Ga0495612_0013454 | 3300053078 | Bacteria | 3296 |
| 678 | Ga0495655_0009206 | 3300053083 | Bacteria | 1906 |
| 679 | Ga0495655_0056796 | 3300053083 | Bacteria | 1054 |
| 680 | Ga0495595_0003095 | 3300053084 | Bacteria | 6581 |
| 681 | Ga0495595_0016247 | 3300053084 | Bacteria | 3180 |
| 682 | Ga0495619_0004543 | 3300053085 | Bacteria | 8862 |
| 683 | Ga0495619_0030322 | 3300053085 | Bacteria | 3500 |
| 684 | Ga0500578_0068194 | 3300053086 | Bacteria | 2268 |
| 685 | Ga0500578_0107327 | 3300053086 | Bacteria | 1763 |
| 686 | Ga0500647_0033209 | 3300053091 | Bacteria | 2460 |
| 687 | Ga0500651_0000526 | 3300053093 | Bacteria | 19635 |
| 688 | Ga0500566_0000097 | 3300053094 | Bacteria | 43920 |
| 689 | Ga0500640_014937 | 3300053095 | Bacteria | 3240 |
| 690 | Ga0500557_000008 | 3300053105 | Bacteria | 127284 |
| 691 | Ga0500572_000853 | 3300053111 | Bacteria | 9498 |
| 692 | Ga0500595_006403 | 3300053119 | Bacteria | 4995 |
| 693 | Ga0500597_043245 | 3300053120 | Bacteria | 1901 |
| 694 | Ga0500607_075728 | 3300053121 | Bacteria | 1727 |
| 695 | Ga0500614_014025 | 3300053123 | Bacteria | 1768 |
| 696 | Ga0500642_0000067 | 3300053130 | Bacteria | 56324 |
| 697 | Ga0500642_0104340 | 3300053130 | Bacteria | 1321 |
| 698 | Ga0500559_0120556 | 3300053136 | Bacteria | 1219 |
| 699 | Ga0500585_057645 | 3300053144 | Bacteria | 1394 |
| 700 | Ga0500603_001381 | 3300053150 | Bacteria | 5534 |
| 701 | Ga0500619_021578 | 3300053154 | Bacteria | 1857 |
| 702 | Ga0500630_035540 | 3300053159 | Bacteria | 2441 |
| 703 | Ga0500639_000219 | 3300053163 | Bacteria | 28391 |
| 704 | Ga0500636_0066605 | 3300053177 | Bacteria | 2094 |
| 705 | Ga0500625_005765 | 3300053729 | Bacteria | 5212 |
| 706 | Ga0501084_0006290 | 3300054114 | Bacteria | 9760 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047471 | Ga0495684_0184941 | Ga0495684_0184941_715_1506 | 256 |
| 2 | iso_pu_bacteria | 8019530166 | 8019536854 | 259 |
| 3 | 3300049822 | Ga0501035_0121270 | Ga0501035_0121270_1480_2271 | 262 |
| 4 | 3300013297 | Ga0157378_10172127 | Ga0157378_101721272 | 263 |
| 5 | 3300036401 | Ga0373937_0324402 | Ga0373937_0324402_649_1440 | 263 |
| 6 | 3300044842 | Ga0466957_0165300 | Ga0466957_0165300_13_804 | 263 |
| 7 | 3300048907 | Ga0496104_0283502 | Ga0496104_0283502_21_812 | 263 |
| 8 | 3300048929 | Ga0496126_0338736 | Ga0496126_0338736_12_803 | 263 |
| 9 | 3300046680 | Ga0495646_0025871 | Ga0495646_0025871_2285_3109 | 274 |
| 10 | 3300048903 | Ga0496100_0029945 | Ga0496100_0029945_2535_3362 | 275 |
| 11 | 3300037853 | Ga0436364_0480253 | Ga0436364_0480253_1029_1955 | 279 |
| 12 | 3300021388 | Ga0213875_10091232 | Ga0213875_100912322 | 280 |
| 13 | 3300037853 | Ga0436364_0341833 | Ga0436364_0341833_4151_5065 | 280 |
| 14 | 3300048927 | Ga0496124_0209458 | Ga0496124_0209458_10_858 | 282 |
| 15 | 3300037853 | Ga0436364_0654054 | Ga0436364_0654054_452_1363 | 283 |
| 16 | 3300021388 | Ga0213875_10003482 | Ga0213875_100034823 | 284 |
| 17 | 3300037853 | Ga0436364_0134493 | Ga0436364_0134493_1896_2807 | 284 |
| 18 | 3300037853 | Ga0436364_1040604 | Ga0436364_1040604_22539_23465 | 284 |
| 19 | 3300021388 | Ga0213875_10000030 | Ga0213875_1000003040 | 287 |
| 20 | 3300039437 | Ga0436365_0151043 | Ga0436365_0151043_288_1211 | 287 |
| 21 | 3300021388 | Ga0213875_10010083 | Ga0213875_100100835 | 288 |
| 22 | 3300021388 | Ga0213875_10019616 | Ga0213875_100196162 | 288 |
| 23 | 3300027296 | Ga0209389_1001618 | Ga0209389_10016185 | 288 |
| 24 | 3300027357 | Ga0209589_1000010 | Ga0209589_100001013 | 288 |
| 25 | 3300027361 | Ga0209489_100011 | Ga0209489_100011222 | 288 |
| 26 | 3300037853 | Ga0436364_1401270 | Ga0436364_1401270_3761_4666 | 288 |
| 27 | 3300037853 | Ga0436364_1503331 | Ga0436364_1503331_6849_7775 | 288 |
| 28 | 3300021388 | Ga0213875_10007291 | Ga0213875_100072912 | 289 |
| 29 | 3300037853 | Ga0436364_1527859 | Ga0436364_1527859_16612_17541 | 289 |
| 30 | iso_pu_bacteria | 8016530956 | 8016537162 | 289 |
| 31 | iso_pu_bacteria | 8016630954 | 8016633667 | 289 |
| 32 | iso_pu_bacteria | 8019576017 | 8019579814 | 289 |
| 33 | iso_pu_bacteria | 8019638758 | 8019642754 | 289 |
| 34 | 3300009551 | Ga0105238_10142049 | Ga0105238_101420493 | 290 |
| 35 | 3300013307 | Ga0157372_10326057 | Ga0157372_103260572 | 290 |
| 36 | 3300021388 | Ga0213875_10014477 | Ga0213875_100144773 | 290 |
| 37 | 3300025917 | Ga0207660_10228682 | Ga0207660_102286822 | 290 |
| 38 | 3300025924 | Ga0207694_10132083 | Ga0207694_101320832 | 290 |
| 39 | 3300037853 | Ga0436364_0294887 | Ga0436364_0294887_6415_7338 | 290 |
| 40 | 3300037853 | Ga0436364_1015733 | Ga0436364_1015733_1463_2374 | 290 |
| 41 | 3300039437 | Ga0436365_0917056 | Ga0436365_0917056_14199_15110 | 290 |
| 42 | 3300039453 | Ga0436362_0895327 | Ga0436362_0895327_2429_3340 | 290 |
| 43 | 3300009551 | Ga0105238_10398268 | Ga0105238_103982682 | 292 |
| 44 | 3300021361 | Ga0213872_10016051 | Ga0213872_100160512 | 293 |
| 45 | 3300039447 | Ga0436361_0838125 | Ga0436361_0838125_2593_3519 | 293 |
| 46 | 3300009093 | Ga0105240_10276799 | Ga0105240_102767992 | 294 |
| 47 | 3300025913 | Ga0207695_10133694 | Ga0207695_101336942 | 294 |
| 48 | 3300005439 | Ga0070711_100119075 | Ga0070711_1001190752 | 295 |
| 49 | 3300005458 | Ga0070681_10493869 | Ga0070681_104938691 | 295 |
| 50 | 3300009093 | Ga0105240_10121920 | Ga0105240_101219203 | 295 |
| 51 | 3300010375 | Ga0105239_10546926 | Ga0105239_105469262 | 295 |
| 52 | 3300021358 | Ga0213873_10000846 | Ga0213873_100008463 | 295 |
| 53 | 3300021384 | Ga0213876_10001630 | Ga0213876_100016302 | 295 |
| 54 | 3300021388 | Ga0213875_10003821 | Ga0213875_100038212 | 295 |
| 55 | 3300021388 | Ga0213875_10046437 | Ga0213875_100464372 | 295 |
| 56 | 3300025916 | Ga0207663_10132455 | Ga0207663_101324552 | 295 |
| 57 | 3300037853 | Ga0436364_0330571 | Ga0436364_0330571_1779_2702 | 295 |
| 58 | 3300037853 | Ga0436364_0629092 | Ga0436364_0629092_5145_6092 | 295 |
| 59 | 3300039438 | Ga0436360_1101828 | Ga0436360_1101828_1191_2120 | 295 |
| 60 | 3300039453 | Ga0436362_0278148 | Ga0436362_0278148_433_1362 | 295 |
| 61 | 3300039453 | Ga0436362_0983233 | Ga0436362_0983233_795_1724 | 295 |
| 62 | 3300048905 | Ga0496102_0567391 | Ga0496102_0567391_71_1000 | 295 |
| 63 | 3300048918 | Ga0496115_0042478 | Ga0496115_0042478_706_1635 | 295 |
| 64 | 3300039438 | Ga0436360_0202427 | Ga0436360_0202427_2532_3464 | 296 |
| 65 | 3300005336 | Ga0070680_100195987 | Ga0070680_1001959872 | 297 |
| 66 | 3300005458 | Ga0070681_10315190 | Ga0070681_103151902 | 297 |
| 67 | 3300013104 | Ga0157370_10205900 | Ga0157370_102059002 | 297 |
| 68 | 3300025912 | Ga0207707_10018073 | Ga0207707_100180732 | 297 |
| 69 | 3300025921 | Ga0207652_10084661 | Ga0207652_100846613 | 297 |
| 70 | 3300039450 | Ga0436363_0121554 | Ga0436363_0121554_3819_4745 | 297 |
| 71 | 3300032133 | Ga0316583_10027407 | Ga0316583_100274072 | 299 |
| 72 | 3300037853 | Ga0436364_0051975 | Ga0436364_0051975_1530_2453 | 299 |
| 73 | 3300039438 | Ga0436360_0480010 | Ga0436360_0480010_2511_3413 | 299 |
| 74 | 3300039450 | Ga0436363_0454820 | Ga0436363_0454820_2372_3274 | 299 |
| 75 | 3300045976 | Ga0466967_0377060 | Ga0466967_0377060_402_1328 | 301 |
| 76 | iso_pu_bacteria | 2595698237 | 2596371343 | 301 |
| 77 | iso_pu_bacteria | 2889306138 | 2889306677 | 301 |
| 78 | iso_pu_bacteria | 2902330777 | 2902332324 | 301 |
| 79 | iso_pu_bacteria | 2902405164 | 2902409673 | 301 |
| 80 | iso_pu_bacteria | 2928125067 | 2928126276 | 301 |
| 81 | 3300037853 | Ga0436364_0178729 | Ga0436364_0178729_2749_3660 | 302 |
| 82 | iso_pu_bacteria | 2545555834 | 2545674496 | 303 |
| 83 | iso_pu_bacteria | 2643221651 | 2644291197 | 303 |
| 84 | iso_pu_bacteria | 3003665799 | 3003666887 | 303 |
| 85 | iso_pu_bacteria | 641522639 | 641644901 | 303 |
| 86 | iso_pu_bacteria | 643348564 | 643597844 | 303 |
| 87 | 3300013102 | Ga0157371_10237967 | Ga0157371_102379672 | 304 |
| 88 | 3300037418 | Ga0395900_0378614 | Ga0395900_0378614_87_1004 | 304 |
| 89 | 3300039450 | Ga0436363_1499575 | Ga0436363_1499575_1789_2706 | 304 |
| 90 | 3300044684 | Ga0466966_0006229 | Ga0466966_0006229_856_1791 | 304 |
| 91 | 3300044693 | Ga0466961_0049669 | Ga0466961_0049669_1423_2358 | 304 |
| 92 | 3300044765 | Ga0466970_0026083 | Ga0466970_0026083_1565_2500 | 304 |
| 93 | 3300045049 | Ga0466959_0245173 | Ga0466959_0245173_99_1034 | 304 |
| 94 | 3300047472 | Ga0495686_0046711 | Ga0495686_0046711_866_1780 | 304 |
| 95 | 3300049570 | Ga0501033_0037684 | Ga0501033_0037684_2324_3241 | 304 |
| 96 | 3300049580 | Ga0501046_0304341 | Ga0501046_0304341_56_973 | 304 |
| 97 | 3300049581 | Ga0501047_0145750 | Ga0501047_0145750_319_1236 | 304 |
| 98 | iso_pu_bacteria | 2507262055 | 2507510856 | 304 |
| 99 | iso_pu_bacteria | 2508501009 | 2508544673 | 304 |
| 100 | iso_pu_bacteria | 2508501042 | 2508697111 | 304 |
| 101 | iso_pu_bacteria | 2508501128 | 2509148566 | 304 |
| 102 | iso_pu_bacteria | 2513237094 | 2513637633 | 304 |
| 103 | iso_pu_bacteria | 2513237095 | 2513649515 | 304 |
| 104 | iso_pu_bacteria | 2513237096 | 2513653945 | 304 |
| 105 | iso_pu_bacteria | 2513237104 | 2513719321 | 304 |
| 106 | iso_pu_bacteria | 2513237137 | 2513856379 | 304 |
| 107 | iso_pu_bacteria | 2513237141 | 2513888424 | 304 |
| 108 | iso_pu_bacteria | 2513237145 | 2513918285 | 304 |
| 109 | iso_pu_bacteria | 2515154112 | 2515630715 | 304 |
| 110 | iso_pu_bacteria | 2517093001 | 2517100429 | 304 |
| 111 | iso_pu_bacteria | 2517572143 | 2517891485 | 304 |
| 112 | iso_pu_bacteria | 2524023205 | 2524437289 | 304 |
| 113 | iso_pu_bacteria | 2524023228 | 2524541002 | 304 |
| 114 | iso_pu_bacteria | 2528768022 | 2528855271 | 304 |
| 115 | iso_pu_bacteria | 2667528175 | 2671118746 | 304 |
| 116 | iso_pu_bacteria | 2728368998 | 2728754864 | 304 |
| 117 | iso_pu_bacteria | 2744054633 | 2745076758 | 304 |
| 118 | iso_pu_bacteria | 2791355196 | 2793065131 | 304 |
| 119 | iso_pu_bacteria | 2791355197 | 2793066853 | 304 |
| 120 | iso_pu_bacteria | 2816332527 | 2818237985 | 304 |
| 121 | iso_pu_bacteria | 2824600985 | 2824601533 | 304 |
| 122 | iso_pu_bacteria | 2824609381 | 2824617195 | 304 |
| 123 | iso_pu_bacteria | 2824653114 | 2824653665 | 304 |
| 124 | iso_pu_bacteria | 2824661429 | 2824663038 | 304 |
| 125 | iso_pu_bacteria | 2824704595 | 2824709871 | 304 |
| 126 | iso_pu_bacteria | 2824753945 | 2824756996 | 304 |
| 127 | iso_pu_bacteria | 2824763712 | 2824770124 | 304 |
| 128 | iso_pu_bacteria | 2844315083 | 2844317084 | 304 |
| 129 | iso_pu_bacteria | 2847930680 | 2847938425 | 304 |
| 130 | iso_pu_bacteria | 2849076700 | 2849081384 | 304 |
| 131 | iso_pu_bacteria | 2874590934 | 2874597571 | 304 |
| 132 | iso_pu_bacteria | 2874645413 | 2874649134 | 304 |
| 133 | iso_pu_bacteria | 2876761206 | 2876767736 | 304 |
| 134 | iso_pu_bacteria | 2876771140 | 2876774956 | 304 |
| 135 | iso_pu_bacteria | 2876818435 | 2876822292 | 304 |
| 136 | iso_pu_bacteria | 2879074833 | 2879078044 | 304 |
| 137 | iso_pu_bacteria | 2879083081 | 2879088662 | 304 |
| 138 | iso_pu_bacteria | 2879099564 | 2879103994 | 304 |
| 139 | iso_pu_bacteria | 2879127579 | 2879132405 | 304 |
| 140 | iso_pu_bacteria | 2879142872 | 2879145296 | 304 |
| 141 | iso_pu_bacteria | 2881364244 | 2881370533 | 304 |
| 142 | iso_pu_bacteria | 2881665667 | 2881667297 | 304 |
| 143 | iso_pu_bacteria | 2885374607 | 2885377810 | 304 |
| 144 | iso_pu_bacteria | 2885409591 | 2885416493 | 304 |
| 145 | iso_pu_bacteria | 2888378607 | 2888381698 | 304 |
| 146 | iso_pu_bacteria | 2888419890 | 2888422085 | 304 |
| 147 | iso_pu_bacteria | 2903727486 | 2903735051 | 304 |
| 148 | iso_pu_bacteria | 2903748898 | 2903758733 | 304 |
| 149 | iso_pu_bacteria | 2904690495 | 2904691341 | 304 |
| 150 | iso_pu_bacteria | 2904699407 | 2904704815 | 304 |
| 151 | iso_pu_bacteria | 2904711408 | 2904719040 | 304 |
| 152 | iso_pu_bacteria | 2906602504 | 2906604167 | 304 |
| 153 | iso_pu_bacteria | 2906610324 | 2906616661 | 304 |
| 154 | iso_pu_bacteria | 2906635258 | 2906643717 | 304 |
| 155 | iso_pu_bacteria | 2906643746 | 2906647979 | 304 |
| 156 | iso_pu_bacteria | 2906660503 | 2906666988 | 304 |
| 157 | iso_pu_bacteria | 2908739725 | 2908741827 | 304 |
| 158 | iso_pu_bacteria | 2908756301 | 2908759521 | 304 |
| 159 | iso_pu_bacteria | 2922368715 | 2922371384 | 304 |
| 160 | iso_pu_bacteria | 2922425934 | 2922431314 | 304 |
| 161 | iso_pu_bacteria | 2929615660 | 2929623243 | 304 |
| 162 | iso_pu_bacteria | 2929624759 | 2929630923 | 304 |
| 163 | iso_pu_bacteria | 2932784394 | 2932786088 | 304 |
| 164 | iso_pu_bacteria | 2932794094 | 2932799136 | 304 |
| 165 | iso_pu_bacteria | 2932801729 | 2932803941 | 304 |
| 166 | iso_pu_bacteria | 2932809354 | 2932811969 | 304 |
| 167 | iso_pu_bacteria | 2932818245 | 2932822545 | 304 |
| 168 | iso_pu_bacteria | 2932828146 | 2932831132 | 304 |
| 169 | iso_pu_bacteria | 2933577622 | 2933585147 | 304 |
| 170 | iso_pu_bacteria | 2935608549 | 2935612922 | 304 |
| 171 | iso_pu_bacteria | 2935616580 | 2935624082 | 304 |
| 172 | iso_pu_bacteria | 2935630451 | 2935633908 | 304 |
| 173 | iso_pu_bacteria | 2935638405 | 2935640272 | 304 |
| 174 | iso_pu_bacteria | 2935648319 | 2935654714 | 304 |
| 175 | iso_pu_bacteria | 2935656913 | 2935663509 | 304 |
| 176 | iso_pu_bacteria | 2935665750 | 2935666890 | 304 |
| 177 | iso_pu_bacteria | 2935675223 | 2935684356 | 304 |
| 178 | iso_pu_bacteria | 2935684952 | 2935691338 | 304 |
| 179 | iso_pu_bacteria | 2935694250 | 2935699897 | 304 |
| 180 | iso_pu_bacteria | 2935703347 | 2935704645 | 304 |
| 181 | iso_pu_bacteria | 2935713505 | 2935719172 | 304 |
| 182 | iso_pu_bacteria | 2935722832 | 2935729228 | 304 |
| 183 | iso_pu_bacteria | 2935732158 | 2935737531 | 304 |
| 184 | iso_pu_bacteria | 2935741537 | 2935746907 | 304 |
| 185 | iso_pu_bacteria | 2935750917 | 2935758294 | 304 |
| 186 | iso_pu_bacteria | 2935760218 | 2935762455 | 304 |
| 187 | iso_pu_bacteria | 2935769743 | 2935777293 | 304 |
| 188 | iso_pu_bacteria | 2935777560 | 2935780388 | 304 |
| 189 | iso_pu_bacteria | 2935785616 | 2935793203 | 304 |
| 190 | iso_pu_bacteria | 2935793552 | 2935801201 | 304 |
| 191 | iso_pu_bacteria | 2935801545 | 2935803952 | 304 |
| 192 | iso_pu_bacteria | 2935810662 | 2935811871 | 304 |
| 193 | iso_pu_bacteria | 2935819856 | 2935824410 | 304 |
| 194 | iso_pu_bacteria | 2935827899 | 2935829755 | 304 |
| 195 | iso_pu_bacteria | 2935837841 | 2935842888 | 304 |
| 196 | iso_pu_bacteria | 2935847175 | 2935852445 | 304 |
| 197 | iso_pu_bacteria | 2935855204 | 2935862418 | 304 |
| 198 | iso_pu_bacteria | 2935864058 | 2935870553 | 304 |
| 199 | iso_pu_bacteria | 2935873716 | 2935881135 | 304 |
| 200 | iso_pu_bacteria | 2935883170 | 2935884253 | 304 |
| 201 | iso_pu_bacteria | 2935908558 | 2935912408 | 304 |
| 202 | iso_pu_bacteria | 2935916978 | 2935921759 | 304 |
| 203 | iso_pu_bacteria | 2935926038 | 2935929703 | 304 |
| 204 | iso_pu_bacteria | 2935934488 | 2935938935 | 304 |
| 205 | iso_pu_bacteria | 2935942939 | 2935948230 | 304 |
| 206 | iso_pu_bacteria | 2935951376 | 2935954954 | 304 |
| 207 | iso_pu_bacteria | 2935959822 | 2935962222 | 304 |
| 208 | iso_pu_bacteria | 2935967501 | 2935972012 | 304 |
| 209 | iso_pu_bacteria | 2935975950 | 2935979340 | 304 |
| 210 | iso_pu_bacteria | 2935984226 | 2935988075 | 304 |
| 211 | iso_pu_bacteria | 2935992306 | 2935993632 | 304 |
| 212 | iso_pu_bacteria | 2936002035 | 2936004528 | 304 |
| 213 | iso_pu_bacteria | 2936011229 | 2936017665 | 304 |
| 214 | iso_pu_bacteria | 2936019824 | 2936026253 | 304 |
| 215 | iso_pu_bacteria | 2936028420 | 2936035243 | 304 |
| 216 | iso_pu_bacteria | 2936037263 | 2936038454 | 304 |
| 217 | iso_pu_bacteria | 2936046547 | 2936053151 | 304 |
| 218 | iso_pu_bacteria | 2936055302 | 2936059374 | 304 |
| 219 | iso_pu_bacteria | 2940556831 | 2940563796 | 304 |
| 220 | iso_pu_bacteria | 2941507105 | 2941510789 | 304 |
| 221 | iso_pu_bacteria | 2941515067 | 2941518173 | 304 |
| 222 | iso_pu_bacteria | 2941523033 | 2941526956 | 304 |
| 223 | iso_pu_bacteria | 2941531003 | 2941533853 | 304 |
| 224 | iso_pu_bacteria | 2941538514 | 2941544137 | 304 |
| 225 | iso_pu_bacteria | 3005474847 | 3005481110 | 304 |
| 226 | iso_pu_bacteria | 3005594810 | 3005596714 | 304 |
| 227 | iso_pu_bacteria | 3005710791 | 3005712785 | 304 |
| 228 | iso_pu_bacteria | 3005718088 | 3005719842 | 304 |
| 229 | iso_pu_bacteria | 8006933436 | 8006939601 | 304 |
| 230 | iso_pu_bacteria | 8006973647 | 8006979352 | 304 |
| 231 | iso_pu_bacteria | 8016511872 | 8016516245 | 304 |
| 232 | iso_pu_bacteria | 8016548790 | 8016551832 | 304 |
| 233 | iso_pu_bacteria | 8016557553 | 8016560215 | 304 |
| 234 | iso_pu_bacteria | 8016566248 | 8016566812 | 304 |
| 235 | iso_pu_bacteria | 8016583857 | 8016589310 | 304 |
| 236 | iso_pu_bacteria | 8016595262 | 8016598133 | 304 |
| 237 | iso_pu_bacteria | 8016603502 | 8016604272 | 304 |
| 238 | iso_pu_bacteria | 8016613128 | 8016620858 | 304 |
| 239 | iso_pu_bacteria | 8016622563 | 8016629130 | 304 |
| 240 | iso_pu_bacteria | 8017057580 | 8017060287 | 304 |
| 241 | iso_pu_bacteria | 8019547302 | 8019548062 | 304 |
| 242 | iso_pu_bacteria | 8019555841 | 8019565492 | 304 |
| 243 | iso_pu_bacteria | 8019565922 | 8019575588 | 304 |
| 244 | iso_pu_bacteria | 8019586578 | 8019587520 | 304 |
| 245 | iso_pu_bacteria | 8019597564 | 8019603818 | 304 |
| 246 | iso_pu_bacteria | 8019608314 | 8019614717 | 304 |
| 247 | iso_pu_bacteria | 8019619141 | 8019625328 | 304 |
| 248 | iso_pu_bacteria | 8019629233 | 8019636853 | 304 |
| 249 | iso_pu_bacteria | 8019648815 | 8019649838 | 304 |
| 250 | iso_pu_bacteria | 8019659431 | 8019664674 | 304 |
| 251 | iso_pu_bacteria | 8019668869 | 8019674264 | 304 |
| 252 | iso_pu_bacteria | 8019687851 | 8019693930 | 304 |
| 253 | iso_pu_bacteria | 8055742211 | 8055748979 | 304 |
| 254 | iso_pu_bacteria | 8056689827 | 8056693836 | 304 |
| 255 | iso_pu_bacteria | 8056967851 | 8056972022 | 304 |
| 256 | 3300039450 | Ga0436363_0700194 | Ga0436363_0700194_493_1416 | 305 |
| 257 | 3300005564 | Ga0070664_100152168 | Ga0070664_1001521681 | 306 |
| 258 | 3300037312 | Ga0395899_0122972 | Ga0395899_0122972_502_1443 | 306 |
| 259 | 3300037418 | Ga0395900_0002114 | Ga0395900_0002114_9411_10352 | 306 |
| 260 | 3300037466 | Ga0395898_0064826 | Ga0395898_0064826_1316_2257 | 306 |
| 261 | 3300037471 | Ga0395905_0259473 | Ga0395905_0259473_270_1211 | 306 |
| 262 | 3300038443 | Ga0395901_0034087 | Ga0395901_0034087_2157_3098 | 306 |
| 263 | 3300046455 | Ga0495603_0139262 | Ga0495603_0139262_423_1346 | 306 |
| 264 | 3300046461 | Ga0495641_0144258 | Ga0495641_0144258_82_1005 | 306 |
| 265 | 3300046690 | Ga0495624_0111238 | Ga0495624_0111238_738_1661 | 306 |
| 266 | 3300048907 | Ga0496104_0005309 | Ga0496104_0005309_8892_9815 | 306 |
| 267 | 3300048911 | Ga0496108_0001861 | Ga0496108_0001861_7716_8639 | 306 |
| 268 | 3300048912 | Ga0496109_0001073 | Ga0496109_0001073_13799_14722 | 306 |
| 269 | 3300048913 | Ga0496110_0002479 | Ga0496110_0002479_5568_6491 | 306 |
| 270 | 3300048914 | Ga0496111_0028004 | Ga0496111_0028004_2444_3367 | 306 |
| 271 | 3300048915 | Ga0496112_0005807 | Ga0496112_0005807_4436_5359 | 306 |
| 272 | 3300048916 | Ga0496113_0000095 | Ga0496113_0000095_21693_22616 | 306 |
| 273 | 3300048918 | Ga0496115_0003952 | Ga0496115_0003952_734_1657 | 306 |
| 274 | 3300005327 | Ga0070658_10056239 | Ga0070658_100562392 | 307 |
| 275 | 3300005329 | Ga0070683_100658453 | Ga0070683_1006584531 | 307 |
| 276 | 3300005337 | Ga0070682_100316334 | Ga0070682_1003163342 | 307 |
| 277 | 3300005434 | Ga0070709_10002013 | Ga0070709_100020137 | 307 |
| 278 | 3300005434 | Ga0070709_10005865 | Ga0070709_100058654 | 307 |
| 279 | 3300005435 | Ga0070714_100006313 | Ga0070714_1000063131 | 307 |
| 280 | 3300005435 | Ga0070714_100041770 | Ga0070714_1000417702 | 307 |
| 281 | 3300005436 | Ga0070713_100004655 | Ga0070713_1000046555 | 307 |
| 282 | 3300005437 | Ga0070710_10000896 | Ga0070710_100008963 | 307 |
| 283 | 3300005437 | Ga0070710_10002832 | Ga0070710_100028324 | 307 |
| 284 | 3300005439 | Ga0070711_100007213 | Ga0070711_1000072134 | 307 |
| 285 | 3300005439 | Ga0070711_100008957 | Ga0070711_1000089573 | 307 |
| 286 | 3300005455 | Ga0070663_100036834 | Ga0070663_1000368342 | 307 |
| 287 | 3300005458 | Ga0070681_10146085 | Ga0070681_101460852 | 307 |
| 288 | 3300005458 | Ga0070681_10511038 | Ga0070681_105110382 | 307 |
| 289 | 3300005563 | Ga0068855_100072657 | Ga0068855_1000726573 | 307 |
| 290 | 3300005983 | Ga0081540_1002227 | Ga0081540_10022272 | 307 |
| 291 | 3300006028 | Ga0070717_10087311 | Ga0070717_100873111 | 307 |
| 292 | 3300006028 | Ga0070717_10429945 | Ga0070717_104299452 | 307 |
| 293 | 3300006163 | Ga0070715_10000456 | Ga0070715_100004568 | 307 |
| 294 | 3300006173 | Ga0070716_100011137 | Ga0070716_1000111374 | 307 |
| 295 | 3300006175 | Ga0070712_100015504 | Ga0070712_1000155044 | 307 |
| 296 | 3300009101 | Ga0105247_10240256 | Ga0105247_102402562 | 307 |
| 297 | 3300013104 | Ga0157370_10338421 | Ga0157370_103384212 | 307 |
| 298 | 3300013296 | Ga0157374_10634738 | Ga0157374_106347382 | 307 |
| 299 | 3300021361 | Ga0213872_10000429 | Ga0213872_1000042916 | 307 |
| 300 | 3300021361 | Ga0213872_10004083 | Ga0213872_100040837 | 307 |
| 301 | 3300021361 | Ga0213872_10004694 | Ga0213872_100046944 | 307 |
| 302 | 3300021377 | Ga0213874_10002580 | Ga0213874_100025802 | 307 |
| 303 | 3300021377 | Ga0213874_10002639 | Ga0213874_100026393 | 307 |
| 304 | 3300021377 | Ga0213874_10005128 | Ga0213874_100051282 | 307 |
| 305 | 3300021384 | Ga0213876_10001306 | Ga0213876_100013063 | 307 |
| 306 | 3300025898 | Ga0207692_10002885 | Ga0207692_100028854 | 307 |
| 307 | 3300025898 | Ga0207692_10005756 | Ga0207692_100057565 | 307 |
| 308 | 3300025905 | Ga0207685_10000267 | Ga0207685_100002672 | 307 |
| 309 | 3300025906 | Ga0207699_10002339 | Ga0207699_100023396 | 307 |
| 310 | 3300025906 | Ga0207699_10003537 | Ga0207699_100035377 | 307 |
| 311 | 3300025914 | Ga0207671_10139497 | Ga0207671_101394972 | 307 |
| 312 | 3300025915 | Ga0207693_10000326 | Ga0207693_100003269 | 307 |
| 313 | 3300025915 | Ga0207693_10015787 | Ga0207693_100157873 | 307 |
| 314 | 3300025916 | Ga0207663_10000225 | Ga0207663_100002253 | 307 |
| 315 | 3300025916 | Ga0207663_10009124 | Ga0207663_100091244 | 307 |
| 316 | 3300025929 | Ga0207664_10014435 | Ga0207664_100144355 | 307 |
| 317 | 3300025929 | Ga0207664_10031784 | Ga0207664_100317842 | 307 |
| 318 | 3300025939 | Ga0207665_10001364 | Ga0207665_1000136410 | 307 |
| 319 | 3300025939 | Ga0207665_10015528 | Ga0207665_100155284 | 307 |
| 320 | 3300026067 | Ga0207678_10054764 | Ga0207678_100547642 | 307 |
| 321 | 3300030878 | Ga0265770_1014959 | Ga0265770_10149591 | 307 |
| 322 | 3300031018 | Ga0265773_1001012 | Ga0265773_10010122 | 307 |
| 323 | 3300031090 | Ga0265760_10051491 | Ga0265760_100514912 | 307 |
| 324 | 3300031241 | Ga0265325_10012959 | Ga0265325_100129593 | 307 |
| 325 | 3300031249 | Ga0265339_10000016 | Ga0265339_10000016134 | 307 |
| 326 | 3300031456 | Ga0307513_10018286 | Ga0307513_100182863 | 307 |
| 327 | 3300031595 | Ga0265313_10000060 | Ga0265313_100000605 | 307 |
| 328 | 3300031730 | Ga0307516_10092521 | Ga0307516_100925212 | 307 |
| 329 | 3300037853 | Ga0436364_0240938 | Ga0436364_0240938_1057_1983 | 307 |
| 330 | 3300038443 | Ga0395901_0063663 | Ga0395901_0063663_2472_3398 | 307 |
| 331 | 3300039437 | Ga0436365_0510188 | Ga0436365_0510188_4120_5046 | 307 |
| 332 | 3300039437 | Ga0436365_0697045 | Ga0436365_0697045_2393_3319 | 307 |
| 333 | 3300039438 | Ga0436360_0545523 | Ga0436360_0545523_202_1128 | 307 |
| 334 | 3300039438 | Ga0436360_1060729 | Ga0436360_1060729_137_1060 | 307 |
| 335 | 3300039447 | Ga0436361_0200283 | Ga0436361_0200283_1267_2193 | 307 |
| 336 | 3300039447 | Ga0436361_0512286 | Ga0436361_0512286_3073_3996 | 307 |
| 337 | 3300039447 | Ga0436361_0638445 | Ga0436361_0638445_3099_4022 | 307 |
| 338 | 3300039447 | Ga0436361_1054672 | Ga0436361_1054672_1223_2182 | 307 |
| 339 | 3300039450 | Ga0436363_0627803 | Ga0436363_0627803_52_978 | 307 |
| 340 | 3300039450 | Ga0436363_1022276 | Ga0436363_1022276_7720_8667 | 307 |
| 341 | 3300044694 | Ga0466963_0209438 | Ga0466963_0209438_37_969 | 307 |
| 342 | 3300044735 | Ga0466968_0011964 | Ga0466968_0011964_1426_2352 | 307 |
| 343 | 3300045976 | Ga0466967_0063821 | Ga0466967_0063821_1458_2384 | 307 |
| 344 | 3300045976 | Ga0466967_0549232 | Ga0466967_0549232_62_988 | 307 |
| 345 | 3300048924 | Ga0496121_0032677 | Ga0496121_0032677_2588_3517 | 307 |
| 346 | 3300048928 | Ga0496125_0000237 | Ga0496125_0000237_52106_53035 | 307 |
| 347 | 3300048928 | Ga0496125_0001822 | Ga0496125_0001822_14306_15235 | 307 |
| 348 | 3300049568 | Ga0501031_0118857 | Ga0501031_0118857_678_1607 | 307 |
| 349 | 3300049569 | Ga0501032_0000358 | Ga0501032_0000358_27395_28324 | 307 |
| 350 | 3300049569 | Ga0501032_0086541 | Ga0501032_0086541_936_1865 | 307 |
| 351 | 3300049570 | Ga0501033_0000601 | Ga0501033_0000601_8103_9032 | 307 |
| 352 | 3300049570 | Ga0501033_0006726 | Ga0501033_0006726_6359_7288 | 307 |
| 353 | 3300049571 | Ga0501034_0193399 | Ga0501034_0193399_282_1211 | 307 |
| 354 | 3300049572 | Ga0501036_0301604 | Ga0501036_0301604_77_1006 | 307 |
| 355 | 3300049573 | Ga0501037_0001450 | Ga0501037_0001450_6130_7059 | 307 |
| 356 | 3300049574 | Ga0501038_0119167 | Ga0501038_0119167_1092_2021 | 307 |
| 357 | 3300049574 | Ga0501038_0177296 | Ga0501038_0177296_157_1086 | 307 |
| 358 | 3300049574 | Ga0501038_0275468 | Ga0501038_0275468_207_1136 | 307 |
| 359 | 3300049575 | Ga0501039_0156253 | Ga0501039_0156253_597_1520 | 307 |
| 360 | 3300049579 | Ga0501043_0000007 | Ga0501043_0000007_217252_218181 | 307 |
| 361 | 3300049581 | Ga0501047_0009482 | Ga0501047_0009482_3418_4347 | 307 |
| 362 | 3300049581 | Ga0501047_0012842 | Ga0501047_0012842_4374_5303 | 307 |
| 363 | 3300049585 | Ga0501069_0000001 | Ga0501069_0000001_177005_177934 | 307 |
| 364 | 3300049585 | Ga0501069_0133516 | Ga0501069_0133516_401_1330 | 307 |
| 365 | 3300049586 | Ga0501070_0000071 | Ga0501070_0000071_18805_19734 | 307 |
| 366 | 3300049586 | Ga0501070_0000824 | Ga0501070_0000824_966_1895 | 307 |
| 367 | 3300049587 | Ga0501071_0010530 | Ga0501071_0010530_3958_4887 | 307 |
| 368 | 3300049589 | Ga0501073_0011727 | Ga0501073_0011727_5336_6265 | 307 |
| 369 | 3300049590 | Ga0501074_0000003 | Ga0501074_0000003_92118_93047 | 307 |
| 370 | 3300049592 | Ga0501076_0332905 | Ga0501076_0332905_216_1145 | 307 |
| 371 | 3300049742 | Ga0501080_0000470 | Ga0501080_0000470_21294_22223 | 307 |
| 372 | 3300049744 | Ga0501083_0000080 | Ga0501083_0000080_25035_25964 | 307 |
| 373 | 3300049744 | Ga0501083_0101325 | Ga0501083_0101325_563_1492 | 307 |
| 374 | 3300049822 | Ga0501035_0000037 | Ga0501035_0000037_121496_122425 | 307 |
| 375 | 3300049822 | Ga0501035_0001584 | Ga0501035_0001584_21626_22555 | 307 |
| 376 | 3300049822 | Ga0501035_0002187 | Ga0501035_0002187_17781_18710 | 307 |
| 377 | 3300049822 | Ga0501035_0070539 | Ga0501035_0070539_1327_2250 | 307 |
| 378 | 3300049822 | Ga0501035_0175161 | Ga0501035_0175161_751_1674 | 307 |
| 379 | 3300049823 | Ga0501044_0000018 | Ga0501044_0000018_102768_103697 | 307 |
| 380 | 3300049823 | Ga0501044_0072305 | Ga0501044_0072305_2485_3414 | 307 |
| 381 | 3300049823 | Ga0501044_0085781 | Ga0501044_0085781_1783_2709 | 307 |
| 382 | 3300049823 | Ga0501044_0087528 | Ga0501044_0087528_815_1744 | 307 |
| 383 | 3300049823 | Ga0501044_0091284 | Ga0501044_0091284_969_1898 | 307 |
| 384 | 3300053130 | Ga0500642_0104340 | Ga0500642_0104340_275_1201 | 307 |
| 385 | 3300003214 | JGI25165J46597_1006767 | JGI25165J46597_10067672 | 308 |
| 386 | 3300003354 | JGI25160J50197_1007582 | JGI25160J50197_10075823 | 308 |
| 387 | 3300004625 | Ga0055543_1013756 | Ga0055543_10137562 | 308 |
| 388 | 3300005262 | Ga0065165_1004374 | Ga0065165_10043742 | 308 |
| 389 | 3300005328 | Ga0070676_10289184 | Ga0070676_102891841 | 308 |
| 390 | 3300005329 | Ga0070683_100001891 | Ga0070683_10000189115 | 308 |
| 391 | 3300005329 | Ga0070683_100019924 | Ga0070683_1000199243 | 308 |
| 392 | 3300005329 | Ga0070683_100072047 | Ga0070683_1000720471 | 308 |
| 393 | 3300005334 | Ga0068869_100001186 | Ga0068869_1000011864 | 308 |
| 394 | 3300005336 | Ga0070680_100016775 | Ga0070680_1000167756 | 308 |
| 395 | 3300005336 | Ga0070680_100312437 | Ga0070680_1003124372 | 308 |
| 396 | 3300005337 | Ga0070682_100056630 | Ga0070682_1000566302 | 308 |
| 397 | 3300005338 | Ga0068868_100002380 | Ga0068868_1000023808 | 308 |
| 398 | 3300005340 | Ga0070689_100090026 | Ga0070689_1000900262 | 308 |
| 399 | 3300005341 | Ga0070691_10186651 | Ga0070691_101866511 | 308 |
| 400 | 3300005347 | Ga0070668_100008952 | Ga0070668_1000089528 | 308 |
| 401 | 3300005356 | Ga0070674_100161557 | Ga0070674_1001615572 | 308 |
| 402 | 3300005366 | Ga0070659_100051334 | Ga0070659_1000513342 | 308 |
| 403 | 3300005366 | Ga0070659_100256937 | Ga0070659_1002569372 | 308 |
| 404 | 3300005367 | Ga0070667_100362682 | Ga0070667_1003626821 | 308 |
| 405 | 3300005435 | Ga0070714_100173398 | Ga0070714_1001733982 | 308 |
| 406 | 3300005436 | Ga0070713_100039500 | Ga0070713_1000395004 | 308 |
| 407 | 3300005436 | Ga0070713_100164699 | Ga0070713_1001646992 | 308 |
| 408 | 3300005438 | Ga0070701_10083906 | Ga0070701_100839062 | 308 |
| 409 | 3300005439 | Ga0070711_100093101 | Ga0070711_1000931012 | 308 |
| 410 | 3300005455 | Ga0070663_100033127 | Ga0070663_1000331273 | 308 |
| 411 | 3300005457 | Ga0070662_100132585 | Ga0070662_1001325852 | 308 |
| 412 | 3300005458 | Ga0070681_10076300 | Ga0070681_100763002 | 308 |
| 413 | 3300005467 | Ga0070706_100118744 | Ga0070706_1001187442 | 308 |
| 414 | 3300005468 | Ga0070707_100171685 | Ga0070707_1001716852 | 308 |
| 415 | 3300005530 | Ga0070679_100029796 | Ga0070679_1000297963 | 308 |
| 416 | 3300005530 | Ga0070679_100291008 | Ga0070679_1002910081 | 308 |
| 417 | 3300005530 | Ga0070679_100316505 | Ga0070679_1003165052 | 308 |
| 418 | 3300005535 | Ga0070684_100010920 | Ga0070684_1000109206 | 308 |
| 419 | 3300005535 | Ga0070684_100052866 | Ga0070684_1000528664 | 308 |
| 420 | 3300005536 | Ga0070697_100093961 | Ga0070697_1000939612 | 308 |
| 421 | 3300005539 | Ga0068853_100035551 | Ga0068853_1000355513 | 308 |
| 422 | 3300005539 | Ga0068853_100169342 | Ga0068853_1001693422 | 308 |
| 423 | 3300005544 | Ga0070686_100053425 | Ga0070686_1000534253 | 308 |
| 424 | 3300005548 | Ga0070665_100012340 | Ga0070665_1000123408 | 308 |
| 425 | 3300005548 | Ga0070665_100035823 | Ga0070665_1000358234 | 308 |
| 426 | 3300005563 | Ga0068855_100040104 | Ga0068855_1000401045 | 308 |
| 427 | 3300005563 | Ga0068855_100077687 | Ga0068855_1000776873 | 308 |
| 428 | 3300005563 | Ga0068855_100097896 | Ga0068855_1000978963 | 308 |
| 429 | 3300005563 | Ga0068855_100328828 | Ga0068855_1003288282 | 308 |
| 430 | 3300005563 | Ga0068855_100342315 | Ga0068855_1003423151 | 308 |
| 431 | 3300005563 | Ga0068855_100425519 | Ga0068855_1004255192 | 308 |
| 432 | 3300005564 | Ga0070664_100026724 | Ga0070664_1000267243 | 308 |
| 433 | 3300005564 | Ga0070664_100410739 | Ga0070664_1004107392 | 308 |
| 434 | 3300005577 | Ga0068857_100017610 | Ga0068857_1000176103 | 308 |
| 435 | 3300005577 | Ga0068857_100028282 | Ga0068857_1000282821 | 308 |
| 436 | 3300005578 | Ga0068854_100097839 | Ga0068854_1000978393 | 308 |
| 437 | 3300005614 | Ga0068856_100000183 | Ga0068856_10000018334 | 308 |
| 438 | 3300005614 | Ga0068856_100029563 | Ga0068856_1000295636 | 308 |
| 439 | 3300005614 | Ga0068856_100063430 | Ga0068856_1000634302 | 308 |
| 440 | 3300005616 | Ga0068852_100053488 | Ga0068852_1000534883 | 308 |
| 441 | 3300005616 | Ga0068852_100230989 | Ga0068852_1002309891 | 308 |
| 442 | 3300005617 | Ga0068859_100063595 | Ga0068859_1000635952 | 308 |
| 443 | 3300005618 | Ga0068864_100049226 | Ga0068864_1000492263 | 308 |
| 444 | 3300005618 | Ga0068864_100122039 | Ga0068864_1001220392 | 308 |
| 445 | 3300005719 | Ga0068861_100042059 | Ga0068861_1000420593 | 308 |
| 446 | 3300005840 | Ga0068870_10004287 | Ga0068870_100042872 | 308 |
| 447 | 3300005841 | Ga0068863_100027853 | Ga0068863_1000278534 | 308 |
| 448 | 3300005842 | Ga0068858_100041385 | Ga0068858_1000413852 | 308 |
| 449 | 3300005842 | Ga0068858_100589553 | Ga0068858_1005895532 | 308 |
| 450 | 3300005843 | Ga0068860_100093295 | Ga0068860_1000932952 | 308 |
| 451 | 3300005983 | Ga0081540_1005198 | Ga0081540_10051985 | 308 |
| 452 | 3300005983 | Ga0081540_1006571 | Ga0081540_10065716 | 308 |
| 453 | 3300005983 | Ga0081540_1006785 | Ga0081540_10067854 | 308 |
| 454 | 3300005983 | Ga0081540_1018573 | Ga0081540_10185733 | 308 |
| 455 | 3300006038 | Ga0075365_10059561 | Ga0075365_100595612 | 308 |
| 456 | 3300006042 | Ga0075368_10019062 | Ga0075368_100190622 | 308 |
| 457 | 3300006048 | Ga0075363_100010158 | Ga0075363_1000101583 | 308 |
| 458 | 3300006048 | Ga0075363_100048514 | Ga0075363_1000485142 | 308 |
| 459 | 3300006051 | Ga0075364_10024619 | Ga0075364_100246192 | 308 |
| 460 | 3300006051 | Ga0075364_10295801 | Ga0075364_102958012 | 308 |
| 461 | 3300006173 | Ga0070716_100023798 | Ga0070716_1000237982 | 308 |
| 462 | 3300006178 | Ga0075367_10001130 | Ga0075367_100011307 | 308 |
| 463 | 3300006186 | Ga0075369_10005353 | Ga0075369_100053533 | 308 |
| 464 | 3300006195 | Ga0075366_10016316 | Ga0075366_100163162 | 308 |
| 465 | 3300006353 | Ga0075370_10009564 | Ga0075370_100095643 | 308 |
| 466 | 3300006353 | Ga0075370_10017687 | Ga0075370_100176872 | 308 |
| 467 | 3300006881 | Ga0068865_100055253 | Ga0068865_1000552533 | 308 |
| 468 | 3300006914 | Ga0075436_100088588 | Ga0075436_1000885882 | 308 |
| 469 | 3300006931 | Ga0097620_100063592 | Ga0097620_1000635923 | 308 |
| 470 | 3300006942 | Ga0099824_1021709 | Ga0099824_10217094 | 308 |
| 471 | 3300006942 | Ga0099824_1033210 | Ga0099824_10332102 | 308 |
| 472 | 3300006943 | Ga0099822_1024226 | Ga0099822_10242263 | 308 |
| 473 | 3300009093 | Ga0105240_10039694 | Ga0105240_100396942 | 308 |
| 474 | 3300009093 | Ga0105240_10109427 | Ga0105240_101094274 | 308 |
| 475 | 3300009093 | Ga0105240_10135701 | Ga0105240_101357012 | 308 |
| 476 | 3300009094 | Ga0111539_10714684 | Ga0111539_107146841 | 308 |
| 477 | 3300009098 | Ga0105245_10005441 | Ga0105245_100054416 | 308 |
| 478 | 3300009098 | Ga0105245_10038994 | Ga0105245_100389943 | 308 |
| 479 | 3300009101 | Ga0105247_10005785 | Ga0105247_100057853 | 308 |
| 480 | 3300009148 | Ga0105243_10042185 | Ga0105243_100421853 | 308 |
| 481 | 3300009174 | Ga0105241_10037493 | Ga0105241_100374932 | 308 |
| 482 | 3300009174 | Ga0105241_10211105 | Ga0105241_102111052 | 308 |
| 483 | 3300009177 | Ga0105248_10646336 | Ga0105248_106463362 | 308 |
| 484 | 3300009545 | Ga0105237_10017339 | Ga0105237_100173395 | 308 |
| 485 | 3300009545 | Ga0105237_10095319 | Ga0105237_100953192 | 308 |
| 486 | 3300009545 | Ga0105237_10138567 | Ga0105237_101385672 | 308 |
| 487 | 3300009545 | Ga0105237_10298145 | Ga0105237_102981452 | 308 |
| 488 | 3300010159 | Ga0099796_10010555 | Ga0099796_100105552 | 308 |
| 489 | 3300010375 | Ga0105239_10003963 | Ga0105239_1000396311 | 308 |
| 490 | 3300010375 | Ga0105239_10109809 | Ga0105239_101098093 | 308 |
| 491 | 3300011119 | Ga0105246_10379968 | Ga0105246_103799681 | 308 |
| 492 | 3300013104 | Ga0157370_10097584 | Ga0157370_100975842 | 308 |
| 493 | 3300013104 | Ga0157370_10357736 | Ga0157370_103577362 | 308 |
| 494 | 3300013105 | Ga0157369_10012373 | Ga0157369_100123739 | 308 |
| 495 | 3300013105 | Ga0157369_10026071 | Ga0157369_100260713 | 308 |
| 496 | 3300013105 | Ga0157369_10083698 | Ga0157369_100836982 | 308 |
| 497 | 3300013306 | Ga0163162_10025402 | Ga0163162_100254024 | 308 |
| 498 | 3300013306 | Ga0163162_10146465 | Ga0163162_101464651 | 308 |
| 499 | 3300013307 | Ga0157372_10034737 | Ga0157372_100347375 | 308 |
| 500 | 3300013307 | Ga0157372_10048052 | Ga0157372_100480524 | 308 |
| 501 | 3300013308 | Ga0157375_10011636 | Ga0157375_100116362 | 308 |
| 502 | 3300014325 | Ga0163163_10007610 | Ga0163163_100076103 | 308 |
| 503 | 3300014325 | Ga0163163_10073797 | Ga0163163_100737973 | 308 |
| 504 | 3300014969 | Ga0157376_10153431 | Ga0157376_101534312 | 308 |
| 505 | 3300021384 | Ga0213876_10134690 | Ga0213876_101346902 | 308 |
| 506 | 3300021388 | Ga0213875_10077961 | Ga0213875_100779612 | 308 |
| 507 | 3300021441 | Ga0213871_10068475 | Ga0213871_100684751 | 308 |
| 508 | 3300025253 | Ga0209677_100749 | Ga0209677_1007492 | 308 |
| 509 | 3300025254 | Ga0209148_1000773 | Ga0209148_10007734 | 308 |
| 510 | 3300025261 | Ga0209233_1003148 | Ga0209233_10031484 | 308 |
| 511 | 3300025261 | Ga0209233_1004858 | Ga0209233_10048582 | 308 |
| 512 | 3300025261 | Ga0209233_1005292 | Ga0209233_10052923 | 308 |
| 513 | 3300025261 | Ga0209233_1005946 | Ga0209233_10059463 | 308 |
| 514 | 3300025272 | Ga0209455_1001728 | Ga0209455_10017288 | 308 |
| 515 | 3300025272 | Ga0209455_1008216 | Ga0209455_10082163 | 308 |
| 516 | 3300025295 | Ga0209564_1003916 | Ga0209564_10039164 | 308 |
| 517 | 3300025297 | Ga0209758_1000282 | Ga0209758_100028274 | 308 |
| 518 | 3300025297 | Ga0209758_1004003 | Ga0209758_10040034 | 308 |
| 519 | 3300025297 | Ga0209758_1027779 | Ga0209758_10277792 | 308 |
| 520 | 3300025302 | Ga0207426_1000437 | Ga0207426_100043762 | 308 |
| 521 | 3300025302 | Ga0207426_1001098 | Ga0207426_100109819 | 308 |
| 522 | 3300025302 | Ga0207426_1012310 | Ga0207426_10123103 | 308 |
| 523 | 3300025898 | Ga0207692_10009200 | Ga0207692_100092002 | 308 |
| 524 | 3300025900 | Ga0207710_10018346 | Ga0207710_100183462 | 308 |
| 525 | 3300025901 | Ga0207688_10019965 | Ga0207688_100199652 | 308 |
| 526 | 3300025908 | Ga0207643_10025498 | Ga0207643_100254983 | 308 |
| 527 | 3300025909 | Ga0207705_10082672 | Ga0207705_100826722 | 308 |
| 528 | 3300025911 | Ga0207654_10021751 | Ga0207654_100217513 | 308 |
| 529 | 3300025911 | Ga0207654_10029110 | Ga0207654_100291102 | 308 |
| 530 | 3300025913 | Ga0207695_10000062 | Ga0207695_1000006296 | 308 |
| 531 | 3300025913 | Ga0207695_10019960 | Ga0207695_100199607 | 308 |
| 532 | 3300025913 | Ga0207695_10078563 | Ga0207695_100785632 | 308 |
| 533 | 3300025913 | Ga0207695_10251375 | Ga0207695_102513752 | 308 |
| 534 | 3300025914 | Ga0207671_10008251 | Ga0207671_100082517 | 308 |
| 535 | 3300025914 | Ga0207671_10051920 | Ga0207671_100519202 | 308 |
| 536 | 3300025914 | Ga0207671_10092336 | Ga0207671_100923362 | 308 |
| 537 | 3300025914 | Ga0207671_10223517 | Ga0207671_102235172 | 308 |
| 538 | 3300025915 | Ga0207693_10003223 | Ga0207693_1000322313 | 308 |
| 539 | 3300025916 | Ga0207663_10096713 | Ga0207663_100967132 | 308 |
| 540 | 3300025916 | Ga0207663_10116539 | Ga0207663_101165392 | 308 |
| 541 | 3300025919 | Ga0207657_10004806 | Ga0207657_1000480610 | 308 |
| 542 | 3300025920 | Ga0207649_10102875 | Ga0207649_101028752 | 308 |
| 543 | 3300025921 | Ga0207652_10013842 | Ga0207652_100138423 | 308 |
| 544 | 3300025921 | Ga0207652_10023687 | Ga0207652_100236873 | 308 |
| 545 | 3300025921 | Ga0207652_10525394 | Ga0207652_105253941 | 308 |
| 546 | 3300025924 | Ga0207694_10525114 | Ga0207694_105251141 | 308 |
| 547 | 3300025929 | Ga0207664_10109709 | Ga0207664_101097092 | 308 |
| 548 | 3300025931 | Ga0207644_10016717 | Ga0207644_100167173 | 308 |
| 549 | 3300025932 | Ga0207690_10025298 | Ga0207690_100252982 | 308 |
| 550 | 3300025933 | Ga0207706_10199961 | Ga0207706_101999611 | 308 |
| 551 | 3300025935 | Ga0207709_10203375 | Ga0207709_102033752 | 308 |
| 552 | 3300025938 | Ga0207704_10048142 | Ga0207704_100481422 | 308 |
| 553 | 3300025939 | Ga0207665_10036269 | Ga0207665_100362692 | 308 |
| 554 | 3300025941 | Ga0207711_10054778 | Ga0207711_100547783 | 308 |
| 555 | 3300025942 | Ga0207689_10014080 | Ga0207689_100140804 | 308 |
| 556 | 3300025944 | Ga0207661_10001182 | Ga0207661_1000118212 | 308 |
| 557 | 3300025944 | Ga0207661_10203221 | Ga0207661_102032212 | 308 |
| 558 | 3300025945 | Ga0207679_10363881 | Ga0207679_103638812 | 308 |
| 559 | 3300025945 | Ga0207679_10489006 | Ga0207679_104890061 | 308 |
| 560 | 3300025961 | Ga0207712_10125479 | Ga0207712_101254792 | 308 |
| 561 | 3300025972 | Ga0207668_10004125 | Ga0207668_100041254 | 308 |
| 562 | 3300025986 | Ga0207658_10093472 | Ga0207658_100934722 | 308 |
| 563 | 3300026023 | Ga0207677_10038130 | Ga0207677_100381302 | 308 |
| 564 | 3300026041 | Ga0207639_10010102 | Ga0207639_100101025 | 308 |
| 565 | 3300026041 | Ga0207639_10196860 | Ga0207639_101968602 | 308 |
| 566 | 3300026041 | Ga0207639_10311422 | Ga0207639_103114222 | 308 |
| 567 | 3300026067 | Ga0207678_10014454 | Ga0207678_100144543 | 308 |
| 568 | 3300026067 | Ga0207678_10021795 | Ga0207678_100217954 | 308 |
| 569 | 3300026067 | Ga0207678_10023002 | Ga0207678_100230022 | 308 |
| 570 | 3300026078 | Ga0207702_10000197 | Ga0207702_1000019766 | 308 |
| 571 | 3300026078 | Ga0207702_10018501 | Ga0207702_100185012 | 308 |
| 572 | 3300026088 | Ga0207641_10238720 | Ga0207641_102387202 | 308 |
| 573 | 3300026089 | Ga0207648_10219239 | Ga0207648_102192392 | 308 |
| 574 | 3300026095 | Ga0207676_10106108 | Ga0207676_101061082 | 308 |
| 575 | 3300026116 | Ga0207674_10464147 | Ga0207674_104641472 | 308 |
| 576 | 3300026118 | Ga0207675_100041364 | Ga0207675_1000413643 | 308 |
| 577 | 3300026121 | Ga0207683_10011087 | Ga0207683_100110873 | 308 |
| 578 | 3300026142 | Ga0207698_10105090 | Ga0207698_101050902 | 308 |
| 579 | 3300026142 | Ga0207698_10200930 | Ga0207698_102009302 | 308 |
| 580 | 3300026142 | Ga0207698_10314938 | Ga0207698_103149382 | 308 |
| 581 | 3300027296 | Ga0209389_1000004 | Ga0209389_1000004145 | 308 |
| 582 | 3300027357 | Ga0209589_1000014 | Ga0209589_100001461 | 308 |
| 583 | 3300027361 | Ga0209489_100014 | Ga0209489_10001461 | 308 |
| 584 | 3300027361 | Ga0209489_100777 | Ga0209489_1007779 | 308 |
| 585 | 3300027363 | Ga0209700_100013 | Ga0209700_100013231 | 308 |
| 586 | 3300027363 | Ga0209700_100024 | Ga0209700_10002461 | 308 |
| 587 | 3300027866 | Ga0209813_10002203 | Ga0209813_100022033 | 308 |
| 588 | 3300028379 | Ga0268266_10001413 | Ga0268266_1000141316 | 308 |
| 589 | 3300028379 | Ga0268266_10087585 | Ga0268266_100875852 | 308 |
| 590 | 3300028381 | Ga0268264_10062341 | Ga0268264_100623413 | 308 |
| 591 | 3300028573 | Ga0265334_10054565 | Ga0265334_100545652 | 308 |
| 592 | 3300031235 | Ga0265330_10035799 | Ga0265330_100357991 | 308 |
| 593 | 3300031247 | Ga0265340_10011608 | Ga0265340_100116082 | 308 |
| 594 | 3300031249 | Ga0265339_10006455 | Ga0265339_100064553 | 308 |
| 595 | 3300031249 | Ga0265339_10016353 | Ga0265339_100163532 | 308 |
| 596 | 3300031249 | Ga0265339_10110791 | Ga0265339_101107912 | 308 |
| 597 | 3300031344 | Ga0265316_10387288 | Ga0265316_103872881 | 308 |
| 598 | 3300031711 | Ga0265314_10016312 | Ga0265314_100163123 | 308 |
| 599 | 3300031711 | Ga0265314_10069850 | Ga0265314_100698502 | 308 |
| 600 | 3300031712 | Ga0265342_10010600 | Ga0265342_100106003 | 308 |
| 601 | 3300033180 | Ga0307510_10019799 | Ga0307510_100197998 | 308 |
| 602 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002279 | 308 |
| 603 | 3300033544 | Ga0316215_1001104 | Ga0316215_10011042 | 308 |
| 604 | 3300035086 | Ga0373934_0002405 | Ga0373934_0002405_2616_3548 | 308 |
| 605 | 3300035111 | Ga0373923_0022547 | Ga0373923_0022547_606_1538 | 308 |
| 606 | 3300035113 | Ga0373936_0018479 | Ga0373936_0018479_771_1697 | 308 |
| 607 | 3300035117 | Ga0373953_0000409 | Ga0373953_0000409_10640_11572 | 308 |
| 608 | 3300035117 | Ga0373953_0009941 | Ga0373953_0009941_382_1308 | 308 |
| 609 | 3300035118 | Ga0373954_0002776 | Ga0373954_0002776_5306_6238 | 308 |
| 610 | 3300035118 | Ga0373954_0029995 | Ga0373954_0029995_82_1008 | 308 |
| 611 | 3300035119 | Ga0373956_0004736 | Ga0373956_0004736_213_1145 | 308 |
| 612 | 3300035119 | Ga0373956_0005250 | Ga0373956_0005250_4070_4996 | 308 |
| 613 | 3300035120 | Ga0373957_0014177 | Ga0373957_0014177_754_1680 | 308 |
| 614 | 3300035172 | Ga0373955_0002711 | Ga0373955_0002711_4514_5440 | 308 |
| 615 | 3300035172 | Ga0373955_0003550 | Ga0373955_0003550_1482_2414 | 308 |
| 616 | 3300035410 | Ga0373924_0006225 | Ga0373924_0006225_894_1820 | 308 |
| 617 | 3300035695 | Ga0373927_0004054 | Ga0373927_0004054_1742_2674 | 308 |
| 618 | 3300035724 | Ga0373933_0002107 | Ga0373933_0002107_6148_7080 | 308 |
| 619 | 3300036401 | Ga0373937_0008396 | Ga0373937_0008396_1138_2070 | 308 |
| 620 | 3300036401 | Ga0373937_0021312 | Ga0373937_0021312_2846_3772 | 308 |
| 621 | 3300036459 | Ga0372808_001074 | Ga0372808_001074_774_1706 | 308 |
| 622 | 3300037068 | Ga0373925_0024876 | Ga0373925_0024876_2323_3255 | 308 |
| 623 | 3300037418 | Ga0395900_0000660 | Ga0395900_0000660_16876_17802 | 308 |
| 624 | 3300037418 | Ga0395900_0008707 | Ga0395900_0008707_5305_6231 | 308 |
| 625 | 3300037418 | Ga0395900_0199262 | Ga0395900_0199262_1014_1940 | 308 |
| 626 | 3300037466 | Ga0395898_0003200 | Ga0395898_0003200_16708_17634 | 308 |
| 627 | 3300037466 | Ga0395898_0006500 | Ga0395898_0006500_3815_4741 | 308 |
| 628 | 3300037466 | Ga0395898_0007107 | Ga0395898_0007107_7878_8804 | 308 |
| 629 | 3300037471 | Ga0395905_0021700 | Ga0395905_0021700_884_1810 | 308 |
| 630 | 3300037853 | Ga0436364_0102033 | Ga0436364_0102033_248_1174 | 308 |
| 631 | 3300037853 | Ga0436364_0425317 | Ga0436364_0425317_146_1078 | 308 |
| 632 | 3300038443 | Ga0395901_0101488 | Ga0395901_0101488_1132_2058 | 308 |
| 633 | 3300038443 | Ga0395901_0437117 | Ga0395901_0437117_35_961 | 308 |
| 634 | 3300038443 | Ga0395901_0515459 | Ga0395901_0515459_221_1147 | 308 |
| 635 | 3300039437 | Ga0436365_0159409 | Ga0436365_0159409_136_1068 | 308 |
| 636 | 3300039437 | Ga0436365_0459588 | Ga0436365_0459588_53_979 | 308 |
| 637 | 3300039437 | Ga0436365_1047663 | Ga0436365_1047663_1671_2597 | 308 |
| 638 | 3300039447 | Ga0436361_1159707 | Ga0436361_1159707_520_1446 | 308 |
| 639 | 3300039450 | Ga0436363_0274569 | Ga0436363_0274569_135_1061 | 308 |
| 640 | 3300039450 | Ga0436363_0761127 | Ga0436363_0761127_541_1467 | 308 |
| 641 | 3300039453 | Ga0436362_0842308 | Ga0436362_0842308_29_955 | 308 |
| 642 | 3300044656 | Ga0466969_0100925 | Ga0466969_0100925_118_1044 | 308 |
| 643 | 3300044658 | Ga0466972_0000079 | Ga0466972_0000079_4425_5351 | 308 |
| 644 | 3300044658 | Ga0466972_0004644 | Ga0466972_0004644_4577_5503 | 308 |
| 645 | 3300044684 | Ga0466966_0001208 | Ga0466966_0001208_7679_8605 | 308 |
| 646 | 3300044693 | Ga0466961_0000020 | Ga0466961_0000020_6920_7846 | 308 |
| 647 | 3300044693 | Ga0466961_0039468 | Ga0466961_0039468_1585_2511 | 308 |
| 648 | 3300044694 | Ga0466963_0031974 | Ga0466963_0031974_478_1404 | 308 |
| 649 | 3300044719 | Ga0466971_0051755 | Ga0466971_0051755_360_1286 | 308 |
| 650 | 3300044765 | Ga0466970_0087989 | Ga0466970_0087989_609_1535 | 308 |
| 651 | 3300044842 | Ga0466957_0041896 | Ga0466957_0041896_49_975 | 308 |
| 652 | 3300044901 | Ga0466960_0000424 | Ga0466960_0000424_5049_5975 | 308 |
| 653 | 3300045049 | Ga0466959_0004294 | Ga0466959_0004294_1149_2075 | 308 |
| 654 | 3300046454 | Ga0495592_0003202 | Ga0495592_0003202_4453_5385 | 308 |
| 655 | 3300046454 | Ga0495592_0036190 | Ga0495592_0036190_1352_2278 | 308 |
| 656 | 3300046459 | Ga0495629_0001830 | Ga0495629_0001830_9698_10630 | 308 |
| 657 | 3300046459 | Ga0495629_0006153 | Ga0495629_0006153_595_1521 | 308 |
| 658 | 3300046459 | Ga0495629_0107512 | Ga0495629_0107512_726_1652 | 308 |
| 659 | 3300046462 | Ga0495651_0002500 | Ga0495651_0002500_10413_11339 | 308 |
| 660 | 3300046462 | Ga0495651_0041294 | Ga0495651_0041294_2557_3489 | 308 |
| 661 | 3300046462 | Ga0495651_0041839 | Ga0495651_0041839_588_1514 | 308 |
| 662 | 3300046462 | Ga0495651_0140950 | Ga0495651_0140950_336_1262 | 308 |
| 663 | 3300046463 | Ga0495653_0001471 | Ga0495653_0001471_13804_14736 | 308 |
| 664 | 3300046463 | Ga0495653_0050752 | Ga0495653_0050752_1017_1943 | 308 |
| 665 | 3300046463 | Ga0495653_0159296 | Ga0495653_0159296_541_1467 | 308 |
| 666 | 3300046473 | Ga0495582_0214523 | Ga0495582_0214523_52_984 | 308 |
| 667 | 3300046475 | Ga0495639_0114838 | Ga0495639_0114838_55_981 | 308 |
| 668 | 3300046476 | Ga0495662_0108284 | Ga0495662_0108284_154_1080 | 308 |
| 669 | 3300046477 | Ga0495664_0007676 | Ga0495664_0007676_2208_3134 | 308 |
| 670 | 3300046477 | Ga0495664_0007911 | Ga0495664_0007911_4348_5274 | 308 |
| 671 | 3300046477 | Ga0495664_0087653 | Ga0495664_0087653_147_1079 | 308 |
| 672 | 3300046500 | Ga0495596_0068738 | Ga0495596_0068738_267_1193 | 308 |
| 673 | 3300046507 | Ga0495606_0005210 | Ga0495606_0005210_2620_3546 | 308 |
| 674 | 3300046511 | Ga0495608_0002191 | Ga0495608_0002191_6034_6966 | 308 |
| 675 | 3300046511 | Ga0495608_0036131 | Ga0495608_0036131_1172_2098 | 308 |
| 676 | 3300046511 | Ga0495608_0060094 | Ga0495608_0060094_1510_2436 | 308 |
| 677 | 3300046514 | Ga0495618_0079959 | Ga0495618_0079959_596_1522 | 308 |
| 678 | 3300046514 | Ga0495618_0279140 | Ga0495618_0279140_50_982 | 308 |
| 679 | 3300046515 | Ga0495620_0060077 | Ga0495620_0060077_544_1470 | 308 |
| 680 | 3300046516 | Ga0495628_0030883 | Ga0495628_0030883_2731_3663 | 308 |
| 681 | 3300046516 | Ga0495628_0033600 | Ga0495628_0033600_856_1782 | 308 |
| 682 | 3300046516 | Ga0495628_0064783 | Ga0495628_0064783_875_1801 | 308 |
| 683 | 3300046517 | Ga0495630_0022407 | Ga0495630_0022407_930_1856 | 308 |
| 684 | 3300046524 | Ga0495648_0003767 | Ga0495648_0003767_11523_12455 | 308 |
| 685 | 3300046524 | Ga0495648_0007614 | Ga0495648_0007614_1038_1964 | 308 |
| 686 | 3300046529 | Ga0495652_0006321 | Ga0495652_0006321_3656_4588 | 308 |
| 687 | 3300046529 | Ga0495652_0031923 | Ga0495652_0031923_1639_2565 | 308 |
| 688 | 3300046533 | Ga0495640_0002348 | Ga0495640_0002348_5352_6284 | 308 |
| 689 | 3300046533 | Ga0495640_0026198 | Ga0495640_0026198_2082_3008 | 308 |
| 690 | 3300046535 | Ga0495586_0022337 | Ga0495586_0022337_405_1331 | 308 |
| 691 | 3300046536 | Ga0495587_0004728 | Ga0495587_0004728_1792_2718 | 308 |
| 692 | 3300046536 | Ga0495587_0015523 | Ga0495587_0015523_2685_3617 | 308 |
| 693 | 3300046536 | Ga0495587_0027948 | Ga0495587_0027948_2045_2971 | 308 |
| 694 | 3300046543 | Ga0495645_0014837 | Ga0495645_0014837_1419_2351 | 308 |
| 695 | 3300046543 | Ga0495645_0040372 | Ga0495645_0040372_792_1724 | 308 |
| 696 | 3300046543 | Ga0495645_0221128 | Ga0495645_0221128_290_1216 | 308 |
| 697 | 3300046559 | Ga0495667_0002963 | Ga0495667_0002963_3629_4561 | 308 |
| 698 | 3300046559 | Ga0495667_0013368 | Ga0495667_0013368_2640_3566 | 308 |
| 699 | 3300046559 | Ga0495667_0016179 | Ga0495667_0016179_3057_3983 | 308 |
| 700 | 3300046642 | Ga0495634_0089901 | Ga0495634_0089901_845_1771 | 308 |
| 701 | 3300046642 | Ga0495634_0197772 | Ga0495634_0197772_258_1184 | 308 |
| 702 | 3300046660 | Ga0495625_0039696 | Ga0495625_0039696_2290_3216 | 308 |
| 703 | 3300046663 | Ga0495635_0000636 | Ga0495635_0000636_14713_15645 | 308 |
| 704 | 3300046663 | Ga0495635_0002205 | Ga0495635_0002205_11148_12074 | 308 |
| 705 | 3300046675 | Ga0495657_0002552 | Ga0495657_0002552_3390_4316 | 308 |
| 706 | 3300046675 | Ga0495657_0014012 | Ga0495657_0014012_2401_3333 | 308 |
| 707 | 3300046678 | Ga0495599_0001077 | Ga0495599_0001077_7045_7977 | 308 |
| 708 | 3300046678 | Ga0495599_0010332 | Ga0495599_0010332_2800_3726 | 308 |
| 709 | 3300046678 | Ga0495599_0060861 | Ga0495599_0060861_903_1829 | 308 |
| 710 | 3300046679 | Ga0495623_0004268 | Ga0495623_0004268_3757_4689 | 308 |
| 711 | 3300046679 | Ga0495623_0006526 | Ga0495623_0006526_5076_6002 | 308 |
| 712 | 3300046679 | Ga0495623_0048527 | Ga0495623_0048527_595_1521 | 308 |
| 713 | 3300046689 | Ga0495613_0033951 | Ga0495613_0033951_2070_3002 | 308 |
| 714 | 3300046689 | Ga0495613_0120524 | Ga0495613_0120524_44_970 | 308 |
| 715 | 3300046690 | Ga0495624_0058576 | Ga0495624_0058576_1064_1990 | 308 |
| 716 | 3300046690 | Ga0495624_0091302 | Ga0495624_0091302_847_1773 | 308 |
| 717 | 3300046809 | Ga0495600_0000873 | Ga0495600_0000873_12569_13495 | 308 |
| 718 | 3300046809 | Ga0495600_0001010 | Ga0495600_0001010_9079_10011 | 308 |
| 719 | 3300047317 | Ga0495604_0008420 | Ga0495604_0008420_7138_8070 | 308 |
| 720 | 3300047317 | Ga0495604_0038621 | Ga0495604_0038621_2458_3384 | 308 |
| 721 | 3300047317 | Ga0495604_0052467 | Ga0495604_0052467_945_1871 | 308 |
| 722 | 3300047317 | Ga0495604_0063576 | Ga0495604_0063576_1421_2347 | 308 |
| 723 | 3300047319 | Ga0495674_0028066 | Ga0495674_0028066_1717_2643 | 308 |
| 724 | 3300047319 | Ga0495674_0065255 | Ga0495674_0065255_411_1337 | 308 |
| 725 | 3300047319 | Ga0495674_0242918 | Ga0495674_0242918_156_1088 | 308 |
| 726 | 3300047321 | Ga0495676_0103736 | Ga0495676_0103736_303_1229 | 308 |
| 727 | 3300047322 | Ga0495680_0001037 | Ga0495680_0001037_25271_26197 | 308 |
| 728 | 3300047322 | Ga0495680_0001883 | Ga0495680_0001883_3757_4689 | 308 |
| 729 | 3300047322 | Ga0495680_0043083 | Ga0495680_0043083_2410_3336 | 308 |
| 730 | 3300047444 | Ga0495675_0001800 | Ga0495675_0001800_2391_3323 | 308 |
| 731 | 3300047444 | Ga0495675_0037092 | Ga0495675_0037092_1990_2916 | 308 |
| 732 | 3300047471 | Ga0495684_0000666 | Ga0495684_0000666_17622_18554 | 308 |
| 733 | 3300047471 | Ga0495684_0036531 | Ga0495684_0036531_2276_3202 | 308 |
| 734 | 3300047471 | Ga0495684_0096515 | Ga0495684_0096515_1241_2167 | 308 |
| 735 | 3300047472 | Ga0495686_0107093 | Ga0495686_0107093_435_1361 | 308 |
| 736 | 3300047673 | Ga0495593_0008032 | Ga0495593_0008032_2929_3861 | 308 |
| 737 | 3300048088 | Ga0495602_0004340 | Ga0495602_0004340_1124_2050 | 308 |
| 738 | 3300048088 | Ga0495602_0012996 | Ga0495602_0012996_7138_8070 | 308 |
| 739 | 3300048088 | Ga0495602_0196647 | Ga0495602_0196647_551_1477 | 308 |
| 740 | 3300048088 | Ga0495602_0201081 | Ga0495602_0201081_176_1102 | 308 |
| 741 | 3300048907 | Ga0496104_0001245 | Ga0496104_0001245_12445_13371 | 308 |
| 742 | 3300048907 | Ga0496104_0082198 | Ga0496104_0082198_1913_2839 | 308 |
| 743 | 3300048908 | Ga0496105_0003657 | Ga0496105_0003657_4484_5410 | 308 |
| 744 | 3300048908 | Ga0496105_0093356 | Ga0496105_0093356_857_1783 | 308 |
| 745 | 3300048909 | Ga0496106_0013957 | Ga0496106_0013957_2688_3614 | 308 |
| 746 | 3300048910 | Ga0496107_0130771 | Ga0496107_0130771_679_1605 | 308 |
| 747 | 3300048911 | Ga0496108_0218656 | Ga0496108_0218656_505_1431 | 308 |
| 748 | 3300048912 | Ga0496109_0155295 | Ga0496109_0155295_10_936 | 308 |
| 749 | 3300048914 | Ga0496111_0061970 | Ga0496111_0061970_244_1170 | 308 |
| 750 | 3300048914 | Ga0496111_0215505 | Ga0496111_0215505_44_970 | 308 |
| 751 | 3300048915 | Ga0496112_0002061 | Ga0496112_0002061_2750_3676 | 308 |
| 752 | 3300048915 | Ga0496112_0008838 | Ga0496112_0008838_235_1161 | 308 |
| 753 | 3300048915 | Ga0496112_0107427 | Ga0496112_0107427_283_1215 | 308 |
| 754 | 3300048915 | Ga0496112_0119654 | Ga0496112_0119654_320_1246 | 308 |
| 755 | 3300048915 | Ga0496112_0223868 | Ga0496112_0223868_623_1549 | 308 |
| 756 | 3300048915 | Ga0496112_0440495 | Ga0496112_0440495_127_1053 | 308 |
| 757 | 3300048916 | Ga0496113_0156636 | Ga0496113_0156636_198_1124 | 308 |
| 758 | 3300048917 | Ga0496114_0200299 | Ga0496114_0200299_519_1445 | 308 |
| 759 | 3300048918 | Ga0496115_0314357 | Ga0496115_0314357_64_990 | 308 |
| 760 | 3300048919 | Ga0496116_0140996 | Ga0496116_0140996_55_981 | 308 |
| 761 | 3300048921 | Ga0496118_0016456 | Ga0496118_0016456_78_1004 | 308 |
| 762 | 3300048921 | Ga0496118_0130626 | Ga0496118_0130626_45_971 | 308 |
| 763 | 3300048922 | Ga0496119_0003004 | Ga0496119_0003004_1067_1993 | 308 |
| 764 | 3300048922 | Ga0496119_0080481 | Ga0496119_0080481_788_1714 | 308 |
| 765 | 3300048924 | Ga0496121_0008659 | Ga0496121_0008659_1448_2374 | 308 |
| 766 | 3300048924 | Ga0496121_0021131 | Ga0496121_0021131_4087_5013 | 308 |
| 767 | 3300048924 | Ga0496121_0066895 | Ga0496121_0066895_1961_2887 | 308 |
| 768 | 3300048924 | Ga0496121_0103413 | Ga0496121_0103413_1251_2177 | 308 |
| 769 | 3300048929 | Ga0496126_0011267 | Ga0496126_0011267_1874_2800 | 308 |
| 770 | 3300048929 | Ga0496126_0158354 | Ga0496126_0158354_961_1887 | 308 |
| 771 | 3300048929 | Ga0496126_0174038 | Ga0496126_0174038_539_1465 | 308 |
| 772 | 3300049568 | Ga0501031_0001197 | Ga0501031_0001197_485_1411 | 308 |
| 773 | 3300049568 | Ga0501031_0003032 | Ga0501031_0003032_6106_7032 | 308 |
| 774 | 3300049569 | Ga0501032_0000696 | Ga0501032_0000696_11750_12676 | 308 |
| 775 | 3300049569 | Ga0501032_0036140 | Ga0501032_0036140_998_1924 | 308 |
| 776 | 3300049570 | Ga0501033_0000232 | Ga0501033_0000232_26455_27381 | 308 |
| 777 | 3300049570 | Ga0501033_0001532 | Ga0501033_0001532_11350_12276 | 308 |
| 778 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_163846_164772 | 308 |
| 779 | 3300049571 | Ga0501034_0000704 | Ga0501034_0000704_22346_23272 | 308 |
| 780 | 3300049572 | Ga0501036_0000007 | Ga0501036_0000007_205042_205968 | 308 |
| 781 | 3300049572 | Ga0501036_0000052 | Ga0501036_0000052_21370_22296 | 308 |
| 782 | 3300049573 | Ga0501037_0000025 | Ga0501037_0000025_66415_67341 | 308 |
| 783 | 3300049573 | Ga0501037_0020087 | Ga0501037_0020087_2691_3617 | 308 |
| 784 | 3300049573 | Ga0501037_0149374 | Ga0501037_0149374_385_1311 | 308 |
| 785 | 3300049574 | Ga0501038_0000026 | Ga0501038_0000026_65337_66263 | 308 |
| 786 | 3300049574 | Ga0501038_0000168 | Ga0501038_0000168_892_1818 | 308 |
| 787 | 3300049575 | Ga0501039_0000005 | Ga0501039_0000005_46223_47149 | 308 |
| 788 | 3300049575 | Ga0501039_0003632 | Ga0501039_0003632_417_1343 | 308 |
| 789 | 3300049578 | Ga0501042_0118124 | Ga0501042_0118124_750_1676 | 308 |
| 790 | 3300049579 | Ga0501043_0000036 | Ga0501043_0000036_109220_110146 | 308 |
| 791 | 3300049579 | Ga0501043_0002042 | Ga0501043_0002042_7973_8899 | 308 |
| 792 | 3300049579 | Ga0501043_0133440 | Ga0501043_0133440_591_1526 | 308 |
| 793 | 3300049580 | Ga0501046_0000147 | Ga0501046_0000147_29676_30602 | 308 |
| 794 | 3300049580 | Ga0501046_0000231 | Ga0501046_0000231_17191_18117 | 308 |
| 795 | 3300049580 | Ga0501046_0070614 | Ga0501046_0070614_877_1803 | 308 |
| 796 | 3300049580 | Ga0501046_0171712 | Ga0501046_0171712_512_1438 | 308 |
| 797 | 3300049581 | Ga0501047_0000209 | Ga0501047_0000209_4953_5879 | 308 |
| 798 | 3300049581 | Ga0501047_0000457 | Ga0501047_0000457_43930_44856 | 308 |
| 799 | 3300049581 | Ga0501047_0071155 | Ga0501047_0071155_1945_2877 | 308 |
| 800 | 3300049581 | Ga0501047_0102930 | Ga0501047_0102930_425_1351 | 308 |
| 801 | 3300049581 | Ga0501047_0223123 | Ga0501047_0223123_281_1207 | 308 |
| 802 | 3300049582 | Ga0501048_0000585 | Ga0501048_0000585_3583_4509 | 308 |
| 803 | 3300049582 | Ga0501048_0020451 | Ga0501048_0020451_3691_4617 | 308 |
| 804 | 3300049583 | Ga0501067_0000025 | Ga0501067_0000025_71299_72225 | 308 |
| 805 | 3300049583 | Ga0501067_0063143 | Ga0501067_0063143_502_1428 | 308 |
| 806 | 3300049583 | Ga0501067_0087364 | Ga0501067_0087364_777_1703 | 308 |
| 807 | 3300049584 | Ga0501068_0002387 | Ga0501068_0002387_3741_4667 | 308 |
| 808 | 3300049584 | Ga0501068_0004030 | Ga0501068_0004030_998_1924 | 308 |
| 809 | 3300049586 | Ga0501070_0001839 | Ga0501070_0001839_17301_18227 | 308 |
| 810 | 3300049586 | Ga0501070_0024940 | Ga0501070_0024940_2533_3465 | 308 |
| 811 | 3300049586 | Ga0501070_0178591 | Ga0501070_0178591_541_1467 | 308 |
| 812 | 3300049586 | Ga0501070_0178612 | Ga0501070_0178612_541_1467 | 308 |
| 813 | 3300049587 | Ga0501071_0022185 | Ga0501071_0022185_583_1509 | 308 |
| 814 | 3300049588 | Ga0501072_0003385 | Ga0501072_0003385_10948_11874 | 308 |
| 815 | 3300049588 | Ga0501072_0051510 | Ga0501072_0051510_553_1479 | 308 |
| 816 | 3300049589 | Ga0501073_0000135 | Ga0501073_0000135_27648_28574 | 308 |
| 817 | 3300049589 | Ga0501073_0013905 | Ga0501073_0013905_3613_4539 | 308 |
| 818 | 3300049589 | Ga0501073_0032984 | Ga0501073_0032984_2574_3500 | 308 |
| 819 | 3300049590 | Ga0501074_0000443 | Ga0501074_0000443_6954_7880 | 308 |
| 820 | 3300049590 | Ga0501074_0019268 | Ga0501074_0019268_215_1141 | 308 |
| 821 | 3300049590 | Ga0501074_0023253 | Ga0501074_0023253_2255_3181 | 308 |
| 822 | 3300049741 | Ga0501079_0003407 | Ga0501079_0003407_2834_3760 | 308 |
| 823 | 3300049742 | Ga0501080_0000382 | Ga0501080_0000382_29526_30452 | 308 |
| 824 | 3300049742 | Ga0501080_0000669 | Ga0501080_0000669_7375_8301 | 308 |
| 825 | 3300049742 | Ga0501080_0005657 | Ga0501080_0005657_7884_8810 | 308 |
| 826 | 3300049743 | Ga0501081_0326335 | Ga0501081_0326335_49_975 | 308 |
| 827 | 3300049744 | Ga0501083_0003054 | Ga0501083_0003054_6748_7674 | 308 |
| 828 | 3300049822 | Ga0501035_0000052 | Ga0501035_0000052_35872_36798 | 308 |
| 829 | 3300049822 | Ga0501035_0001237 | Ga0501035_0001237_24811_25737 | 308 |
| 830 | 3300049823 | Ga0501044_0000217 | Ga0501044_0000217_19817_20743 | 308 |
| 831 | 3300049823 | Ga0501044_0000366 | Ga0501044_0000366_29172_30098 | 308 |
| 832 | 3300049823 | Ga0501044_0046984 | Ga0501044_0046984_1080_2006 | 308 |
| 833 | 3300049823 | Ga0501044_0147382 | Ga0501044_0147382_843_1769 | 308 |
| 834 | 3300050490 | nmdc:mga03n38_14660_c1 | nmdc:mga03n38_14660_c1_1791_2717 | 308 |
| 835 | 3300050490 | nmdc:mga03n38_224_c1 | nmdc:mga03n38_224_c1_3139_4065 | 308 |
| 836 | 3300050491 | nmdc:mga00v17_205002_c1 | nmdc:mga00v17_205002_c1_312_1238 | 308 |
| 837 | 3300050491 | nmdc:mga00v17_9386_c1 | nmdc:mga00v17_9386_c1_4061_4987 | 308 |
| 838 | 3300050492 | nmdc:mga0yw44_52563_c1 | nmdc:mga0yw44_52563_c1_175_1101 | 308 |
| 839 | 3300050492 | nmdc:mga0yw44_72837_c1 | nmdc:mga0yw44_72837_c1_588_1514 | 308 |
| 840 | 3300050493 | nmdc:mga0k408_5979_c1 | nmdc:mga0k408_5979_c1_3265_4191 | 308 |
| 841 | 3300050495 | nmdc:mga04h51_6775_c1 | nmdc:mga04h51_6775_c1_2042_2968 | 308 |
| 842 | 3300050496 | nmdc:mga07m45_6074_c1 | nmdc:mga07m45_6074_c1_4280_5206 | 308 |
| 843 | 3300050512 | nmdc:mga0n895_64214_c1 | nmdc:mga0n895_64214_c1_951_1877 | 308 |
| 844 | 3300050514 | nmdc:mga08x19_79614_c1 | nmdc:mga08x19_79614_c1_1080_2006 | 308 |
| 845 | 3300050516 | nmdc:mga0sz30_55309_c1 | nmdc:mga0sz30_55309_c1_276_1202 | 308 |
| 846 | 3300050516 | nmdc:mga0sz30_9528_c1 | nmdc:mga0sz30_9528_c1_2677_3603 | 308 |
| 847 | 3300053077 | Ga0495601_0014819 | Ga0495601_0014819_3655_4587 | 308 |
| 848 | 3300053077 | Ga0495601_0041332 | Ga0495601_0041332_1336_2262 | 308 |
| 849 | 3300053077 | Ga0495601_0185195 | Ga0495601_0185195_88_1020 | 308 |
| 850 | 3300053077 | Ga0495601_0239203 | Ga0495601_0239203_156_1088 | 308 |
| 851 | 3300053078 | Ga0495612_0013454 | Ga0495612_0013454_266_1192 | 308 |
| 852 | 3300053083 | Ga0495655_0009206 | Ga0495655_0009206_777_1703 | 308 |
| 853 | 3300053083 | Ga0495655_0056796 | Ga0495655_0056796_33_965 | 308 |
| 854 | 3300053084 | Ga0495595_0003095 | Ga0495595_0003095_3756_4688 | 308 |
| 855 | 3300053084 | Ga0495595_0016247 | Ga0495595_0016247_1529_2455 | 308 |
| 856 | 3300053085 | Ga0495619_0004543 | Ga0495619_0004543_4174_5106 | 308 |
| 857 | 3300053085 | Ga0495619_0030322 | Ga0495619_0030322_2083_3009 | 308 |
| 858 | 3300053086 | Ga0500578_0068194 | Ga0500578_0068194_816_1742 | 308 |
| 859 | 3300053086 | Ga0500578_0107327 | Ga0500578_0107327_103_1029 | 308 |
| 860 | 3300053091 | Ga0500647_0033209 | Ga0500647_0033209_569_1501 | 308 |
| 861 | 3300053093 | Ga0500651_0000526 | Ga0500651_0000526_17290_18216 | 308 |
| 862 | 3300053094 | Ga0500566_0000097 | Ga0500566_0000097_41571_42503 | 308 |
| 863 | 3300053095 | Ga0500640_014937 | Ga0500640_014937_2080_3012 | 308 |
| 864 | 3300053105 | Ga0500557_000008 | Ga0500557_000008_40740_41666 | 308 |
| 865 | 3300053111 | Ga0500572_000853 | Ga0500572_000853_2743_3675 | 308 |
| 866 | 3300053119 | Ga0500595_006403 | Ga0500595_006403_3009_3935 | 308 |
| 867 | 3300053120 | Ga0500597_043245 | Ga0500597_043245_609_1535 | 308 |
| 868 | 3300053121 | Ga0500607_075728 | Ga0500607_075728_100_1026 | 308 |
| 869 | 3300053123 | Ga0500614_014025 | Ga0500614_014025_68_1000 | 308 |
| 870 | 3300053130 | Ga0500642_0000067 | Ga0500642_0000067_3653_4579 | 308 |
| 871 | 3300053136 | Ga0500559_0120556 | Ga0500559_0120556_274_1200 | 308 |
| 872 | 3300053144 | Ga0500585_057645 | Ga0500585_057645_115_1047 | 308 |
| 873 | 3300053150 | Ga0500603_001381 | Ga0500603_001381_4474_5406 | 308 |
| 874 | 3300053154 | Ga0500619_021578 | Ga0500619_021578_109_1035 | 308 |
| 875 | 3300053159 | Ga0500630_035540 | Ga0500630_035540_681_1613 | 308 |
| 876 | 3300053163 | Ga0500639_000219 | Ga0500639_000219_2080_3012 | 308 |
| 877 | 3300053177 | Ga0500636_0066605 | Ga0500636_0066605_21_947 | 308 |
| 878 | 3300053729 | Ga0500625_005765 | Ga0500625_005765_961_1887 | 308 |
| 879 | 3300054114 | Ga0501084_0006290 | Ga0501084_0006290_325_1251 | 308 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nq2-assembly1.cif.gz_A | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5945 | 8 | 294 |
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.5909 | 34 | 292 |
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.5858 | 31 | 292 |
| 4g1u-assembly1.cif.gz_B | x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis | 0.576 | 14 | 292 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5571 | 15 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58666_4_320_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8652 | 31 | 290 | 1.10.3470.10 |
| af_P23200_41_325_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8077 | 33 | 290 | 1.10.3470.10 |
| af_P0AGI4_56_383_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8062 | 33 | 290 | 1.10.3470.10 |
| af_P39328_55_321_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8042 | 28 | 289 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7995 | 31 | 290 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0D7EH95-F1-model_v4 | ABC transporter permease | 0.9752 | 3 | 216 |
GO:0005886
GO:0015658 |
| AF-A0A257S961-F1-model_v4 | deleted | 0.9649 | 7 | 308 |
|
| AF-A0A0D7EH95-F1-model_v4 | ABC transporter permease | 0.962 | 3 | 216 |
GO:0005886
GO:0015658 |
| AF-A0A523UBX2-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9472 | 12 | 221 |
GO:0005886
GO:0015658 |
| AF-A0A7Y0C2Q4-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9469 | 10 | 307 |
GO:0005886
GO:0015658 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar