F484412

General Info

Members Datasets Scaffolds Average Seq Length
878 268 878 98

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1013466|JGI24736J21556_10134663
Length 103
Sequence MSQEWTPPPSSGAPVASVPNYLIPAIISLFCCLPLGVVGVIFAAQVNGKVAAGDTVGALDASKKAKLFSFIAIGLGLLGIVGYVLFVVIMGVGMGLAGSSSSF

Samples

Sample ID Description Type Environment
1 2088090001 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
5 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
198 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
221 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
222 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
223 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
224 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
225 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
226 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
227 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
230 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
231 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
232 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
235 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
236 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
237 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
238 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
239 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
240 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
241 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
242 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
245 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
246 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
247 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
248 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
249 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
252 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
253 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
254 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
255 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
256 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
257 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
258 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
259 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
260 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
261 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
262 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.82
Rhizosphere 98.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNB_F6ESG4R02GJA28 2088090001 Unclassified 506
2 SwRhRL2b_contig_1394274 2162886007 Unclassified 3714
3 MBSR1b_contig_1406643 2162886012 Bacteria 906
4 MBSR1b_contig_3385735 2162886012 Unclassified 1385
5 CNBas_1011925 3300000531 Unclassified 539
6 CNAas_1001055 3300000532 Bacteria 2532
7 JGI24736J21556_1013466 3300001904 Unclassified 1321
8 JGI24737J22298_10053525 3300001990 Bacteria 1222
9 Ga0065714_10064435 3300005288 Bacteria 121919
10 Ga0065704_10077444 3300005289 Unclassified 4736
11 Ga0065704_10166104 3300005289 Bacteria 1321
12 Ga0065704_10288123 3300005289 Bacteria 909
13 Ga0065712_10000118 3300005290 Bacteria 121959
14 Ga0065712_10005040 3300005290 Bacteria 4471
15 Ga0065712_10077663 3300005290 Bacteria 3460
16 Ga0065712_10296637 3300005290 Bacteria 867
17 Ga0065712_10538609 3300005290 Unclassified 625
18 Ga0065715_10014122 3300005293 Bacteria 2666
19 Ga0065715_10047621 3300005293 Unclassified 886
20 Ga0065715_10088964 3300005293 Bacteria 19499
21 Ga0065715_10126787 3300005293 Unclassified 2085
22 Ga0065715_10147568 3300005293 Bacteria 1760
23 Ga0065715_10151441 3300005293 Bacteria 1724
24 Ga0065715_10184217 3300005293 Unclassified 1456
25 Ga0065715_10322335 3300005293 Bacteria 999
26 Ga0065715_10768037 3300005293 Unclassified 623
27 Ga0065715_11086307 3300005293 Unclassified 523
28 Ga0065707_10002981 3300005295 Bacteria 5155
29 Ga0065707_10086482 3300005295 Bacteria 5438
30 Ga0065707_10147838 3300005295 Bacteria 1693
31 Ga0065707_10494254 3300005295 Bacteria 762
32 Ga0065707_10714456 3300005295 Unclassified 633
33 Ga0070676_10029420 3300005328 Bacteria 3124
34 Ga0070690_100027531 3300005330 Bacteria 3514
35 Ga0070690_100480542 3300005330 Bacteria 926
36 Ga0070690_100511469 3300005330 Bacteria 900
37 Ga0070690_100782796 3300005330 Unclassified 739
38 Ga0070690_100920714 3300005330 Bacteria 685
39 Ga0070670_100062091 3300005331 Unclassified 3208
40 Ga0070670_100380512 3300005331 Bacteria 1243
41 Ga0070670_101398025 3300005331 Bacteria 642
42 Ga0070670_101723564 3300005331 Unclassified 577
43 Ga0070670_102155785 3300005331 Unclassified 514
44 Ga0070677_10218516 3300005333 Bacteria 929
45 Ga0068869_100007615 3300005334 Bacteria 6931
46 Ga0068869_100031026 3300005334 Bacteria 3758
47 Ga0068869_100046295 3300005334 Bacteria 3136
48 Ga0068869_100050490 3300005334 Bacteria 3015
49 Ga0068869_100150240 3300005334 Unclassified 1806
50 Ga0068869_100214311 3300005334 Unclassified 1524
51 Ga0068869_100221420 3300005334 Bacteria 1500
52 Ga0068869_100417434 3300005334 Bacteria 1106
53 Ga0068869_100940998 3300005334 Bacteria 750
54 Ga0070666_10027343 3300005335 Bacteria 3735
55 Ga0070666_10155061 3300005335 Bacteria 1599
56 Ga0070680_100005787 3300005336 Bacteria 9383
57 Ga0070680_100440711 3300005336 Unclassified 1112
58 Ga0070682_100004309 3300005337 Bacteria 7901
59 Ga0070682_100058537 3300005337 Bacteria 2430
60 Ga0070682_100259310 3300005337 Bacteria 1257
61 Ga0070682_101792981 3300005337 Bacteria 535
62 Ga0068868_100008836 3300005338 Bacteria 7217
63 Ga0068868_100071761 3300005338 Bacteria 2761
64 Ga0068868_100089732 3300005338 Bacteria 2474
65 Ga0068868_100535836 3300005338 Bacteria 1030
66 Ga0070660_100292179 3300005339 Bacteria 1335
67 Ga0070689_100024564 3300005340 Bacteria 4521
68 Ga0070689_100349658 3300005340 Bacteria 1239
69 Ga0070689_101400809 3300005340 Unclassified 631
70 Ga0070689_102213828 3300005340 Bacteria 504
71 Ga0070691_10233917 3300005341 Bacteria 979
72 Ga0070691_10541176 3300005341 Unclassified 679
73 Ga0070691_10622500 3300005341 Unclassified 639
74 Ga0070687_100099187 3300005343 Bacteria 1627
75 Ga0070687_100179326 3300005343 Bacteria 1267
76 Ga0070687_100215779 3300005343 Bacteria 1172
77 Ga0070687_100747814 3300005343 Bacteria 688
78 Ga0070661_100050445 3300005344 Bacteria 3045
79 Ga0070661_100286860 3300005344 Bacteria 1278
80 Ga0070661_100506466 3300005344 Bacteria 967
81 Ga0070692_10011688 3300005345 Unclassified 4037
82 Ga0070692_10016318 3300005345 Bacteria 3531
83 Ga0070692_10068731 3300005345 Bacteria 1883
84 Ga0070692_10101095 3300005345 Bacteria 1580
85 Ga0070692_10141019 3300005345 Bacteria 1364
86 Ga0070692_10252286 3300005345 Unclassified 1057
87 Ga0070692_10450084 3300005345 Bacteria 824
88 Ga0070692_10471635 3300005345 Bacteria 808
89 Ga0070669_100265288 3300005353 Bacteria 1371
90 Ga0070669_100577530 3300005353 Bacteria 940
91 Ga0070669_100588114 3300005353 Unclassified 931
92 Ga0070669_100880280 3300005353 Bacteria 764
93 Ga0070669_100943334 3300005353 Bacteria 738
94 Ga0070669_100981855 3300005353 Unclassified 724
95 Ga0070669_101256046 3300005353 Bacteria 641
96 Ga0070669_101424778 3300005353 Unclassified 601
97 Ga0070675_100172009 3300005354 Unclassified 1868
98 Ga0070675_100299695 3300005354 Bacteria 1416
99 Ga0070675_100334410 3300005354 Bacteria 1340
100 Ga0070671_100027395 3300005355 Bacteria 4691
101 Ga0070671_100759461 3300005355 Bacteria 843
102 Ga0070671_100830245 3300005355 Bacteria 805
103 Ga0070673_100039643 3300005364 Bacteria 3607
104 Ga0070673_100083222 3300005364 Bacteria 2599
105 Ga0070673_100092701 3300005364 Bacteria 2472
106 Ga0070673_100192685 3300005364 Bacteria 1752
107 Ga0070673_100363648 3300005364 Unclassified 1287
108 Ga0070673_100365812 3300005364 Bacteria 1283
109 Ga0070673_100461694 3300005364 Unclassified 1144
110 Ga0070673_100859255 3300005364 Unclassified 840
111 Ga0070673_100914368 3300005364 Bacteria 814
112 Ga0070673_102245339 3300005364 Bacteria 519
113 Ga0070688_100019538 3300005365 Bacteria 3926
114 Ga0070688_100398923 3300005365 Bacteria 1018
115 Ga0070688_100942916 3300005365 Bacteria 683
116 Ga0070659_100028338 3300005366 Bacteria 4324
117 Ga0070659_100175184 3300005366 Bacteria 1759
118 Ga0070659_100384354 3300005366 Bacteria 1183
119 Ga0070667_100016035 3300005367 Bacteria 6198
120 Ga0070667_100069166 3300005367 Bacteria 3004
121 Ga0070667_102244271 3300005367 Unclassified 514
122 Ga0070703_10473967 3300005406 Bacteria 559
123 Ga0070701_10023135 3300005438 Bacteria 2988
124 Ga0070701_10033699 3300005438 Bacteria 2561
125 Ga0070701_10311688 3300005438 Bacteria 971
126 Ga0070701_10314143 3300005438 Bacteria 967
127 Ga0070701_10332370 3300005438 Unclassified 944
128 Ga0070701_10518120 3300005438 Unclassified 777
129 Ga0070705_100003326 3300005440 Bacteria 7890
130 Ga0070705_100017216 3300005440 Bacteria 3769
131 Ga0070705_100082743 3300005440 Bacteria 1976
132 Ga0070705_100418967 3300005440 Bacteria 996
133 Ga0070705_100451032 3300005440 Unclassified 965
134 Ga0070705_100573569 3300005440 Unclassified 869
135 Ga0070705_101452650 3300005440 Unclassified 573
136 Ga0070700_100065335 3300005441 Unclassified 2307
137 Ga0070700_100106143 3300005441 Bacteria 1859
138 Ga0070700_100106583 3300005441 Unclassified 1856
139 Ga0070700_100142886 3300005441 Bacteria 1628
140 Ga0070700_100156737 3300005441 Bacteria 1563
141 Ga0070700_100369952 3300005441 Bacteria 1069
142 Ga0070700_101853551 3300005441 Bacteria 520
143 Ga0070694_100009516 3300005444 Bacteria 5961
144 Ga0070694_100020624 3300005444 Bacteria 4204
145 Ga0070694_100033450 3300005444 Bacteria 3383
146 Ga0070694_100092392 3300005444 Bacteria 2126
147 Ga0070694_100103937 3300005444 Bacteria 2013
148 Ga0070694_100126246 3300005444 Bacteria 1842
149 Ga0070694_100327993 3300005444 Unclassified 1180
150 Ga0070694_101189282 3300005444 Unclassified 638
151 Ga0070708_100305909 3300005445 Unclassified 1497
152 Ga0070708_101005998 3300005445 Unclassified 782
153 Ga0070663_100366208 3300005455 Bacteria 1170
154 Ga0070678_100028427 3300005456 Bacteria 3813
155 Ga0070678_100382597 3300005456 Bacteria 1218
156 Ga0070678_100703867 3300005456 Unclassified 910
157 Ga0070662_100345425 3300005457 Unclassified 1218
158 Ga0070662_100356909 3300005457 Bacteria 1199
159 Ga0070662_100754410 3300005457 Bacteria 825
160 Ga0070681_10008402 3300005458 Bacteria 10109
161 Ga0068867_100047917 3300005459 Bacteria 3143
162 Ga0068867_100060133 3300005459 Bacteria 2818
163 Ga0068867_100730767 3300005459 Bacteria 876
164 Ga0070685_10089330 3300005466 Bacteria 1862
165 Ga0070706_100007728 3300005467 Bacteria 10054
166 Ga0070706_100337991 3300005467 Bacteria 1404
167 Ga0070707_100126752 3300005468 Bacteria 2481
168 Ga0070707_100192223 3300005468 Unclassified 1990
169 Ga0070707_100955195 3300005468 Unclassified 822
170 Ga0070698_100017251 3300005471 Bacteria 7608
171 Ga0070698_100087016 3300005471 Unclassified 3111
172 Ga0070698_100824118 3300005471 Unclassified 872
173 Ga0070698_100956787 3300005471 Unclassified 803
174 Ga0070698_101823691 3300005471 Unclassified 561
175 Ga0070699_100057560 3300005518 Unclassified 3367
176 Ga0070699_100189046 3300005518 Bacteria 1829
177 Ga0070699_100854598 3300005518 Bacteria 833
178 Ga0070699_101013701 3300005518 Bacteria 761
179 Ga0070699_101140029 3300005518 Unclassified 715
180 Ga0070679_100236447 3300005530 Bacteria 1786
181 Ga0070684_100215481 3300005535 Bacteria 1751
182 Ga0070697_100029783 3300005536 Bacteria 4380
183 Ga0070697_100073915 3300005536 Unclassified 2799
184 Ga0070697_100374935 3300005536 Bacteria 1232
185 Ga0070697_100573754 3300005536 Bacteria 990
186 Ga0070697_101431975 3300005536 Unclassified 617
187 Ga0070697_101788731 3300005536 Unclassified 550
188 Ga0068853_100311168 3300005539 Bacteria 1458
189 Ga0068853_100964908 3300005539 Unclassified 820
190 Ga0068853_101245951 3300005539 Unclassified 718
191 Ga0070672_100322591 3300005543 Bacteria 1313
192 Ga0070672_100390632 3300005543 Bacteria 1191
193 Ga0070672_100991880 3300005543 Bacteria 744
194 Ga0070686_100003078 3300005544 Bacteria 9135
195 Ga0070686_100259136 3300005544 Unclassified 1274
196 Ga0070686_101096931 3300005544 Unclassified 657
197 Ga0070695_100093792 3300005545 Bacteria 2009
198 Ga0070695_100129941 3300005545 Bacteria 1735
199 Ga0070695_100181827 3300005545 Bacteria 1490
200 Ga0070695_101229806 3300005545 Unclassified 617
201 Ga0070695_101242033 3300005545 Bacteria 614
202 Ga0070695_101290773 3300005545 Unclassified 603
203 Ga0070696_100011414 3300005546 Bacteria 5951
204 Ga0070696_100338084 3300005546 Bacteria 1163
205 Ga0070696_100457168 3300005546 Unclassified 1008
206 Ga0070696_100581852 3300005546 Unclassified 901
207 Ga0070696_100634109 3300005546 Unclassified 865
208 Ga0070693_100014900 3300005547 Bacteria 3996
209 Ga0070693_100052610 3300005547 Unclassified 2335
210 Ga0070693_100056114 3300005547 Bacteria 2272
211 Ga0070693_100067641 3300005547 Bacteria 2095
212 Ga0070693_100327532 3300005547 Unclassified 1041
213 Ga0070693_100960661 3300005547 Unclassified 644
214 Ga0070665_100031997 3300005548 Bacteria 5295
215 Ga0070665_100398630 3300005548 Bacteria 1384
216 Ga0070704_100089494 3300005549 Bacteria 2290
217 Ga0070704_100247619 3300005549 Unclassified 1462
218 Ga0070704_100300710 3300005549 Bacteria 1337
219 Ga0070704_100550630 3300005549 Unclassified 1008
220 Ga0070704_100634247 3300005549 Unclassified 942
221 Ga0070704_102078181 3300005549 Unclassified 528
222 Ga0068855_101086725 3300005563 Unclassified 837
223 Ga0068855_101208435 3300005563 Bacteria 786
224 Ga0068855_102057399 3300005563 Unclassified 576
225 Ga0070664_100005565 3300005564 Bacteria 10120
226 Ga0070664_100319351 3300005564 Bacteria 1407
227 Ga0070664_100596731 3300005564 Bacteria 1024
228 Ga0068857_100004581 3300005577 Bacteria 11707
229 Ga0068857_100113003 3300005577 Bacteria 2442
230 Ga0068857_101342870 3300005577 Unclassified 695
231 Ga0068857_102279765 3300005577 Bacteria 532
232 Ga0068854_100039363 3300005578 Bacteria 3330
233 Ga0068854_100251148 3300005578 Bacteria 1412
234 Ga0068854_100673784 3300005578 Bacteria 890
235 Ga0068854_100697376 3300005578 Unclassified 876
236 Ga0068854_100802087 3300005578 Unclassified 821
237 Ga0068854_101583668 3300005578 Viruses 596
238 Ga0070702_100007838 3300005615 Bacteria 5134
239 Ga0070702_100016078 3300005615 Unclassified 3832
240 Ga0070702_100027670 3300005615 Bacteria 3063
241 Ga0070702_100036510 3300005615 Bacteria 2723
242 Ga0070702_100072453 3300005615 Unclassified 2039
243 Ga0070702_100099509 3300005615 Bacteria 1781
244 Ga0070702_100133746 3300005615 Bacteria 1570
245 Ga0068852_100100902 3300005616 Bacteria 2605
246 Ga0068852_100122908 3300005616 Bacteria 2380
247 Ga0068852_100425659 3300005616 Unclassified 1310
248 Ga0068852_100711303 3300005616 Unclassified 1015
249 Ga0068852_101796051 3300005616 Bacteria 635
250 Ga0068852_102033763 3300005616 Unclassified 596
251 Ga0068859_100007875 3300005617 Bacteria 10812
252 Ga0068859_100018906 3300005617 Bacteria 6921
253 Ga0068859_100021317 3300005617 Bacteria 6502
254 Ga0068859_100072286 3300005617 Unclassified 3486
255 Ga0068859_100084986 3300005617 Bacteria 3209
256 Ga0068859_100145099 3300005617 Bacteria 2448
257 Ga0068859_100207003 3300005617 Bacteria 2047
258 Ga0068859_100297289 3300005617 Unclassified 1708
259 Ga0068859_100395683 3300005617 Bacteria 1477
260 Ga0068859_100415098 3300005617 Bacteria 1442
261 Ga0068859_100631924 3300005617 Unclassified 1163
262 Ga0068859_100697995 3300005617 Bacteria 1105
263 Ga0068859_100871901 3300005617 Unclassified 986
264 Ga0068859_101042658 3300005617 Unclassified 899
265 Ga0068859_101094000 3300005617 Unclassified 877
266 Ga0068859_102032671 3300005617 Unclassified 634
267 Ga0068859_102865211 3300005617 Unclassified 529
268 Ga0068864_100006089 3300005618 Bacteria 9896
269 Ga0068864_100015368 3300005618 Bacteria 6364
270 Ga0068864_100040916 3300005618 Bacteria 3963
271 Ga0068864_100064433 3300005618 Unclassified 3178
272 Ga0068864_100088642 3300005618 Bacteria 2725
273 Ga0068864_100108045 3300005618 Unclassified 2475
274 Ga0068864_100232781 3300005618 Bacteria 1704
275 Ga0068864_100494303 3300005618 Unclassified 1176
276 Ga0068864_101073602 3300005618 Bacteria 800
277 Ga0068864_101253835 3300005618 Unclassified 741
278 Ga0068864_101579734 3300005618 Unclassified 660
279 Ga0068866_10008901 3300005718 Bacteria 4248
280 Ga0068866_10378908 3300005718 Bacteria 907
281 Ga0068861_100003971 3300005719 Bacteria 9906
282 Ga0068861_100016173 3300005719 Bacteria 5273
283 Ga0068861_100040986 3300005719 Bacteria 3466
284 Ga0068861_100177580 3300005719 Bacteria 1770
285 Ga0068861_100778348 3300005719 Unclassified 896
286 Ga0068861_101108893 3300005719 Unclassified 761
287 Ga0068851_10008858 3300005834 Bacteria 4666
288 Ga0068851_10263785 3300005834 Bacteria 980
289 Ga0068870_10042785 3300005840 Bacteria 2359
290 Ga0068870_10084560 3300005840 Unclassified 1761
291 Ga0068870_10199923 3300005840 Unclassified 1211
292 Ga0068870_10321325 3300005840 Unclassified 983
293 Ga0068870_10417160 3300005840 Unclassified 877
294 Ga0068870_10655528 3300005840 Bacteria 719
295 Ga0068863_100144756 3300005841 Bacteria 2272
296 Ga0068863_100175325 3300005841 Unclassified 2057
297 Ga0068863_100258389 3300005841 Bacteria 1683
298 Ga0068863_100281389 3300005841 Unclassified 1612
299 Ga0068863_100318022 3300005841 Bacteria 1511
300 Ga0068863_100416631 3300005841 Bacteria 1315
301 Ga0068863_100459297 3300005841 Bacteria 1250
302 Ga0068863_101044610 3300005841 Unclassified 821
303 Ga0068858_100010380 3300005842 Bacteria 8824
304 Ga0068858_100036039 3300005842 Bacteria 4587
305 Ga0068858_100047010 3300005842 Bacteria 4002
306 Ga0068858_100052664 3300005842 Bacteria 3765
307 Ga0068858_100073298 3300005842 Bacteria 3179
308 Ga0068858_100098077 3300005842 Bacteria 2732
309 Ga0068858_100120538 3300005842 Unclassified 2453
310 Ga0068858_100139543 3300005842 Unclassified 2275
311 Ga0068858_100622762 3300005842 Bacteria 1048
312 Ga0068860_100014717 3300005843 Bacteria 7651
313 Ga0068860_100038855 3300005843 Unclassified 4553
314 Ga0068860_100047587 3300005843 Bacteria 4087
315 Ga0068860_100073072 3300005843 Unclassified 3260
316 Ga0068860_100103993 3300005843 Bacteria 2711
317 Ga0068860_101388501 3300005843 Bacteria 723
318 Ga0068860_101492806 3300005843 Unclassified 698
319 Ga0068862_100012119 3300005844 Bacteria 7125
320 Ga0068862_100118956 3300005844 Bacteria 2326
321 Ga0068862_100132150 3300005844 Bacteria 2209
322 Ga0068862_100209823 3300005844 Unclassified 1759
323 Ga0068862_100881643 3300005844 Unclassified 879
324 Ga0068862_101709812 3300005844 Unclassified 637
325 Ga0081455_10358536 3300005937 Bacteria 1026
326 Ga0081540_1288456 3300005983 Unclassified 565
327 Ga0081539_10179258 3300005985 Bacteria 995
328 Ga0097621_100002934 3300006237 Bacteria 11721
329 Ga0097621_100032607 3300006237 Unclassified 4143
330 Ga0097621_100161133 3300006237 Bacteria 1928
331 Ga0097621_101758584 3300006237 Unclassified 591
332 Ga0068871_100000516 3300006358 Bacteria 26474
333 Ga0068871_100002200 3300006358 Bacteria 13254
334 Ga0068871_100109787 3300006358 Bacteria 2319
335 Ga0068871_100183442 3300006358 Bacteria 1799
336 Ga0068871_101117860 3300006358 Unclassified 737
337 Ga0075428_100017311 3300006844 Bacteria 7965
338 Ga0075428_100088879 3300006844 Unclassified 3370
339 Ga0075428_100368523 3300006844 Archaea 1541
340 Ga0075428_102594882 3300006844 Unclassified 518
341 Ga0075430_101580639 3300006846 Unclassified 538
342 Ga0075431_102149325 3300006847 Archaea 513
343 Ga0075433_10008013 3300006852 Bacteria 8412
344 Ga0075433_10012260 3300006852 Bacteria 6912
345 Ga0075433_10050623 3300006852 Bacteria 3616
346 Ga0075433_10057467 3300006852 Bacteria 3401
347 Ga0075433_10924548 3300006852 Unclassified 761
348 Ga0075434_100051099 3300006871 Unclassified 4107
349 Ga0075434_100094518 3300006871 Bacteria 2994
350 Ga0075434_100218039 3300006871 Bacteria 1928
351 Ga0075434_100394075 3300006871 Unclassified 1406
352 Ga0075434_101268780 3300006871 Unclassified 748
353 Ga0075434_102520284 3300006871 Unclassified 515
354 Ga0075434_102548516 3300006871 Unclassified 512
355 Ga0075429_100013208 3300006880 Bacteria 7164
356 Ga0075429_100805804 3300006880 Unclassified 822
357 Ga0068865_100002742 3300006881 Bacteria 10464
358 Ga0068865_100488337 3300006881 Bacteria 1025
359 Ga0068865_100808407 3300006881 Unclassified 809
360 Ga0097620_100007875 3300006931 Bacteria 10812
361 Ga0097620_100018906 3300006931 Bacteria 6921
362 Ga0097620_100021317 3300006931 Bacteria 6502
363 Ga0097620_100072284 3300006931 Unclassified 3486
364 Ga0097620_100084998 3300006931 Bacteria 3209
365 Ga0097620_100145102 3300006931 Bacteria 2448
366 Ga0097620_100207000 3300006931 Bacteria 2047
367 Ga0097620_100297266 3300006931 Unclassified 1708
368 Ga0097620_100395662 3300006931 Bacteria 1477
369 Ga0097620_100415085 3300006931 Bacteria 1442
370 Ga0097620_100632051 3300006931 Unclassified 1163
371 Ga0097620_100697985 3300006931 Bacteria 1105
372 Ga0097620_100871905 3300006931 Unclassified 986
373 Ga0097620_101042772 3300006931 Unclassified 899
374 Ga0097620_101093933 3300006931 Unclassified 877
375 Ga0097620_102033807 3300006931 Unclassified 634
376 Ga0097620_102865164 3300006931 Unclassified 529
377 Ga0099794_10246734 3300007265 Unclassified 920
378 Ga0099795_10322139 3300007788 Unclassified 685
379 Ga0105251_10102011 3300009011 Unclassified 1311
380 Ga0105250_10064250 3300009092 Unclassified 1478
381 Ga0105240_10207866 3300009093 Unclassified 2289
382 Ga0105240_10742268 3300009093 Unclassified 1068
383 Ga0105240_12513509 3300009093 Unclassified 532
384 Ga0111539_10009124 3300009094 Bacteria 12549
385 Ga0111539_10112058 3300009094 Bacteria 3201
386 Ga0111539_10285051 3300009094 Unclassified 1922
387 Ga0111539_11608323 3300009094 Unclassified 754
388 Ga0105245_10065278 3300009098 Bacteria 3291
389 Ga0105245_10190950 3300009098 Unclassified 1962
390 Ga0105245_10681008 3300009098 Unclassified 1060
391 Ga0105245_11387472 3300009098 Bacteria 752
392 Ga0105247_10367449 3300009101 Bacteria 1016
393 Ga0114129_10059772 3300009147 Bacteria 5328
394 Ga0114129_10100624 3300009147 Bacteria 4000
395 Ga0114129_10143244 3300009147 Unclassified 3275
396 Ga0114129_10221825 3300009147 Bacteria 2550
397 Ga0114129_10641907 3300009147 Bacteria 1371
398 Ga0114129_12631927 3300009147 Unclassified 600
399 Ga0105243_10000318 3300009148 Bacteria 53066
400 Ga0105243_10016886 3300009148 Bacteria 5519
401 Ga0105243_10023043 3300009148 Bacteria 4737
402 Ga0105243_10031300 3300009148 Unclassified 4101
403 Ga0105243_10300389 3300009148 Unclassified 1455
404 Ga0105243_10326389 3300009148 Bacteria 1400
405 Ga0105243_10570034 3300009148 Unclassified 1085
406 Ga0105243_10854462 3300009148 Bacteria 901
407 Ga0105243_10944849 3300009148 Unclassified 861
408 Ga0105241_10082841 3300009174 Bacteria 2515
409 Ga0105241_10088421 3300009174 Bacteria 2440
410 Ga0105241_10109205 3300009174 Bacteria 2212
411 Ga0105241_10114218 3300009174 Unclassified 2166
412 Ga0105241_10178643 3300009174 Unclassified 1759
413 Ga0105241_10397644 3300009174 Bacteria 1208
414 Ga0105241_10508517 3300009174 Unclassified 1075
415 Ga0105241_10569560 3300009174 Bacteria 1019
416 Ga0105241_10874921 3300009174 Unclassified 833
417 Ga0105241_10887467 3300009174 Unclassified 827
418 Ga0105242_10001437 3300009176 Bacteria 18752
419 Ga0105242_10028000 3300009176 Bacteria 4482
420 Ga0105242_10110788 3300009176 Bacteria 2339
421 Ga0105242_10296659 3300009176 Bacteria 1474
422 Ga0105242_10433115 3300009176 Bacteria 1235
423 Ga0105242_12342458 3300009176 Unclassified 581
424 Ga0105248_10001931 3300009177 Bacteria 23033
425 Ga0105248_10087760 3300009177 Bacteria 3501
426 Ga0105248_10093387 3300009177 Bacteria 3388
427 Ga0105248_10222001 3300009177 Unclassified 2127
428 Ga0105248_10231318 3300009177 Bacteria 2081
429 Ga0105248_10796184 3300009177 Unclassified 1067
430 Ga0105248_10998927 3300009177 Bacteria 945
431 Ga0105237_10000264 3300009545 Bacteria 73957
432 Ga0105237_10335234 3300009545 Bacteria 1517
433 Ga0105238_10199865 3300009551 Unclassified 1974
434 Ga0105249_10005195 3300009553 Bacteria 11237
435 Ga0105249_10110974 3300009553 Bacteria 2592
436 Ga0105249_10176258 3300009553 Bacteria 2077
437 Ga0105249_10258421 3300009553 Unclassified 1729
438 Ga0105249_11718089 3300009553 Unclassified 700
439 Ga0105249_11931629 3300009553 Unclassified 663
440 Ga0105239_10046859 3300010375 Bacteria 4736
441 Ga0105239_10115932 3300010375 Bacteria 2972
442 Ga0105239_10165716 3300010375 Bacteria 2471
443 Ga0105239_10952718 3300010375 Bacteria 986
444 Ga0105246_10006555 3300011119 Bacteria 7108
445 Ga0105246_10026560 3300011119 Bacteria 3785
446 Ga0105246_10172242 3300011119 Unclassified 1659
447 Ga0105246_11108354 3300011119 Unclassified 723
448 Ga0157373_10001007 3300013100 Bacteria 21766
449 Ga0157371_10152206 3300013102 Bacteria 1650
450 Ga0157371_10182579 3300013102 Bacteria 1501
451 Ga0157374_10048415 3300013296 Bacteria 3944
452 Ga0157374_10222733 3300013296 Bacteria 1851
453 Ga0157378_10000679 3300013297 Bacteria 31993
454 Ga0157378_10004360 3300013297 Bacteria 12453
455 Ga0157378_10031045 3300013297 Bacteria 4718
456 Ga0157378_10057879 3300013297 Bacteria 3455
457 Ga0157378_10290592 3300013297 Bacteria 1579
458 Ga0157378_10391757 3300013297 Bacteria 1367
459 Ga0157378_10441303 3300013297 Unclassified 1290
460 Ga0157378_10874900 3300013297 Unclassified 928
461 Ga0157378_12108074 3300013297 Unclassified 614
462 Ga0163162_10006297 3300013306 Bacteria 11494
463 Ga0163162_10009333 3300013306 Bacteria 9539
464 Ga0163162_10043160 3300013306 Unclassified 4515
465 Ga0163162_10139253 3300013306 Bacteria 2539
466 Ga0163162_10173158 3300013306 Bacteria 2283
467 Ga0163162_10311373 3300013306 Bacteria 1707
468 Ga0163162_10964984 3300013306 Bacteria 963
469 Ga0163162_10972131 3300013306 Bacteria 959
470 Ga0163162_12075002 3300013306 Unclassified 652
471 Ga0157372_10064757 3300013307 Bacteria 4102
472 Ga0157372_10315365 3300013307 Unclassified 1820
473 Ga0157372_10332722 3300013307 Bacteria 1769
474 Ga0157372_11156908 3300013307 Bacteria 894
475 Ga0157372_13245896 3300013307 Unclassified 518
476 Ga0157375_10016064 3300013308 Bacteria 6716
477 Ga0157375_10108615 3300013308 Bacteria 2869
478 Ga0157375_10111752 3300013308 Bacteria 2832
479 Ga0157375_10167552 3300013308 Bacteria 2342
480 Ga0157375_10306171 3300013308 Bacteria 1753
481 Ga0157375_10585151 3300013308 Unclassified 1276
482 Ga0157375_11059192 3300013308 Bacteria 948
483 Ga0157375_11426255 3300013308 Unclassified 816
484 Ga0157375_11545980 3300013308 Unclassified 784
485 Ga0157375_11971150 3300013308 Unclassified 694
486 Ga0163163_10007125 3300014325 Bacteria 9831
487 Ga0163163_10058727 3300014325 Bacteria 3804
488 Ga0163163_10110583 3300014325 Unclassified 2776
489 Ga0163163_10133794 3300014325 Bacteria 2520
490 Ga0163163_10142835 3300014325 Unclassified 2436
491 Ga0163163_10628610 3300014325 Bacteria 1137
492 Ga0163163_12062325 3300014325 Bacteria 630
493 Ga0157380_10039822 3300014326 Bacteria 3657
494 Ga0157380_10189324 3300014326 Bacteria 1815
495 Ga0157380_11277256 3300014326 Unclassified 780
496 Ga0157380_11471164 3300014326 Unclassified 733
497 Ga0157380_11532048 3300014326 Unclassified 720
498 Ga0157380_12371594 3300014326 Unclassified 596
499 Ga0157380_12863915 3300014326 Unclassified 549
500 Ga0157377_10034821 3300014745 Bacteria 2757
501 Ga0157377_10125882 3300014745 Bacteria 1559
502 Ga0157377_10619805 3300014745 Bacteria 774
503 Ga0157377_10652202 3300014745 Unclassified 758
504 Ga0157379_10030846 3300014968 Bacteria 4774
505 Ga0157379_10067552 3300014968 Unclassified 3195
506 Ga0157379_11399665 3300014968 Unclassified 678
507 Ga0157376_10016049 3300014969 Bacteria 5674
508 Ga0157376_10023330 3300014969 Bacteria 4841
509 Ga0182007_10048583 3300015262 Bacteria 1402
510 Ga0163161_10041016 3300017792 Bacteria 3325
511 Ga0163161_10216153 3300017792 Bacteria 1483
512 Ga0163161_10466354 3300017792 Unclassified 1023
513 Ga0163161_10483521 3300017792 Unclassified 1006
514 Ga0207697_10011469 3300025315 Bacteria 3747
515 Ga0207656_10015588 3300025321 Bacteria 2944
516 Ga0207656_10126172 3300025321 Bacteria 1195
517 Ga0207713_1235717 3300025735 Unclassified 545
518 Ga0207653_10000007 3300025885 Bacteria 198873
519 Ga0207653_10005604 3300025885 Bacteria 3921
520 Ga0207653_10179468 3300025885 Bacteria 791
521 Ga0207642_10021395 3300025899 Bacteria 2545
522 Ga0207710_10284773 3300025900 Unclassified 832
523 Ga0207710_10689298 3300025900 Bacteria 536
524 Ga0207688_10139016 3300025901 Unclassified 1429
525 Ga0207680_10074275 3300025903 Bacteria 2117
526 Ga0207680_10107490 3300025903 Bacteria 1803
527 Ga0207647_10002956 3300025904 Bacteria 12789
528 Ga0207647_10097786 3300025904 Bacteria 1745
529 Ga0207647_10161374 3300025904 Bacteria 1307
530 Ga0207647_10468030 3300025904 Unclassified 705
531 Ga0207647_10524303 3300025904 Bacteria 659
532 Ga0207645_10045469 3300025907 Bacteria 2806
533 Ga0207645_10166097 3300025907 Unclassified 1445
534 Ga0207645_10503921 3300025907 Bacteria 820
535 Ga0207643_10001829 3300025908 Bacteria 11791
536 Ga0207643_10059752 3300025908 Bacteria 2175
537 Ga0207643_10090640 3300025908 Unclassified 1782
538 Ga0207643_10409698 3300025908 Unclassified 858
539 Ga0207684_10030926 3300025910 Bacteria 4556
540 Ga0207684_10386569 3300025910 Bacteria 1203
541 Ga0207684_10390673 3300025910 Bacteria 1196
542 Ga0207654_10158161 3300025911 Unclassified 1461
543 Ga0207654_10360657 3300025911 Unclassified 1003
544 Ga0207654_10413801 3300025911 Bacteria 940
545 Ga0207654_11145566 3300025911 Unclassified 567
546 Ga0207654_11313743 3300025911 Unclassified 527
547 Ga0207707_10089287 3300025912 Bacteria 2693
548 Ga0207707_10434639 3300025912 Unclassified 1124
549 Ga0207695_10934282 3300025913 Bacteria 747
550 Ga0207671_10008288 3300025914 Bacteria 8836
551 Ga0207660_10227126 3300025917 Unclassified 1467
552 Ga0207660_10364606 3300025917 Unclassified 1159
553 Ga0207660_10385109 3300025917 Unclassified 1128
554 Ga0207662_10069177 3300025918 Bacteria 2133
555 Ga0207662_10073440 3300025918 Bacteria 2075
556 Ga0207662_10205957 3300025918 Bacteria 1275
557 Ga0207662_10305816 3300025918 Bacteria 1058
558 Ga0207662_10365573 3300025918 Unclassified 972
559 Ga0207662_10387486 3300025918 Unclassified 945
560 Ga0207662_10578203 3300025918 Unclassified 780
561 Ga0207662_10874219 3300025918 Unclassified 636
562 Ga0207657_10095149 3300025919 Bacteria 2479
563 Ga0207649_10240720 3300025920 Bacteria 1299
564 Ga0207652_10098469 3300025921 Bacteria 2579
565 Ga0207646_10545600 3300025922 Bacteria 1043
566 Ga0207681_10243072 3300025923 Bacteria 1402
567 Ga0207681_10274487 3300025923 Bacteria 1325
568 Ga0207681_10536469 3300025923 Bacteria 961
569 Ga0207681_10538707 3300025923 Unclassified 960
570 Ga0207681_10890791 3300025923 Bacteria 745
571 Ga0207681_11527775 3300025923 Bacteria 560
572 Ga0207694_10444576 3300025924 Unclassified 1082
573 Ga0207650_10127319 3300025925 Bacteria 1989
574 Ga0207650_10188670 3300025925 Bacteria 1646
575 Ga0207650_10593913 3300025925 Unclassified 931
576 Ga0207650_10851124 3300025925 Unclassified 774
577 Ga0207650_10963907 3300025925 Unclassified 725
578 Ga0207659_10085671 3300025926 Bacteria 2341
579 Ga0207659_10178300 3300025926 Bacteria 1681
580 Ga0207659_10411911 3300025926 Bacteria 1132
581 Ga0207687_10910470 3300025927 Unclassified 753
582 Ga0207687_10935663 3300025927 Unclassified 742
583 Ga0207644_10117195 3300025931 Bacteria 2022
584 Ga0207644_10225070 3300025931 Bacteria 1488
585 Ga0207644_11008233 3300025931 Bacteria 699
586 Ga0207690_10013344 3300025932 Bacteria 4936
587 Ga0207690_10152284 3300025932 Bacteria 1715
588 Ga0207690_10325785 3300025932 Bacteria 1209
589 Ga0207690_10556621 3300025932 Bacteria 933
590 Ga0207706_10898223 3300025933 Bacteria 748
591 Ga0207706_11064088 3300025933 Bacteria 677
592 Ga0207686_10001147 3300025934 Bacteria 15288
593 Ga0207686_10001521 3300025934 Bacteria 13071
594 Ga0207686_10308686 3300025934 Unclassified 1177
595 Ga0207686_10798279 3300025934 Bacteria 756
596 Ga0207709_10000009 3300025935 Bacteria 619238
597 Ga0207709_10001210 3300025935 Bacteria 18549
598 Ga0207709_10001346 3300025935 Bacteria 17288
599 Ga0207709_10039349 3300025935 Bacteria 2824
600 Ga0207709_10673525 3300025935 Unclassified 826
601 Ga0207709_10939701 3300025935 Unclassified 704
602 Ga0207709_11591332 3300025935 Unclassified 543
603 Ga0207670_10002913 3300025936 Bacteria 9043
604 Ga0207670_10110200 3300025936 Bacteria 1982
605 Ga0207670_10135379 3300025936 Bacteria 1810
606 Ga0207670_11007329 3300025936 Bacteria 701
607 Ga0207670_11335817 3300025936 Unclassified 608
608 Ga0207670_11668617 3300025936 Unclassified 542
609 Ga0207670_11739941 3300025936 Bacteria 530
610 Ga0207669_10517010 3300025937 Unclassified 958
611 Ga0207704_10041191 3300025938 Bacteria 2706
612 Ga0207704_10236882 3300025938 Bacteria 1361
613 Ga0207704_10934495 3300025938 Bacteria 731
614 Ga0207704_11076504 3300025938 Bacteria 682
615 Ga0207691_10010300 3300025940 Bacteria 8968
616 Ga0207691_10513614 3300025940 Bacteria 1017
617 Ga0207691_10678931 3300025940 Unclassified 869
618 Ga0207691_10953898 3300025940 Unclassified 717
619 Ga0207711_10012250 3300025941 Bacteria 7129
620 Ga0207711_10016873 3300025941 Bacteria 6064
621 Ga0207711_10062975 3300025941 Bacteria 3200
622 Ga0207711_10147141 3300025941 Unclassified 2123
623 Ga0207711_10163832 3300025941 Unclassified 2014
624 Ga0207711_10364444 3300025941 Bacteria 1339
625 Ga0207711_10653222 3300025941 Bacteria 981
626 Ga0207711_10772123 3300025941 Bacteria 895
627 Ga0207711_10787371 3300025941 Unclassified 886
628 Ga0207689_10004428 3300025942 Bacteria 12741
629 Ga0207689_10012375 3300025942 Bacteria 7299
630 Ga0207689_10073495 3300025942 Bacteria 2809
631 Ga0207689_10124716 3300025942 Bacteria 2119
632 Ga0207689_10207489 3300025942 Unclassified 1618
633 Ga0207689_10512687 3300025942 Unclassified 1005
634 Ga0207689_10614053 3300025942 Bacteria 915
635 Ga0207689_10919482 3300025942 Unclassified 738
636 Ga0207661_10628059 3300025944 Bacteria 987
637 Ga0207679_10005977 3300025945 Bacteria 7656
638 Ga0207679_10882642 3300025945 Bacteria 817
639 Ga0207667_11062423 3300025949 Bacteria 794
640 Ga0207667_11234200 3300025949 Unclassified 726
641 Ga0207667_11492544 3300025949 Unclassified 647
642 Ga0207651_10073471 3300025960 Unclassified 2432
643 Ga0207651_10112797 3300025960 Unclassified 2044
644 Ga0207651_10224267 3300025960 Bacteria 1521
645 Ga0207651_10325554 3300025960 Bacteria 1286
646 Ga0207651_10496563 3300025960 Unclassified 1054
647 Ga0207651_10822385 3300025960 Bacteria 824
648 Ga0207651_11336501 3300025960 Bacteria 645
649 Ga0207651_11901424 3300025960 Unclassified 535
650 Ga0207712_10041059 3300025961 Bacteria 3178
651 Ga0207712_10119042 3300025961 Bacteria 1995
652 Ga0207712_10299555 3300025961 Bacteria 1319
653 Ga0207712_11278818 3300025961 Bacteria 655
654 Ga0207640_10098369 3300025981 Bacteria 2045
655 Ga0207640_10326166 3300025981 Bacteria 1224
656 Ga0207640_10738397 3300025981 Unclassified 848
657 Ga0207640_10844610 3300025981 Unclassified 796
658 Ga0207640_11344160 3300025981 Unclassified 639
659 Ga0207640_11806841 3300025981 Unclassified 552
660 Ga0207658_10020766 3300025986 Bacteria 4550
661 Ga0207658_10049212 3300025986 Bacteria 3096
662 Ga0207677_10022258 3300026023 Bacteria 3892
663 Ga0207677_10212281 3300026023 Bacteria 1546
664 Ga0207677_10473065 3300026023 Bacteria 1078
665 Ga0207677_11767162 3300026023 Unclassified 574
666 Ga0207703_10030729 3300026035 Bacteria 4244
667 Ga0207703_10077019 3300026035 Bacteria 2768
668 Ga0207703_10094616 3300026035 Bacteria 2519
669 Ga0207703_10271962 3300026035 Bacteria 1535
670 Ga0207703_10445791 3300026035 Unclassified 1208
671 Ga0207703_12071797 3300026035 Bacteria 545
672 Ga0207639_10181503 3300026041 Bacteria 1790
673 Ga0207639_10317048 3300026041 Bacteria 1383
674 Ga0207678_10290034 3300026067 Bacteria 1405
675 Ga0207708_10021921 3300026075 Unclassified 4821
676 Ga0207708_10043381 3300026075 Bacteria 3428
677 Ga0207708_10062555 3300026075 Bacteria 2843
678 Ga0207708_10173124 3300026075 Unclassified 1711
679 Ga0207708_10187692 3300026075 Bacteria 1644
680 Ga0207708_10423061 3300026075 Unclassified 1105
681 Ga0207708_11482944 3300026075 Bacteria 596
682 Ga0207708_11912203 3300026075 Bacteria 520
683 Ga0207641_10144435 3300026088 Bacteria 2150
684 Ga0207641_10147528 3300026088 Bacteria 2128
685 Ga0207641_10162416 3300026088 Unclassified 2032
686 Ga0207641_10205718 3300026088 Unclassified 1817
687 Ga0207641_10494842 3300026088 Unclassified 1187
688 Ga0207641_10713953 3300026088 Unclassified 988
689 Ga0207641_10759739 3300026088 Bacteria 957
690 Ga0207648_10011861 3300026089 Bacteria 8191
691 Ga0207648_10178237 3300026089 Unclassified 1880
692 Ga0207648_10188550 3300026089 Bacteria 1827
693 Ga0207648_10330066 3300026089 Bacteria 1372
694 Ga0207648_11431573 3300026089 Unclassified 650
695 Ga0207676_10009127 3300026095 Bacteria 7063
696 Ga0207676_10028548 3300026095 Bacteria 4169
697 Ga0207676_10108719 3300026095 Bacteria 2315
698 Ga0207676_10151530 3300026095 Bacteria 1997
699 Ga0207676_10165974 3300026095 Bacteria 1918
700 Ga0207676_10256230 3300026095 Bacteria 1577
701 Ga0207676_10361846 3300026095 Unclassified 1345
702 Ga0207676_10621736 3300026095 Bacteria 1039
703 Ga0207676_10717377 3300026095 Bacteria 970
704 Ga0207674_10000391 3300026116 Bacteria 56809
705 Ga0207674_10037994 3300026116 Bacteria 5002
706 Ga0207674_10314984 3300026116 Bacteria 1514
707 Ga0207674_10440985 3300026116 Bacteria 1259
708 Ga0207675_100000187 3300026118 Bacteria 56148
709 Ga0207675_100001515 3300026118 Bacteria 23286
710 Ga0207675_100104912 3300026118 Bacteria 2664
711 Ga0207675_100357977 3300026118 Bacteria 1431
712 Ga0207675_101050629 3300026118 Unclassified 834
713 Ga0207675_101704796 3300026118 Unclassified 650
714 Ga0207683_10028711 3300026121 Bacteria 4812
715 Ga0207683_10440588 3300026121 Bacteria 1201
716 Ga0207683_10646006 3300026121 Unclassified 980
717 Ga0207698_10226477 3300026142 Bacteria 1694
718 Ga0207698_10270125 3300026142 Bacteria 1567
719 Ga0207698_10357250 3300026142 Bacteria 1382
720 Ga0207698_11122435 3300026142 Unclassified 799
721 Ga0207428_10003831 3300027907 Bacteria 14426
722 Ga0207428_10078721 3300027907 Bacteria 2579
723 Ga0268266_10034047 3300028379 Bacteria 4331
724 Ga0268266_10275232 3300028379 Bacteria 1564
725 Ga0268265_10082594 3300028380 Unclassified 2541
726 Ga0268265_10093042 3300028380 Bacteria 2414
727 Ga0268265_10209294 3300028380 Bacteria 1698
728 Ga0268265_11477166 3300028380 Unclassified 683
729 Ga0268265_11691359 3300028380 Unclassified 638
730 Ga0268265_12394837 3300028380 Unclassified 534
731 Ga0268264_10223280 3300028381 Bacteria 1735
732 Ga0268264_10232837 3300028381 Bacteria 1702
733 Ga0268264_10260996 3300028381 Unclassified 1614
734 Ga0268264_10276777 3300028381 Bacteria 1570
735 Ga0268264_10909962 3300028381 Bacteria 883
736 Ga0268264_11461448 3300028381 Unclassified 694
737 Ga0268264_11684551 3300028381 Unclassified 645
738 Ga0268264_11893179 3300028381 Bacteria 606
739 Ga0307408_100826890 3300031548 Unclassified 842
740 Ga0307408_101232719 3300031548 Unclassified 699
741 Ga0307405_10443928 3300031731 Unclassified 1027
742 Ga0307405_10479589 3300031731 Unclassified 992
743 Ga0307410_10010140 3300031852 Bacteria 5325
744 Ga0307410_11121230 3300031852 Unclassified 683
745 Ga0307410_11418028 3300031852 Unclassified 610
746 Ga0307406_10049362 3300031901 Unclassified 2663
747 Ga0307406_10628196 3300031901 Unclassified 889
748 Ga0307407_10660409 3300031903 Unclassified 784
749 Ga0307412_10024058 3300031911 Unclassified 3756
750 Ga0307412_10251172 3300031911 Unclassified 1373
751 Ga0307409_100135427 3300031995 Bacteria 2113
752 Ga0307409_101216362 3300031995 Unclassified 777
753 Ga0307416_100329261 3300032002 Unclassified 1534
754 Ga0307416_100480300 3300032002 Unclassified 1302
755 Ga0307416_102969099 3300032002 Unclassified 567
756 Ga0307414_10113158 3300032004 Bacteria 2071
757 Ga0307414_10502658 3300032004 Unclassified 1073
758 Ga0307414_10587700 3300032004 Unclassified 997
759 Ga0307411_10074533 3300032005 Bacteria 2313
760 Ga0307411_10798848 3300032005 Unclassified 831
761 Ga0307415_100282351 3300032126 Unclassified 1366
762 Ga0307415_100443212 3300032126 Unclassified 1120
763 Ga0373942_0107750 3300035207 Unclassified 858
764 Ga0373937_0321865 3300036401 Unclassified 1463
765 Ga0439433_0023973 3300041999 Bacteria 1374
766 Ga0439462_0014736 3300042015 Unclassified 2011
767 Ga0439434_0041954 3300042435 Unclassified 1406
768 Ga0451577_0140340 3300042876 Unclassified 2171
769 Ga0451577_0404706 3300042876 Unclassified 1239
770 Ga0453683_0041509 3300044673 Bacteria 2890
771 Ga0453683_0056484 3300044673 Unclassified 2457
772 Ga0453683_0136873 3300044673 Unclassified 1545
773 Ga0453684_1285112 3300044712 Unclassified 764
774 Ga0453684_1304376 3300044712 Unclassified 757
775 Ga0451576_0029458 3300045051 Archaea 5873
776 Ga0451576_0410233 3300045051 Unclassified 1421
777 Ga0451576_2387108 3300045051 Unclassified 541
778 Ga0495582_0378178 3300046473 Bacteria 816
779 Ga0495598_0172372 3300046537 Unclassified 767
780 Ga0495609_0307542 3300046538 Unclassified 645
781 Ga0495621_0455843 3300046539 Unclassified 548
782 Ga0495658_0097910 3300046683 Bacteria 1747
783 Ga0495669_0194262 3300046684 Bacteria 969
784 Ga0496101_0789078 3300048904 Unclassified 749
785 Ga0496102_0662642 3300048905 Unclassified 967
786 Ga0496102_1676142 3300048905 Unclassified 554
787 Ga0496104_0739462 3300048907 Unclassified 891
788 Ga0496106_0004793 3300048909 Bacteria 10005
789 Ga0496106_1072112 3300048909 Bacteria 632
790 Ga0496107_0080120 3300048910 Bacteria 2381
791 Ga0496107_0327234 3300048910 Bacteria 1140
792 Ga0496110_0922535 3300048913 Unclassified 780
793 Ga0496111_0610611 3300048914 Unclassified 798
794 Ga0496111_1130737 3300048914 Unclassified 557
795 Ga0496112_1721060 3300048915 Unclassified 539
796 Ga0496113_0217710 3300048916 Bacteria 1521
797 Ga0496113_0447418 3300048916 Bacteria 1038
798 Ga0496113_0501304 3300048916 Unclassified 975
799 Ga0496113_1302593 3300048916 Unclassified 565
800 Ga0501310_050247 3300049130 Unclassified 601
801 Ga0501291_002632 3300049514 Bacteria 2170
802 Ga0501292_004413 3300049515 Unclassified 1926
803 Ga0501294_013602 3300049517 Unclassified 826
804 Ga0501296_008480 3300049519 Unclassified 1192
805 Ga0501296_023104 3300049519 Unclassified 804
806 Ga0501297_001243 3300049520 Unclassified 2330
807 Ga0501298_009963 3300049521 Unclassified 1626
808 Ga0501299_002680 3300049522 Bacteria 2489
809 Ga0501312_071016 3300049528 Unclassified 617
810 Ga0501038_0113649 3300049574 Bacteria 2240
811 Ga0501198_002996 3300049649 Bacteria 2301
812 Ga0501198_007421 3300049649 Bacteria 1577
813 Ga0501206_002162 3300049653 Bacteria 2483
814 Ga0501209_022646 3300049656 Unclassified 1509
815 Ga0501216_000852 3300049660 Bacteria 3852
816 Ga0501216_016315 3300049660 Unclassified 1259
817 Ga0501217_008765 3300049661 Bacteria 2191
818 Ga0501217_165647 3300049661 Unclassified 669
819 Ga0501223_018432 3300049663 Unclassified 1373
820 Ga0501223_076697 3300049663 Unclassified 665
821 Ga0501223_090870 3300049663 Bacteria 620
822 Ga0501224_001118 3300049664 Bacteria 3494
823 Ga0501227_001664 3300049665 Bacteria 4951
824 Ga0501227_058698 3300049665 Unclassified 982
825 Ga0501233_013375 3300049668 Unclassified 1662
826 Ga0501233_034465 3300049668 Bacteria 1161
827 Ga0501235_005315 3300049669 Unclassified 2801
828 Ga0501238_035673 3300049671 Unclassified 725
829 Ga0501240_000544 3300049673 Bacteria 3125
830 Ga0501243_017783 3300049675 Unclassified 1154
831 Ga0501246_002739 3300049676 Unclassified 1396
832 Ga0501249_006708 3300049679 Bacteria 2371
833 Ga0501251_080559 3300049681 Unclassified 570
834 Ga0501253_133060 3300049683 Unclassified 613
835 Ga0501256_005331 3300049685 Unclassified 1131
836 Ga0501256_038940 3300049685 Unclassified 559
837 Ga0501259_043382 3300049688 Unclassified 891
838 Ga0501259_164031 3300049688 Unclassified 556
839 Ga0501260_001515 3300049689 Bacteria 1927
840 Ga0501221_006473 3300049704 Unclassified 1983
841 Ga0501221_014700 3300049704 Unclassified 1459
842 Ga0501225_0029635 3300049705 Unclassified 1504
843 Ga0501225_0063380 3300049705 Unclassified 1042
844 Ga0501229_008988 3300049706 Unclassified 1252
845 Ga0501234_005255 3300049707 Bacteria 2026
846 Ga0501234_006234 3300049707 Bacteria 1867
847 Ga0501245_011276 3300049708 Bacteria 1298
848 Ga0501232_036448 3300049757 Unclassified 707
849 Ga0501268_000436 3300049765 Bacteria 4496
850 Ga0501270_071711 3300049767 Unclassified 671
851 Ga0501271_020441 3300049768 Unclassified 766
852 Ga0501275_009284 3300049772 Unclassified 1028
853 Ga0501278_001700 3300049774 Unclassified 1559
854 Ga0501204_005715 3300049850 Unclassified 1370
855 Ga0501212_004834 3300049851 Bacteria 1756
856 Ga0501212_022512 3300049851 Unclassified 983
857 Ga0501226_007950 3300049853 Unclassified 1187
858 nmdc:mga05p37_114956_c1 3300050507 Unclassified 3308
859 nmdc:mga05p37_11964_c2 3300050507 Unclassified 4702
860 nmdc:mga05p37_176825_c1 3300050507 Bacteria 2600
861 nmdc:mga05p37_653436_c1 3300050507 Bacteria 1177
862 nmdc:mga09592_1158470_c1 3300050508 Unclassified 640
863 nmdc:mga06r32_1415684_c1 3300050510 Archaea 637
864 nmdc:mga08y16_1646788_c1 3300050511 Unclassified 598
865 nmdc:mga08y16_180695_c1 3300050511 Bacteria 2191
866 nmdc:mga08y16_560295_c1 3300050511 Unclassified 1156
867 nmdc:mga0n895_243353_c1 3300050512 Unclassified 1826
868 nmdc:mga0n895_278640_c1 3300050512 Bacteria 1696
869 nmdc:mga0n895_422534_c1 3300050512 Bacteria 1347
870 nmdc:mga0n895_62058_c1 3300050512 Bacteria 3692
871 nmdc:mga0n895_79753_c1 3300050512 Bacteria 3260
872 nmdc:mga0n895_834855_c1 3300050512 Unclassified 910
873 nmdc:mga0a205_1498812_c1 3300050515 Unclassified 523
874 nmdc:mga0a205_211437_c1 3300050515 Bacteria 1828
875 nmdc:mga0a205_43932_c1 3300050515 Bacteria 4307
876 nmdc:mga0a205_66588_c1 3300050515 Unclassified 3480
877 nmdc:mga0a205_69857_c1 3300050515 Bacteria 3391
878 nmdc:mga0a205_89674_c1 3300050515 Bacteria 2972

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10335234 Ga0105237_103352343 75
2 3300005330 Ga0070690_100920714 Ga0070690_1009207142 77
3 3300005337 Ga0070682_101792981 Ga0070682_1017929811 77
4 3300005365 Ga0070688_100398923 Ga0070688_1003989231 77
5 3300005444 Ga0070694_100092392 Ga0070694_1000923923 77
6 3300005457 Ga0070662_100356909 Ga0070662_1003569091 77
7 3300005545 Ga0070695_101242033 Ga0070695_1012420331 77
8 3300005617 Ga0068859_100697995 Ga0068859_1006979952 77
9 3300005718 Ga0068866_10378908 Ga0068866_103789082 77
10 3300005842 Ga0068858_100622762 Ga0068858_1006227623 77
11 3300005843 Ga0068860_100073072 Ga0068860_1000730724 77
12 3300006931 Ga0097620_100697985 Ga0097620_1006979852 77
13 3300009098 Ga0105245_11387472 Ga0105245_113874721 77
14 3300009148 Ga0105243_10031300 Ga0105243_100313004 77
15 3300009174 Ga0105241_10109205 Ga0105241_101092051 77
16 3300009176 Ga0105242_10433115 Ga0105242_104331153 77
17 3300046538 Ga0495609_0307542 Ga0495609_0307542_273_563 79
18 3300026088 Ga0207641_10494842 Ga0207641_104948422 80
19 3300014326 Ga0157380_12863915 Ga0157380_128639151 81
20 3300005334 Ga0068869_100007615 Ga0068869_1000076154 82
21 3300005338 Ga0068868_100071761 Ga0068868_1000717612 82
22 3300005341 Ga0070691_10233917 Ga0070691_102339171 82
23 3300005353 Ga0070669_100981855 Ga0070669_1009818551 82
24 3300005364 Ga0070673_100039643 Ga0070673_1000396433 82
25 3300005536 Ga0070697_100073915 Ga0070697_1000739152 82
26 3300005536 Ga0070697_100573754 Ga0070697_1005737541 82
27 3300005544 Ga0070686_101096931 Ga0070686_1010969311 82
28 3300005545 Ga0070695_101290773 Ga0070695_1012907731 82
29 3300005617 Ga0068859_100072286 Ga0068859_1000722866 82
30 3300005719 Ga0068861_100003971 Ga0068861_1000039716 82
31 3300005842 Ga0068858_100036039 Ga0068858_1000360392 82
32 3300006852 Ga0075433_10050623 Ga0075433_100506232 82
33 3300006881 Ga0068865_100808407 Ga0068865_1008084072 82
34 3300006931 Ga0097620_100072284 Ga0097620_1000722846 82
35 3300009098 Ga0105245_10190950 Ga0105245_101909502 82
36 3300009148 Ga0105243_10000318 Ga0105243_1000031824 82
37 3300009174 Ga0105241_10874921 Ga0105241_108749212 82
38 3300009176 Ga0105242_10001437 Ga0105242_1000143710 82
39 3300009177 Ga0105248_10222001 Ga0105248_102220013 82
40 3300009553 Ga0105249_10005195 Ga0105249_100051952 82
41 3300010375 Ga0105239_10046859 Ga0105239_100468594 82
42 3300013102 Ga0157371_10152206 Ga0157371_101522063 82
43 3300013297 Ga0157378_10000679 Ga0157378_1000067918 82
44 3300013297 Ga0157378_10004360 Ga0157378_100043602 82
45 3300013306 Ga0163162_10006297 Ga0163162_1000629710 82
46 3300013308 Ga0157375_10016064 Ga0157375_100160645 82
47 3300014745 Ga0157377_10652202 Ga0157377_106522021 82
48 3300017792 Ga0163161_10466354 Ga0163161_104663543 82
49 3300025901 Ga0207688_10139016 Ga0207688_101390162 82
50 3300025911 Ga0207654_11313743 Ga0207654_113137432 82
51 3300025918 Ga0207662_10387486 Ga0207662_103874862 82
52 3300025918 Ga0207662_10874219 Ga0207662_108742191 82
53 3300025927 Ga0207687_10910470 Ga0207687_109104701 82
54 3300025934 Ga0207686_10001147 Ga0207686_100011473 82
55 3300025935 Ga0207709_10001210 Ga0207709_100012103 82
56 3300025935 Ga0207709_11591332 Ga0207709_115913321 82
57 3300025938 Ga0207704_11076504 Ga0207704_110765041 82
58 3300025941 Ga0207711_10147141 Ga0207711_101471412 82
59 3300025942 Ga0207689_10004428 Ga0207689_100044288 82
60 3300025960 Ga0207651_10112797 Ga0207651_101127972 82
61 3300025981 Ga0207640_10844610 Ga0207640_108446102 82
62 3300026023 Ga0207677_10473065 Ga0207677_104730652 82
63 3300026035 Ga0207703_10077019 Ga0207703_100770191 82
64 3300026089 Ga0207648_11431573 Ga0207648_114315731 82
65 3300026118 Ga0207675_100000187 Ga0207675_10000018717 82
66 3300028381 Ga0268264_10260996 Ga0268264_102609962 82
67 3300042876 Ga0451577_0140340 Ga0451577_0140340_1667_1966 82
68 3300044673 Ga0453683_0041509 Ga0453683_0041509_666_965 82
69 3300044712 Ga0453684_1285112 Ga0453684_1285112_208_507 82
70 3300045051 Ga0451576_0029458 Ga0451576_0029458_586_885 82
71 3300048904 Ga0496101_0789078 Ga0496101_0789078_121_420 82
72 3300048909 Ga0496106_0004793 Ga0496106_0004793_8079_8378 82
73 3300050512 nmdc:mga0n895_278640_c1 nmdc:mga0n895_278640_c1_337_636 82
74 3300050515 nmdc:mga0a205_89674_c1 nmdc:mga0a205_89674_c1_1654_1953 82
75 3300005467 Ga0070706_100007728 Ga0070706_1000077282 83
76 3300005468 Ga0070707_100192223 Ga0070707_1001922232 83
77 3300005536 Ga0070697_101431975 Ga0070697_1014319751 83
78 3300006871 Ga0075434_100094518 Ga0075434_1000945184 83
79 3300025910 Ga0207684_10030926 Ga0207684_100309262 83
80 3300049705 Ga0501225_0029635 Ga0501225_0029635_118_387 83
81 3300050512 nmdc:mga0n895_62058_c1 nmdc:mga0n895_62058_c1_1324_1623 83
82 3300026075 Ga0207708_10173124 Ga0207708_101731241 84
83 3300007788 Ga0099795_10322139 Ga0099795_103221392 85
84 3300009147 Ga0114129_10641907 Ga0114129_106419072 85
85 3300025936 Ga0207670_11739941 Ga0207670_117399412 85
86 3300026075 Ga0207708_11482944 Ga0207708_114829442 85
87 3300050507 nmdc:mga05p37_176825_c1 nmdc:mga05p37_176825_c1_932_1231 85
88 3300005445 Ga0070708_101005998 Ga0070708_1010059982 86
89 3300005471 Ga0070698_101823691 Ga0070698_1018236911 86
90 3300005518 Ga0070699_100189046 Ga0070699_1001890463 86
91 3300005518 Ga0070699_101013701 Ga0070699_1010137012 86
92 3300005536 Ga0070697_100029783 Ga0070697_1000297833 86
93 3300005536 Ga0070697_101788731 Ga0070697_1017887312 86
94 3300005547 Ga0070693_100067641 Ga0070693_1000676412 86
95 3300005577 Ga0068857_102279765 Ga0068857_1022797652 86
96 3300009148 Ga0105243_10944849 Ga0105243_109448492 86
97 3300009176 Ga0105242_10296659 Ga0105242_102966591 86
98 3300013297 Ga0157378_10290592 Ga0157378_102905922 86
99 3300025910 Ga0207684_10390673 Ga0207684_103906731 86
100 3300005353 Ga0070669_101424778 Ga0070669_1014247781 87
101 3300005341 Ga0070691_10622500 Ga0070691_106225001 88
102 3300005353 Ga0070669_100880280 Ga0070669_1008802802 88
103 3300005364 Ga0070673_100914368 Ga0070673_1009143682 88
104 3300005440 Ga0070705_101452650 Ga0070705_1014526501 88
105 3300005444 Ga0070694_101189282 Ga0070694_1011892821 88
106 3300005468 Ga0070707_100955195 Ga0070707_1009551951 88
107 3300005471 Ga0070698_100956787 Ga0070698_1009567871 88
108 3300005549 Ga0070704_100550630 Ga0070704_1005506302 88
109 3300013297 Ga0157378_10874900 Ga0157378_108749002 88
110 3300025923 Ga0207681_10243072 Ga0207681_102430721 88
111 3300005441 Ga0070700_100156737 Ga0070700_1001567374 89
112 3300009094 Ga0111539_11608323 Ga0111539_116083232 89
113 3300014326 Ga0157380_11532048 Ga0157380_115320481 89
114 3300026118 Ga0207675_101704796 Ga0207675_1017047961 89
115 3300032002 Ga0307416_100329261 Ga0307416_1003292613 89
116 3300005456 Ga0070678_100703867 Ga0070678_1007038672 90
117 3300026121 Ga0207683_10646006 Ga0207683_106460062 90
118 3300000531 CNBas_1011925 CNBas_10119252 91
119 3300005290 Ga0065712_10538609 Ga0065712_105386092 91
120 3300005293 Ga0065715_10768037 Ga0065715_107680371 91
121 3300005295 Ga0065707_10002981 Ga0065707_100029816 91
122 3300005334 Ga0068869_100417434 Ga0068869_1004174342 91
123 3300005340 Ga0070689_100349658 Ga0070689_1003496582 91
124 3300005345 Ga0070692_10252286 Ga0070692_102522862 91
125 3300005353 Ga0070669_100577530 Ga0070669_1005775302 91
126 3300005353 Ga0070669_101256046 Ga0070669_1012560461 91
127 3300005354 Ga0070675_100172009 Ga0070675_1001720091 91
128 3300005364 Ga0070673_100859255 Ga0070673_1008592552 91
129 3300005367 Ga0070667_102244271 Ga0070667_1022442711 91
130 3300005438 Ga0070701_10311688 Ga0070701_103116881 91
131 3300005441 Ga0070700_100065335 Ga0070700_1000653352 91
132 3300005444 Ga0070694_100327993 Ga0070694_1003279932 91
133 3300005445 Ga0070708_100305909 Ga0070708_1003059092 91
134 3300005518 Ga0070699_100057560 Ga0070699_1000575605 91
135 3300005544 Ga0070686_100259136 Ga0070686_1002591362 91
136 3300005578 Ga0068854_100697376 Ga0068854_1006973761 91
137 3300005617 Ga0068859_100021317 Ga0068859_1000213175 91
138 3300005617 Ga0068859_100297289 Ga0068859_1002972892 91
139 3300005618 Ga0068864_100064433 Ga0068864_1000644333 91
140 3300005841 Ga0068863_100459297 Ga0068863_1004592973 91
141 3300005843 Ga0068860_101492806 Ga0068860_1014928062 91
142 3300005844 Ga0068862_100118956 Ga0068862_1001189562 91
143 3300006237 Ga0097621_101758584 Ga0097621_1017585842 91
144 3300006844 Ga0075428_100088879 Ga0075428_1000888797 91
145 3300006871 Ga0075434_102520284 Ga0075434_1025202841 91
146 3300006880 Ga0075429_100013208 Ga0075429_1000132082 91
147 3300006881 Ga0068865_100488337 Ga0068865_1004883372 91
148 3300006931 Ga0097620_100021317 Ga0097620_1000213175 91
149 3300006931 Ga0097620_100297266 Ga0097620_1002972662 91
150 3300007265 Ga0099794_10246734 Ga0099794_102467342 91
151 3300017792 Ga0163161_10216153 Ga0163161_102161532 91
152 3300025885 Ga0207653_10000007 Ga0207653_1000000722 91
153 3300025900 Ga0207710_10284773 Ga0207710_102847731 91
154 3300025918 Ga0207662_10365573 Ga0207662_103655732 91
155 3300025923 Ga0207681_10274487 Ga0207681_102744871 91
156 3300025926 Ga0207659_10411911 Ga0207659_104119112 91
157 3300025934 Ga0207686_10308686 Ga0207686_103086861 91
158 3300025935 Ga0207709_10000009 Ga0207709_1000000989 91
159 3300025936 Ga0207670_11335817 Ga0207670_113358171 91
160 3300025941 Ga0207711_10653222 Ga0207711_106532222 91
161 3300025942 Ga0207689_10207489 Ga0207689_102074892 91
162 3300025960 Ga0207651_10073471 Ga0207651_100734713 91
163 3300025961 Ga0207712_10119042 Ga0207712_101190422 91
164 3300025961 Ga0207712_10299555 Ga0207712_102995552 91
165 3300025981 Ga0207640_11806841 Ga0207640_118068411 91
166 3300026075 Ga0207708_10021921 Ga0207708_100219213 91
167 3300026088 Ga0207641_10713953 Ga0207641_107139532 91
168 3300026095 Ga0207676_10028548 Ga0207676_100285487 91
169 3300026118 Ga0207675_100104912 Ga0207675_1001049125 91
170 3300027907 Ga0207428_10003831 Ga0207428_1000383119 91
171 3300028380 Ga0268265_10093042 Ga0268265_100930422 91
172 3300028381 Ga0268264_10223280 Ga0268264_102232803 91
173 3300044673 Ga0453683_0056484 Ga0453683_0056484_801_1097 91
174 3300046537 Ga0495598_0172372 Ga0495598_0172372_88_378 91
175 2162886012 MBSR1b_contig_1406643 MBSR1b_0736.00003950 92
176 3300005290 Ga0065712_10296637 Ga0065712_102966372 92
177 3300005293 Ga0065715_10151441 Ga0065715_101514413 92
178 3300005293 Ga0065715_11086307 Ga0065715_110863072 92
179 3300005295 Ga0065707_10494254 Ga0065707_104942542 92
180 3300005328 Ga0070676_10029420 Ga0070676_100294202 92
181 3300005330 Ga0070690_100511469 Ga0070690_1005114692 92
182 3300005331 Ga0070670_102155785 Ga0070670_1021557852 92
183 3300005334 Ga0068869_100046295 Ga0068869_1000462952 92
184 3300005334 Ga0068869_100050490 Ga0068869_1000504904 92
185 3300005334 Ga0068869_100214311 Ga0068869_1002143113 92
186 3300005335 Ga0070666_10027343 Ga0070666_100273434 92
187 3300005336 Ga0070680_100440711 Ga0070680_1004407112 92
188 3300005337 Ga0070682_100004309 Ga0070682_1000043091 92
189 3300005338 Ga0068868_100008836 Ga0068868_1000088364 92
190 3300005338 Ga0068868_100535836 Ga0068868_1005358361 92
191 3300005340 Ga0070689_100024564 Ga0070689_1000245642 92
192 3300005340 Ga0070689_102213828 Ga0070689_1022138281 92
193 3300005343 Ga0070687_100179326 Ga0070687_1001793262 92
194 3300005343 Ga0070687_100747814 Ga0070687_1007478141 92
195 3300005344 Ga0070661_100050445 Ga0070661_1000504454 92
196 3300005345 Ga0070692_10101095 Ga0070692_101010952 92
197 3300005353 Ga0070669_100588114 Ga0070669_1005881142 92
198 3300005354 Ga0070675_100299695 Ga0070675_1002996952 92
199 3300005355 Ga0070671_100830245 Ga0070671_1008302451 92
200 3300005364 Ga0070673_100092701 Ga0070673_1000927013 92
201 3300005364 Ga0070673_100363648 Ga0070673_1003636482 92
202 3300005364 Ga0070673_100365812 Ga0070673_1003658122 92
203 3300005365 Ga0070688_100942916 Ga0070688_1009429162 92
204 3300005366 Ga0070659_100384354 Ga0070659_1003843541 92
205 3300005367 Ga0070667_100016035 Ga0070667_1000160356 92
206 3300005406 Ga0070703_10473967 Ga0070703_104739671 92
207 3300005438 Ga0070701_10023135 Ga0070701_100231354 92
208 3300005438 Ga0070701_10314143 Ga0070701_103141431 92
209 3300005440 Ga0070705_100003326 Ga0070705_1000033263 92
210 3300005440 Ga0070705_100418967 Ga0070705_1004189672 92
211 3300005441 Ga0070700_100369952 Ga0070700_1003699522 92
212 3300005441 Ga0070700_101853551 Ga0070700_1018535511 92
213 3300005444 Ga0070694_100009516 Ga0070694_1000095166 92
214 3300005444 Ga0070694_100033450 Ga0070694_1000334502 92
215 3300005456 Ga0070678_100382597 Ga0070678_1003825973 92
216 3300005457 Ga0070662_100754410 Ga0070662_1007544101 92
217 3300005459 Ga0068867_100730767 Ga0068867_1007307671 92
218 3300005466 Ga0070685_10089330 Ga0070685_100893302 92
219 3300005471 Ga0070698_100087016 Ga0070698_1000870162 92
220 3300005518 Ga0070699_100854598 Ga0070699_1008545982 92
221 3300005543 Ga0070672_100322591 Ga0070672_1003225913 92
222 3300005543 Ga0070672_100991880 Ga0070672_1009918802 92
223 3300005545 Ga0070695_100093792 Ga0070695_1000937922 92
224 3300005545 Ga0070695_100129941 Ga0070695_1001299414 92
225 3300005546 Ga0070696_100011414 Ga0070696_1000114145 92
226 3300005546 Ga0070696_100634109 Ga0070696_1006341091 92
227 3300005547 Ga0070693_100014900 Ga0070693_1000149002 92
228 3300005547 Ga0070693_100056114 Ga0070693_1000561142 92
229 3300005547 Ga0070693_100327532 Ga0070693_1003275322 92
230 3300005548 Ga0070665_100031997 Ga0070665_1000319976 92
231 3300005549 Ga0070704_100089494 Ga0070704_1000894941 92
232 3300005549 Ga0070704_100247619 Ga0070704_1002476193 92
233 3300005549 Ga0070704_100634247 Ga0070704_1006342472 92
234 3300005564 Ga0070664_100319351 Ga0070664_1003193513 92
235 3300005578 Ga0068854_100251148 Ga0068854_1002511483 92
236 3300005578 Ga0068854_100673784 Ga0068854_1006737842 92
237 3300005615 Ga0070702_100036510 Ga0070702_1000365104 92
238 3300005615 Ga0070702_100072453 Ga0070702_1000724533 92
239 3300005615 Ga0070702_100133746 Ga0070702_1001337462 92
240 3300005616 Ga0068852_100100902 Ga0068852_1001009023 92
241 3300005616 Ga0068852_100122908 Ga0068852_1001229083 92
242 3300005617 Ga0068859_100007875 Ga0068859_1000078755 92
243 3300005617 Ga0068859_100018906 Ga0068859_1000189064 92
244 3300005617 Ga0068859_100395683 Ga0068859_1003956832 92
245 3300005617 Ga0068859_100631924 Ga0068859_1006319242 92
246 3300005618 Ga0068864_100006089 Ga0068864_1000060896 92
247 3300005618 Ga0068864_100015368 Ga0068864_1000153682 92
248 3300005618 Ga0068864_100088642 Ga0068864_1000886423 92
249 3300005618 Ga0068864_100494303 Ga0068864_1004943031 92
250 3300005719 Ga0068861_100177580 Ga0068861_1001775803 92
251 3300005834 Ga0068851_10008858 Ga0068851_100088585 92
252 3300005834 Ga0068851_10263785 Ga0068851_102637852 92
253 3300005840 Ga0068870_10199923 Ga0068870_101999232 92
254 3300005840 Ga0068870_10321325 Ga0068870_103213253 92
255 3300005840 Ga0068870_10417160 Ga0068870_104171601 92
256 3300005841 Ga0068863_100175325 Ga0068863_1001753252 92
257 3300005841 Ga0068863_100258389 Ga0068863_1002583893 92
258 3300005841 Ga0068863_101044610 Ga0068863_1010446102 92
259 3300005842 Ga0068858_100047010 Ga0068858_1000470103 92
260 3300005842 Ga0068858_100052664 Ga0068858_1000526644 92
261 3300005842 Ga0068858_100120538 Ga0068858_1001205384 92
262 3300005843 Ga0068860_100103993 Ga0068860_1001039934 92
263 3300005844 Ga0068862_100132150 Ga0068862_1001321503 92
264 3300005937 Ga0081455_10358536 Ga0081455_103585362 92
265 3300006237 Ga0097621_100002934 Ga0097621_1000029346 92
266 3300006358 Ga0068871_100002200 Ga0068871_1000022007 92
267 3300006844 Ga0075428_102594882 Ga0075428_1025948822 92
268 3300006852 Ga0075433_10008013 Ga0075433_100080136 92
269 3300006852 Ga0075433_10057467 Ga0075433_100574672 92
270 3300006871 Ga0075434_100051099 Ga0075434_1000510992 92
271 3300006871 Ga0075434_101268780 Ga0075434_1012687802 92
272 3300006871 Ga0075434_102548516 Ga0075434_1025485162 92
273 3300006931 Ga0097620_100007875 Ga0097620_1000078755 92
274 3300006931 Ga0097620_100018906 Ga0097620_1000189064 92
275 3300006931 Ga0097620_100395662 Ga0097620_1003956622 92
276 3300006931 Ga0097620_100632051 Ga0097620_1006320512 92
277 3300009011 Ga0105251_10102011 Ga0105251_101020113 92
278 3300009093 Ga0105240_10742268 Ga0105240_107422682 92
279 3300009093 Ga0105240_12513509 Ga0105240_125135091 92
280 3300009094 Ga0111539_10285051 Ga0111539_102850513 92
281 3300009147 Ga0114129_10143244 Ga0114129_101432443 92
282 3300009147 Ga0114129_10221825 Ga0114129_102218254 92
283 3300009148 Ga0105243_10300389 Ga0105243_103003892 92
284 3300009174 Ga0105241_10114218 Ga0105241_101142182 92
285 3300009174 Ga0105241_10569560 Ga0105241_105695602 92
286 3300009174 Ga0105241_10887467 Ga0105241_108874672 92
287 3300009176 Ga0105242_10110788 Ga0105242_101107883 92
288 3300009177 Ga0105248_10001931 Ga0105248_1000193110 92
289 3300009177 Ga0105248_10998927 Ga0105248_109989272 92
290 3300009545 Ga0105237_10000264 Ga0105237_1000026428 92
291 3300009553 Ga0105249_11718089 Ga0105249_117180892 92
292 3300010375 Ga0105239_10165716 Ga0105239_101657163 92
293 3300011119 Ga0105246_10026560 Ga0105246_100265605 92
294 3300011119 Ga0105246_10172242 Ga0105246_101722423 92
295 3300013296 Ga0157374_10048415 Ga0157374_100484152 92
296 3300013297 Ga0157378_10057879 Ga0157378_100578796 92
297 3300013297 Ga0157378_10391757 Ga0157378_103917572 92
298 3300013306 Ga0163162_10173158 Ga0163162_101731583 92
299 3300013306 Ga0163162_10311373 Ga0163162_103113733 92
300 3300013306 Ga0163162_12075002 Ga0163162_120750022 92
301 3300013307 Ga0157372_10064757 Ga0157372_100647574 92
302 3300013307 Ga0157372_11156908 Ga0157372_111569082 92
303 3300013307 Ga0157372_13245896 Ga0157372_132458961 92
304 3300013308 Ga0157375_10108615 Ga0157375_101086154 92
305 3300013308 Ga0157375_10111752 Ga0157375_101117524 92
306 3300013308 Ga0157375_11059192 Ga0157375_110591923 92
307 3300014325 Ga0163163_10007125 Ga0163163_100071254 92
308 3300014325 Ga0163163_10110583 Ga0163163_101105832 92
309 3300014325 Ga0163163_10628610 Ga0163163_106286103 92
310 3300014326 Ga0157380_10189324 Ga0157380_101893243 92
311 3300014326 Ga0157380_11277256 Ga0157380_112772562 92
312 3300014326 Ga0157380_12371594 Ga0157380_123715942 92
313 3300014745 Ga0157377_10125882 Ga0157377_101258823 92
314 3300014968 Ga0157379_10030846 Ga0157379_100308464 92
315 3300014969 Ga0157376_10016049 Ga0157376_100160492 92
316 3300017792 Ga0163161_10483521 Ga0163161_104835212 92
317 3300025321 Ga0207656_10015588 Ga0207656_100155885 92
318 3300025321 Ga0207656_10126172 Ga0207656_101261722 92
319 3300025735 Ga0207713_1235717 Ga0207713_12357172 92
320 3300025885 Ga0207653_10005604 Ga0207653_100056044 92
321 3300025903 Ga0207680_10074275 Ga0207680_100742752 92
322 3300025904 Ga0207647_10161374 Ga0207647_101613743 92
323 3300025904 Ga0207647_10524303 Ga0207647_105243032 92
324 3300025907 Ga0207645_10166097 Ga0207645_101660972 92
325 3300025907 Ga0207645_10503921 Ga0207645_105039212 92
326 3300025908 Ga0207643_10001829 Ga0207643_100018295 92
327 3300025908 Ga0207643_10409698 Ga0207643_104096982 92
328 3300025911 Ga0207654_10158161 Ga0207654_101581613 92
329 3300025913 Ga0207695_10934282 Ga0207695_109342822 92
330 3300025914 Ga0207671_10008288 Ga0207671_100082886 92
331 3300025917 Ga0207660_10385109 Ga0207660_103851092 92
332 3300025918 Ga0207662_10205957 Ga0207662_102059573 92
333 3300025918 Ga0207662_10305816 Ga0207662_103058161 92
334 3300025923 Ga0207681_11527775 Ga0207681_115277751 92
335 3300025925 Ga0207650_10127319 Ga0207650_101273193 92
336 3300025926 Ga0207659_10085671 Ga0207659_100856712 92
337 3300025931 Ga0207644_10117195 Ga0207644_101171953 92
338 3300025932 Ga0207690_10325785 Ga0207690_103257851 92
339 3300025932 Ga0207690_10556621 Ga0207690_105566212 92
340 3300025933 Ga0207706_11064088 Ga0207706_110640881 92
341 3300025934 Ga0207686_10001521 Ga0207686_1000152114 92
342 3300025934 Ga0207686_10798279 Ga0207686_107982791 92
343 3300025935 Ga0207709_10673525 Ga0207709_106735252 92
344 3300025935 Ga0207709_10939701 Ga0207709_109397012 92
345 3300025936 Ga0207670_10002913 Ga0207670_100029139 92
346 3300025936 Ga0207670_10110200 Ga0207670_101102003 92
347 3300025938 Ga0207704_10236882 Ga0207704_102368822 92
348 3300025938 Ga0207704_10934495 Ga0207704_109344952 92
349 3300025940 Ga0207691_10513614 Ga0207691_105136141 92
350 3300025940 Ga0207691_10678931 Ga0207691_106789312 92
351 3300025941 Ga0207711_10012250 Ga0207711_100122506 92
352 3300025941 Ga0207711_10016873 Ga0207711_100168731 92
353 3300025941 Ga0207711_10364444 Ga0207711_103644442 92
354 3300025941 Ga0207711_10772123 Ga0207711_107721232 92
355 3300025942 Ga0207689_10073495 Ga0207689_100734952 92
356 3300025945 Ga0207679_10882642 Ga0207679_108826422 92
357 3300025960 Ga0207651_10822385 Ga0207651_108223852 92
358 3300025960 Ga0207651_11336501 Ga0207651_113365011 92
359 3300025960 Ga0207651_11901424 Ga0207651_119014242 92
360 3300025961 Ga0207712_11278818 Ga0207712_112788181 92
361 3300025981 Ga0207640_10738397 Ga0207640_107383972 92
362 3300025981 Ga0207640_11344160 Ga0207640_113441602 92
363 3300025986 Ga0207658_10020766 Ga0207658_100207664 92
364 3300026023 Ga0207677_10022258 Ga0207677_100222583 92
365 3300026035 Ga0207703_10030729 Ga0207703_100307299 92
366 3300026035 Ga0207703_10094616 Ga0207703_100946164 92
367 3300026035 Ga0207703_12071797 Ga0207703_120717971 92
368 3300026075 Ga0207708_10187692 Ga0207708_101876921 92
369 3300026075 Ga0207708_11912203 Ga0207708_119122032 92
370 3300026088 Ga0207641_10162416 Ga0207641_101624161 92
371 3300026088 Ga0207641_10205718 Ga0207641_102057183 92
372 3300026089 Ga0207648_10188550 Ga0207648_101885502 92
373 3300026089 Ga0207648_10330066 Ga0207648_103300662 92
374 3300026095 Ga0207676_10009127 Ga0207676_100091278 92
375 3300026095 Ga0207676_10108719 Ga0207676_101087193 92
376 3300026095 Ga0207676_10256230 Ga0207676_102562302 92
377 3300026095 Ga0207676_10621736 Ga0207676_106217362 92
378 3300026116 Ga0207674_10037994 Ga0207674_100379943 92
379 3300026116 Ga0207674_10314984 Ga0207674_103149844 92
380 3300026121 Ga0207683_10440588 Ga0207683_104405882 92
381 3300026142 Ga0207698_10226477 Ga0207698_102264771 92
382 3300026142 Ga0207698_10270125 Ga0207698_102701251 92
383 3300028379 Ga0268266_10034047 Ga0268266_100340474 92
384 3300028379 Ga0268266_10275232 Ga0268266_102752323 92
385 3300028380 Ga0268265_10209294 Ga0268265_102092943 92
386 3300028381 Ga0268264_10276777 Ga0268264_102767771 92
387 3300028381 Ga0268264_10909962 Ga0268264_109099621 92
388 3300028381 Ga0268264_11684551 Ga0268264_116845512 92
389 3300036401 Ga0373937_0321865 Ga0373937_0321865_760_1053 92
390 3300041999 Ga0439433_0023973 Ga0439433_0023973_715_1011 92
391 3300042015 Ga0439462_0014736 Ga0439462_0014736_889_1185 92
392 3300042435 Ga0439434_0041954 Ga0439434_0041954_606_902 92
393 3300044673 Ga0453683_0136873 Ga0453683_0136873_732_1028 92
394 3300045051 Ga0451576_2387108 Ga0451576_2387108_215_511 92
395 3300046473 Ga0495582_0378178 Ga0495582_0378178_470_763 92
396 3300046683 Ga0495658_0097910 Ga0495658_0097910_596_889 92
397 3300048905 Ga0496102_0662642 Ga0496102_0662642_458_760 92
398 3300048909 Ga0496106_1072112 Ga0496106_1072112_95_391 92
399 3300048913 Ga0496110_0922535 Ga0496110_0922535_202_495 92
400 3300048914 Ga0496111_0610611 Ga0496111_0610611_37_333 92
401 3300048915 Ga0496112_1721060 Ga0496112_1721060_196_489 92
402 3300048916 Ga0496113_0217710 Ga0496113_0217710_581_883 92
403 3300048916 Ga0496113_0447418 Ga0496113_0447418_90_383 92
404 3300049574 Ga0501038_0113649 Ga0501038_0113649_1614_1910 92
405 3300049663 Ga0501223_090870 Ga0501223_090870_269_565 92
406 3300049668 Ga0501233_034465 Ga0501233_034465_125_421 92
407 3300050507 nmdc:mga05p37_11964_c2 nmdc:mga05p37_11964_c2_211_507 92
408 3300050507 nmdc:mga05p37_653436_c1 nmdc:mga05p37_653436_c1_121_417 92
409 3300050511 nmdc:mga08y16_1646788_c1 nmdc:mga08y16_1646788_c1_164_460 92
410 3300050512 nmdc:mga0n895_243353_c1 nmdc:mga0n895_243353_c1_624_920 92
411 3300050512 nmdc:mga0n895_834855_c1 nmdc:mga0n895_834855_c1_48_344 92
412 3300050515 nmdc:mga0a205_211437_c1 nmdc:mga0a205_211437_c1_951_1247 92
413 3300050515 nmdc:mga0a205_69857_c1 nmdc:mga0a205_69857_c1_1680_1976 92
414 2162886012 MBSR1b_contig_3385735 MBSR1b_0259.00001710 93
415 3300005289 Ga0065704_10166104 Ga0065704_101661043 93
416 3300005290 Ga0065712_10005040 Ga0065712_100050405 93
417 3300005293 Ga0065715_10047621 Ga0065715_100476212 93
418 3300005295 Ga0065707_10147838 Ga0065707_101478383 93
419 3300005330 Ga0070690_100027531 Ga0070690_1000275313 93
420 3300005331 Ga0070670_100380512 Ga0070670_1003805123 93
421 3300005333 Ga0070677_10218516 Ga0070677_102185162 93
422 3300005334 Ga0068869_100031026 Ga0068869_1000310265 93
423 3300005334 Ga0068869_100221420 Ga0068869_1002214201 93
424 3300005335 Ga0070666_10155061 Ga0070666_101550613 93
425 3300005336 Ga0070680_100005787 Ga0070680_1000057879 93
426 3300005337 Ga0070682_100259310 Ga0070682_1002593102 93
427 3300005338 Ga0068868_100089732 Ga0068868_1000897322 93
428 3300005339 Ga0070660_100292179 Ga0070660_1002921791 93
429 3300005340 Ga0070689_101400809 Ga0070689_1014008091 93
430 3300005343 Ga0070687_100099187 Ga0070687_1000991872 93
431 3300005344 Ga0070661_100286860 Ga0070661_1002868602 93
432 3300005344 Ga0070661_100506466 Ga0070661_1005064661 93
433 3300005345 Ga0070692_10016318 Ga0070692_100163183 93
434 3300005345 Ga0070692_10068731 Ga0070692_100687315 93
435 3300005345 Ga0070692_10471635 Ga0070692_104716352 93
436 3300005353 Ga0070669_100265288 Ga0070669_1002652883 93
437 3300005353 Ga0070669_100943334 Ga0070669_1009433342 93
438 3300005354 Ga0070675_100334410 Ga0070675_1003344102 93
439 3300005355 Ga0070671_100027395 Ga0070671_1000273952 93
440 3300005364 Ga0070673_100083222 Ga0070673_1000832224 93
441 3300005364 Ga0070673_100192685 Ga0070673_1001926852 93
442 3300005365 Ga0070688_100019538 Ga0070688_1000195386 93
443 3300005366 Ga0070659_100028338 Ga0070659_1000283384 93
444 3300005367 Ga0070667_100069166 Ga0070667_1000691663 93
445 3300005438 Ga0070701_10033699 Ga0070701_100336993 93
446 3300005440 Ga0070705_100017216 Ga0070705_1000172164 93
447 3300005444 Ga0070694_100103937 Ga0070694_1001039373 93
448 3300005444 Ga0070694_100126246 Ga0070694_1001262463 93
449 3300005455 Ga0070663_100366208 Ga0070663_1003662082 93
450 3300005456 Ga0070678_100028427 Ga0070678_1000284273 93
451 3300005457 Ga0070662_100345425 Ga0070662_1003454251 93
452 3300005458 Ga0070681_10008402 Ga0070681_100084029 93
453 3300005459 Ga0068867_100047917 Ga0068867_1000479173 93
454 3300005471 Ga0070698_100824118 Ga0070698_1008241182 93
455 3300005518 Ga0070699_101140029 Ga0070699_1011400292 93
456 3300005530 Ga0070679_100236447 Ga0070679_1002364471 93
457 3300005535 Ga0070684_100215481 Ga0070684_1002154813 93
458 3300005539 Ga0068853_100311168 Ga0068853_1003111683 93
459 3300005543 Ga0070672_100390632 Ga0070672_1003906323 93
460 3300005544 Ga0070686_100003078 Ga0070686_1000030786 93
461 3300005546 Ga0070696_100338084 Ga0070696_1003380842 93
462 3300005548 Ga0070665_100398630 Ga0070665_1003986301 93
463 3300005549 Ga0070704_102078181 Ga0070704_1020781811 93
464 3300005563 Ga0068855_101208435 Ga0068855_1012084352 93
465 3300005564 Ga0070664_100005565 Ga0070664_1000055659 93
466 3300005564 Ga0070664_100596731 Ga0070664_1005967312 93
467 3300005577 Ga0068857_100004581 Ga0068857_1000045813 93
468 3300005577 Ga0068857_100113003 Ga0068857_1001130032 93
469 3300005578 Ga0068854_100039363 Ga0068854_1000393633 93
470 3300005615 Ga0070702_100099509 Ga0070702_1000995092 93
471 3300005616 Ga0068852_100425659 Ga0068852_1004256592 93
472 3300005617 Ga0068859_100145099 Ga0068859_1001450993 93
473 3300005617 Ga0068859_100207003 Ga0068859_1002070033 93
474 3300005617 Ga0068859_102032671 Ga0068859_1020326712 93
475 3300005618 Ga0068864_100040916 Ga0068864_1000409163 93
476 3300005618 Ga0068864_101073602 Ga0068864_1010736021 93
477 3300005718 Ga0068866_10008901 Ga0068866_100089013 93
478 3300005719 Ga0068861_100040986 Ga0068861_1000409865 93
479 3300005719 Ga0068861_100778348 Ga0068861_1007783481 93
480 3300005841 Ga0068863_100416631 Ga0068863_1004166311 93
481 3300005842 Ga0068858_100010380 Ga0068858_1000103808 93
482 3300005842 Ga0068858_100098077 Ga0068858_1000980774 93
483 3300005843 Ga0068860_100047587 Ga0068860_1000475873 93
484 3300005844 Ga0068862_100012119 Ga0068862_1000121193 93
485 3300005983 Ga0081540_1288456 Ga0081540_12884562 93
486 3300005985 Ga0081539_10179258 Ga0081539_101792582 93
487 3300006237 Ga0097621_100161133 Ga0097621_1001611332 93
488 3300006358 Ga0068871_100109787 Ga0068871_1001097871 93
489 3300006844 Ga0075428_100017311 Ga0075428_1000173112 93
490 3300006847 Ga0075431_102149325 Ga0075431_1021493252 93
491 3300006852 Ga0075433_10012260 Ga0075433_100122606 93
492 3300006852 Ga0075433_10924548 Ga0075433_109245482 93
493 3300006871 Ga0075434_100394075 Ga0075434_1003940752 93
494 3300006881 Ga0068865_100002742 Ga0068865_1000027427 93
495 3300006931 Ga0097620_100145102 Ga0097620_1001451022 93
496 3300006931 Ga0097620_100207000 Ga0097620_1002070003 93
497 3300006931 Ga0097620_102033807 Ga0097620_1020338072 93
498 3300009092 Ga0105250_10064250 Ga0105250_100642502 93
499 3300009094 Ga0111539_10112058 Ga0111539_101120584 93
500 3300009098 Ga0105245_10065278 Ga0105245_100652784 93
501 3300009147 Ga0114129_10059772 Ga0114129_100597726 93
502 3300009148 Ga0105243_10016886 Ga0105243_100168864 93
503 3300009174 Ga0105241_10088421 Ga0105241_100884214 93
504 3300009174 Ga0105241_10397644 Ga0105241_103976443 93
505 3300009176 Ga0105242_10028000 Ga0105242_100280003 93
506 3300009176 Ga0105242_12342458 Ga0105242_123424582 93
507 3300009177 Ga0105248_10087760 Ga0105248_100877602 93
508 3300009177 Ga0105248_10796184 Ga0105248_107961842 93
509 3300009553 Ga0105249_10110974 Ga0105249_101109742 93
510 3300009553 Ga0105249_10258421 Ga0105249_102584214 93
511 3300010375 Ga0105239_10115932 Ga0105239_101159323 93
512 3300011119 Ga0105246_10006555 Ga0105246_100065554 93
513 3300013296 Ga0157374_10222733 Ga0157374_102227333 93
514 3300013297 Ga0157378_10031045 Ga0157378_100310454 93
515 3300013297 Ga0157378_10441303 Ga0157378_104413032 93
516 3300013297 Ga0157378_12108074 Ga0157378_121080741 93
517 3300013306 Ga0163162_10009333 Ga0163162_100093337 93
518 3300013306 Ga0163162_10964984 Ga0163162_109649842 93
519 3300013307 Ga0157372_10332722 Ga0157372_103327223 93
520 3300013308 Ga0157375_11426255 Ga0157375_114262552 93
521 3300013308 Ga0157375_11545980 Ga0157375_115459802 93
522 3300013308 Ga0157375_11971150 Ga0157375_119711502 93
523 3300014325 Ga0163163_10058727 Ga0163163_100587273 93
524 3300014325 Ga0163163_10133794 Ga0163163_101337943 93
525 3300014325 Ga0163163_10142835 Ga0163163_101428353 93
526 3300014325 Ga0163163_12062325 Ga0163163_120623251 93
527 3300014326 Ga0157380_10039822 Ga0157380_100398222 93
528 3300014745 Ga0157377_10034821 Ga0157377_100348215 93
529 3300014968 Ga0157379_11399665 Ga0157379_113996651 93
530 3300014969 Ga0157376_10023330 Ga0157376_100233304 93
531 3300017792 Ga0163161_10041016 Ga0163161_100410163 93
532 3300025315 Ga0207697_10011469 Ga0207697_100114695 93
533 3300025899 Ga0207642_10021395 Ga0207642_100213951 93
534 3300025903 Ga0207680_10107490 Ga0207680_101074904 93
535 3300025904 Ga0207647_10097786 Ga0207647_100977863 93
536 3300025904 Ga0207647_10468030 Ga0207647_104680302 93
537 3300025907 Ga0207645_10045469 Ga0207645_100454692 93
538 3300025912 Ga0207707_10089287 Ga0207707_100892871 93
539 3300025917 Ga0207660_10227126 Ga0207660_102271263 93
540 3300025918 Ga0207662_10069177 Ga0207662_100691772 93
541 3300025919 Ga0207657_10095149 Ga0207657_100951493 93
542 3300025920 Ga0207649_10240720 Ga0207649_102407202 93
543 3300025921 Ga0207652_10098469 Ga0207652_100984694 93
544 3300025923 Ga0207681_10536469 Ga0207681_105364691 93
545 3300025923 Ga0207681_10890791 Ga0207681_108907912 93
546 3300025925 Ga0207650_10963907 Ga0207650_109639071 93
547 3300025926 Ga0207659_10178300 Ga0207659_101783002 93
548 3300025931 Ga0207644_10225070 Ga0207644_102250702 93
549 3300025932 Ga0207690_10013344 Ga0207690_100133441 93
550 3300025933 Ga0207706_10898223 Ga0207706_108982232 93
551 3300025935 Ga0207709_10039349 Ga0207709_100393494 93
552 3300025936 Ga0207670_10135379 Ga0207670_101353791 93
553 3300025937 Ga0207669_10517010 Ga0207669_105170102 93
554 3300025938 Ga0207704_10041191 Ga0207704_100411911 93
555 3300025940 Ga0207691_10010300 Ga0207691_100103006 93
556 3300025941 Ga0207711_10062975 Ga0207711_100629754 93
557 3300025941 Ga0207711_10787371 Ga0207711_107873712 93
558 3300025942 Ga0207689_10012375 Ga0207689_100123754 93
559 3300025942 Ga0207689_10614053 Ga0207689_106140531 93
560 3300025944 Ga0207661_10628059 Ga0207661_106280591 93
561 3300025945 Ga0207679_10005977 Ga0207679_1000597710 93
562 3300025949 Ga0207667_11062423 Ga0207667_110624231 93
563 3300025960 Ga0207651_10224267 Ga0207651_102242673 93
564 3300025960 Ga0207651_10325554 Ga0207651_103255541 93
565 3300025961 Ga0207712_10041059 Ga0207712_100410596 93
566 3300025981 Ga0207640_10326166 Ga0207640_103261662 93
567 3300025986 Ga0207658_10049212 Ga0207658_100492124 93
568 3300026023 Ga0207677_10212281 Ga0207677_102122813 93
569 3300026035 Ga0207703_10271962 Ga0207703_102719623 93
570 3300026041 Ga0207639_10181503 Ga0207639_101815032 93
571 3300026067 Ga0207678_10290034 Ga0207678_102900343 93
572 3300026088 Ga0207641_10144435 Ga0207641_101444352 93
573 3300026089 Ga0207648_10011861 Ga0207648_100118616 93
574 3300026095 Ga0207676_10151530 Ga0207676_101515303 93
575 3300026095 Ga0207676_10165974 Ga0207676_101659743 93
576 3300026116 Ga0207674_10000391 Ga0207674_1000039134 93
577 3300026116 Ga0207674_10440985 Ga0207674_104409852 93
578 3300026118 Ga0207675_100001515 Ga0207675_10000151511 93
579 3300026121 Ga0207683_10028711 Ga0207683_100287114 93
580 3300026142 Ga0207698_10357250 Ga0207698_103572503 93
581 3300028380 Ga0268265_11691359 Ga0268265_116913591 93
582 3300028381 Ga0268264_10232837 Ga0268264_102328373 93
583 3300042876 Ga0451577_0404706 Ga0451577_0404706_491_796 93
584 3300044712 Ga0453684_1304376 Ga0453684_1304376_47_352 93
585 3300045051 Ga0451576_0410233 Ga0451576_0410233_878_1183 93
586 3300046539 Ga0495621_0455843 Ga0495621_0455843_242_535 93
587 3300046684 Ga0495669_0194262 Ga0495669_0194262_100_393 93
588 3300048905 Ga0496102_1676142 Ga0496102_1676142_155_460 93
589 3300049130 Ga0501310_050247 Ga0501310_050247_215_520 93
590 3300049515 Ga0501292_004413 Ga0501292_004413_218_523 93
591 3300049519 Ga0501296_008480 Ga0501296_008480_764_1069 93
592 3300049521 Ga0501298_009963 Ga0501298_009963_922_1227 93
593 3300049528 Ga0501312_071016 Ga0501312_071016_144_449 93
594 3300049649 Ga0501198_007421 Ga0501198_007421_683_988 93
595 3300049660 Ga0501216_016315 Ga0501216_016315_285_590 93
596 3300049661 Ga0501217_165647 Ga0501217_165647_163_468 93
597 3300049663 Ga0501223_018432 Ga0501223_018432_529_834 93
598 3300049664 Ga0501224_001118 Ga0501224_001118_1871_2176 93
599 3300049665 Ga0501227_001664 Ga0501227_001664_1916_2221 93
600 3300049668 Ga0501233_013375 Ga0501233_013375_138_443 93
601 3300049673 Ga0501240_000544 Ga0501240_000544_1184_1489 93
602 3300049675 Ga0501243_017783 Ga0501243_017783_549_854 93
603 3300049676 Ga0501246_002739 Ga0501246_002739_121_426 93
604 3300049683 Ga0501253_133060 Ga0501253_133060_136_441 93
605 3300049685 Ga0501256_038940 Ga0501256_038940_129_434 93
606 3300049688 Ga0501259_043382 Ga0501259_043382_548_853 93
607 3300049689 Ga0501260_001515 Ga0501260_001515_1485_1790 93
608 3300049704 Ga0501221_006473 Ga0501221_006473_369_674 93
609 3300049706 Ga0501229_008988 Ga0501229_008988_377_682 93
610 3300049707 Ga0501234_005255 Ga0501234_005255_592_897 93
611 3300049708 Ga0501245_011276 Ga0501245_011276_651_956 93
612 3300049765 Ga0501268_000436 Ga0501268_000436_1360_1665 93
613 3300049767 Ga0501270_071711 Ga0501270_071711_85_390 93
614 3300049768 Ga0501271_020441 Ga0501271_020441_250_555 93
615 3300049851 Ga0501212_022512 Ga0501212_022512_127_432 93
616 3300049853 Ga0501226_007950 Ga0501226_007950_119_424 93
617 3300050507 nmdc:mga05p37_114956_c1 nmdc:mga05p37_114956_c1_1805_2110 93
618 3300050510 nmdc:mga06r32_1415684_c1 nmdc:mga06r32_1415684_c1_136_441 93
619 3300050511 nmdc:mga08y16_560295_c1 nmdc:mga08y16_560295_c1_267_572 93
620 3300050512 nmdc:mga0n895_422534_c1 nmdc:mga0n895_422534_c1_857_1162 93
621 3300050512 nmdc:mga0n895_79753_c1 nmdc:mga0n895_79753_c1_182_487 93
622 3300050515 nmdc:mga0a205_1498812_c1 nmdc:mga0a205_1498812_c1_110_415 93
623 3300050515 nmdc:mga0a205_43932_c1 nmdc:mga0a205_43932_c1_2146_2451 93
624 3300005288 Ga0065714_10064435 Ga0065714_1006443569 94
625 3300005290 Ga0065712_10000118 Ga0065712_1000011870 94
626 3300005293 Ga0065715_10014122 Ga0065715_100141222 94
627 3300005293 Ga0065715_10088964 Ga0065715_1008896412 94
628 3300005536 Ga0070697_100374935 Ga0070697_1003749352 94
629 3300031731 Ga0307405_10479589 Ga0307405_104795892 94
630 3300031852 Ga0307410_10010140 Ga0307410_100101406 94
631 3300031901 Ga0307406_10049362 Ga0307406_100493623 94
632 3300031911 Ga0307412_10024058 Ga0307412_100240584 94
633 3300031995 Ga0307409_100135427 Ga0307409_1001354273 94
634 3300032002 Ga0307416_100480300 Ga0307416_1004803002 94
635 3300032004 Ga0307414_10113158 Ga0307414_101131582 94
636 3300032005 Ga0307411_10074533 Ga0307411_100745334 94
637 3300032126 Ga0307415_100443212 Ga0307415_1004432122 94
638 3300048910 Ga0496107_0080120 Ga0496107_0080120_1548_1853 94
639 3300048910 Ga0496107_0327234 Ga0496107_0327234_447_752 94
640 3300049514 Ga0501291_002632 Ga0501291_002632_1322_1630 94
641 3300049517 Ga0501294_013602 Ga0501294_013602_305_613 94
642 3300049519 Ga0501296_023104 Ga0501296_023104_292_600 94
643 3300049520 Ga0501297_001243 Ga0501297_001243_921_1229 94
644 3300049522 Ga0501299_002680 Ga0501299_002680_1258_1566 94
645 3300049649 Ga0501198_002996 Ga0501198_002996_1033_1341 94
646 3300049653 Ga0501206_002162 Ga0501206_002162_2162_2470 94
647 3300049656 Ga0501209_022646 Ga0501209_022646_711_1019 94
648 3300049660 Ga0501216_000852 Ga0501216_000852_1239_1547 94
649 3300049661 Ga0501217_008765 Ga0501217_008765_896_1204 94
650 3300049663 Ga0501223_076697 Ga0501223_076697_185_493 94
651 3300049665 Ga0501227_058698 Ga0501227_058698_94_402 94
652 3300049669 Ga0501235_005315 Ga0501235_005315_1064_1372 94
653 3300049671 Ga0501238_035673 Ga0501238_035673_320_628 94
654 3300049679 Ga0501249_006708 Ga0501249_006708_1571_1879 94
655 3300049681 Ga0501251_080559 Ga0501251_080559_68_376 94
656 3300049685 Ga0501256_005331 Ga0501256_005331_469_777 94
657 3300049688 Ga0501259_164031 Ga0501259_164031_236_544 94
658 3300049704 Ga0501221_014700 Ga0501221_014700_194_502 94
659 3300049705 Ga0501225_0063380 Ga0501225_0063380_286_594 94
660 3300049707 Ga0501234_006234 Ga0501234_006234_1081_1389 94
661 3300049757 Ga0501232_036448 Ga0501232_036448_285_593 94
662 3300049772 Ga0501275_009284 Ga0501275_009284_600_908 94
663 3300049774 Ga0501278_001700 Ga0501278_001700_314_622 94
664 3300049850 Ga0501204_005715 Ga0501204_005715_368_676 94
665 3300049851 Ga0501212_004834 Ga0501212_004834_1340_1648 94
666 3300005331 Ga0070670_100062091 Ga0070670_1000620914 95
667 3300005563 Ga0068855_102057399 Ga0068855_1020573991 95
668 3300005577 Ga0068857_101342870 Ga0068857_1013428702 95
669 3300013307 Ga0157372_10315365 Ga0157372_103153651 95
670 3300013308 Ga0157375_10306171 Ga0157375_103061712 95
671 3300025925 Ga0207650_10188670 Ga0207650_101886704 95
672 3300025925 Ga0207650_10593913 Ga0207650_105939132 95
673 3300025949 Ga0207667_11492544 Ga0207667_114925442 95
674 3300031852 Ga0307410_11121230 Ga0307410_111212302 95
675 3300031903 Ga0307407_10660409 Ga0307407_106604091 95
676 3300032004 Ga0307414_10587700 Ga0307414_105877002 95
677 3300032126 Ga0307415_100282351 Ga0307415_1002823512 95
678 2088090001 CNB_F6ESG4R02GJA28 CNB_01007120 96
679 2162886007 SwRhRL2b_contig_1394274 SwRhRL2b_0202.00000890 96
680 3300000532 CNAas_1001055 CNAas_10010552 96
681 3300001904 JGI24736J21556_1013466 JGI24736J21556_10134663 96
682 3300001990 JGI24737J22298_10053525 JGI24737J22298_100535252 96
683 3300005289 Ga0065704_10077444 Ga0065704_100774447 96
684 3300005289 Ga0065704_10288123 Ga0065704_102881231 96
685 3300005290 Ga0065712_10077663 Ga0065712_100776635 96
686 3300005293 Ga0065715_10126787 Ga0065715_101267875 96
687 3300005293 Ga0065715_10147568 Ga0065715_101475683 96
688 3300005293 Ga0065715_10184217 Ga0065715_101842172 96
689 3300005293 Ga0065715_10322335 Ga0065715_103223352 96
690 3300005295 Ga0065707_10086482 Ga0065707_100864826 96
691 3300005295 Ga0065707_10714456 Ga0065707_107144561 96
692 3300005330 Ga0070690_100480542 Ga0070690_1004805422 96
693 3300005330 Ga0070690_100782796 Ga0070690_1007827962 96
694 3300005331 Ga0070670_101398025 Ga0070670_1013980251 96
695 3300005331 Ga0070670_101723564 Ga0070670_1017235641 96
696 3300005334 Ga0068869_100150240 Ga0068869_1001502403 96
697 3300005334 Ga0068869_100940998 Ga0068869_1009409982 96
698 3300005337 Ga0070682_100058537 Ga0070682_1000585373 96
699 3300005341 Ga0070691_10541176 Ga0070691_105411761 96
700 3300005343 Ga0070687_100215779 Ga0070687_1002157792 96
701 3300005345 Ga0070692_10011688 Ga0070692_100116886 96
702 3300005345 Ga0070692_10141019 Ga0070692_101410192 96
703 3300005345 Ga0070692_10450084 Ga0070692_104500842 96
704 3300005355 Ga0070671_100759461 Ga0070671_1007594612 96
705 3300005364 Ga0070673_100461694 Ga0070673_1004616943 96
706 3300005364 Ga0070673_102245339 Ga0070673_1022453391 96
707 3300005366 Ga0070659_100175184 Ga0070659_1001751842 96
708 3300005438 Ga0070701_10332370 Ga0070701_103323702 96
709 3300005438 Ga0070701_10518120 Ga0070701_105181202 96
710 3300005440 Ga0070705_100082743 Ga0070705_1000827432 96
711 3300005440 Ga0070705_100451032 Ga0070705_1004510322 96
712 3300005440 Ga0070705_100573569 Ga0070705_1005735692 96
713 3300005441 Ga0070700_100106143 Ga0070700_1001061432 96
714 3300005441 Ga0070700_100106583 Ga0070700_1001065832 96
715 3300005441 Ga0070700_100142886 Ga0070700_1001428863 96
716 3300005444 Ga0070694_100020624 Ga0070694_1000206244 96
717 3300005459 Ga0068867_100060133 Ga0068867_1000601333 96
718 3300005467 Ga0070706_100337991 Ga0070706_1003379912 96
719 3300005468 Ga0070707_100126752 Ga0070707_1001267523 96
720 3300005471 Ga0070698_100017251 Ga0070698_1000172517 96
721 3300005539 Ga0068853_100964908 Ga0068853_1009649081 96
722 3300005539 Ga0068853_101245951 Ga0068853_1012459511 96
723 3300005545 Ga0070695_100181827 Ga0070695_1001818272 96
724 3300005545 Ga0070695_101229806 Ga0070695_1012298062 96
725 3300005546 Ga0070696_100457168 Ga0070696_1004571681 96
726 3300005546 Ga0070696_100581852 Ga0070696_1005818521 96
727 3300005547 Ga0070693_100052610 Ga0070693_1000526104 96
728 3300005547 Ga0070693_100960661 Ga0070693_1009606611 96
729 3300005549 Ga0070704_100300710 Ga0070704_1003007103 96
730 3300005563 Ga0068855_101086725 Ga0068855_1010867251 96
731 3300005578 Ga0068854_100802087 Ga0068854_1008020872 96
732 3300005578 Ga0068854_101583668 Ga0068854_1015836682 96
733 3300005615 Ga0070702_100007838 Ga0070702_1000078383 96
734 3300005615 Ga0070702_100016078 Ga0070702_1000160783 96
735 3300005615 Ga0070702_100027670 Ga0070702_1000276703 96
736 3300005616 Ga0068852_100711303 Ga0068852_1007113032 96
737 3300005616 Ga0068852_101796051 Ga0068852_1017960512 96
738 3300005616 Ga0068852_102033763 Ga0068852_1020337631 96
739 3300005617 Ga0068859_100084986 Ga0068859_1000849863 96
740 3300005617 Ga0068859_100415098 Ga0068859_1004150983 96
741 3300005617 Ga0068859_100871901 Ga0068859_1008719011 96
742 3300005617 Ga0068859_101042658 Ga0068859_1010426581 96
743 3300005617 Ga0068859_101094000 Ga0068859_1010940001 96
744 3300005617 Ga0068859_102865211 Ga0068859_1028652112 96
745 3300005618 Ga0068864_100108045 Ga0068864_1001080454 96
746 3300005618 Ga0068864_100232781 Ga0068864_1002327814 96
747 3300005618 Ga0068864_101253835 Ga0068864_1012538351 96
748 3300005618 Ga0068864_101579734 Ga0068864_1015797342 96
749 3300005719 Ga0068861_100016173 Ga0068861_1000161733 96
750 3300005719 Ga0068861_101108893 Ga0068861_1011088932 96
751 3300005840 Ga0068870_10042785 Ga0068870_100427853 96
752 3300005840 Ga0068870_10084560 Ga0068870_100845602 96
753 3300005840 Ga0068870_10655528 Ga0068870_106555281 96
754 3300005841 Ga0068863_100144756 Ga0068863_1001447562 96
755 3300005841 Ga0068863_100281389 Ga0068863_1002813893 96
756 3300005841 Ga0068863_100318022 Ga0068863_1003180222 96
757 3300005842 Ga0068858_100073298 Ga0068858_1000732982 96
758 3300005842 Ga0068858_100139543 Ga0068858_1001395432 96
759 3300005843 Ga0068860_100014717 Ga0068860_1000147178 96
760 3300005843 Ga0068860_100038855 Ga0068860_1000388556 96
761 3300005843 Ga0068860_101388501 Ga0068860_1013885011 96
762 3300005844 Ga0068862_100209823 Ga0068862_1002098232 96
763 3300005844 Ga0068862_100881643 Ga0068862_1008816431 96
764 3300005844 Ga0068862_101709812 Ga0068862_1017098121 96
765 3300006237 Ga0097621_100032607 Ga0097621_1000326073 96
766 3300006358 Ga0068871_100000516 Ga0068871_10000051620 96
767 3300006358 Ga0068871_100183442 Ga0068871_1001834423 96
768 3300006358 Ga0068871_101117860 Ga0068871_1011178601 96
769 3300006844 Ga0075428_100368523 Ga0075428_1003685232 96
770 3300006846 Ga0075430_101580639 Ga0075430_1015806392 96
771 3300006871 Ga0075434_100218039 Ga0075434_1002180394 96
772 3300006880 Ga0075429_100805804 Ga0075429_1008058042 96
773 3300006931 Ga0097620_100084998 Ga0097620_1000849983 96
774 3300006931 Ga0097620_100415085 Ga0097620_1004150852 96
775 3300006931 Ga0097620_100871905 Ga0097620_1008719051 96
776 3300006931 Ga0097620_101042772 Ga0097620_1010427721 96
777 3300006931 Ga0097620_101093933 Ga0097620_1010939331 96
778 3300006931 Ga0097620_102865164 Ga0097620_1028651642 96
779 3300009093 Ga0105240_10207866 Ga0105240_102078661 96
780 3300009094 Ga0111539_10009124 Ga0111539_1000912412 96
781 3300009098 Ga0105245_10681008 Ga0105245_106810082 96
782 3300009101 Ga0105247_10367449 Ga0105247_103674491 96
783 3300009147 Ga0114129_10100624 Ga0114129_101006243 96
784 3300009147 Ga0114129_12631927 Ga0114129_126319271 96
785 3300009148 Ga0105243_10023043 Ga0105243_100230434 96
786 3300009148 Ga0105243_10326389 Ga0105243_103263893 96
787 3300009148 Ga0105243_10570034 Ga0105243_105700342 96
788 3300009148 Ga0105243_10854462 Ga0105243_108544621 96
789 3300009174 Ga0105241_10082841 Ga0105241_100828414 96
790 3300009174 Ga0105241_10178643 Ga0105241_101786433 96
791 3300009174 Ga0105241_10508517 Ga0105241_105085172 96
792 3300009177 Ga0105248_10093387 Ga0105248_100933875 96
793 3300009177 Ga0105248_10231318 Ga0105248_102313181 96
794 3300009551 Ga0105238_10199865 Ga0105238_101998653 96
795 3300009553 Ga0105249_10176258 Ga0105249_101762582 96
796 3300009553 Ga0105249_11931629 Ga0105249_119316291 96
797 3300010375 Ga0105239_10952718 Ga0105239_109527182 96
798 3300011119 Ga0105246_11108354 Ga0105246_111083542 96
799 3300013100 Ga0157373_10001007 Ga0157373_100010077 96
800 3300013102 Ga0157371_10182579 Ga0157371_101825793 96
801 3300013306 Ga0163162_10043160 Ga0163162_100431602 96
802 3300013306 Ga0163162_10139253 Ga0163162_101392532 96
803 3300013306 Ga0163162_10972131 Ga0163162_109721312 96
804 3300013308 Ga0157375_10167552 Ga0157375_101675524 96
805 3300013308 Ga0157375_10585151 Ga0157375_105851512 96
806 3300014326 Ga0157380_11471164 Ga0157380_114711642 96
807 3300014745 Ga0157377_10619805 Ga0157377_106198052 96
808 3300014968 Ga0157379_10067552 Ga0157379_100675524 96
809 3300015262 Ga0182007_10048583 Ga0182007_100485832 96
810 3300025885 Ga0207653_10179468 Ga0207653_101794681 96
811 3300025900 Ga0207710_10689298 Ga0207710_106892981 96
812 3300025904 Ga0207647_10002956 Ga0207647_100029569 96
813 3300025908 Ga0207643_10059752 Ga0207643_100597523 96
814 3300025908 Ga0207643_10090640 Ga0207643_100906404 96
815 3300025910 Ga0207684_10386569 Ga0207684_103865691 96
816 3300025911 Ga0207654_10360657 Ga0207654_103606572 96
817 3300025911 Ga0207654_10413801 Ga0207654_104138011 96
818 3300025911 Ga0207654_11145566 Ga0207654_111455662 96
819 3300025912 Ga0207707_10434639 Ga0207707_104346392 96
820 3300025917 Ga0207660_10364606 Ga0207660_103646062 96
821 3300025918 Ga0207662_10073440 Ga0207662_100734402 96
822 3300025918 Ga0207662_10578203 Ga0207662_105782032 96
823 3300025922 Ga0207646_10545600 Ga0207646_105456001 96
824 3300025923 Ga0207681_10538707 Ga0207681_105387071 96
825 3300025924 Ga0207694_10444576 Ga0207694_104445762 96
826 3300025925 Ga0207650_10851124 Ga0207650_108511242 96
827 3300025927 Ga0207687_10935663 Ga0207687_109356631 96
828 3300025931 Ga0207644_11008233 Ga0207644_110082331 96
829 3300025932 Ga0207690_10152284 Ga0207690_101522843 96
830 3300025935 Ga0207709_10001346 Ga0207709_100013463 96
831 3300025936 Ga0207670_11007329 Ga0207670_110073292 96
832 3300025936 Ga0207670_11668617 Ga0207670_116686171 96
833 3300025940 Ga0207691_10953898 Ga0207691_109538982 96
834 3300025941 Ga0207711_10163832 Ga0207711_101638323 96
835 3300025942 Ga0207689_10124716 Ga0207689_101247163 96
836 3300025942 Ga0207689_10512687 Ga0207689_105126873 96
837 3300025942 Ga0207689_10919482 Ga0207689_109194821 96
838 3300025949 Ga0207667_11234200 Ga0207667_112342002 96
839 3300025960 Ga0207651_10496563 Ga0207651_104965631 96
840 3300025981 Ga0207640_10098369 Ga0207640_100983693 96
841 3300026023 Ga0207677_11767162 Ga0207677_117671622 96
842 3300026035 Ga0207703_10445791 Ga0207703_104457912 96
843 3300026041 Ga0207639_10317048 Ga0207639_103170482 96
844 3300026075 Ga0207708_10043381 Ga0207708_100433814 96
845 3300026075 Ga0207708_10062555 Ga0207708_100625555 96
846 3300026075 Ga0207708_10423061 Ga0207708_104230611 96
847 3300026088 Ga0207641_10147528 Ga0207641_101475283 96
848 3300026088 Ga0207641_10759739 Ga0207641_107597392 96
849 3300026089 Ga0207648_10178237 Ga0207648_101782372 96
850 3300026095 Ga0207676_10361846 Ga0207676_103618463 96
851 3300026095 Ga0207676_10717377 Ga0207676_107173771 96
852 3300026118 Ga0207675_100357977 Ga0207675_1003579773 96
853 3300026118 Ga0207675_101050629 Ga0207675_1010506292 96
854 3300026142 Ga0207698_11122435 Ga0207698_111224352 96
855 3300027907 Ga0207428_10078721 Ga0207428_100787214 96
856 3300028380 Ga0268265_10082594 Ga0268265_100825944 96
857 3300028380 Ga0268265_11477166 Ga0268265_114771661 96
858 3300028380 Ga0268265_12394837 Ga0268265_123948371 96
859 3300028381 Ga0268264_11461448 Ga0268264_114614481 96
860 3300028381 Ga0268264_11893179 Ga0268264_118931791 96
861 3300031548 Ga0307408_100826890 Ga0307408_1008268902 96
862 3300031548 Ga0307408_101232719 Ga0307408_1012327191 96
863 3300031731 Ga0307405_10443928 Ga0307405_104439282 96
864 3300031852 Ga0307410_11418028 Ga0307410_114180282 96
865 3300031901 Ga0307406_10628196 Ga0307406_106281962 96
866 3300031911 Ga0307412_10251172 Ga0307412_102511723 96
867 3300031995 Ga0307409_101216362 Ga0307409_1012163622 96
868 3300032002 Ga0307416_102969099 Ga0307416_1029690991 96
869 3300032004 Ga0307414_10502658 Ga0307414_105026582 96
870 3300032005 Ga0307411_10798848 Ga0307411_107988482 96
871 3300035207 Ga0373942_0107750 Ga0373942_0107750_193_501 96
872 3300048907 Ga0496104_0739462 Ga0496104_0739462_502_813 96
873 3300048914 Ga0496111_1130737 Ga0496111_1130737_54_365 96
874 3300048916 Ga0496113_0501304 Ga0496113_0501304_381_692 96
875 3300048916 Ga0496113_1302593 Ga0496113_1302593_47_355 96
876 3300050508 nmdc:mga09592_1158470_c1 nmdc:mga09592_1158470_c1_293_601 96
877 3300050511 nmdc:mga08y16_180695_c1 nmdc:mga08y16_180695_c1_1692_2000 96
878 3300050515 nmdc:mga0a205_66588_c1 nmdc:mga0a205_66588_c1_2251_2559 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04505

CD225

Interferon-induced transmembrane protein

14

92

0.95

Feature Viewer

pLDDT pTM Quality
66.65 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map