F484459

General Info

Members Datasets Scaffolds Average Seq Length
879 505 706 306

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10002639|Ga0213874_100026393
Length 321
Sequence MCARAGSLGDGRPMPRLSVREMSFAAIIVVALAAALPFFVSDYVLGVLTPGFYIAVFAMAWDLLFGFANEVNFGPTFLIGLGAYAAGIIDNRLGWAIWLCVAAGTAAAVAGGLVLALPALRVRGPYFGLTTLVAVLILSNLIVVFADLTGGEIGLTVPDVISIDAHANYWIALGFMSASGAILFALSRSPMGLILQASGQDAVQAGALGFNVTKHKLAAFTISAFFSGLAGALYVFYLGAASVGTLVDVTVGVQVIIAAVLGGRRTILGAALGAIFLIGATEALRPLGELATLVVSAVALLIVLFFPNGLLALIARIGGRA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
10 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
11 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
15 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
16 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
17 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
18 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
19 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
20 2643221651 Afipia sp. Root123D2 Isolate Unclassified
21 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
22 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
23 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
24 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
25 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
26 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
27 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
28 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
29 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
30 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
31 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
32 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
33 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
34 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
35 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
36 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
37 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
38 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
39 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
40 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
41 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
42 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
43 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
44 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
45 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
46 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
47 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
48 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
49 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
50 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
51 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
52 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
53 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
54 2902330777 Methylobacterium sp. 2A Isolate Unclassified
55 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
56 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
57 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
58 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
59 2904699407
60 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
61 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
62 2906610324
63 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
64 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
65 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
66 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
67 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
68 2922368715
69 2922425934
70 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
71 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
72 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
73 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
74 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
75 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
76 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
77 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
78 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
79 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
80 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
81 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
82 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
83 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
84 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
85 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
86 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
87 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
88 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
89 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
90 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
91 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
92 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
93 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
94 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
95 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
96 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
97 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
98 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
99 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
100 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
101 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
102 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
103 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
104 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
105 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
106 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
107 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
108 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
109 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
110 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
111 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
112 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
113 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
114 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
115 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
116 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
117 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
118 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
119 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
120 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
121 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
122 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
123 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
124 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
125 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
126 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
127 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
128 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
129 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
130 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
131 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
132 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
133 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
134 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
135 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
136 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
137 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
138 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
139 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
140 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
141 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
142 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
143 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
144 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
145 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
146 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
147 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
148 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
149 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
150 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
151 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
152 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
153 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
154 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
155 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
156 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
157 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
158 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
159 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
160 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
161 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
162 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
163 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
164 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
165 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
166 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
167 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
168 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
169 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
170 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
171 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
172 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
173 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
174 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
175 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
176 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
177 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
178 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
179 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
180 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
181 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
182 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
183 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
184 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
185 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
186 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
187 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
188 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
189 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
190 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
191 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
192 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
193 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
194 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
195 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
196 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
197 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
198 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
199 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
200 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
201 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
202 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
203 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
204 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
205 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
206 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
207 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
208 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
209 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
210 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
211 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
212 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
213 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
214 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
215 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
216 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
217 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
218 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
219 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
220 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
221 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
222 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
223 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
224 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
225 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
226 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
227 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
228 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
229 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
230 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
231 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
232 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
233 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
236 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
239 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
240 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
284 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
285 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
286 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
287 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
288 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
291 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
295 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
296 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
297 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
298 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
299 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
300 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
301 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
302 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
303 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
304 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
305 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
306 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
307 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
308 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
309 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
310 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
311 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
312 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
313 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
314 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
315 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
316 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
317 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
318 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
319 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
320 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
323 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
324 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
327 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
328 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
329 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
330 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
331 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
332 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
333 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
334 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
335 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
336 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
337 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
338 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
339 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
340 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
341 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
342 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
343 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
344 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
345 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
346 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
347 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
348 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
349 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
350 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
351 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
352 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
353 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
354 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
355 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
356 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
357 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
358 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
359 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
360 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
361 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
362 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
363 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
364 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
365 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
366 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
367 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
368 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
369 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
377 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
378 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
379 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
380 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
381 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
382 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
383 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
384 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
385 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
386 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
387 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
388 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
389 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
390 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
391 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
392 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
393 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
394 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
395 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
396 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
397 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
398 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
399 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
400 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
401 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
402 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
406 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
407 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
408 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
409 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
423 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
424 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
425 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
426 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
427 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
428 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
429 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
430 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
431 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
432 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
433 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
434 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
435 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
437 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
438 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
439 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
440 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
441 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
442 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
443 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
444 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
445 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
446 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
447 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
448 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
449 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
450 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
451 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
452 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
453 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
454 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
455 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
456 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
457 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
458 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
459 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
460 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
461 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
462 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
463 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
464 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
465 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
466 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
467 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
468 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
469 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
470 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
471 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
472 641522639 Methylobacterium sp. 4-46 Isolate Nodule
473 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
474 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
475 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
476 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
477 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
478 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
479 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
480 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
481 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
482 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
483 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
484 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
485 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
486 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
487 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
488 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
489 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
490 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
491 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
492 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
493 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
494 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
495 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
496 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
497 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
498 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
499 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
500 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
501 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
502 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
503 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
504 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
505 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.23
Metatranscriptomes 0.46
Isolates 19.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.28
Nodule 16.95
Rhizoplane 3.64
Rhizosphere 60.18
Stem 0
Stem Tuber 0
Unclassified 11.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1006767 3300003214 Bacteria 1992
2 JGI25160J50197_1007582 3300003354 Bacteria 4232
3 Ga0055543_1013756 3300004625 Bacteria 1592
4 Ga0065165_1004374 3300005262 Bacteria 8825
5 Ga0070658_10056239 3300005327 Bacteria 3197
6 Ga0070676_10289184 3300005328 Bacteria 1107
7 Ga0070683_100001891 3300005329 Bacteria 16357
8 Ga0070683_100019924 3300005329 Bacteria 5963
9 Ga0070683_100072047 3300005329 Bacteria 3225
10 Ga0070683_100658453 3300005329 Bacteria 1003
11 Ga0068869_100001186 3300005334 Bacteria 15287
12 Ga0070680_100016775 3300005336 Bacteria 5763
13 Ga0070680_100195987 3300005336 Bacteria 1703
14 Ga0070680_100312437 3300005336 Bacteria 1334
15 Ga0070682_100056630 3300005337 Bacteria 2466
16 Ga0070682_100316334 3300005337 Bacteria 1151
17 Ga0068868_100002380 3300005338 Bacteria 13017
18 Ga0070689_100090026 3300005340 Bacteria 2417
19 Ga0070691_10186651 3300005341 Bacteria 1082
20 Ga0070668_100008952 3300005347 Bacteria 7432
21 Ga0070674_100161557 3300005356 Bacteria 1700
22 Ga0070659_100051334 3300005366 Bacteria 3243
23 Ga0070659_100256937 3300005366 Bacteria 1449
24 Ga0070667_100362682 3300005367 Bacteria 1314
25 Ga0070709_10002013 3300005434 Bacteria 11043
26 Ga0070709_10005865 3300005434 Bacteria 6660
27 Ga0070714_100006313 3300005435 Bacteria 9137
28 Ga0070714_100041770 3300005435 Bacteria 3872
29 Ga0070714_100173398 3300005435 Bacteria 1958
30 Ga0070713_100004655 3300005436 Bacteria 9259
31 Ga0070713_100039500 3300005436 Bacteria 3831
32 Ga0070713_100164699 3300005436 Bacteria 1982
33 Ga0070710_10000896 3300005437 Bacteria 14247
34 Ga0070710_10002832 3300005437 Bacteria 8268
35 Ga0070701_10083906 3300005438 Bacteria 1731
36 Ga0070711_100007213 3300005439 Bacteria 6752
37 Ga0070711_100008957 3300005439 Bacteria 6142
38 Ga0070711_100093101 3300005439 Bacteria 2175
39 Ga0070711_100119075 3300005439 Bacteria 1950
40 Ga0070663_100033127 3300005455 Bacteria 3567
41 Ga0070663_100036834 3300005455 Bacteria 3401
42 Ga0070662_100132585 3300005457 Bacteria 1923
43 Ga0070681_10076300 3300005458 Bacteria 3310
44 Ga0070681_10146085 3300005458 Bacteria 2294
45 Ga0070681_10315190 3300005458 Bacteria 1473
46 Ga0070681_10493869 3300005458 Bacteria 1137
47 Ga0070681_10511038 3300005458 Bacteria 1115
48 Ga0070706_100118744 3300005467 Bacteria 2464
49 Ga0070707_100171685 3300005468 Bacteria 2113
50 Ga0070679_100029796 3300005530 Bacteria 5384
51 Ga0070679_100291008 3300005530 Bacteria 1585
52 Ga0070679_100316505 3300005530 Bacteria 1510
53 Ga0070684_100010920 3300005535 Bacteria 7217
54 Ga0070684_100052866 3300005535 Bacteria 3534
55 Ga0070697_100093961 3300005536 Bacteria 2484
56 Ga0068853_100035551 3300005539 Bacteria 4232
57 Ga0068853_100169342 3300005539 Bacteria 1975
58 Ga0070686_100053425 3300005544 Bacteria 2580
59 Ga0070665_100012340 3300005548 Bacteria 8611
60 Ga0070665_100035823 3300005548 Bacteria 4992
61 Ga0068855_100040104 3300005563 Bacteria 5558
62 Ga0068855_100072657 3300005563 Bacteria 3998
63 Ga0068855_100077687 3300005563 Bacteria 3852
64 Ga0068855_100097896 3300005563 Bacteria 3379
65 Ga0068855_100328828 3300005563 Bacteria 1688
66 Ga0068855_100342315 3300005563 Bacteria 1649
67 Ga0068855_100425519 3300005563 Bacteria 1452
68 Ga0070664_100026724 3300005564 Bacteria 4791
69 Ga0070664_100152168 3300005564 Bacteria 2043
70 Ga0070664_100410739 3300005564 Bacteria 1239
71 Ga0068857_100017610 3300005577 Bacteria 6264
72 Ga0068857_100028282 3300005577 Bacteria 4946
73 Ga0068854_100097839 3300005578 Bacteria 2194
74 Ga0068856_100000183 3300005614 Bacteria 65005
75 Ga0068856_100029563 3300005614 Bacteria 5352
76 Ga0068856_100063430 3300005614 Bacteria 3651
77 Ga0068852_100053488 3300005616 Bacteria 3475
78 Ga0068852_100230989 3300005616 Bacteria 1763
79 Ga0068859_100063595 3300005617 Bacteria 3721
80 Ga0068864_100049226 3300005618 Bacteria 3625
81 Ga0068864_100122039 3300005618 Bacteria 2331
82 Ga0068861_100042059 3300005719 Bacteria 3424
83 Ga0068870_10004287 3300005840 Bacteria 6137
84 Ga0068863_100027853 3300005841 Bacteria 5394
85 Ga0068858_100041385 3300005842 Bacteria 4272
86 Ga0068858_100589553 3300005842 Bacteria 1078
87 Ga0068860_100093295 3300005843 Bacteria 2869
88 Ga0081540_1002227 3300005983 Bacteria 15974
89 Ga0081540_1005198 3300005983 Bacteria 9740
90 Ga0081540_1006571 3300005983 Bacteria 8437
91 Ga0081540_1006785 3300005983 Bacteria 8274
92 Ga0081540_1018573 3300005983 Bacteria 4259
93 Ga0070717_10087311 3300006028 Bacteria 2627
94 Ga0070717_10429945 3300006028 Bacteria 1188
95 Ga0075365_10059561 3300006038 Bacteria 2545
96 Ga0075368_10019062 3300006042 Bacteria 2587
97 Ga0075363_100010158 3300006048 Bacteria 4453
98 Ga0075363_100048514 3300006048 Bacteria 2258
99 Ga0075364_10024619 3300006051 Bacteria 3824
100 Ga0075364_10295801 3300006051 Bacteria 1102
101 Ga0070715_10000456 3300006163 Bacteria 10562
102 Ga0070716_100011137 3300006173 Bacteria 4526
103 Ga0070716_100023798 3300006173 Bacteria 3253
104 Ga0070712_100015504 3300006175 Bacteria 4912
105 Ga0075367_10001130 3300006178 Bacteria 11093
106 Ga0075369_10005353 3300006186 Bacteria 4787
107 Ga0075366_10016316 3300006195 Bacteria 4268
108 Ga0075370_10009564 3300006353 Bacteria 5039
109 Ga0075370_10017687 3300006353 Bacteria 3854
110 Ga0068865_100055253 3300006881 Bacteria 2762
111 Ga0075436_100088588 3300006914 Bacteria 2150
112 Ga0097620_100063592 3300006931 Bacteria 3721
113 Ga0099824_1021709 3300006942 Bacteria 4410
114 Ga0099824_1033210 3300006942 Bacteria 1768
115 Ga0099822_1024226 3300006943 Bacteria 5463
116 Ga0105240_10039694 3300009093 Bacteria 6026
117 Ga0105240_10109427 3300009093 Bacteria 3346
118 Ga0105240_10121920 3300009093 Bacteria 3138
119 Ga0105240_10135701 3300009093 Bacteria 2947
120 Ga0105240_10276799 3300009093 Bacteria 1930
121 Ga0111539_10714684 3300009094 Bacteria 1166
122 Ga0105245_10005441 3300009098 Bacteria 11187
123 Ga0105245_10038994 3300009098 Bacteria 4228
124 Ga0105247_10005785 3300009101 Bacteria 7742
125 Ga0105247_10240256 3300009101 Bacteria 1234
126 Ga0105243_10042185 3300009148 Bacteria 3571
127 Ga0105241_10037493 3300009174 Bacteria 3652
128 Ga0105241_10211105 3300009174 Bacteria 1626
129 Ga0105248_10646336 3300009177 Bacteria 1193
130 Ga0105237_10017339 3300009545 Bacteria 7466
131 Ga0105237_10095319 3300009545 Bacteria 2965
132 Ga0105237_10138567 3300009545 Bacteria 2427
133 Ga0105237_10298145 3300009545 Bacteria 1615
134 Ga0105238_10142049 3300009551 Bacteria 2377
135 Ga0105238_10398268 3300009551 Bacteria 1370
136 Ga0099796_10010555 3300010159 Bacteria 2543
137 Ga0105239_10003963 3300010375 Bacteria 17936
138 Ga0105239_10109809 3300010375 Bacteria 3057
139 Ga0105239_10546926 3300010375 Bacteria 1318
140 Ga0105246_10379968 3300011119 Bacteria 1167
141 Ga0157371_10237967 3300013102 Bacteria 1309
142 Ga0157370_10097584 3300013104 Bacteria 2756
143 Ga0157370_10205900 3300013104 Bacteria 1824
144 Ga0157370_10338421 3300013104 Bacteria 1387
145 Ga0157370_10357736 3300013104 Bacteria 1345
146 Ga0157369_10012373 3300013105 Bacteria 9688
147 Ga0157369_10026071 3300013105 Bacteria 6485
148 Ga0157369_10083698 3300013105 Bacteria 3411
149 Ga0157374_10634738 3300013296 Bacteria 1079
150 Ga0157378_10172127 3300013297 Bacteria 2031
151 Ga0163162_10025402 3300013306 Bacteria 5853
152 Ga0163162_10146465 3300013306 Bacteria 2478
153 Ga0157372_10034737 3300013307 Bacteria 5546
154 Ga0157372_10048052 3300013307 Bacteria 4743
155 Ga0157372_10326057 3300013307 Bacteria 1788
156 Ga0157375_10011636 3300013308 Bacteria 7774
157 Ga0163163_10007610 3300014325 Bacteria 9569
158 Ga0163163_10073797 3300014325 Bacteria 3403
159 Ga0157376_10153431 3300014969 Bacteria 2080
160 Ga0213873_10000846 3300021358 Bacteria 4931
161 Ga0213872_10000429 3300021361 Bacteria 34403
162 Ga0213872_10004083 3300021361 Bacteria 7859
163 Ga0213872_10004694 3300021361 Bacteria 7180
164 Ga0213872_10016051 3300021361 Bacteria 3478
165 Ga0213874_10002580 3300021377 Bacteria 3917
166 Ga0213874_10002639 3300021377 Bacteria 3888
167 Ga0213874_10005128 3300021377 Bacteria 3035
168 Ga0213876_10001306 3300021384 Bacteria 15675
169 Ga0213876_10001630 3300021384 Bacteria 13688
170 Ga0213876_10134690 3300021384 Bacteria 1314
171 Ga0213875_10000030 3300021388 Bacteria 178500
172 Ga0213875_10003482 3300021388 Bacteria 8959
173 Ga0213875_10003821 3300021388 Bacteria 8464
174 Ga0213875_10007291 3300021388 Bacteria 5723
175 Ga0213875_10010083 3300021388 Bacteria 4749
176 Ga0213875_10014477 3300021388 Bacteria 3848
177 Ga0213875_10019616 3300021388 Bacteria 3252
178 Ga0213875_10046437 3300021388 Bacteria 2038
179 Ga0213875_10077961 3300021388 Bacteria 1546
180 Ga0213875_10091232 3300021388 Bacteria 1421
181 Ga0213871_10068475 3300021441 Bacteria 999
182 Ga0209677_100749 3300025253 Bacteria 16460
183 Ga0209148_1000773 3300025254 Bacteria 23969
184 Ga0209233_1003148 3300025261 Bacteria 5852
185 Ga0209233_1004858 3300025261 Bacteria 4525
186 Ga0209233_1005292 3300025261 Bacteria 4301
187 Ga0209233_1005946 3300025261 Bacteria 3993
188 Ga0209455_1001728 3300025272 Bacteria 9312
189 Ga0209455_1008216 3300025272 Bacteria 2858
190 Ga0209564_1003916 3300025295 Bacteria 9529
191 Ga0209758_1000282 3300025297 Bacteria 100746
192 Ga0209758_1004003 3300025297 Bacteria 12747
193 Ga0209758_1027779 3300025297 Bacteria 2410
194 Ga0207426_1000437 3300025302 Bacteria 67439
195 Ga0207426_1001098 3300025302 Bacteria 24902
196 Ga0207426_1012310 3300025302 Bacteria 3218
197 Ga0207692_10002885 3300025898 Bacteria 6655
198 Ga0207692_10005756 3300025898 Bacteria 4986
199 Ga0207692_10009200 3300025898 Bacteria 4116
200 Ga0207710_10018346 3300025900 Bacteria 2975
201 Ga0207688_10019965 3300025901 Bacteria 3655
202 Ga0207685_10000267 3300025905 Bacteria 8260
203 Ga0207699_10002339 3300025906 Bacteria 8949
204 Ga0207699_10003537 3300025906 Bacteria 7456
205 Ga0207643_10025498 3300025908 Bacteria 3267
206 Ga0207705_10082672 3300025909 Bacteria 2342
207 Ga0207654_10021751 3300025911 Bacteria 3414
208 Ga0207654_10029110 3300025911 Bacteria 3019
209 Ga0207707_10018073 3300025912 Bacteria 6143
210 Ga0207695_10000062 3300025913 Bacteria 351979
211 Ga0207695_10019960 3300025913 Bacteria 7695
212 Ga0207695_10078563 3300025913 Bacteria 3348
213 Ga0207695_10133694 3300025913 Bacteria 2435
214 Ga0207695_10251375 3300025913 Bacteria 1667
215 Ga0207671_10008251 3300025914 Bacteria 8862
216 Ga0207671_10051920 3300025914 Bacteria 3037
217 Ga0207671_10092336 3300025914 Bacteria 2282
218 Ga0207671_10139497 3300025914 Bacteria 1867
219 Ga0207671_10223517 3300025914 Bacteria 1476
220 Ga0207693_10000326 3300025915 Bacteria 44051
221 Ga0207693_10003223 3300025915 Bacteria 14005
222 Ga0207693_10015787 3300025915 Bacteria 6050
223 Ga0207663_10000225 3300025916 Bacteria 25184
224 Ga0207663_10009124 3300025916 Bacteria 5229
225 Ga0207663_10096713 3300025916 Bacteria 1973
226 Ga0207663_10116539 3300025916 Bacteria 1821
227 Ga0207663_10132455 3300025916 Bacteria 1724
228 Ga0207660_10228682 3300025917 Bacteria 1462
229 Ga0207657_10004806 3300025919 Bacteria 14248
230 Ga0207649_10102875 3300025920 Bacteria 1894
231 Ga0207652_10013842 3300025921 Bacteria 6527
232 Ga0207652_10023687 3300025921 Bacteria 5088
233 Ga0207652_10084661 3300025921 Bacteria 2778
234 Ga0207652_10525394 3300025921 Bacteria 1065
235 Ga0207694_10132083 3300025924 Bacteria 2002
236 Ga0207694_10525114 3300025924 Bacteria 992
237 Ga0207664_10014435 3300025929 Bacteria 5704
238 Ga0207664_10031784 3300025929 Bacteria 4042
239 Ga0207664_10109709 3300025929 Bacteria 2293
240 Ga0207644_10016717 3300025931 Bacteria 4940
241 Ga0207690_10025298 3300025932 Bacteria 3725
242 Ga0207706_10199961 3300025933 Bacteria 1753
243 Ga0207709_10203375 3300025935 Bacteria 1416
244 Ga0207704_10048142 3300025938 Bacteria 2554
245 Ga0207665_10001364 3300025939 Bacteria 16457
246 Ga0207665_10015528 3300025939 Bacteria 4997
247 Ga0207665_10036269 3300025939 Bacteria 3278
248 Ga0207711_10054778 3300025941 Bacteria 3423
249 Ga0207689_10014080 3300025942 Bacteria 6807
250 Ga0207661_10001182 3300025944 Bacteria 17455
251 Ga0207661_10203221 3300025944 Bacteria 1743
252 Ga0207679_10363881 3300025945 Bacteria 1264
253 Ga0207679_10489006 3300025945 Bacteria 1097
254 Ga0207712_10125479 3300025961 Bacteria 1948
255 Ga0207668_10004125 3300025972 Bacteria 8524
256 Ga0207658_10093472 3300025986 Bacteria 2338
257 Ga0207677_10038130 3300026023 Bacteria 3148
258 Ga0207639_10010102 3300026041 Bacteria 6528
259 Ga0207639_10196860 3300026041 Bacteria 1725
260 Ga0207639_10311422 3300026041 Bacteria 1395
261 Ga0207678_10014454 3300026067 Bacteria 6941
262 Ga0207678_10021795 3300026067 Bacteria 5619
263 Ga0207678_10023002 3300026067 Bacteria 5454
264 Ga0207678_10054764 3300026067 Bacteria 3436
265 Ga0207702_10000197 3300026078 Bacteria 71667
266 Ga0207702_10018501 3300026078 Bacteria 5764
267 Ga0207641_10238720 3300026088 Bacteria 1693
268 Ga0207648_10219239 3300026089 Bacteria 1690
269 Ga0207676_10106108 3300026095 Bacteria 2340
270 Ga0207674_10464147 3300026116 Bacteria 1224
271 Ga0207675_100041364 3300026118 Bacteria 4304
272 Ga0207683_10011087 3300026121 Bacteria 7681
273 Ga0207698_10105090 3300026142 Bacteria 2352
274 Ga0207698_10200930 3300026142 Bacteria 1785
275 Ga0207698_10314938 3300026142 Bacteria 1463
276 Ga0209389_1000004 3300027296 Bacteria 263759
277 Ga0209389_1001618 3300027296 Bacteria 16174
278 Ga0209589_1000010 3300027357 Bacteria 237657
279 Ga0209589_1000014 3300027357 Bacteria 227996
280 Ga0209489_100011 3300027361 Bacteria 244710
281 Ga0209489_100014 3300027361 Bacteria 227996
282 Ga0209489_100777 3300027361 Bacteria 63061
283 Ga0209700_100013 3300027363 Bacteria 341906
284 Ga0209700_100024 3300027363 Bacteria 227996
285 Ga0209813_10002203 3300027866 Bacteria 4450
286 Ga0268266_10001413 3300028379 Bacteria 28643
287 Ga0268266_10087585 3300028379 Bacteria 2724
288 Ga0268264_10062341 3300028381 Bacteria 3130
289 Ga0265334_10054565 3300028573 Bacteria 1524
290 Ga0265770_1014959 3300030878 Bacteria 1176
291 Ga0265773_1001012 3300031018 Bacteria 1387
292 Ga0265760_10051491 3300031090 Bacteria 1240
293 Ga0265330_10035799 3300031235 Bacteria 2214
294 Ga0265325_10012959 3300031241 Bacteria 4755
295 Ga0265340_10011608 3300031247 Bacteria 4676
296 Ga0265339_10000016 3300031249 Bacteria 185313
297 Ga0265339_10006455 3300031249 Bacteria 7692
298 Ga0265339_10016353 3300031249 Bacteria 4424
299 Ga0265339_10110791 3300031249 Bacteria 1420
300 Ga0265316_10387288 3300031344 Bacteria 1008
301 Ga0307513_10018286 3300031456 Bacteria 8378
302 Ga0265313_10000060 3300031595 Bacteria 107224
303 Ga0265314_10016312 3300031711 Bacteria 5871
304 Ga0265314_10069850 3300031711 Bacteria 2356
305 Ga0265342_10010600 3300031712 Bacteria 6375
306 Ga0307516_10092521 3300031730 Bacteria 2851
307 Ga0316583_10027407 3300032133 Bacteria 2034
308 Ga0307510_10019799 3300033180 Bacteria 7881
309 Ga0315911_1000002 3300033442 Bacteria 926833
310 Ga0316215_1001104 3300033544 Bacteria 2623
311 Ga0373934_0002405 3300035086 Bacteria 6890
312 Ga0373923_0022547 3300035111 Bacteria 2470
313 Ga0373936_0018479 3300035113 Bacteria 2693
314 Ga0373953_0000409 3300035117 Bacteria 11662
315 Ga0373953_0009941 3300035117 Bacteria 3296
316 Ga0373954_0002776 3300035118 Bacteria 7375
317 Ga0373954_0029995 3300035118 Bacteria 2507
318 Ga0373956_0004736 3300035119 Bacteria 5443
319 Ga0373956_0005250 3300035119 Bacteria 5184
320 Ga0373957_0014177 3300035120 Bacteria 2720
321 Ga0373955_0002711 3300035172 Bacteria 7754
322 Ga0373955_0003550 3300035172 Bacteria 6865
323 Ga0373924_0006225 3300035410 Bacteria 4267
324 Ga0373927_0004054 3300035695 Bacteria 10349
325 Ga0373933_0002107 3300035724 Bacteria 11423
326 Ga0373937_0008396 3300036401 Bacteria 8974
327 Ga0373937_0021312 3300036401 Bacteria 5816
328 Ga0373937_0324402 3300036401 Bacteria 1457
329 Ga0372808_001074 3300036459 Bacteria 2661
330 Ga0373925_0024876 3300037068 Bacteria 4374
331 Ga0395899_0122972 3300037312 Bacteria 1857
332 Ga0395900_0000660 3300037418 Bacteria 46104
333 Ga0395900_0002114 3300037418 Bacteria 22253
334 Ga0395900_0008707 3300037418 Bacteria 10423
335 Ga0395900_0199262 3300037418 Bacteria 2027
336 Ga0395900_0378614 3300037418 Bacteria 1384
337 Ga0395898_0003200 3300037466 Bacteria 18438
338 Ga0395898_0006500 3300037466 Bacteria 12485
339 Ga0395898_0007107 3300037466 Bacteria 11890
340 Ga0395898_0064826 3300037466 Bacteria 3543
341 Ga0395905_0021700 3300037471 Bacteria 6074
342 Ga0395905_0259473 3300037471 Bacteria 1622
343 Ga0436364_0051975 3300037853 Bacteria 3739
344 Ga0436364_0102033 3300037853 Bacteria 1689
345 Ga0436364_0134493 3300037853 Bacteria 6192
346 Ga0436364_0178729 3300037853 Bacteria 19908
347 Ga0436364_0240938 3300037853 Bacteria 2811
348 Ga0436364_0294887 3300037853 Bacteria 20599
349 Ga0436364_0330571 3300037853 Bacteria 2928
350 Ga0436364_0341833 3300037853 Bacteria 5349
351 Ga0436364_0425317 3300037853 Bacteria 2884
352 Ga0436364_0480253 3300037853 Bacteria 2172
353 Ga0436364_0629092 3300037853 Bacteria 6792
354 Ga0436364_0654054 3300037853 Bacteria 1462
355 Ga0436364_1015733 3300037853 Bacteria 2723
356 Ga0436364_1040604 3300037853 Bacteria 60326
357 Ga0436364_1401270 3300037853 Bacteria 10880
358 Ga0436364_1503331 3300037853 Bacteria 31628
359 Ga0436364_1527859 3300037853 Bacteria 20905
360 Ga0395901_0034087 3300038443 Bacteria 5257
361 Ga0395901_0063663 3300038443 Bacteria 3839
362 Ga0395901_0101488 3300038443 Bacteria 3019
363 Ga0395901_0437117 3300038443 Bacteria 1340
364 Ga0395901_0515459 3300038443 Bacteria 1215
365 Ga0436365_0151043 3300039437 Bacteria 1380
366 Ga0436365_0159409 3300039437 Bacteria 2110
367 Ga0436365_0459588 3300039437 Bacteria 1325
368 Ga0436365_0510188 3300039437 Bacteria 12764
369 Ga0436365_0697045 3300039437 Bacteria 35162
370 Ga0436365_0917056 3300039437 Bacteria 16389
371 Ga0436365_1047663 3300039437 Bacteria 2746
372 Ga0436360_0202427 3300039438 Bacteria 4987
373 Ga0436360_0480010 3300039438 Bacteria 3604
374 Ga0436360_0545523 3300039438 Bacteria 2119
375 Ga0436360_1060729 3300039438 Bacteria 1128
376 Ga0436360_1101828 3300039438 Bacteria 2281
377 Ga0436361_0200283 3300039447 Bacteria 2300
378 Ga0436361_0512286 3300039447 Bacteria 5516
379 Ga0436361_0638445 3300039447 Bacteria 9354
380 Ga0436361_0838125 3300039447 Bacteria 5115
381 Ga0436361_1054672 3300039447 Bacteria 3969
382 Ga0436361_1159707 3300039447 Bacteria 1567
383 Ga0436363_0121554 3300039450 Bacteria 5905
384 Ga0436363_0274569 3300039450 Bacteria 2779
385 Ga0436363_0454820 3300039450 Bacteria 3677
386 Ga0436363_0627803 3300039450 Bacteria 1682
387 Ga0436363_0700194 3300039450 Bacteria 1499
388 Ga0436363_0761127 3300039450 Bacteria 1785
389 Ga0436363_1022276 3300039450 Bacteria 10376
390 Ga0436363_1499575 3300039450 Bacteria 4582
391 Ga0436362_0278148 3300039453 Bacteria 2371
392 Ga0436362_0842308 3300039453 Bacteria 1254
393 Ga0436362_0895327 3300039453 Bacteria 9610
394 Ga0436362_0983233 3300039453 Bacteria 2080
395 Ga0466969_0100925 3300044656 Bacteria 1358
396 Ga0466972_0000079 3300044658 Bacteria 90348
397 Ga0466972_0004644 3300044658 Bacteria 6881
398 Ga0466966_0001208 3300044684 Bacteria 16568
399 Ga0466966_0006229 3300044684 Bacteria 7887
400 Ga0466961_0000020 3300044693 Bacteria 107610
401 Ga0466961_0039468 3300044693 Bacteria 3027
402 Ga0466961_0049669 3300044693 Bacteria 2680
403 Ga0466963_0031974 3300044694 Bacteria 3404
404 Ga0466963_0209438 3300044694 Bacteria 1364
405 Ga0466971_0051755 3300044719 Bacteria 1849
406 Ga0466968_0011964 3300044735 Bacteria 3389
407 Ga0466970_0026083 3300044765 Bacteria 3063
408 Ga0466970_0087989 3300044765 Bacteria 1685
409 Ga0466957_0041896 3300044842 Bacteria 2769
410 Ga0466957_0165300 3300044842 Bacteria 1439
411 Ga0466960_0000424 3300044901 Bacteria 14510
412 Ga0466959_0004294 3300045049 Bacteria 9508
413 Ga0466959_0245173 3300045049 Bacteria 1236
414 Ga0466967_0063821 3300045976 Bacteria 3274
415 Ga0466967_0377060 3300045976 Bacteria 1377
416 Ga0466967_0549232 3300045976 Bacteria 1137
417 Ga0495592_0003202 3300046454 Bacteria 11732
418 Ga0495592_0036190 3300046454 Bacteria 3718
419 Ga0495603_0139262 3300046455 Bacteria 1412
420 Ga0495629_0001830 3300046459 Bacteria 16661
421 Ga0495629_0006153 3300046459 Bacteria 8909
422 Ga0495629_0107512 3300046459 Bacteria 1946
423 Ga0495641_0144258 3300046461 Bacteria 1064
424 Ga0495651_0002500 3300046462 Bacteria 14218
425 Ga0495651_0041294 3300046462 Bacteria 3583
426 Ga0495651_0041839 3300046462 Bacteria 3558
427 Ga0495651_0140950 3300046462 Bacteria 1748
428 Ga0495653_0001471 3300046463 Bacteria 18364
429 Ga0495653_0050752 3300046463 Bacteria 3189
430 Ga0495653_0159296 3300046463 Bacteria 1568
431 Ga0495582_0214523 3300046473 Bacteria 1101
432 Ga0495639_0114838 3300046475 Bacteria 1280
433 Ga0495662_0108284 3300046476 Bacteria 1361
434 Ga0495664_0007676 3300046477 Bacteria 6001
435 Ga0495664_0007911 3300046477 Bacteria 5917
436 Ga0495664_0087653 3300046477 Bacteria 1870
437 Ga0495596_0068738 3300046500 Bacteria 1377
438 Ga0495606_0005210 3300046507 Bacteria 12548
439 Ga0495608_0002191 3300046511 Bacteria 14103
440 Ga0495608_0036131 3300046511 Bacteria 3328
441 Ga0495608_0060094 3300046511 Bacteria 2502
442 Ga0495618_0079959 3300046514 Bacteria 2085
443 Ga0495618_0279140 3300046514 Bacteria 1042
444 Ga0495620_0060077 3300046515 Bacteria 1586
445 Ga0495628_0030883 3300046516 Bacteria 4335
446 Ga0495628_0033600 3300046516 Bacteria 4131
447 Ga0495628_0064783 3300046516 Bacteria 2860
448 Ga0495630_0022407 3300046517 Bacteria 4664
449 Ga0495648_0003767 3300046524 Bacteria 13191
450 Ga0495648_0007614 3300046524 Bacteria 8644
451 Ga0495652_0006321 3300046529 Bacteria 11036
452 Ga0495652_0031923 3300046529 Bacteria 4609
453 Ga0495640_0002348 3300046533 Bacteria 15175
454 Ga0495640_0026198 3300046533 Bacteria 4216
455 Ga0495586_0022337 3300046535 Bacteria 3377
456 Ga0495587_0004728 3300046536 Bacteria 8935
457 Ga0495587_0015523 3300046536 Bacteria 4754
458 Ga0495587_0027948 3300046536 Bacteria 3434
459 Ga0495645_0014837 3300046543 Bacteria 5536
460 Ga0495645_0040372 3300046543 Bacteria 3404
461 Ga0495645_0221128 3300046543 Bacteria 1274
462 Ga0495667_0002963 3300046559 Bacteria 11387
463 Ga0495667_0013368 3300046559 Bacteria 5555
464 Ga0495667_0016179 3300046559 Bacteria 5039
465 Ga0495634_0089901 3300046642 Bacteria 1995
466 Ga0495634_0197772 3300046642 Bacteria 1250
467 Ga0495625_0039696 3300046660 Bacteria 3436
468 Ga0495635_0000636 3300046663 Bacteria 22538
469 Ga0495635_0002205 3300046663 Bacteria 13252
470 Ga0495657_0002552 3300046675 Bacteria 15277
471 Ga0495657_0014012 3300046675 Bacteria 5889
472 Ga0495599_0001077 3300046678 Bacteria 15369
473 Ga0495599_0010332 3300046678 Bacteria 5708
474 Ga0495599_0060861 3300046678 Bacteria 2360
475 Ga0495623_0004268 3300046679 Bacteria 9412
476 Ga0495623_0006526 3300046679 Bacteria 7595
477 Ga0495623_0048527 3300046679 Bacteria 2692
478 Ga0495646_0025871 3300046680 Bacteria 3687
479 Ga0495613_0033951 3300046689 Bacteria 3790
480 Ga0495613_0120524 3300046689 Bacteria 1884
481 Ga0495624_0058576 3300046690 Bacteria 2418
482 Ga0495624_0091302 3300046690 Bacteria 1879
483 Ga0495624_0111238 3300046690 Bacteria 1684
484 Ga0495600_0000873 3300046809 Bacteria 16122
485 Ga0495600_0001010 3300046809 Bacteria 15188
486 Ga0495604_0008420 3300047317 Bacteria 8146
487 Ga0495604_0038621 3300047317 Bacteria 3755
488 Ga0495604_0052467 3300047317 Bacteria 3157
489 Ga0495604_0063576 3300047317 Bacteria 2814
490 Ga0495674_0028066 3300047319 Bacteria 5137
491 Ga0495674_0065255 3300047319 Bacteria 3163
492 Ga0495674_0242918 3300047319 Bacteria 1483
493 Ga0495676_0103736 3300047321 Bacteria 2099
494 Ga0495680_0001037 3300047322 Bacteria 30809
495 Ga0495680_0001883 3300047322 Bacteria 22052
496 Ga0495680_0043083 3300047322 Bacteria 3576
497 Ga0495675_0001800 3300047444 Bacteria 12774
498 Ga0495675_0037092 3300047444 Bacteria 3105
499 Ga0495684_0000666 3300047471 Bacteria 27678
500 Ga0495684_0036531 3300047471 Bacteria 3765
501 Ga0495684_0096515 3300047471 Bacteria 2237
502 Ga0495684_0184941 3300047471 Bacteria 1543
503 Ga0495686_0046711 3300047472 Bacteria 2736
504 Ga0495686_0107093 3300047472 Bacteria 1680
505 Ga0495593_0008032 3300047673 Bacteria 6139
506 Ga0495602_0004340 3300048088 Bacteria 14780
507 Ga0495602_0012996 3300048088 Bacteria 8521
508 Ga0495602_0196647 3300048088 Bacteria 1541
509 Ga0495602_0201081 3300048088 Bacteria 1520
510 Ga0496100_0029945 3300048903 Bacteria 3372
511 Ga0496102_0567391 3300048905 Bacteria 1058
512 Ga0496104_0001245 3300048907 Bacteria 21918
513 Ga0496104_0005309 3300048907 Bacteria 11271
514 Ga0496104_0082198 3300048907 Bacteria 3072
515 Ga0496104_0283502 3300048907 Bacteria 1569
516 Ga0496105_0003657 3300048908 Bacteria 11428
517 Ga0496105_0093356 3300048908 Bacteria 2485
518 Ga0496106_0013957 3300048909 Bacteria 5941
519 Ga0496107_0130771 3300048910 Bacteria 1853
520 Ga0496108_0001861 3300048911 Bacteria 16875
521 Ga0496108_0218656 3300048911 Bacteria 1655
522 Ga0496109_0001073 3300048912 Bacteria 22672
523 Ga0496109_0155295 3300048912 Bacteria 2143
524 Ga0496110_0002479 3300048913 Bacteria 13828
525 Ga0496111_0028004 3300048914 Bacteria 3991
526 Ga0496111_0061970 3300048914 Bacteria 2712
527 Ga0496111_0215505 3300048914 Bacteria 1426
528 Ga0496112_0002061 3300048915 Bacteria 15937
529 Ga0496112_0005807 3300048915 Bacteria 10736
530 Ga0496112_0008838 3300048915 Bacteria 9038
531 Ga0496112_0107427 3300048915 Bacteria 2761
532 Ga0496112_0119654 3300048915 Bacteria 2603
533 Ga0496112_0223868 3300048915 Bacteria 1837
534 Ga0496112_0440495 3300048915 Bacteria 1241
535 Ga0496113_0000095 3300048916 Bacteria 37445
536 Ga0496113_0156636 3300048916 Bacteria 1799
537 Ga0496114_0200299 3300048917 Bacteria 1749
538 Ga0496115_0003952 3300048918 Bacteria 10689
539 Ga0496115_0042478 3300048918 Bacteria 3621
540 Ga0496115_0314357 3300048918 Bacteria 1282
541 Ga0496116_0140996 3300048919 Bacteria 1356
542 Ga0496118_0016456 3300048921 Bacteria 6783
543 Ga0496118_0130626 3300048921 Bacteria 1614
544 Ga0496119_0003004 3300048922 Bacteria 17875
545 Ga0496119_0080481 3300048922 Bacteria 1879
546 Ga0496121_0008659 3300048924 Bacteria 11890
547 Ga0496121_0021131 3300048924 Bacteria 6392
548 Ga0496121_0032677 3300048924 Bacteria 4725
549 Ga0496121_0066895 3300048924 Bacteria 2915
550 Ga0496121_0103413 3300048924 Bacteria 2191
551 Ga0496124_0209458 3300048927 Bacteria 1476
552 Ga0496125_0000237 3300048928 Bacteria 113322
553 Ga0496125_0001822 3300048928 Bacteria 29443
554 Ga0496126_0011267 3300048929 Bacteria 9277
555 Ga0496126_0158354 3300048929 Bacteria 1936
556 Ga0496126_0174038 3300048929 Bacteria 1832
557 Ga0496126_0338736 3300048929 Bacteria 1232
558 Ga0501031_0001197 3300049568 Bacteria 15831
559 Ga0501031_0003032 3300049568 Bacteria 10740
560 Ga0501031_0118857 3300049568 Bacteria 1727
561 Ga0501032_0000358 3300049569 Bacteria 38004
562 Ga0501032_0000696 3300049569 Bacteria 27371
563 Ga0501032_0036140 3300049569 Bacteria 3373
564 Ga0501032_0086541 3300049569 Bacteria 2083
565 Ga0501033_0000232 3300049570 Bacteria 53703
566 Ga0501033_0000601 3300049570 Bacteria 33366
567 Ga0501033_0001532 3300049570 Bacteria 20415
568 Ga0501033_0006726 3300049570 Bacteria 8984
569 Ga0501033_0037684 3300049570 Bacteria 3618
570 Ga0501034_0000039 3300049571 Bacteria 237357
571 Ga0501034_0000704 3300049571 Bacteria 50735
572 Ga0501034_0193399 3300049571 Bacteria 1996
573 Ga0501036_0000007 3300049572 Bacteria 240500
574 Ga0501036_0000052 3300049572 Bacteria 74795
575 Ga0501036_0301604 3300049572 Bacteria 1340
576 Ga0501037_0000025 3300049573 Bacteria 143276
577 Ga0501037_0001450 3300049573 Bacteria 17426
578 Ga0501037_0020087 3300049573 Bacteria 4931
579 Ga0501037_0149374 3300049573 Bacteria 1671
580 Ga0501038_0000026 3300049574 Bacteria 146493
581 Ga0501038_0000168 3300049574 Bacteria 55496
582 Ga0501038_0119167 3300049574 Bacteria 2179
583 Ga0501038_0177296 3300049574 Bacteria 1722
584 Ga0501038_0275468 3300049574 Bacteria 1326
585 Ga0501039_0000005 3300049575 Bacteria 295471
586 Ga0501039_0003632 3300049575 Bacteria 11560
587 Ga0501039_0156253 3300049575 Bacteria 1792
588 Ga0501042_0118124 3300049578 Bacteria 1909
589 Ga0501043_0000007 3300049579 Bacteria 224595
590 Ga0501043_0000036 3300049579 Bacteria 132959
591 Ga0501043_0002042 3300049579 Bacteria 17221
592 Ga0501043_0133440 3300049579 Bacteria 1946
593 Ga0501046_0000147 3300049580 Bacteria 74186
594 Ga0501046_0000231 3300049580 Bacteria 57655
595 Ga0501046_0070614 3300049580 Bacteria 2715
596 Ga0501046_0171712 3300049580 Bacteria 1627
597 Ga0501046_0304341 3300049580 Bacteria 1164
598 Ga0501047_0000209 3300049581 Bacteria 70658
599 Ga0501047_0000457 3300049581 Bacteria 45136
600 Ga0501047_0009482 3300049581 Bacteria 9198
601 Ga0501047_0012842 3300049581 Bacteria 7935
602 Ga0501047_0071155 3300049581 Bacteria 3348
603 Ga0501047_0102930 3300049581 Bacteria 2735
604 Ga0501047_0145750 3300049581 Bacteria 2245
605 Ga0501047_0223123 3300049581 Bacteria 1740
606 Ga0501048_0000585 3300049582 Bacteria 25849
607 Ga0501048_0020451 3300049582 Bacteria 4850
608 Ga0501067_0000025 3300049583 Bacteria 91481
609 Ga0501067_0063143 3300049583 Bacteria 2051
610 Ga0501067_0087364 3300049583 Bacteria 1730
611 Ga0501068_0002387 3300049584 Bacteria 9984
612 Ga0501068_0004030 3300049584 Bacteria 7988
613 Ga0501069_0000001 3300049585 Bacteria 289100
614 Ga0501069_0133516 3300049585 Bacteria 1422
615 Ga0501070_0000071 3300049586 Bacteria 86669
616 Ga0501070_0000824 3300049586 Bacteria 28140
617 Ga0501070_0001839 3300049586 Bacteria 18710
618 Ga0501070_0024940 3300049586 Bacteria 5015
619 Ga0501070_0178591 3300049586 Bacteria 1747
620 Ga0501070_0178612 3300049586 Bacteria 1747
621 Ga0501071_0010530 3300049587 Bacteria 6202
622 Ga0501071_0022185 3300049587 Bacteria 4425
623 Ga0501072_0003385 3300049588 Bacteria 11997
624 Ga0501072_0051510 3300049588 Bacteria 3241
625 Ga0501073_0000135 3300049589 Bacteria 47869
626 Ga0501073_0011727 3300049589 Bacteria 6399
627 Ga0501073_0013905 3300049589 Bacteria 5849
628 Ga0501073_0032984 3300049589 Bacteria 3690
629 Ga0501074_0000003 3300049590 Bacteria 116101
630 Ga0501074_0000443 3300049590 Bacteria 24761
631 Ga0501074_0019268 3300049590 Bacteria 4956
632 Ga0501074_0023253 3300049590 Bacteria 4508
633 Ga0501076_0332905 3300049592 Bacteria 1246
634 Ga0501079_0003407 3300049741 Bacteria 11674
635 Ga0501080_0000382 3300049742 Bacteria 34121
636 Ga0501080_0000470 3300049742 Bacteria 31361
637 Ga0501080_0000669 3300049742 Bacteria 27250
638 Ga0501080_0005657 3300049742 Bacteria 11171
639 Ga0501081_0326335 3300049743 Bacteria 1129
640 Ga0501083_0000080 3300049744 Bacteria 64705
641 Ga0501083_0003054 3300049744 Bacteria 11634
642 Ga0501083_0101325 3300049744 Bacteria 1899
643 Ga0501035_0000037 3300049822 Bacteria 160921
644 Ga0501035_0000052 3300049822 Bacteria 143038
645 Ga0501035_0001237 3300049822 Bacteria 26512
646 Ga0501035_0001584 3300049822 Bacteria 23082
647 Ga0501035_0002187 3300049822 Bacteria 19401
648 Ga0501035_0070539 3300049822 Bacteria 3095
649 Ga0501035_0121270 3300049822 Bacteria 2285
650 Ga0501035_0175161 3300049822 Bacteria 1851
651 Ga0501044_0000018 3300049823 Bacteria 225885
652 Ga0501044_0000217 3300049823 Bacteria 73242
653 Ga0501044_0000366 3300049823 Bacteria 56832
654 Ga0501044_0046984 3300049823 Bacteria 4467
655 Ga0501044_0072305 3300049823 Bacteria 3506
656 Ga0501044_0085781 3300049823 Bacteria 3181
657 Ga0501044_0087528 3300049823 Bacteria 3146
658 Ga0501044_0091284 3300049823 Bacteria 3072
659 Ga0501044_0147382 3300049823 Bacteria 2338
660 nmdc:mga03n38_14660_c1 3300050490 Bacteria 3010
661 nmdc:mga03n38_224_c1 3300050490 Bacteria 13138
662 nmdc:mga00v17_205002_c1 3300050491 Bacteria 1275
663 nmdc:mga00v17_9386_c1 3300050491 Bacteria 5292
664 nmdc:mga0yw44_52563_c1 3300050492 Bacteria 2470
665 nmdc:mga0yw44_72837_c1 3300050492 Bacteria 2136
666 nmdc:mga0k408_5979_c1 3300050493 Bacteria 6497
667 nmdc:mga04h51_6775_c1 3300050495 Bacteria 2992
668 nmdc:mga07m45_6074_c1 3300050496 Bacteria 6081
669 nmdc:mga0n895_64214_c1 3300050512 Bacteria 3631
670 nmdc:mga08x19_79614_c1 3300050514 Bacteria 2149
671 nmdc:mga0sz30_55309_c1 3300050516 Bacteria 1689
672 nmdc:mga0sz30_9528_c1 3300050516 Bacteria 3699
673 Ga0495601_0014819 3300053077 Bacteria 4705
674 Ga0495601_0041332 3300053077 Bacteria 2889
675 Ga0495601_0185195 3300053077 Bacteria 1361
676 Ga0495601_0239203 3300053077 Bacteria 1185
677 Ga0495612_0013454 3300053078 Bacteria 3296
678 Ga0495655_0009206 3300053083 Bacteria 1906
679 Ga0495655_0056796 3300053083 Bacteria 1054
680 Ga0495595_0003095 3300053084 Bacteria 6581
681 Ga0495595_0016247 3300053084 Bacteria 3180
682 Ga0495619_0004543 3300053085 Bacteria 8862
683 Ga0495619_0030322 3300053085 Bacteria 3500
684 Ga0500578_0068194 3300053086 Bacteria 2268
685 Ga0500578_0107327 3300053086 Bacteria 1763
686 Ga0500647_0033209 3300053091 Bacteria 2460
687 Ga0500651_0000526 3300053093 Bacteria 19635
688 Ga0500566_0000097 3300053094 Bacteria 43920
689 Ga0500640_014937 3300053095 Bacteria 3240
690 Ga0500557_000008 3300053105 Bacteria 127284
691 Ga0500572_000853 3300053111 Bacteria 9498
692 Ga0500595_006403 3300053119 Bacteria 4995
693 Ga0500597_043245 3300053120 Bacteria 1901
694 Ga0500607_075728 3300053121 Bacteria 1727
695 Ga0500614_014025 3300053123 Bacteria 1768
696 Ga0500642_0000067 3300053130 Bacteria 56324
697 Ga0500642_0104340 3300053130 Bacteria 1321
698 Ga0500559_0120556 3300053136 Bacteria 1219
699 Ga0500585_057645 3300053144 Bacteria 1394
700 Ga0500603_001381 3300053150 Bacteria 5534
701 Ga0500619_021578 3300053154 Bacteria 1857
702 Ga0500630_035540 3300053159 Bacteria 2441
703 Ga0500639_000219 3300053163 Bacteria 28391
704 Ga0500636_0066605 3300053177 Bacteria 2094
705 Ga0500625_005765 3300053729 Bacteria 5212
706 Ga0501084_0006290 3300054114 Bacteria 9760

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047471 Ga0495684_0184941 Ga0495684_0184941_715_1506 256
2 iso_pu_bacteria 8019530166 8019536854 259
3 3300049822 Ga0501035_0121270 Ga0501035_0121270_1480_2271 262
4 3300013297 Ga0157378_10172127 Ga0157378_101721272 263
5 3300036401 Ga0373937_0324402 Ga0373937_0324402_649_1440 263
6 3300044842 Ga0466957_0165300 Ga0466957_0165300_13_804 263
7 3300048907 Ga0496104_0283502 Ga0496104_0283502_21_812 263
8 3300048929 Ga0496126_0338736 Ga0496126_0338736_12_803 263
9 3300046680 Ga0495646_0025871 Ga0495646_0025871_2285_3109 274
10 3300048903 Ga0496100_0029945 Ga0496100_0029945_2535_3362 275
11 3300037853 Ga0436364_0480253 Ga0436364_0480253_1029_1955 279
12 3300021388 Ga0213875_10091232 Ga0213875_100912322 280
13 3300037853 Ga0436364_0341833 Ga0436364_0341833_4151_5065 280
14 3300048927 Ga0496124_0209458 Ga0496124_0209458_10_858 282
15 3300037853 Ga0436364_0654054 Ga0436364_0654054_452_1363 283
16 3300021388 Ga0213875_10003482 Ga0213875_100034823 284
17 3300037853 Ga0436364_0134493 Ga0436364_0134493_1896_2807 284
18 3300037853 Ga0436364_1040604 Ga0436364_1040604_22539_23465 284
19 3300021388 Ga0213875_10000030 Ga0213875_1000003040 287
20 3300039437 Ga0436365_0151043 Ga0436365_0151043_288_1211 287
21 3300021388 Ga0213875_10010083 Ga0213875_100100835 288
22 3300021388 Ga0213875_10019616 Ga0213875_100196162 288
23 3300027296 Ga0209389_1001618 Ga0209389_10016185 288
24 3300027357 Ga0209589_1000010 Ga0209589_100001013 288
25 3300027361 Ga0209489_100011 Ga0209489_100011222 288
26 3300037853 Ga0436364_1401270 Ga0436364_1401270_3761_4666 288
27 3300037853 Ga0436364_1503331 Ga0436364_1503331_6849_7775 288
28 3300021388 Ga0213875_10007291 Ga0213875_100072912 289
29 3300037853 Ga0436364_1527859 Ga0436364_1527859_16612_17541 289
30 iso_pu_bacteria 8016530956 8016537162 289
31 iso_pu_bacteria 8016630954 8016633667 289
32 iso_pu_bacteria 8019576017 8019579814 289
33 iso_pu_bacteria 8019638758 8019642754 289
34 3300009551 Ga0105238_10142049 Ga0105238_101420493 290
35 3300013307 Ga0157372_10326057 Ga0157372_103260572 290
36 3300021388 Ga0213875_10014477 Ga0213875_100144773 290
37 3300025917 Ga0207660_10228682 Ga0207660_102286822 290
38 3300025924 Ga0207694_10132083 Ga0207694_101320832 290
39 3300037853 Ga0436364_0294887 Ga0436364_0294887_6415_7338 290
40 3300037853 Ga0436364_1015733 Ga0436364_1015733_1463_2374 290
41 3300039437 Ga0436365_0917056 Ga0436365_0917056_14199_15110 290
42 3300039453 Ga0436362_0895327 Ga0436362_0895327_2429_3340 290
43 3300009551 Ga0105238_10398268 Ga0105238_103982682 292
44 3300021361 Ga0213872_10016051 Ga0213872_100160512 293
45 3300039447 Ga0436361_0838125 Ga0436361_0838125_2593_3519 293
46 3300009093 Ga0105240_10276799 Ga0105240_102767992 294
47 3300025913 Ga0207695_10133694 Ga0207695_101336942 294
48 3300005439 Ga0070711_100119075 Ga0070711_1001190752 295
49 3300005458 Ga0070681_10493869 Ga0070681_104938691 295
50 3300009093 Ga0105240_10121920 Ga0105240_101219203 295
51 3300010375 Ga0105239_10546926 Ga0105239_105469262 295
52 3300021358 Ga0213873_10000846 Ga0213873_100008463 295
53 3300021384 Ga0213876_10001630 Ga0213876_100016302 295
54 3300021388 Ga0213875_10003821 Ga0213875_100038212 295
55 3300021388 Ga0213875_10046437 Ga0213875_100464372 295
56 3300025916 Ga0207663_10132455 Ga0207663_101324552 295
57 3300037853 Ga0436364_0330571 Ga0436364_0330571_1779_2702 295
58 3300037853 Ga0436364_0629092 Ga0436364_0629092_5145_6092 295
59 3300039438 Ga0436360_1101828 Ga0436360_1101828_1191_2120 295
60 3300039453 Ga0436362_0278148 Ga0436362_0278148_433_1362 295
61 3300039453 Ga0436362_0983233 Ga0436362_0983233_795_1724 295
62 3300048905 Ga0496102_0567391 Ga0496102_0567391_71_1000 295
63 3300048918 Ga0496115_0042478 Ga0496115_0042478_706_1635 295
64 3300039438 Ga0436360_0202427 Ga0436360_0202427_2532_3464 296
65 3300005336 Ga0070680_100195987 Ga0070680_1001959872 297
66 3300005458 Ga0070681_10315190 Ga0070681_103151902 297
67 3300013104 Ga0157370_10205900 Ga0157370_102059002 297
68 3300025912 Ga0207707_10018073 Ga0207707_100180732 297
69 3300025921 Ga0207652_10084661 Ga0207652_100846613 297
70 3300039450 Ga0436363_0121554 Ga0436363_0121554_3819_4745 297
71 3300032133 Ga0316583_10027407 Ga0316583_100274072 299
72 3300037853 Ga0436364_0051975 Ga0436364_0051975_1530_2453 299
73 3300039438 Ga0436360_0480010 Ga0436360_0480010_2511_3413 299
74 3300039450 Ga0436363_0454820 Ga0436363_0454820_2372_3274 299
75 3300045976 Ga0466967_0377060 Ga0466967_0377060_402_1328 301
76 iso_pu_bacteria 2595698237 2596371343 301
77 iso_pu_bacteria 2889306138 2889306677 301
78 iso_pu_bacteria 2902330777 2902332324 301
79 iso_pu_bacteria 2902405164 2902409673 301
80 iso_pu_bacteria 2928125067 2928126276 301
81 3300037853 Ga0436364_0178729 Ga0436364_0178729_2749_3660 302
82 iso_pu_bacteria 2545555834 2545674496 303
83 iso_pu_bacteria 2643221651 2644291197 303
84 iso_pu_bacteria 3003665799 3003666887 303
85 iso_pu_bacteria 641522639 641644901 303
86 iso_pu_bacteria 643348564 643597844 303
87 3300013102 Ga0157371_10237967 Ga0157371_102379672 304
88 3300037418 Ga0395900_0378614 Ga0395900_0378614_87_1004 304
89 3300039450 Ga0436363_1499575 Ga0436363_1499575_1789_2706 304
90 3300044684 Ga0466966_0006229 Ga0466966_0006229_856_1791 304
91 3300044693 Ga0466961_0049669 Ga0466961_0049669_1423_2358 304
92 3300044765 Ga0466970_0026083 Ga0466970_0026083_1565_2500 304
93 3300045049 Ga0466959_0245173 Ga0466959_0245173_99_1034 304
94 3300047472 Ga0495686_0046711 Ga0495686_0046711_866_1780 304
95 3300049570 Ga0501033_0037684 Ga0501033_0037684_2324_3241 304
96 3300049580 Ga0501046_0304341 Ga0501046_0304341_56_973 304
97 3300049581 Ga0501047_0145750 Ga0501047_0145750_319_1236 304
98 iso_pu_bacteria 2507262055 2507510856 304
99 iso_pu_bacteria 2508501009 2508544673 304
100 iso_pu_bacteria 2508501042 2508697111 304
101 iso_pu_bacteria 2508501128 2509148566 304
102 iso_pu_bacteria 2513237094 2513637633 304
103 iso_pu_bacteria 2513237095 2513649515 304
104 iso_pu_bacteria 2513237096 2513653945 304
105 iso_pu_bacteria 2513237104 2513719321 304
106 iso_pu_bacteria 2513237137 2513856379 304
107 iso_pu_bacteria 2513237141 2513888424 304
108 iso_pu_bacteria 2513237145 2513918285 304
109 iso_pu_bacteria 2515154112 2515630715 304
110 iso_pu_bacteria 2517093001 2517100429 304
111 iso_pu_bacteria 2517572143 2517891485 304
112 iso_pu_bacteria 2524023205 2524437289 304
113 iso_pu_bacteria 2524023228 2524541002 304
114 iso_pu_bacteria 2528768022 2528855271 304
115 iso_pu_bacteria 2667528175 2671118746 304
116 iso_pu_bacteria 2728368998 2728754864 304
117 iso_pu_bacteria 2744054633 2745076758 304
118 iso_pu_bacteria 2791355196 2793065131 304
119 iso_pu_bacteria 2791355197 2793066853 304
120 iso_pu_bacteria 2816332527 2818237985 304
121 iso_pu_bacteria 2824600985 2824601533 304
122 iso_pu_bacteria 2824609381 2824617195 304
123 iso_pu_bacteria 2824653114 2824653665 304
124 iso_pu_bacteria 2824661429 2824663038 304
125 iso_pu_bacteria 2824704595 2824709871 304
126 iso_pu_bacteria 2824753945 2824756996 304
127 iso_pu_bacteria 2824763712 2824770124 304
128 iso_pu_bacteria 2844315083 2844317084 304
129 iso_pu_bacteria 2847930680 2847938425 304
130 iso_pu_bacteria 2849076700 2849081384 304
131 iso_pu_bacteria 2874590934 2874597571 304
132 iso_pu_bacteria 2874645413 2874649134 304
133 iso_pu_bacteria 2876761206 2876767736 304
134 iso_pu_bacteria 2876771140 2876774956 304
135 iso_pu_bacteria 2876818435 2876822292 304
136 iso_pu_bacteria 2879074833 2879078044 304
137 iso_pu_bacteria 2879083081 2879088662 304
138 iso_pu_bacteria 2879099564 2879103994 304
139 iso_pu_bacteria 2879127579 2879132405 304
140 iso_pu_bacteria 2879142872 2879145296 304
141 iso_pu_bacteria 2881364244 2881370533 304
142 iso_pu_bacteria 2881665667 2881667297 304
143 iso_pu_bacteria 2885374607 2885377810 304
144 iso_pu_bacteria 2885409591 2885416493 304
145 iso_pu_bacteria 2888378607 2888381698 304
146 iso_pu_bacteria 2888419890 2888422085 304
147 iso_pu_bacteria 2903727486 2903735051 304
148 iso_pu_bacteria 2903748898 2903758733 304
149 iso_pu_bacteria 2904690495 2904691341 304
150 iso_pu_bacteria 2904699407 2904704815 304
151 iso_pu_bacteria 2904711408 2904719040 304
152 iso_pu_bacteria 2906602504 2906604167 304
153 iso_pu_bacteria 2906610324 2906616661 304
154 iso_pu_bacteria 2906635258 2906643717 304
155 iso_pu_bacteria 2906643746 2906647979 304
156 iso_pu_bacteria 2906660503 2906666988 304
157 iso_pu_bacteria 2908739725 2908741827 304
158 iso_pu_bacteria 2908756301 2908759521 304
159 iso_pu_bacteria 2922368715 2922371384 304
160 iso_pu_bacteria 2922425934 2922431314 304
161 iso_pu_bacteria 2929615660 2929623243 304
162 iso_pu_bacteria 2929624759 2929630923 304
163 iso_pu_bacteria 2932784394 2932786088 304
164 iso_pu_bacteria 2932794094 2932799136 304
165 iso_pu_bacteria 2932801729 2932803941 304
166 iso_pu_bacteria 2932809354 2932811969 304
167 iso_pu_bacteria 2932818245 2932822545 304
168 iso_pu_bacteria 2932828146 2932831132 304
169 iso_pu_bacteria 2933577622 2933585147 304
170 iso_pu_bacteria 2935608549 2935612922 304
171 iso_pu_bacteria 2935616580 2935624082 304
172 iso_pu_bacteria 2935630451 2935633908 304
173 iso_pu_bacteria 2935638405 2935640272 304
174 iso_pu_bacteria 2935648319 2935654714 304
175 iso_pu_bacteria 2935656913 2935663509 304
176 iso_pu_bacteria 2935665750 2935666890 304
177 iso_pu_bacteria 2935675223 2935684356 304
178 iso_pu_bacteria 2935684952 2935691338 304
179 iso_pu_bacteria 2935694250 2935699897 304
180 iso_pu_bacteria 2935703347 2935704645 304
181 iso_pu_bacteria 2935713505 2935719172 304
182 iso_pu_bacteria 2935722832 2935729228 304
183 iso_pu_bacteria 2935732158 2935737531 304
184 iso_pu_bacteria 2935741537 2935746907 304
185 iso_pu_bacteria 2935750917 2935758294 304
186 iso_pu_bacteria 2935760218 2935762455 304
187 iso_pu_bacteria 2935769743 2935777293 304
188 iso_pu_bacteria 2935777560 2935780388 304
189 iso_pu_bacteria 2935785616 2935793203 304
190 iso_pu_bacteria 2935793552 2935801201 304
191 iso_pu_bacteria 2935801545 2935803952 304
192 iso_pu_bacteria 2935810662 2935811871 304
193 iso_pu_bacteria 2935819856 2935824410 304
194 iso_pu_bacteria 2935827899 2935829755 304
195 iso_pu_bacteria 2935837841 2935842888 304
196 iso_pu_bacteria 2935847175 2935852445 304
197 iso_pu_bacteria 2935855204 2935862418 304
198 iso_pu_bacteria 2935864058 2935870553 304
199 iso_pu_bacteria 2935873716 2935881135 304
200 iso_pu_bacteria 2935883170 2935884253 304
201 iso_pu_bacteria 2935908558 2935912408 304
202 iso_pu_bacteria 2935916978 2935921759 304
203 iso_pu_bacteria 2935926038 2935929703 304
204 iso_pu_bacteria 2935934488 2935938935 304
205 iso_pu_bacteria 2935942939 2935948230 304
206 iso_pu_bacteria 2935951376 2935954954 304
207 iso_pu_bacteria 2935959822 2935962222 304
208 iso_pu_bacteria 2935967501 2935972012 304
209 iso_pu_bacteria 2935975950 2935979340 304
210 iso_pu_bacteria 2935984226 2935988075 304
211 iso_pu_bacteria 2935992306 2935993632 304
212 iso_pu_bacteria 2936002035 2936004528 304
213 iso_pu_bacteria 2936011229 2936017665 304
214 iso_pu_bacteria 2936019824 2936026253 304
215 iso_pu_bacteria 2936028420 2936035243 304
216 iso_pu_bacteria 2936037263 2936038454 304
217 iso_pu_bacteria 2936046547 2936053151 304
218 iso_pu_bacteria 2936055302 2936059374 304
219 iso_pu_bacteria 2940556831 2940563796 304
220 iso_pu_bacteria 2941507105 2941510789 304
221 iso_pu_bacteria 2941515067 2941518173 304
222 iso_pu_bacteria 2941523033 2941526956 304
223 iso_pu_bacteria 2941531003 2941533853 304
224 iso_pu_bacteria 2941538514 2941544137 304
225 iso_pu_bacteria 3005474847 3005481110 304
226 iso_pu_bacteria 3005594810 3005596714 304
227 iso_pu_bacteria 3005710791 3005712785 304
228 iso_pu_bacteria 3005718088 3005719842 304
229 iso_pu_bacteria 8006933436 8006939601 304
230 iso_pu_bacteria 8006973647 8006979352 304
231 iso_pu_bacteria 8016511872 8016516245 304
232 iso_pu_bacteria 8016548790 8016551832 304
233 iso_pu_bacteria 8016557553 8016560215 304
234 iso_pu_bacteria 8016566248 8016566812 304
235 iso_pu_bacteria 8016583857 8016589310 304
236 iso_pu_bacteria 8016595262 8016598133 304
237 iso_pu_bacteria 8016603502 8016604272 304
238 iso_pu_bacteria 8016613128 8016620858 304
239 iso_pu_bacteria 8016622563 8016629130 304
240 iso_pu_bacteria 8017057580 8017060287 304
241 iso_pu_bacteria 8019547302 8019548062 304
242 iso_pu_bacteria 8019555841 8019565492 304
243 iso_pu_bacteria 8019565922 8019575588 304
244 iso_pu_bacteria 8019586578 8019587520 304
245 iso_pu_bacteria 8019597564 8019603818 304
246 iso_pu_bacteria 8019608314 8019614717 304
247 iso_pu_bacteria 8019619141 8019625328 304
248 iso_pu_bacteria 8019629233 8019636853 304
249 iso_pu_bacteria 8019648815 8019649838 304
250 iso_pu_bacteria 8019659431 8019664674 304
251 iso_pu_bacteria 8019668869 8019674264 304
252 iso_pu_bacteria 8019687851 8019693930 304
253 iso_pu_bacteria 8055742211 8055748979 304
254 iso_pu_bacteria 8056689827 8056693836 304
255 iso_pu_bacteria 8056967851 8056972022 304
256 3300039450 Ga0436363_0700194 Ga0436363_0700194_493_1416 305
257 3300005564 Ga0070664_100152168 Ga0070664_1001521681 306
258 3300037312 Ga0395899_0122972 Ga0395899_0122972_502_1443 306
259 3300037418 Ga0395900_0002114 Ga0395900_0002114_9411_10352 306
260 3300037466 Ga0395898_0064826 Ga0395898_0064826_1316_2257 306
261 3300037471 Ga0395905_0259473 Ga0395905_0259473_270_1211 306
262 3300038443 Ga0395901_0034087 Ga0395901_0034087_2157_3098 306
263 3300046455 Ga0495603_0139262 Ga0495603_0139262_423_1346 306
264 3300046461 Ga0495641_0144258 Ga0495641_0144258_82_1005 306
265 3300046690 Ga0495624_0111238 Ga0495624_0111238_738_1661 306
266 3300048907 Ga0496104_0005309 Ga0496104_0005309_8892_9815 306
267 3300048911 Ga0496108_0001861 Ga0496108_0001861_7716_8639 306
268 3300048912 Ga0496109_0001073 Ga0496109_0001073_13799_14722 306
269 3300048913 Ga0496110_0002479 Ga0496110_0002479_5568_6491 306
270 3300048914 Ga0496111_0028004 Ga0496111_0028004_2444_3367 306
271 3300048915 Ga0496112_0005807 Ga0496112_0005807_4436_5359 306
272 3300048916 Ga0496113_0000095 Ga0496113_0000095_21693_22616 306
273 3300048918 Ga0496115_0003952 Ga0496115_0003952_734_1657 306
274 3300005327 Ga0070658_10056239 Ga0070658_100562392 307
275 3300005329 Ga0070683_100658453 Ga0070683_1006584531 307
276 3300005337 Ga0070682_100316334 Ga0070682_1003163342 307
277 3300005434 Ga0070709_10002013 Ga0070709_100020137 307
278 3300005434 Ga0070709_10005865 Ga0070709_100058654 307
279 3300005435 Ga0070714_100006313 Ga0070714_1000063131 307
280 3300005435 Ga0070714_100041770 Ga0070714_1000417702 307
281 3300005436 Ga0070713_100004655 Ga0070713_1000046555 307
282 3300005437 Ga0070710_10000896 Ga0070710_100008963 307
283 3300005437 Ga0070710_10002832 Ga0070710_100028324 307
284 3300005439 Ga0070711_100007213 Ga0070711_1000072134 307
285 3300005439 Ga0070711_100008957 Ga0070711_1000089573 307
286 3300005455 Ga0070663_100036834 Ga0070663_1000368342 307
287 3300005458 Ga0070681_10146085 Ga0070681_101460852 307
288 3300005458 Ga0070681_10511038 Ga0070681_105110382 307
289 3300005563 Ga0068855_100072657 Ga0068855_1000726573 307
290 3300005983 Ga0081540_1002227 Ga0081540_10022272 307
291 3300006028 Ga0070717_10087311 Ga0070717_100873111 307
292 3300006028 Ga0070717_10429945 Ga0070717_104299452 307
293 3300006163 Ga0070715_10000456 Ga0070715_100004568 307
294 3300006173 Ga0070716_100011137 Ga0070716_1000111374 307
295 3300006175 Ga0070712_100015504 Ga0070712_1000155044 307
296 3300009101 Ga0105247_10240256 Ga0105247_102402562 307
297 3300013104 Ga0157370_10338421 Ga0157370_103384212 307
298 3300013296 Ga0157374_10634738 Ga0157374_106347382 307
299 3300021361 Ga0213872_10000429 Ga0213872_1000042916 307
300 3300021361 Ga0213872_10004083 Ga0213872_100040837 307
301 3300021361 Ga0213872_10004694 Ga0213872_100046944 307
302 3300021377 Ga0213874_10002580 Ga0213874_100025802 307
303 3300021377 Ga0213874_10002639 Ga0213874_100026393 307
304 3300021377 Ga0213874_10005128 Ga0213874_100051282 307
305 3300021384 Ga0213876_10001306 Ga0213876_100013063 307
306 3300025898 Ga0207692_10002885 Ga0207692_100028854 307
307 3300025898 Ga0207692_10005756 Ga0207692_100057565 307
308 3300025905 Ga0207685_10000267 Ga0207685_100002672 307
309 3300025906 Ga0207699_10002339 Ga0207699_100023396 307
310 3300025906 Ga0207699_10003537 Ga0207699_100035377 307
311 3300025914 Ga0207671_10139497 Ga0207671_101394972 307
312 3300025915 Ga0207693_10000326 Ga0207693_100003269 307
313 3300025915 Ga0207693_10015787 Ga0207693_100157873 307
314 3300025916 Ga0207663_10000225 Ga0207663_100002253 307
315 3300025916 Ga0207663_10009124 Ga0207663_100091244 307
316 3300025929 Ga0207664_10014435 Ga0207664_100144355 307
317 3300025929 Ga0207664_10031784 Ga0207664_100317842 307
318 3300025939 Ga0207665_10001364 Ga0207665_1000136410 307
319 3300025939 Ga0207665_10015528 Ga0207665_100155284 307
320 3300026067 Ga0207678_10054764 Ga0207678_100547642 307
321 3300030878 Ga0265770_1014959 Ga0265770_10149591 307
322 3300031018 Ga0265773_1001012 Ga0265773_10010122 307
323 3300031090 Ga0265760_10051491 Ga0265760_100514912 307
324 3300031241 Ga0265325_10012959 Ga0265325_100129593 307
325 3300031249 Ga0265339_10000016 Ga0265339_10000016134 307
326 3300031456 Ga0307513_10018286 Ga0307513_100182863 307
327 3300031595 Ga0265313_10000060 Ga0265313_100000605 307
328 3300031730 Ga0307516_10092521 Ga0307516_100925212 307
329 3300037853 Ga0436364_0240938 Ga0436364_0240938_1057_1983 307
330 3300038443 Ga0395901_0063663 Ga0395901_0063663_2472_3398 307
331 3300039437 Ga0436365_0510188 Ga0436365_0510188_4120_5046 307
332 3300039437 Ga0436365_0697045 Ga0436365_0697045_2393_3319 307
333 3300039438 Ga0436360_0545523 Ga0436360_0545523_202_1128 307
334 3300039438 Ga0436360_1060729 Ga0436360_1060729_137_1060 307
335 3300039447 Ga0436361_0200283 Ga0436361_0200283_1267_2193 307
336 3300039447 Ga0436361_0512286 Ga0436361_0512286_3073_3996 307
337 3300039447 Ga0436361_0638445 Ga0436361_0638445_3099_4022 307
338 3300039447 Ga0436361_1054672 Ga0436361_1054672_1223_2182 307
339 3300039450 Ga0436363_0627803 Ga0436363_0627803_52_978 307
340 3300039450 Ga0436363_1022276 Ga0436363_1022276_7720_8667 307
341 3300044694 Ga0466963_0209438 Ga0466963_0209438_37_969 307
342 3300044735 Ga0466968_0011964 Ga0466968_0011964_1426_2352 307
343 3300045976 Ga0466967_0063821 Ga0466967_0063821_1458_2384 307
344 3300045976 Ga0466967_0549232 Ga0466967_0549232_62_988 307
345 3300048924 Ga0496121_0032677 Ga0496121_0032677_2588_3517 307
346 3300048928 Ga0496125_0000237 Ga0496125_0000237_52106_53035 307
347 3300048928 Ga0496125_0001822 Ga0496125_0001822_14306_15235 307
348 3300049568 Ga0501031_0118857 Ga0501031_0118857_678_1607 307
349 3300049569 Ga0501032_0000358 Ga0501032_0000358_27395_28324 307
350 3300049569 Ga0501032_0086541 Ga0501032_0086541_936_1865 307
351 3300049570 Ga0501033_0000601 Ga0501033_0000601_8103_9032 307
352 3300049570 Ga0501033_0006726 Ga0501033_0006726_6359_7288 307
353 3300049571 Ga0501034_0193399 Ga0501034_0193399_282_1211 307
354 3300049572 Ga0501036_0301604 Ga0501036_0301604_77_1006 307
355 3300049573 Ga0501037_0001450 Ga0501037_0001450_6130_7059 307
356 3300049574 Ga0501038_0119167 Ga0501038_0119167_1092_2021 307
357 3300049574 Ga0501038_0177296 Ga0501038_0177296_157_1086 307
358 3300049574 Ga0501038_0275468 Ga0501038_0275468_207_1136 307
359 3300049575 Ga0501039_0156253 Ga0501039_0156253_597_1520 307
360 3300049579 Ga0501043_0000007 Ga0501043_0000007_217252_218181 307
361 3300049581 Ga0501047_0009482 Ga0501047_0009482_3418_4347 307
362 3300049581 Ga0501047_0012842 Ga0501047_0012842_4374_5303 307
363 3300049585 Ga0501069_0000001 Ga0501069_0000001_177005_177934 307
364 3300049585 Ga0501069_0133516 Ga0501069_0133516_401_1330 307
365 3300049586 Ga0501070_0000071 Ga0501070_0000071_18805_19734 307
366 3300049586 Ga0501070_0000824 Ga0501070_0000824_966_1895 307
367 3300049587 Ga0501071_0010530 Ga0501071_0010530_3958_4887 307
368 3300049589 Ga0501073_0011727 Ga0501073_0011727_5336_6265 307
369 3300049590 Ga0501074_0000003 Ga0501074_0000003_92118_93047 307
370 3300049592 Ga0501076_0332905 Ga0501076_0332905_216_1145 307
371 3300049742 Ga0501080_0000470 Ga0501080_0000470_21294_22223 307
372 3300049744 Ga0501083_0000080 Ga0501083_0000080_25035_25964 307
373 3300049744 Ga0501083_0101325 Ga0501083_0101325_563_1492 307
374 3300049822 Ga0501035_0000037 Ga0501035_0000037_121496_122425 307
375 3300049822 Ga0501035_0001584 Ga0501035_0001584_21626_22555 307
376 3300049822 Ga0501035_0002187 Ga0501035_0002187_17781_18710 307
377 3300049822 Ga0501035_0070539 Ga0501035_0070539_1327_2250 307
378 3300049822 Ga0501035_0175161 Ga0501035_0175161_751_1674 307
379 3300049823 Ga0501044_0000018 Ga0501044_0000018_102768_103697 307
380 3300049823 Ga0501044_0072305 Ga0501044_0072305_2485_3414 307
381 3300049823 Ga0501044_0085781 Ga0501044_0085781_1783_2709 307
382 3300049823 Ga0501044_0087528 Ga0501044_0087528_815_1744 307
383 3300049823 Ga0501044_0091284 Ga0501044_0091284_969_1898 307
384 3300053130 Ga0500642_0104340 Ga0500642_0104340_275_1201 307
385 3300003214 JGI25165J46597_1006767 JGI25165J46597_10067672 308
386 3300003354 JGI25160J50197_1007582 JGI25160J50197_10075823 308
387 3300004625 Ga0055543_1013756 Ga0055543_10137562 308
388 3300005262 Ga0065165_1004374 Ga0065165_10043742 308
389 3300005328 Ga0070676_10289184 Ga0070676_102891841 308
390 3300005329 Ga0070683_100001891 Ga0070683_10000189115 308
391 3300005329 Ga0070683_100019924 Ga0070683_1000199243 308
392 3300005329 Ga0070683_100072047 Ga0070683_1000720471 308
393 3300005334 Ga0068869_100001186 Ga0068869_1000011864 308
394 3300005336 Ga0070680_100016775 Ga0070680_1000167756 308
395 3300005336 Ga0070680_100312437 Ga0070680_1003124372 308
396 3300005337 Ga0070682_100056630 Ga0070682_1000566302 308
397 3300005338 Ga0068868_100002380 Ga0068868_1000023808 308
398 3300005340 Ga0070689_100090026 Ga0070689_1000900262 308
399 3300005341 Ga0070691_10186651 Ga0070691_101866511 308
400 3300005347 Ga0070668_100008952 Ga0070668_1000089528 308
401 3300005356 Ga0070674_100161557 Ga0070674_1001615572 308
402 3300005366 Ga0070659_100051334 Ga0070659_1000513342 308
403 3300005366 Ga0070659_100256937 Ga0070659_1002569372 308
404 3300005367 Ga0070667_100362682 Ga0070667_1003626821 308
405 3300005435 Ga0070714_100173398 Ga0070714_1001733982 308
406 3300005436 Ga0070713_100039500 Ga0070713_1000395004 308
407 3300005436 Ga0070713_100164699 Ga0070713_1001646992 308
408 3300005438 Ga0070701_10083906 Ga0070701_100839062 308
409 3300005439 Ga0070711_100093101 Ga0070711_1000931012 308
410 3300005455 Ga0070663_100033127 Ga0070663_1000331273 308
411 3300005457 Ga0070662_100132585 Ga0070662_1001325852 308
412 3300005458 Ga0070681_10076300 Ga0070681_100763002 308
413 3300005467 Ga0070706_100118744 Ga0070706_1001187442 308
414 3300005468 Ga0070707_100171685 Ga0070707_1001716852 308
415 3300005530 Ga0070679_100029796 Ga0070679_1000297963 308
416 3300005530 Ga0070679_100291008 Ga0070679_1002910081 308
417 3300005530 Ga0070679_100316505 Ga0070679_1003165052 308
418 3300005535 Ga0070684_100010920 Ga0070684_1000109206 308
419 3300005535 Ga0070684_100052866 Ga0070684_1000528664 308
420 3300005536 Ga0070697_100093961 Ga0070697_1000939612 308
421 3300005539 Ga0068853_100035551 Ga0068853_1000355513 308
422 3300005539 Ga0068853_100169342 Ga0068853_1001693422 308
423 3300005544 Ga0070686_100053425 Ga0070686_1000534253 308
424 3300005548 Ga0070665_100012340 Ga0070665_1000123408 308
425 3300005548 Ga0070665_100035823 Ga0070665_1000358234 308
426 3300005563 Ga0068855_100040104 Ga0068855_1000401045 308
427 3300005563 Ga0068855_100077687 Ga0068855_1000776873 308
428 3300005563 Ga0068855_100097896 Ga0068855_1000978963 308
429 3300005563 Ga0068855_100328828 Ga0068855_1003288282 308
430 3300005563 Ga0068855_100342315 Ga0068855_1003423151 308
431 3300005563 Ga0068855_100425519 Ga0068855_1004255192 308
432 3300005564 Ga0070664_100026724 Ga0070664_1000267243 308
433 3300005564 Ga0070664_100410739 Ga0070664_1004107392 308
434 3300005577 Ga0068857_100017610 Ga0068857_1000176103 308
435 3300005577 Ga0068857_100028282 Ga0068857_1000282821 308
436 3300005578 Ga0068854_100097839 Ga0068854_1000978393 308
437 3300005614 Ga0068856_100000183 Ga0068856_10000018334 308
438 3300005614 Ga0068856_100029563 Ga0068856_1000295636 308
439 3300005614 Ga0068856_100063430 Ga0068856_1000634302 308
440 3300005616 Ga0068852_100053488 Ga0068852_1000534883 308
441 3300005616 Ga0068852_100230989 Ga0068852_1002309891 308
442 3300005617 Ga0068859_100063595 Ga0068859_1000635952 308
443 3300005618 Ga0068864_100049226 Ga0068864_1000492263 308
444 3300005618 Ga0068864_100122039 Ga0068864_1001220392 308
445 3300005719 Ga0068861_100042059 Ga0068861_1000420593 308
446 3300005840 Ga0068870_10004287 Ga0068870_100042872 308
447 3300005841 Ga0068863_100027853 Ga0068863_1000278534 308
448 3300005842 Ga0068858_100041385 Ga0068858_1000413852 308
449 3300005842 Ga0068858_100589553 Ga0068858_1005895532 308
450 3300005843 Ga0068860_100093295 Ga0068860_1000932952 308
451 3300005983 Ga0081540_1005198 Ga0081540_10051985 308
452 3300005983 Ga0081540_1006571 Ga0081540_10065716 308
453 3300005983 Ga0081540_1006785 Ga0081540_10067854 308
454 3300005983 Ga0081540_1018573 Ga0081540_10185733 308
455 3300006038 Ga0075365_10059561 Ga0075365_100595612 308
456 3300006042 Ga0075368_10019062 Ga0075368_100190622 308
457 3300006048 Ga0075363_100010158 Ga0075363_1000101583 308
458 3300006048 Ga0075363_100048514 Ga0075363_1000485142 308
459 3300006051 Ga0075364_10024619 Ga0075364_100246192 308
460 3300006051 Ga0075364_10295801 Ga0075364_102958012 308
461 3300006173 Ga0070716_100023798 Ga0070716_1000237982 308
462 3300006178 Ga0075367_10001130 Ga0075367_100011307 308
463 3300006186 Ga0075369_10005353 Ga0075369_100053533 308
464 3300006195 Ga0075366_10016316 Ga0075366_100163162 308
465 3300006353 Ga0075370_10009564 Ga0075370_100095643 308
466 3300006353 Ga0075370_10017687 Ga0075370_100176872 308
467 3300006881 Ga0068865_100055253 Ga0068865_1000552533 308
468 3300006914 Ga0075436_100088588 Ga0075436_1000885882 308
469 3300006931 Ga0097620_100063592 Ga0097620_1000635923 308
470 3300006942 Ga0099824_1021709 Ga0099824_10217094 308
471 3300006942 Ga0099824_1033210 Ga0099824_10332102 308
472 3300006943 Ga0099822_1024226 Ga0099822_10242263 308
473 3300009093 Ga0105240_10039694 Ga0105240_100396942 308
474 3300009093 Ga0105240_10109427 Ga0105240_101094274 308
475 3300009093 Ga0105240_10135701 Ga0105240_101357012 308
476 3300009094 Ga0111539_10714684 Ga0111539_107146841 308
477 3300009098 Ga0105245_10005441 Ga0105245_100054416 308
478 3300009098 Ga0105245_10038994 Ga0105245_100389943 308
479 3300009101 Ga0105247_10005785 Ga0105247_100057853 308
480 3300009148 Ga0105243_10042185 Ga0105243_100421853 308
481 3300009174 Ga0105241_10037493 Ga0105241_100374932 308
482 3300009174 Ga0105241_10211105 Ga0105241_102111052 308
483 3300009177 Ga0105248_10646336 Ga0105248_106463362 308
484 3300009545 Ga0105237_10017339 Ga0105237_100173395 308
485 3300009545 Ga0105237_10095319 Ga0105237_100953192 308
486 3300009545 Ga0105237_10138567 Ga0105237_101385672 308
487 3300009545 Ga0105237_10298145 Ga0105237_102981452 308
488 3300010159 Ga0099796_10010555 Ga0099796_100105552 308
489 3300010375 Ga0105239_10003963 Ga0105239_1000396311 308
490 3300010375 Ga0105239_10109809 Ga0105239_101098093 308
491 3300011119 Ga0105246_10379968 Ga0105246_103799681 308
492 3300013104 Ga0157370_10097584 Ga0157370_100975842 308
493 3300013104 Ga0157370_10357736 Ga0157370_103577362 308
494 3300013105 Ga0157369_10012373 Ga0157369_100123739 308
495 3300013105 Ga0157369_10026071 Ga0157369_100260713 308
496 3300013105 Ga0157369_10083698 Ga0157369_100836982 308
497 3300013306 Ga0163162_10025402 Ga0163162_100254024 308
498 3300013306 Ga0163162_10146465 Ga0163162_101464651 308
499 3300013307 Ga0157372_10034737 Ga0157372_100347375 308
500 3300013307 Ga0157372_10048052 Ga0157372_100480524 308
501 3300013308 Ga0157375_10011636 Ga0157375_100116362 308
502 3300014325 Ga0163163_10007610 Ga0163163_100076103 308
503 3300014325 Ga0163163_10073797 Ga0163163_100737973 308
504 3300014969 Ga0157376_10153431 Ga0157376_101534312 308
505 3300021384 Ga0213876_10134690 Ga0213876_101346902 308
506 3300021388 Ga0213875_10077961 Ga0213875_100779612 308
507 3300021441 Ga0213871_10068475 Ga0213871_100684751 308
508 3300025253 Ga0209677_100749 Ga0209677_1007492 308
509 3300025254 Ga0209148_1000773 Ga0209148_10007734 308
510 3300025261 Ga0209233_1003148 Ga0209233_10031484 308
511 3300025261 Ga0209233_1004858 Ga0209233_10048582 308
512 3300025261 Ga0209233_1005292 Ga0209233_10052923 308
513 3300025261 Ga0209233_1005946 Ga0209233_10059463 308
514 3300025272 Ga0209455_1001728 Ga0209455_10017288 308
515 3300025272 Ga0209455_1008216 Ga0209455_10082163 308
516 3300025295 Ga0209564_1003916 Ga0209564_10039164 308
517 3300025297 Ga0209758_1000282 Ga0209758_100028274 308
518 3300025297 Ga0209758_1004003 Ga0209758_10040034 308
519 3300025297 Ga0209758_1027779 Ga0209758_10277792 308
520 3300025302 Ga0207426_1000437 Ga0207426_100043762 308
521 3300025302 Ga0207426_1001098 Ga0207426_100109819 308
522 3300025302 Ga0207426_1012310 Ga0207426_10123103 308
523 3300025898 Ga0207692_10009200 Ga0207692_100092002 308
524 3300025900 Ga0207710_10018346 Ga0207710_100183462 308
525 3300025901 Ga0207688_10019965 Ga0207688_100199652 308
526 3300025908 Ga0207643_10025498 Ga0207643_100254983 308
527 3300025909 Ga0207705_10082672 Ga0207705_100826722 308
528 3300025911 Ga0207654_10021751 Ga0207654_100217513 308
529 3300025911 Ga0207654_10029110 Ga0207654_100291102 308
530 3300025913 Ga0207695_10000062 Ga0207695_1000006296 308
531 3300025913 Ga0207695_10019960 Ga0207695_100199607 308
532 3300025913 Ga0207695_10078563 Ga0207695_100785632 308
533 3300025913 Ga0207695_10251375 Ga0207695_102513752 308
534 3300025914 Ga0207671_10008251 Ga0207671_100082517 308
535 3300025914 Ga0207671_10051920 Ga0207671_100519202 308
536 3300025914 Ga0207671_10092336 Ga0207671_100923362 308
537 3300025914 Ga0207671_10223517 Ga0207671_102235172 308
538 3300025915 Ga0207693_10003223 Ga0207693_1000322313 308
539 3300025916 Ga0207663_10096713 Ga0207663_100967132 308
540 3300025916 Ga0207663_10116539 Ga0207663_101165392 308
541 3300025919 Ga0207657_10004806 Ga0207657_1000480610 308
542 3300025920 Ga0207649_10102875 Ga0207649_101028752 308
543 3300025921 Ga0207652_10013842 Ga0207652_100138423 308
544 3300025921 Ga0207652_10023687 Ga0207652_100236873 308
545 3300025921 Ga0207652_10525394 Ga0207652_105253941 308
546 3300025924 Ga0207694_10525114 Ga0207694_105251141 308
547 3300025929 Ga0207664_10109709 Ga0207664_101097092 308
548 3300025931 Ga0207644_10016717 Ga0207644_100167173 308
549 3300025932 Ga0207690_10025298 Ga0207690_100252982 308
550 3300025933 Ga0207706_10199961 Ga0207706_101999611 308
551 3300025935 Ga0207709_10203375 Ga0207709_102033752 308
552 3300025938 Ga0207704_10048142 Ga0207704_100481422 308
553 3300025939 Ga0207665_10036269 Ga0207665_100362692 308
554 3300025941 Ga0207711_10054778 Ga0207711_100547783 308
555 3300025942 Ga0207689_10014080 Ga0207689_100140804 308
556 3300025944 Ga0207661_10001182 Ga0207661_1000118212 308
557 3300025944 Ga0207661_10203221 Ga0207661_102032212 308
558 3300025945 Ga0207679_10363881 Ga0207679_103638812 308
559 3300025945 Ga0207679_10489006 Ga0207679_104890061 308
560 3300025961 Ga0207712_10125479 Ga0207712_101254792 308
561 3300025972 Ga0207668_10004125 Ga0207668_100041254 308
562 3300025986 Ga0207658_10093472 Ga0207658_100934722 308
563 3300026023 Ga0207677_10038130 Ga0207677_100381302 308
564 3300026041 Ga0207639_10010102 Ga0207639_100101025 308
565 3300026041 Ga0207639_10196860 Ga0207639_101968602 308
566 3300026041 Ga0207639_10311422 Ga0207639_103114222 308
567 3300026067 Ga0207678_10014454 Ga0207678_100144543 308
568 3300026067 Ga0207678_10021795 Ga0207678_100217954 308
569 3300026067 Ga0207678_10023002 Ga0207678_100230022 308
570 3300026078 Ga0207702_10000197 Ga0207702_1000019766 308
571 3300026078 Ga0207702_10018501 Ga0207702_100185012 308
572 3300026088 Ga0207641_10238720 Ga0207641_102387202 308
573 3300026089 Ga0207648_10219239 Ga0207648_102192392 308
574 3300026095 Ga0207676_10106108 Ga0207676_101061082 308
575 3300026116 Ga0207674_10464147 Ga0207674_104641472 308
576 3300026118 Ga0207675_100041364 Ga0207675_1000413643 308
577 3300026121 Ga0207683_10011087 Ga0207683_100110873 308
578 3300026142 Ga0207698_10105090 Ga0207698_101050902 308
579 3300026142 Ga0207698_10200930 Ga0207698_102009302 308
580 3300026142 Ga0207698_10314938 Ga0207698_103149382 308
581 3300027296 Ga0209389_1000004 Ga0209389_1000004145 308
582 3300027357 Ga0209589_1000014 Ga0209589_100001461 308
583 3300027361 Ga0209489_100014 Ga0209489_10001461 308
584 3300027361 Ga0209489_100777 Ga0209489_1007779 308
585 3300027363 Ga0209700_100013 Ga0209700_100013231 308
586 3300027363 Ga0209700_100024 Ga0209700_10002461 308
587 3300027866 Ga0209813_10002203 Ga0209813_100022033 308
588 3300028379 Ga0268266_10001413 Ga0268266_1000141316 308
589 3300028379 Ga0268266_10087585 Ga0268266_100875852 308
590 3300028381 Ga0268264_10062341 Ga0268264_100623413 308
591 3300028573 Ga0265334_10054565 Ga0265334_100545652 308
592 3300031235 Ga0265330_10035799 Ga0265330_100357991 308
593 3300031247 Ga0265340_10011608 Ga0265340_100116082 308
594 3300031249 Ga0265339_10006455 Ga0265339_100064553 308
595 3300031249 Ga0265339_10016353 Ga0265339_100163532 308
596 3300031249 Ga0265339_10110791 Ga0265339_101107912 308
597 3300031344 Ga0265316_10387288 Ga0265316_103872881 308
598 3300031711 Ga0265314_10016312 Ga0265314_100163123 308
599 3300031711 Ga0265314_10069850 Ga0265314_100698502 308
600 3300031712 Ga0265342_10010600 Ga0265342_100106003 308
601 3300033180 Ga0307510_10019799 Ga0307510_100197998 308
602 3300033442 Ga0315911_1000002 Ga0315911_1000002279 308
603 3300033544 Ga0316215_1001104 Ga0316215_10011042 308
604 3300035086 Ga0373934_0002405 Ga0373934_0002405_2616_3548 308
605 3300035111 Ga0373923_0022547 Ga0373923_0022547_606_1538 308
606 3300035113 Ga0373936_0018479 Ga0373936_0018479_771_1697 308
607 3300035117 Ga0373953_0000409 Ga0373953_0000409_10640_11572 308
608 3300035117 Ga0373953_0009941 Ga0373953_0009941_382_1308 308
609 3300035118 Ga0373954_0002776 Ga0373954_0002776_5306_6238 308
610 3300035118 Ga0373954_0029995 Ga0373954_0029995_82_1008 308
611 3300035119 Ga0373956_0004736 Ga0373956_0004736_213_1145 308
612 3300035119 Ga0373956_0005250 Ga0373956_0005250_4070_4996 308
613 3300035120 Ga0373957_0014177 Ga0373957_0014177_754_1680 308
614 3300035172 Ga0373955_0002711 Ga0373955_0002711_4514_5440 308
615 3300035172 Ga0373955_0003550 Ga0373955_0003550_1482_2414 308
616 3300035410 Ga0373924_0006225 Ga0373924_0006225_894_1820 308
617 3300035695 Ga0373927_0004054 Ga0373927_0004054_1742_2674 308
618 3300035724 Ga0373933_0002107 Ga0373933_0002107_6148_7080 308
619 3300036401 Ga0373937_0008396 Ga0373937_0008396_1138_2070 308
620 3300036401 Ga0373937_0021312 Ga0373937_0021312_2846_3772 308
621 3300036459 Ga0372808_001074 Ga0372808_001074_774_1706 308
622 3300037068 Ga0373925_0024876 Ga0373925_0024876_2323_3255 308
623 3300037418 Ga0395900_0000660 Ga0395900_0000660_16876_17802 308
624 3300037418 Ga0395900_0008707 Ga0395900_0008707_5305_6231 308
625 3300037418 Ga0395900_0199262 Ga0395900_0199262_1014_1940 308
626 3300037466 Ga0395898_0003200 Ga0395898_0003200_16708_17634 308
627 3300037466 Ga0395898_0006500 Ga0395898_0006500_3815_4741 308
628 3300037466 Ga0395898_0007107 Ga0395898_0007107_7878_8804 308
629 3300037471 Ga0395905_0021700 Ga0395905_0021700_884_1810 308
630 3300037853 Ga0436364_0102033 Ga0436364_0102033_248_1174 308
631 3300037853 Ga0436364_0425317 Ga0436364_0425317_146_1078 308
632 3300038443 Ga0395901_0101488 Ga0395901_0101488_1132_2058 308
633 3300038443 Ga0395901_0437117 Ga0395901_0437117_35_961 308
634 3300038443 Ga0395901_0515459 Ga0395901_0515459_221_1147 308
635 3300039437 Ga0436365_0159409 Ga0436365_0159409_136_1068 308
636 3300039437 Ga0436365_0459588 Ga0436365_0459588_53_979 308
637 3300039437 Ga0436365_1047663 Ga0436365_1047663_1671_2597 308
638 3300039447 Ga0436361_1159707 Ga0436361_1159707_520_1446 308
639 3300039450 Ga0436363_0274569 Ga0436363_0274569_135_1061 308
640 3300039450 Ga0436363_0761127 Ga0436363_0761127_541_1467 308
641 3300039453 Ga0436362_0842308 Ga0436362_0842308_29_955 308
642 3300044656 Ga0466969_0100925 Ga0466969_0100925_118_1044 308
643 3300044658 Ga0466972_0000079 Ga0466972_0000079_4425_5351 308
644 3300044658 Ga0466972_0004644 Ga0466972_0004644_4577_5503 308
645 3300044684 Ga0466966_0001208 Ga0466966_0001208_7679_8605 308
646 3300044693 Ga0466961_0000020 Ga0466961_0000020_6920_7846 308
647 3300044693 Ga0466961_0039468 Ga0466961_0039468_1585_2511 308
648 3300044694 Ga0466963_0031974 Ga0466963_0031974_478_1404 308
649 3300044719 Ga0466971_0051755 Ga0466971_0051755_360_1286 308
650 3300044765 Ga0466970_0087989 Ga0466970_0087989_609_1535 308
651 3300044842 Ga0466957_0041896 Ga0466957_0041896_49_975 308
652 3300044901 Ga0466960_0000424 Ga0466960_0000424_5049_5975 308
653 3300045049 Ga0466959_0004294 Ga0466959_0004294_1149_2075 308
654 3300046454 Ga0495592_0003202 Ga0495592_0003202_4453_5385 308
655 3300046454 Ga0495592_0036190 Ga0495592_0036190_1352_2278 308
656 3300046459 Ga0495629_0001830 Ga0495629_0001830_9698_10630 308
657 3300046459 Ga0495629_0006153 Ga0495629_0006153_595_1521 308
658 3300046459 Ga0495629_0107512 Ga0495629_0107512_726_1652 308
659 3300046462 Ga0495651_0002500 Ga0495651_0002500_10413_11339 308
660 3300046462 Ga0495651_0041294 Ga0495651_0041294_2557_3489 308
661 3300046462 Ga0495651_0041839 Ga0495651_0041839_588_1514 308
662 3300046462 Ga0495651_0140950 Ga0495651_0140950_336_1262 308
663 3300046463 Ga0495653_0001471 Ga0495653_0001471_13804_14736 308
664 3300046463 Ga0495653_0050752 Ga0495653_0050752_1017_1943 308
665 3300046463 Ga0495653_0159296 Ga0495653_0159296_541_1467 308
666 3300046473 Ga0495582_0214523 Ga0495582_0214523_52_984 308
667 3300046475 Ga0495639_0114838 Ga0495639_0114838_55_981 308
668 3300046476 Ga0495662_0108284 Ga0495662_0108284_154_1080 308
669 3300046477 Ga0495664_0007676 Ga0495664_0007676_2208_3134 308
670 3300046477 Ga0495664_0007911 Ga0495664_0007911_4348_5274 308
671 3300046477 Ga0495664_0087653 Ga0495664_0087653_147_1079 308
672 3300046500 Ga0495596_0068738 Ga0495596_0068738_267_1193 308
673 3300046507 Ga0495606_0005210 Ga0495606_0005210_2620_3546 308
674 3300046511 Ga0495608_0002191 Ga0495608_0002191_6034_6966 308
675 3300046511 Ga0495608_0036131 Ga0495608_0036131_1172_2098 308
676 3300046511 Ga0495608_0060094 Ga0495608_0060094_1510_2436 308
677 3300046514 Ga0495618_0079959 Ga0495618_0079959_596_1522 308
678 3300046514 Ga0495618_0279140 Ga0495618_0279140_50_982 308
679 3300046515 Ga0495620_0060077 Ga0495620_0060077_544_1470 308
680 3300046516 Ga0495628_0030883 Ga0495628_0030883_2731_3663 308
681 3300046516 Ga0495628_0033600 Ga0495628_0033600_856_1782 308
682 3300046516 Ga0495628_0064783 Ga0495628_0064783_875_1801 308
683 3300046517 Ga0495630_0022407 Ga0495630_0022407_930_1856 308
684 3300046524 Ga0495648_0003767 Ga0495648_0003767_11523_12455 308
685 3300046524 Ga0495648_0007614 Ga0495648_0007614_1038_1964 308
686 3300046529 Ga0495652_0006321 Ga0495652_0006321_3656_4588 308
687 3300046529 Ga0495652_0031923 Ga0495652_0031923_1639_2565 308
688 3300046533 Ga0495640_0002348 Ga0495640_0002348_5352_6284 308
689 3300046533 Ga0495640_0026198 Ga0495640_0026198_2082_3008 308
690 3300046535 Ga0495586_0022337 Ga0495586_0022337_405_1331 308
691 3300046536 Ga0495587_0004728 Ga0495587_0004728_1792_2718 308
692 3300046536 Ga0495587_0015523 Ga0495587_0015523_2685_3617 308
693 3300046536 Ga0495587_0027948 Ga0495587_0027948_2045_2971 308
694 3300046543 Ga0495645_0014837 Ga0495645_0014837_1419_2351 308
695 3300046543 Ga0495645_0040372 Ga0495645_0040372_792_1724 308
696 3300046543 Ga0495645_0221128 Ga0495645_0221128_290_1216 308
697 3300046559 Ga0495667_0002963 Ga0495667_0002963_3629_4561 308
698 3300046559 Ga0495667_0013368 Ga0495667_0013368_2640_3566 308
699 3300046559 Ga0495667_0016179 Ga0495667_0016179_3057_3983 308
700 3300046642 Ga0495634_0089901 Ga0495634_0089901_845_1771 308
701 3300046642 Ga0495634_0197772 Ga0495634_0197772_258_1184 308
702 3300046660 Ga0495625_0039696 Ga0495625_0039696_2290_3216 308
703 3300046663 Ga0495635_0000636 Ga0495635_0000636_14713_15645 308
704 3300046663 Ga0495635_0002205 Ga0495635_0002205_11148_12074 308
705 3300046675 Ga0495657_0002552 Ga0495657_0002552_3390_4316 308
706 3300046675 Ga0495657_0014012 Ga0495657_0014012_2401_3333 308
707 3300046678 Ga0495599_0001077 Ga0495599_0001077_7045_7977 308
708 3300046678 Ga0495599_0010332 Ga0495599_0010332_2800_3726 308
709 3300046678 Ga0495599_0060861 Ga0495599_0060861_903_1829 308
710 3300046679 Ga0495623_0004268 Ga0495623_0004268_3757_4689 308
711 3300046679 Ga0495623_0006526 Ga0495623_0006526_5076_6002 308
712 3300046679 Ga0495623_0048527 Ga0495623_0048527_595_1521 308
713 3300046689 Ga0495613_0033951 Ga0495613_0033951_2070_3002 308
714 3300046689 Ga0495613_0120524 Ga0495613_0120524_44_970 308
715 3300046690 Ga0495624_0058576 Ga0495624_0058576_1064_1990 308
716 3300046690 Ga0495624_0091302 Ga0495624_0091302_847_1773 308
717 3300046809 Ga0495600_0000873 Ga0495600_0000873_12569_13495 308
718 3300046809 Ga0495600_0001010 Ga0495600_0001010_9079_10011 308
719 3300047317 Ga0495604_0008420 Ga0495604_0008420_7138_8070 308
720 3300047317 Ga0495604_0038621 Ga0495604_0038621_2458_3384 308
721 3300047317 Ga0495604_0052467 Ga0495604_0052467_945_1871 308
722 3300047317 Ga0495604_0063576 Ga0495604_0063576_1421_2347 308
723 3300047319 Ga0495674_0028066 Ga0495674_0028066_1717_2643 308
724 3300047319 Ga0495674_0065255 Ga0495674_0065255_411_1337 308
725 3300047319 Ga0495674_0242918 Ga0495674_0242918_156_1088 308
726 3300047321 Ga0495676_0103736 Ga0495676_0103736_303_1229 308
727 3300047322 Ga0495680_0001037 Ga0495680_0001037_25271_26197 308
728 3300047322 Ga0495680_0001883 Ga0495680_0001883_3757_4689 308
729 3300047322 Ga0495680_0043083 Ga0495680_0043083_2410_3336 308
730 3300047444 Ga0495675_0001800 Ga0495675_0001800_2391_3323 308
731 3300047444 Ga0495675_0037092 Ga0495675_0037092_1990_2916 308
732 3300047471 Ga0495684_0000666 Ga0495684_0000666_17622_18554 308
733 3300047471 Ga0495684_0036531 Ga0495684_0036531_2276_3202 308
734 3300047471 Ga0495684_0096515 Ga0495684_0096515_1241_2167 308
735 3300047472 Ga0495686_0107093 Ga0495686_0107093_435_1361 308
736 3300047673 Ga0495593_0008032 Ga0495593_0008032_2929_3861 308
737 3300048088 Ga0495602_0004340 Ga0495602_0004340_1124_2050 308
738 3300048088 Ga0495602_0012996 Ga0495602_0012996_7138_8070 308
739 3300048088 Ga0495602_0196647 Ga0495602_0196647_551_1477 308
740 3300048088 Ga0495602_0201081 Ga0495602_0201081_176_1102 308
741 3300048907 Ga0496104_0001245 Ga0496104_0001245_12445_13371 308
742 3300048907 Ga0496104_0082198 Ga0496104_0082198_1913_2839 308
743 3300048908 Ga0496105_0003657 Ga0496105_0003657_4484_5410 308
744 3300048908 Ga0496105_0093356 Ga0496105_0093356_857_1783 308
745 3300048909 Ga0496106_0013957 Ga0496106_0013957_2688_3614 308
746 3300048910 Ga0496107_0130771 Ga0496107_0130771_679_1605 308
747 3300048911 Ga0496108_0218656 Ga0496108_0218656_505_1431 308
748 3300048912 Ga0496109_0155295 Ga0496109_0155295_10_936 308
749 3300048914 Ga0496111_0061970 Ga0496111_0061970_244_1170 308
750 3300048914 Ga0496111_0215505 Ga0496111_0215505_44_970 308
751 3300048915 Ga0496112_0002061 Ga0496112_0002061_2750_3676 308
752 3300048915 Ga0496112_0008838 Ga0496112_0008838_235_1161 308
753 3300048915 Ga0496112_0107427 Ga0496112_0107427_283_1215 308
754 3300048915 Ga0496112_0119654 Ga0496112_0119654_320_1246 308
755 3300048915 Ga0496112_0223868 Ga0496112_0223868_623_1549 308
756 3300048915 Ga0496112_0440495 Ga0496112_0440495_127_1053 308
757 3300048916 Ga0496113_0156636 Ga0496113_0156636_198_1124 308
758 3300048917 Ga0496114_0200299 Ga0496114_0200299_519_1445 308
759 3300048918 Ga0496115_0314357 Ga0496115_0314357_64_990 308
760 3300048919 Ga0496116_0140996 Ga0496116_0140996_55_981 308
761 3300048921 Ga0496118_0016456 Ga0496118_0016456_78_1004 308
762 3300048921 Ga0496118_0130626 Ga0496118_0130626_45_971 308
763 3300048922 Ga0496119_0003004 Ga0496119_0003004_1067_1993 308
764 3300048922 Ga0496119_0080481 Ga0496119_0080481_788_1714 308
765 3300048924 Ga0496121_0008659 Ga0496121_0008659_1448_2374 308
766 3300048924 Ga0496121_0021131 Ga0496121_0021131_4087_5013 308
767 3300048924 Ga0496121_0066895 Ga0496121_0066895_1961_2887 308
768 3300048924 Ga0496121_0103413 Ga0496121_0103413_1251_2177 308
769 3300048929 Ga0496126_0011267 Ga0496126_0011267_1874_2800 308
770 3300048929 Ga0496126_0158354 Ga0496126_0158354_961_1887 308
771 3300048929 Ga0496126_0174038 Ga0496126_0174038_539_1465 308
772 3300049568 Ga0501031_0001197 Ga0501031_0001197_485_1411 308
773 3300049568 Ga0501031_0003032 Ga0501031_0003032_6106_7032 308
774 3300049569 Ga0501032_0000696 Ga0501032_0000696_11750_12676 308
775 3300049569 Ga0501032_0036140 Ga0501032_0036140_998_1924 308
776 3300049570 Ga0501033_0000232 Ga0501033_0000232_26455_27381 308
777 3300049570 Ga0501033_0001532 Ga0501033_0001532_11350_12276 308
778 3300049571 Ga0501034_0000039 Ga0501034_0000039_163846_164772 308
779 3300049571 Ga0501034_0000704 Ga0501034_0000704_22346_23272 308
780 3300049572 Ga0501036_0000007 Ga0501036_0000007_205042_205968 308
781 3300049572 Ga0501036_0000052 Ga0501036_0000052_21370_22296 308
782 3300049573 Ga0501037_0000025 Ga0501037_0000025_66415_67341 308
783 3300049573 Ga0501037_0020087 Ga0501037_0020087_2691_3617 308
784 3300049573 Ga0501037_0149374 Ga0501037_0149374_385_1311 308
785 3300049574 Ga0501038_0000026 Ga0501038_0000026_65337_66263 308
786 3300049574 Ga0501038_0000168 Ga0501038_0000168_892_1818 308
787 3300049575 Ga0501039_0000005 Ga0501039_0000005_46223_47149 308
788 3300049575 Ga0501039_0003632 Ga0501039_0003632_417_1343 308
789 3300049578 Ga0501042_0118124 Ga0501042_0118124_750_1676 308
790 3300049579 Ga0501043_0000036 Ga0501043_0000036_109220_110146 308
791 3300049579 Ga0501043_0002042 Ga0501043_0002042_7973_8899 308
792 3300049579 Ga0501043_0133440 Ga0501043_0133440_591_1526 308
793 3300049580 Ga0501046_0000147 Ga0501046_0000147_29676_30602 308
794 3300049580 Ga0501046_0000231 Ga0501046_0000231_17191_18117 308
795 3300049580 Ga0501046_0070614 Ga0501046_0070614_877_1803 308
796 3300049580 Ga0501046_0171712 Ga0501046_0171712_512_1438 308
797 3300049581 Ga0501047_0000209 Ga0501047_0000209_4953_5879 308
798 3300049581 Ga0501047_0000457 Ga0501047_0000457_43930_44856 308
799 3300049581 Ga0501047_0071155 Ga0501047_0071155_1945_2877 308
800 3300049581 Ga0501047_0102930 Ga0501047_0102930_425_1351 308
801 3300049581 Ga0501047_0223123 Ga0501047_0223123_281_1207 308
802 3300049582 Ga0501048_0000585 Ga0501048_0000585_3583_4509 308
803 3300049582 Ga0501048_0020451 Ga0501048_0020451_3691_4617 308
804 3300049583 Ga0501067_0000025 Ga0501067_0000025_71299_72225 308
805 3300049583 Ga0501067_0063143 Ga0501067_0063143_502_1428 308
806 3300049583 Ga0501067_0087364 Ga0501067_0087364_777_1703 308
807 3300049584 Ga0501068_0002387 Ga0501068_0002387_3741_4667 308
808 3300049584 Ga0501068_0004030 Ga0501068_0004030_998_1924 308
809 3300049586 Ga0501070_0001839 Ga0501070_0001839_17301_18227 308
810 3300049586 Ga0501070_0024940 Ga0501070_0024940_2533_3465 308
811 3300049586 Ga0501070_0178591 Ga0501070_0178591_541_1467 308
812 3300049586 Ga0501070_0178612 Ga0501070_0178612_541_1467 308
813 3300049587 Ga0501071_0022185 Ga0501071_0022185_583_1509 308
814 3300049588 Ga0501072_0003385 Ga0501072_0003385_10948_11874 308
815 3300049588 Ga0501072_0051510 Ga0501072_0051510_553_1479 308
816 3300049589 Ga0501073_0000135 Ga0501073_0000135_27648_28574 308
817 3300049589 Ga0501073_0013905 Ga0501073_0013905_3613_4539 308
818 3300049589 Ga0501073_0032984 Ga0501073_0032984_2574_3500 308
819 3300049590 Ga0501074_0000443 Ga0501074_0000443_6954_7880 308
820 3300049590 Ga0501074_0019268 Ga0501074_0019268_215_1141 308
821 3300049590 Ga0501074_0023253 Ga0501074_0023253_2255_3181 308
822 3300049741 Ga0501079_0003407 Ga0501079_0003407_2834_3760 308
823 3300049742 Ga0501080_0000382 Ga0501080_0000382_29526_30452 308
824 3300049742 Ga0501080_0000669 Ga0501080_0000669_7375_8301 308
825 3300049742 Ga0501080_0005657 Ga0501080_0005657_7884_8810 308
826 3300049743 Ga0501081_0326335 Ga0501081_0326335_49_975 308
827 3300049744 Ga0501083_0003054 Ga0501083_0003054_6748_7674 308
828 3300049822 Ga0501035_0000052 Ga0501035_0000052_35872_36798 308
829 3300049822 Ga0501035_0001237 Ga0501035_0001237_24811_25737 308
830 3300049823 Ga0501044_0000217 Ga0501044_0000217_19817_20743 308
831 3300049823 Ga0501044_0000366 Ga0501044_0000366_29172_30098 308
832 3300049823 Ga0501044_0046984 Ga0501044_0046984_1080_2006 308
833 3300049823 Ga0501044_0147382 Ga0501044_0147382_843_1769 308
834 3300050490 nmdc:mga03n38_14660_c1 nmdc:mga03n38_14660_c1_1791_2717 308
835 3300050490 nmdc:mga03n38_224_c1 nmdc:mga03n38_224_c1_3139_4065 308
836 3300050491 nmdc:mga00v17_205002_c1 nmdc:mga00v17_205002_c1_312_1238 308
837 3300050491 nmdc:mga00v17_9386_c1 nmdc:mga00v17_9386_c1_4061_4987 308
838 3300050492 nmdc:mga0yw44_52563_c1 nmdc:mga0yw44_52563_c1_175_1101 308
839 3300050492 nmdc:mga0yw44_72837_c1 nmdc:mga0yw44_72837_c1_588_1514 308
840 3300050493 nmdc:mga0k408_5979_c1 nmdc:mga0k408_5979_c1_3265_4191 308
841 3300050495 nmdc:mga04h51_6775_c1 nmdc:mga04h51_6775_c1_2042_2968 308
842 3300050496 nmdc:mga07m45_6074_c1 nmdc:mga07m45_6074_c1_4280_5206 308
843 3300050512 nmdc:mga0n895_64214_c1 nmdc:mga0n895_64214_c1_951_1877 308
844 3300050514 nmdc:mga08x19_79614_c1 nmdc:mga08x19_79614_c1_1080_2006 308
845 3300050516 nmdc:mga0sz30_55309_c1 nmdc:mga0sz30_55309_c1_276_1202 308
846 3300050516 nmdc:mga0sz30_9528_c1 nmdc:mga0sz30_9528_c1_2677_3603 308
847 3300053077 Ga0495601_0014819 Ga0495601_0014819_3655_4587 308
848 3300053077 Ga0495601_0041332 Ga0495601_0041332_1336_2262 308
849 3300053077 Ga0495601_0185195 Ga0495601_0185195_88_1020 308
850 3300053077 Ga0495601_0239203 Ga0495601_0239203_156_1088 308
851 3300053078 Ga0495612_0013454 Ga0495612_0013454_266_1192 308
852 3300053083 Ga0495655_0009206 Ga0495655_0009206_777_1703 308
853 3300053083 Ga0495655_0056796 Ga0495655_0056796_33_965 308
854 3300053084 Ga0495595_0003095 Ga0495595_0003095_3756_4688 308
855 3300053084 Ga0495595_0016247 Ga0495595_0016247_1529_2455 308
856 3300053085 Ga0495619_0004543 Ga0495619_0004543_4174_5106 308
857 3300053085 Ga0495619_0030322 Ga0495619_0030322_2083_3009 308
858 3300053086 Ga0500578_0068194 Ga0500578_0068194_816_1742 308
859 3300053086 Ga0500578_0107327 Ga0500578_0107327_103_1029 308
860 3300053091 Ga0500647_0033209 Ga0500647_0033209_569_1501 308
861 3300053093 Ga0500651_0000526 Ga0500651_0000526_17290_18216 308
862 3300053094 Ga0500566_0000097 Ga0500566_0000097_41571_42503 308
863 3300053095 Ga0500640_014937 Ga0500640_014937_2080_3012 308
864 3300053105 Ga0500557_000008 Ga0500557_000008_40740_41666 308
865 3300053111 Ga0500572_000853 Ga0500572_000853_2743_3675 308
866 3300053119 Ga0500595_006403 Ga0500595_006403_3009_3935 308
867 3300053120 Ga0500597_043245 Ga0500597_043245_609_1535 308
868 3300053121 Ga0500607_075728 Ga0500607_075728_100_1026 308
869 3300053123 Ga0500614_014025 Ga0500614_014025_68_1000 308
870 3300053130 Ga0500642_0000067 Ga0500642_0000067_3653_4579 308
871 3300053136 Ga0500559_0120556 Ga0500559_0120556_274_1200 308
872 3300053144 Ga0500585_057645 Ga0500585_057645_115_1047 308
873 3300053150 Ga0500603_001381 Ga0500603_001381_4474_5406 308
874 3300053154 Ga0500619_021578 Ga0500619_021578_109_1035 308
875 3300053159 Ga0500630_035540 Ga0500630_035540_681_1613 308
876 3300053163 Ga0500639_000219 Ga0500639_000219_2080_3012 308
877 3300053177 Ga0500636_0066605 Ga0500636_0066605_21_947 308
878 3300053729 Ga0500625_005765 Ga0500625_005765_961_1887 308
879 3300054114 Ga0501084_0006290 Ga0501084_0006290_325_1251 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

43

306

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5945 8 294
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5909 34 292
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5858 31 292
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.576 14 292
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5571 15 292
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8652 31 290 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8077 33 290 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8062 33 290 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8042 28 289 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7995 31 290 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A0D7EH95-F1-model_v4 ABC transporter permease 0.9752 3 216 GO:0005886
GO:0015658
AF-A0A257S961-F1-model_v4 deleted 0.9649 7 308
AF-A0A0D7EH95-F1-model_v4 ABC transporter permease 0.962 3 216 GO:0005886
GO:0015658
AF-A0A523UBX2-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9472 12 221 GO:0005886
GO:0015658
AF-A0A7Y0C2Q4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9469 10 307 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
85.06 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map