F484412
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 878 | 268 | 878 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300001904|JGI24736J21556_1013466|JGI24736J21556_10134663 |
| Length | 103 |
| Sequence | MSQEWTPPPSSGAPVASVPNYLIPAIISLFCCLPLGVVGVIFAAQVNGKVAAGDTVGALDASKKAKLFSFIAIGLGLLGIVGYVLFVVIMGVGMGLAGSSSSF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090001 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 6 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 198 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 199 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 200 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 201 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 202 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 214 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 221 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 222 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 223 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 224 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 225 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 226 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 227 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 230 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 231 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 232 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 233 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 234 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 239 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 240 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 241 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 242 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 243 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 244 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 245 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 246 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 247 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 248 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 250 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 252 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 254 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 255 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 256 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 257 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 258 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 259 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 260 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 261 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 262 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.82 |
| Rhizosphere | 98.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNB_F6ESG4R02GJA28 | 2088090001 | Unclassified | 506 |
| 2 | SwRhRL2b_contig_1394274 | 2162886007 | Unclassified | 3714 |
| 3 | MBSR1b_contig_1406643 | 2162886012 | Bacteria | 906 |
| 4 | MBSR1b_contig_3385735 | 2162886012 | Unclassified | 1385 |
| 5 | CNBas_1011925 | 3300000531 | Unclassified | 539 |
| 6 | CNAas_1001055 | 3300000532 | Bacteria | 2532 |
| 7 | JGI24736J21556_1013466 | 3300001904 | Unclassified | 1321 |
| 8 | JGI24737J22298_10053525 | 3300001990 | Bacteria | 1222 |
| 9 | Ga0065714_10064435 | 3300005288 | Bacteria | 121919 |
| 10 | Ga0065704_10077444 | 3300005289 | Unclassified | 4736 |
| 11 | Ga0065704_10166104 | 3300005289 | Bacteria | 1321 |
| 12 | Ga0065704_10288123 | 3300005289 | Bacteria | 909 |
| 13 | Ga0065712_10000118 | 3300005290 | Bacteria | 121959 |
| 14 | Ga0065712_10005040 | 3300005290 | Bacteria | 4471 |
| 15 | Ga0065712_10077663 | 3300005290 | Bacteria | 3460 |
| 16 | Ga0065712_10296637 | 3300005290 | Bacteria | 867 |
| 17 | Ga0065712_10538609 | 3300005290 | Unclassified | 625 |
| 18 | Ga0065715_10014122 | 3300005293 | Bacteria | 2666 |
| 19 | Ga0065715_10047621 | 3300005293 | Unclassified | 886 |
| 20 | Ga0065715_10088964 | 3300005293 | Bacteria | 19499 |
| 21 | Ga0065715_10126787 | 3300005293 | Unclassified | 2085 |
| 22 | Ga0065715_10147568 | 3300005293 | Bacteria | 1760 |
| 23 | Ga0065715_10151441 | 3300005293 | Bacteria | 1724 |
| 24 | Ga0065715_10184217 | 3300005293 | Unclassified | 1456 |
| 25 | Ga0065715_10322335 | 3300005293 | Bacteria | 999 |
| 26 | Ga0065715_10768037 | 3300005293 | Unclassified | 623 |
| 27 | Ga0065715_11086307 | 3300005293 | Unclassified | 523 |
| 28 | Ga0065707_10002981 | 3300005295 | Bacteria | 5155 |
| 29 | Ga0065707_10086482 | 3300005295 | Bacteria | 5438 |
| 30 | Ga0065707_10147838 | 3300005295 | Bacteria | 1693 |
| 31 | Ga0065707_10494254 | 3300005295 | Bacteria | 762 |
| 32 | Ga0065707_10714456 | 3300005295 | Unclassified | 633 |
| 33 | Ga0070676_10029420 | 3300005328 | Bacteria | 3124 |
| 34 | Ga0070690_100027531 | 3300005330 | Bacteria | 3514 |
| 35 | Ga0070690_100480542 | 3300005330 | Bacteria | 926 |
| 36 | Ga0070690_100511469 | 3300005330 | Bacteria | 900 |
| 37 | Ga0070690_100782796 | 3300005330 | Unclassified | 739 |
| 38 | Ga0070690_100920714 | 3300005330 | Bacteria | 685 |
| 39 | Ga0070670_100062091 | 3300005331 | Unclassified | 3208 |
| 40 | Ga0070670_100380512 | 3300005331 | Bacteria | 1243 |
| 41 | Ga0070670_101398025 | 3300005331 | Bacteria | 642 |
| 42 | Ga0070670_101723564 | 3300005331 | Unclassified | 577 |
| 43 | Ga0070670_102155785 | 3300005331 | Unclassified | 514 |
| 44 | Ga0070677_10218516 | 3300005333 | Bacteria | 929 |
| 45 | Ga0068869_100007615 | 3300005334 | Bacteria | 6931 |
| 46 | Ga0068869_100031026 | 3300005334 | Bacteria | 3758 |
| 47 | Ga0068869_100046295 | 3300005334 | Bacteria | 3136 |
| 48 | Ga0068869_100050490 | 3300005334 | Bacteria | 3015 |
| 49 | Ga0068869_100150240 | 3300005334 | Unclassified | 1806 |
| 50 | Ga0068869_100214311 | 3300005334 | Unclassified | 1524 |
| 51 | Ga0068869_100221420 | 3300005334 | Bacteria | 1500 |
| 52 | Ga0068869_100417434 | 3300005334 | Bacteria | 1106 |
| 53 | Ga0068869_100940998 | 3300005334 | Bacteria | 750 |
| 54 | Ga0070666_10027343 | 3300005335 | Bacteria | 3735 |
| 55 | Ga0070666_10155061 | 3300005335 | Bacteria | 1599 |
| 56 | Ga0070680_100005787 | 3300005336 | Bacteria | 9383 |
| 57 | Ga0070680_100440711 | 3300005336 | Unclassified | 1112 |
| 58 | Ga0070682_100004309 | 3300005337 | Bacteria | 7901 |
| 59 | Ga0070682_100058537 | 3300005337 | Bacteria | 2430 |
| 60 | Ga0070682_100259310 | 3300005337 | Bacteria | 1257 |
| 61 | Ga0070682_101792981 | 3300005337 | Bacteria | 535 |
| 62 | Ga0068868_100008836 | 3300005338 | Bacteria | 7217 |
| 63 | Ga0068868_100071761 | 3300005338 | Bacteria | 2761 |
| 64 | Ga0068868_100089732 | 3300005338 | Bacteria | 2474 |
| 65 | Ga0068868_100535836 | 3300005338 | Bacteria | 1030 |
| 66 | Ga0070660_100292179 | 3300005339 | Bacteria | 1335 |
| 67 | Ga0070689_100024564 | 3300005340 | Bacteria | 4521 |
| 68 | Ga0070689_100349658 | 3300005340 | Bacteria | 1239 |
| 69 | Ga0070689_101400809 | 3300005340 | Unclassified | 631 |
| 70 | Ga0070689_102213828 | 3300005340 | Bacteria | 504 |
| 71 | Ga0070691_10233917 | 3300005341 | Bacteria | 979 |
| 72 | Ga0070691_10541176 | 3300005341 | Unclassified | 679 |
| 73 | Ga0070691_10622500 | 3300005341 | Unclassified | 639 |
| 74 | Ga0070687_100099187 | 3300005343 | Bacteria | 1627 |
| 75 | Ga0070687_100179326 | 3300005343 | Bacteria | 1267 |
| 76 | Ga0070687_100215779 | 3300005343 | Bacteria | 1172 |
| 77 | Ga0070687_100747814 | 3300005343 | Bacteria | 688 |
| 78 | Ga0070661_100050445 | 3300005344 | Bacteria | 3045 |
| 79 | Ga0070661_100286860 | 3300005344 | Bacteria | 1278 |
| 80 | Ga0070661_100506466 | 3300005344 | Bacteria | 967 |
| 81 | Ga0070692_10011688 | 3300005345 | Unclassified | 4037 |
| 82 | Ga0070692_10016318 | 3300005345 | Bacteria | 3531 |
| 83 | Ga0070692_10068731 | 3300005345 | Bacteria | 1883 |
| 84 | Ga0070692_10101095 | 3300005345 | Bacteria | 1580 |
| 85 | Ga0070692_10141019 | 3300005345 | Bacteria | 1364 |
| 86 | Ga0070692_10252286 | 3300005345 | Unclassified | 1057 |
| 87 | Ga0070692_10450084 | 3300005345 | Bacteria | 824 |
| 88 | Ga0070692_10471635 | 3300005345 | Bacteria | 808 |
| 89 | Ga0070669_100265288 | 3300005353 | Bacteria | 1371 |
| 90 | Ga0070669_100577530 | 3300005353 | Bacteria | 940 |
| 91 | Ga0070669_100588114 | 3300005353 | Unclassified | 931 |
| 92 | Ga0070669_100880280 | 3300005353 | Bacteria | 764 |
| 93 | Ga0070669_100943334 | 3300005353 | Bacteria | 738 |
| 94 | Ga0070669_100981855 | 3300005353 | Unclassified | 724 |
| 95 | Ga0070669_101256046 | 3300005353 | Bacteria | 641 |
| 96 | Ga0070669_101424778 | 3300005353 | Unclassified | 601 |
| 97 | Ga0070675_100172009 | 3300005354 | Unclassified | 1868 |
| 98 | Ga0070675_100299695 | 3300005354 | Bacteria | 1416 |
| 99 | Ga0070675_100334410 | 3300005354 | Bacteria | 1340 |
| 100 | Ga0070671_100027395 | 3300005355 | Bacteria | 4691 |
| 101 | Ga0070671_100759461 | 3300005355 | Bacteria | 843 |
| 102 | Ga0070671_100830245 | 3300005355 | Bacteria | 805 |
| 103 | Ga0070673_100039643 | 3300005364 | Bacteria | 3607 |
| 104 | Ga0070673_100083222 | 3300005364 | Bacteria | 2599 |
| 105 | Ga0070673_100092701 | 3300005364 | Bacteria | 2472 |
| 106 | Ga0070673_100192685 | 3300005364 | Bacteria | 1752 |
| 107 | Ga0070673_100363648 | 3300005364 | Unclassified | 1287 |
| 108 | Ga0070673_100365812 | 3300005364 | Bacteria | 1283 |
| 109 | Ga0070673_100461694 | 3300005364 | Unclassified | 1144 |
| 110 | Ga0070673_100859255 | 3300005364 | Unclassified | 840 |
| 111 | Ga0070673_100914368 | 3300005364 | Bacteria | 814 |
| 112 | Ga0070673_102245339 | 3300005364 | Bacteria | 519 |
| 113 | Ga0070688_100019538 | 3300005365 | Bacteria | 3926 |
| 114 | Ga0070688_100398923 | 3300005365 | Bacteria | 1018 |
| 115 | Ga0070688_100942916 | 3300005365 | Bacteria | 683 |
| 116 | Ga0070659_100028338 | 3300005366 | Bacteria | 4324 |
| 117 | Ga0070659_100175184 | 3300005366 | Bacteria | 1759 |
| 118 | Ga0070659_100384354 | 3300005366 | Bacteria | 1183 |
| 119 | Ga0070667_100016035 | 3300005367 | Bacteria | 6198 |
| 120 | Ga0070667_100069166 | 3300005367 | Bacteria | 3004 |
| 121 | Ga0070667_102244271 | 3300005367 | Unclassified | 514 |
| 122 | Ga0070703_10473967 | 3300005406 | Bacteria | 559 |
| 123 | Ga0070701_10023135 | 3300005438 | Bacteria | 2988 |
| 124 | Ga0070701_10033699 | 3300005438 | Bacteria | 2561 |
| 125 | Ga0070701_10311688 | 3300005438 | Bacteria | 971 |
| 126 | Ga0070701_10314143 | 3300005438 | Bacteria | 967 |
| 127 | Ga0070701_10332370 | 3300005438 | Unclassified | 944 |
| 128 | Ga0070701_10518120 | 3300005438 | Unclassified | 777 |
| 129 | Ga0070705_100003326 | 3300005440 | Bacteria | 7890 |
| 130 | Ga0070705_100017216 | 3300005440 | Bacteria | 3769 |
| 131 | Ga0070705_100082743 | 3300005440 | Bacteria | 1976 |
| 132 | Ga0070705_100418967 | 3300005440 | Bacteria | 996 |
| 133 | Ga0070705_100451032 | 3300005440 | Unclassified | 965 |
| 134 | Ga0070705_100573569 | 3300005440 | Unclassified | 869 |
| 135 | Ga0070705_101452650 | 3300005440 | Unclassified | 573 |
| 136 | Ga0070700_100065335 | 3300005441 | Unclassified | 2307 |
| 137 | Ga0070700_100106143 | 3300005441 | Bacteria | 1859 |
| 138 | Ga0070700_100106583 | 3300005441 | Unclassified | 1856 |
| 139 | Ga0070700_100142886 | 3300005441 | Bacteria | 1628 |
| 140 | Ga0070700_100156737 | 3300005441 | Bacteria | 1563 |
| 141 | Ga0070700_100369952 | 3300005441 | Bacteria | 1069 |
| 142 | Ga0070700_101853551 | 3300005441 | Bacteria | 520 |
| 143 | Ga0070694_100009516 | 3300005444 | Bacteria | 5961 |
| 144 | Ga0070694_100020624 | 3300005444 | Bacteria | 4204 |
| 145 | Ga0070694_100033450 | 3300005444 | Bacteria | 3383 |
| 146 | Ga0070694_100092392 | 3300005444 | Bacteria | 2126 |
| 147 | Ga0070694_100103937 | 3300005444 | Bacteria | 2013 |
| 148 | Ga0070694_100126246 | 3300005444 | Bacteria | 1842 |
| 149 | Ga0070694_100327993 | 3300005444 | Unclassified | 1180 |
| 150 | Ga0070694_101189282 | 3300005444 | Unclassified | 638 |
| 151 | Ga0070708_100305909 | 3300005445 | Unclassified | 1497 |
| 152 | Ga0070708_101005998 | 3300005445 | Unclassified | 782 |
| 153 | Ga0070663_100366208 | 3300005455 | Bacteria | 1170 |
| 154 | Ga0070678_100028427 | 3300005456 | Bacteria | 3813 |
| 155 | Ga0070678_100382597 | 3300005456 | Bacteria | 1218 |
| 156 | Ga0070678_100703867 | 3300005456 | Unclassified | 910 |
| 157 | Ga0070662_100345425 | 3300005457 | Unclassified | 1218 |
| 158 | Ga0070662_100356909 | 3300005457 | Bacteria | 1199 |
| 159 | Ga0070662_100754410 | 3300005457 | Bacteria | 825 |
| 160 | Ga0070681_10008402 | 3300005458 | Bacteria | 10109 |
| 161 | Ga0068867_100047917 | 3300005459 | Bacteria | 3143 |
| 162 | Ga0068867_100060133 | 3300005459 | Bacteria | 2818 |
| 163 | Ga0068867_100730767 | 3300005459 | Bacteria | 876 |
| 164 | Ga0070685_10089330 | 3300005466 | Bacteria | 1862 |
| 165 | Ga0070706_100007728 | 3300005467 | Bacteria | 10054 |
| 166 | Ga0070706_100337991 | 3300005467 | Bacteria | 1404 |
| 167 | Ga0070707_100126752 | 3300005468 | Bacteria | 2481 |
| 168 | Ga0070707_100192223 | 3300005468 | Unclassified | 1990 |
| 169 | Ga0070707_100955195 | 3300005468 | Unclassified | 822 |
| 170 | Ga0070698_100017251 | 3300005471 | Bacteria | 7608 |
| 171 | Ga0070698_100087016 | 3300005471 | Unclassified | 3111 |
| 172 | Ga0070698_100824118 | 3300005471 | Unclassified | 872 |
| 173 | Ga0070698_100956787 | 3300005471 | Unclassified | 803 |
| 174 | Ga0070698_101823691 | 3300005471 | Unclassified | 561 |
| 175 | Ga0070699_100057560 | 3300005518 | Unclassified | 3367 |
| 176 | Ga0070699_100189046 | 3300005518 | Bacteria | 1829 |
| 177 | Ga0070699_100854598 | 3300005518 | Bacteria | 833 |
| 178 | Ga0070699_101013701 | 3300005518 | Bacteria | 761 |
| 179 | Ga0070699_101140029 | 3300005518 | Unclassified | 715 |
| 180 | Ga0070679_100236447 | 3300005530 | Bacteria | 1786 |
| 181 | Ga0070684_100215481 | 3300005535 | Bacteria | 1751 |
| 182 | Ga0070697_100029783 | 3300005536 | Bacteria | 4380 |
| 183 | Ga0070697_100073915 | 3300005536 | Unclassified | 2799 |
| 184 | Ga0070697_100374935 | 3300005536 | Bacteria | 1232 |
| 185 | Ga0070697_100573754 | 3300005536 | Bacteria | 990 |
| 186 | Ga0070697_101431975 | 3300005536 | Unclassified | 617 |
| 187 | Ga0070697_101788731 | 3300005536 | Unclassified | 550 |
| 188 | Ga0068853_100311168 | 3300005539 | Bacteria | 1458 |
| 189 | Ga0068853_100964908 | 3300005539 | Unclassified | 820 |
| 190 | Ga0068853_101245951 | 3300005539 | Unclassified | 718 |
| 191 | Ga0070672_100322591 | 3300005543 | Bacteria | 1313 |
| 192 | Ga0070672_100390632 | 3300005543 | Bacteria | 1191 |
| 193 | Ga0070672_100991880 | 3300005543 | Bacteria | 744 |
| 194 | Ga0070686_100003078 | 3300005544 | Bacteria | 9135 |
| 195 | Ga0070686_100259136 | 3300005544 | Unclassified | 1274 |
| 196 | Ga0070686_101096931 | 3300005544 | Unclassified | 657 |
| 197 | Ga0070695_100093792 | 3300005545 | Bacteria | 2009 |
| 198 | Ga0070695_100129941 | 3300005545 | Bacteria | 1735 |
| 199 | Ga0070695_100181827 | 3300005545 | Bacteria | 1490 |
| 200 | Ga0070695_101229806 | 3300005545 | Unclassified | 617 |
| 201 | Ga0070695_101242033 | 3300005545 | Bacteria | 614 |
| 202 | Ga0070695_101290773 | 3300005545 | Unclassified | 603 |
| 203 | Ga0070696_100011414 | 3300005546 | Bacteria | 5951 |
| 204 | Ga0070696_100338084 | 3300005546 | Bacteria | 1163 |
| 205 | Ga0070696_100457168 | 3300005546 | Unclassified | 1008 |
| 206 | Ga0070696_100581852 | 3300005546 | Unclassified | 901 |
| 207 | Ga0070696_100634109 | 3300005546 | Unclassified | 865 |
| 208 | Ga0070693_100014900 | 3300005547 | Bacteria | 3996 |
| 209 | Ga0070693_100052610 | 3300005547 | Unclassified | 2335 |
| 210 | Ga0070693_100056114 | 3300005547 | Bacteria | 2272 |
| 211 | Ga0070693_100067641 | 3300005547 | Bacteria | 2095 |
| 212 | Ga0070693_100327532 | 3300005547 | Unclassified | 1041 |
| 213 | Ga0070693_100960661 | 3300005547 | Unclassified | 644 |
| 214 | Ga0070665_100031997 | 3300005548 | Bacteria | 5295 |
| 215 | Ga0070665_100398630 | 3300005548 | Bacteria | 1384 |
| 216 | Ga0070704_100089494 | 3300005549 | Bacteria | 2290 |
| 217 | Ga0070704_100247619 | 3300005549 | Unclassified | 1462 |
| 218 | Ga0070704_100300710 | 3300005549 | Bacteria | 1337 |
| 219 | Ga0070704_100550630 | 3300005549 | Unclassified | 1008 |
| 220 | Ga0070704_100634247 | 3300005549 | Unclassified | 942 |
| 221 | Ga0070704_102078181 | 3300005549 | Unclassified | 528 |
| 222 | Ga0068855_101086725 | 3300005563 | Unclassified | 837 |
| 223 | Ga0068855_101208435 | 3300005563 | Bacteria | 786 |
| 224 | Ga0068855_102057399 | 3300005563 | Unclassified | 576 |
| 225 | Ga0070664_100005565 | 3300005564 | Bacteria | 10120 |
| 226 | Ga0070664_100319351 | 3300005564 | Bacteria | 1407 |
| 227 | Ga0070664_100596731 | 3300005564 | Bacteria | 1024 |
| 228 | Ga0068857_100004581 | 3300005577 | Bacteria | 11707 |
| 229 | Ga0068857_100113003 | 3300005577 | Bacteria | 2442 |
| 230 | Ga0068857_101342870 | 3300005577 | Unclassified | 695 |
| 231 | Ga0068857_102279765 | 3300005577 | Bacteria | 532 |
| 232 | Ga0068854_100039363 | 3300005578 | Bacteria | 3330 |
| 233 | Ga0068854_100251148 | 3300005578 | Bacteria | 1412 |
| 234 | Ga0068854_100673784 | 3300005578 | Bacteria | 890 |
| 235 | Ga0068854_100697376 | 3300005578 | Unclassified | 876 |
| 236 | Ga0068854_100802087 | 3300005578 | Unclassified | 821 |
| 237 | Ga0068854_101583668 | 3300005578 | Viruses | 596 |
| 238 | Ga0070702_100007838 | 3300005615 | Bacteria | 5134 |
| 239 | Ga0070702_100016078 | 3300005615 | Unclassified | 3832 |
| 240 | Ga0070702_100027670 | 3300005615 | Bacteria | 3063 |
| 241 | Ga0070702_100036510 | 3300005615 | Bacteria | 2723 |
| 242 | Ga0070702_100072453 | 3300005615 | Unclassified | 2039 |
| 243 | Ga0070702_100099509 | 3300005615 | Bacteria | 1781 |
| 244 | Ga0070702_100133746 | 3300005615 | Bacteria | 1570 |
| 245 | Ga0068852_100100902 | 3300005616 | Bacteria | 2605 |
| 246 | Ga0068852_100122908 | 3300005616 | Bacteria | 2380 |
| 247 | Ga0068852_100425659 | 3300005616 | Unclassified | 1310 |
| 248 | Ga0068852_100711303 | 3300005616 | Unclassified | 1015 |
| 249 | Ga0068852_101796051 | 3300005616 | Bacteria | 635 |
| 250 | Ga0068852_102033763 | 3300005616 | Unclassified | 596 |
| 251 | Ga0068859_100007875 | 3300005617 | Bacteria | 10812 |
| 252 | Ga0068859_100018906 | 3300005617 | Bacteria | 6921 |
| 253 | Ga0068859_100021317 | 3300005617 | Bacteria | 6502 |
| 254 | Ga0068859_100072286 | 3300005617 | Unclassified | 3486 |
| 255 | Ga0068859_100084986 | 3300005617 | Bacteria | 3209 |
| 256 | Ga0068859_100145099 | 3300005617 | Bacteria | 2448 |
| 257 | Ga0068859_100207003 | 3300005617 | Bacteria | 2047 |
| 258 | Ga0068859_100297289 | 3300005617 | Unclassified | 1708 |
| 259 | Ga0068859_100395683 | 3300005617 | Bacteria | 1477 |
| 260 | Ga0068859_100415098 | 3300005617 | Bacteria | 1442 |
| 261 | Ga0068859_100631924 | 3300005617 | Unclassified | 1163 |
| 262 | Ga0068859_100697995 | 3300005617 | Bacteria | 1105 |
| 263 | Ga0068859_100871901 | 3300005617 | Unclassified | 986 |
| 264 | Ga0068859_101042658 | 3300005617 | Unclassified | 899 |
| 265 | Ga0068859_101094000 | 3300005617 | Unclassified | 877 |
| 266 | Ga0068859_102032671 | 3300005617 | Unclassified | 634 |
| 267 | Ga0068859_102865211 | 3300005617 | Unclassified | 529 |
| 268 | Ga0068864_100006089 | 3300005618 | Bacteria | 9896 |
| 269 | Ga0068864_100015368 | 3300005618 | Bacteria | 6364 |
| 270 | Ga0068864_100040916 | 3300005618 | Bacteria | 3963 |
| 271 | Ga0068864_100064433 | 3300005618 | Unclassified | 3178 |
| 272 | Ga0068864_100088642 | 3300005618 | Bacteria | 2725 |
| 273 | Ga0068864_100108045 | 3300005618 | Unclassified | 2475 |
| 274 | Ga0068864_100232781 | 3300005618 | Bacteria | 1704 |
| 275 | Ga0068864_100494303 | 3300005618 | Unclassified | 1176 |
| 276 | Ga0068864_101073602 | 3300005618 | Bacteria | 800 |
| 277 | Ga0068864_101253835 | 3300005618 | Unclassified | 741 |
| 278 | Ga0068864_101579734 | 3300005618 | Unclassified | 660 |
| 279 | Ga0068866_10008901 | 3300005718 | Bacteria | 4248 |
| 280 | Ga0068866_10378908 | 3300005718 | Bacteria | 907 |
| 281 | Ga0068861_100003971 | 3300005719 | Bacteria | 9906 |
| 282 | Ga0068861_100016173 | 3300005719 | Bacteria | 5273 |
| 283 | Ga0068861_100040986 | 3300005719 | Bacteria | 3466 |
| 284 | Ga0068861_100177580 | 3300005719 | Bacteria | 1770 |
| 285 | Ga0068861_100778348 | 3300005719 | Unclassified | 896 |
| 286 | Ga0068861_101108893 | 3300005719 | Unclassified | 761 |
| 287 | Ga0068851_10008858 | 3300005834 | Bacteria | 4666 |
| 288 | Ga0068851_10263785 | 3300005834 | Bacteria | 980 |
| 289 | Ga0068870_10042785 | 3300005840 | Bacteria | 2359 |
| 290 | Ga0068870_10084560 | 3300005840 | Unclassified | 1761 |
| 291 | Ga0068870_10199923 | 3300005840 | Unclassified | 1211 |
| 292 | Ga0068870_10321325 | 3300005840 | Unclassified | 983 |
| 293 | Ga0068870_10417160 | 3300005840 | Unclassified | 877 |
| 294 | Ga0068870_10655528 | 3300005840 | Bacteria | 719 |
| 295 | Ga0068863_100144756 | 3300005841 | Bacteria | 2272 |
| 296 | Ga0068863_100175325 | 3300005841 | Unclassified | 2057 |
| 297 | Ga0068863_100258389 | 3300005841 | Bacteria | 1683 |
| 298 | Ga0068863_100281389 | 3300005841 | Unclassified | 1612 |
| 299 | Ga0068863_100318022 | 3300005841 | Bacteria | 1511 |
| 300 | Ga0068863_100416631 | 3300005841 | Bacteria | 1315 |
| 301 | Ga0068863_100459297 | 3300005841 | Bacteria | 1250 |
| 302 | Ga0068863_101044610 | 3300005841 | Unclassified | 821 |
| 303 | Ga0068858_100010380 | 3300005842 | Bacteria | 8824 |
| 304 | Ga0068858_100036039 | 3300005842 | Bacteria | 4587 |
| 305 | Ga0068858_100047010 | 3300005842 | Bacteria | 4002 |
| 306 | Ga0068858_100052664 | 3300005842 | Bacteria | 3765 |
| 307 | Ga0068858_100073298 | 3300005842 | Bacteria | 3179 |
| 308 | Ga0068858_100098077 | 3300005842 | Bacteria | 2732 |
| 309 | Ga0068858_100120538 | 3300005842 | Unclassified | 2453 |
| 310 | Ga0068858_100139543 | 3300005842 | Unclassified | 2275 |
| 311 | Ga0068858_100622762 | 3300005842 | Bacteria | 1048 |
| 312 | Ga0068860_100014717 | 3300005843 | Bacteria | 7651 |
| 313 | Ga0068860_100038855 | 3300005843 | Unclassified | 4553 |
| 314 | Ga0068860_100047587 | 3300005843 | Bacteria | 4087 |
| 315 | Ga0068860_100073072 | 3300005843 | Unclassified | 3260 |
| 316 | Ga0068860_100103993 | 3300005843 | Bacteria | 2711 |
| 317 | Ga0068860_101388501 | 3300005843 | Bacteria | 723 |
| 318 | Ga0068860_101492806 | 3300005843 | Unclassified | 698 |
| 319 | Ga0068862_100012119 | 3300005844 | Bacteria | 7125 |
| 320 | Ga0068862_100118956 | 3300005844 | Bacteria | 2326 |
| 321 | Ga0068862_100132150 | 3300005844 | Bacteria | 2209 |
| 322 | Ga0068862_100209823 | 3300005844 | Unclassified | 1759 |
| 323 | Ga0068862_100881643 | 3300005844 | Unclassified | 879 |
| 324 | Ga0068862_101709812 | 3300005844 | Unclassified | 637 |
| 325 | Ga0081455_10358536 | 3300005937 | Bacteria | 1026 |
| 326 | Ga0081540_1288456 | 3300005983 | Unclassified | 565 |
| 327 | Ga0081539_10179258 | 3300005985 | Bacteria | 995 |
| 328 | Ga0097621_100002934 | 3300006237 | Bacteria | 11721 |
| 329 | Ga0097621_100032607 | 3300006237 | Unclassified | 4143 |
| 330 | Ga0097621_100161133 | 3300006237 | Bacteria | 1928 |
| 331 | Ga0097621_101758584 | 3300006237 | Unclassified | 591 |
| 332 | Ga0068871_100000516 | 3300006358 | Bacteria | 26474 |
| 333 | Ga0068871_100002200 | 3300006358 | Bacteria | 13254 |
| 334 | Ga0068871_100109787 | 3300006358 | Bacteria | 2319 |
| 335 | Ga0068871_100183442 | 3300006358 | Bacteria | 1799 |
| 336 | Ga0068871_101117860 | 3300006358 | Unclassified | 737 |
| 337 | Ga0075428_100017311 | 3300006844 | Bacteria | 7965 |
| 338 | Ga0075428_100088879 | 3300006844 | Unclassified | 3370 |
| 339 | Ga0075428_100368523 | 3300006844 | Archaea | 1541 |
| 340 | Ga0075428_102594882 | 3300006844 | Unclassified | 518 |
| 341 | Ga0075430_101580639 | 3300006846 | Unclassified | 538 |
| 342 | Ga0075431_102149325 | 3300006847 | Archaea | 513 |
| 343 | Ga0075433_10008013 | 3300006852 | Bacteria | 8412 |
| 344 | Ga0075433_10012260 | 3300006852 | Bacteria | 6912 |
| 345 | Ga0075433_10050623 | 3300006852 | Bacteria | 3616 |
| 346 | Ga0075433_10057467 | 3300006852 | Bacteria | 3401 |
| 347 | Ga0075433_10924548 | 3300006852 | Unclassified | 761 |
| 348 | Ga0075434_100051099 | 3300006871 | Unclassified | 4107 |
| 349 | Ga0075434_100094518 | 3300006871 | Bacteria | 2994 |
| 350 | Ga0075434_100218039 | 3300006871 | Bacteria | 1928 |
| 351 | Ga0075434_100394075 | 3300006871 | Unclassified | 1406 |
| 352 | Ga0075434_101268780 | 3300006871 | Unclassified | 748 |
| 353 | Ga0075434_102520284 | 3300006871 | Unclassified | 515 |
| 354 | Ga0075434_102548516 | 3300006871 | Unclassified | 512 |
| 355 | Ga0075429_100013208 | 3300006880 | Bacteria | 7164 |
| 356 | Ga0075429_100805804 | 3300006880 | Unclassified | 822 |
| 357 | Ga0068865_100002742 | 3300006881 | Bacteria | 10464 |
| 358 | Ga0068865_100488337 | 3300006881 | Bacteria | 1025 |
| 359 | Ga0068865_100808407 | 3300006881 | Unclassified | 809 |
| 360 | Ga0097620_100007875 | 3300006931 | Bacteria | 10812 |
| 361 | Ga0097620_100018906 | 3300006931 | Bacteria | 6921 |
| 362 | Ga0097620_100021317 | 3300006931 | Bacteria | 6502 |
| 363 | Ga0097620_100072284 | 3300006931 | Unclassified | 3486 |
| 364 | Ga0097620_100084998 | 3300006931 | Bacteria | 3209 |
| 365 | Ga0097620_100145102 | 3300006931 | Bacteria | 2448 |
| 366 | Ga0097620_100207000 | 3300006931 | Bacteria | 2047 |
| 367 | Ga0097620_100297266 | 3300006931 | Unclassified | 1708 |
| 368 | Ga0097620_100395662 | 3300006931 | Bacteria | 1477 |
| 369 | Ga0097620_100415085 | 3300006931 | Bacteria | 1442 |
| 370 | Ga0097620_100632051 | 3300006931 | Unclassified | 1163 |
| 371 | Ga0097620_100697985 | 3300006931 | Bacteria | 1105 |
| 372 | Ga0097620_100871905 | 3300006931 | Unclassified | 986 |
| 373 | Ga0097620_101042772 | 3300006931 | Unclassified | 899 |
| 374 | Ga0097620_101093933 | 3300006931 | Unclassified | 877 |
| 375 | Ga0097620_102033807 | 3300006931 | Unclassified | 634 |
| 376 | Ga0097620_102865164 | 3300006931 | Unclassified | 529 |
| 377 | Ga0099794_10246734 | 3300007265 | Unclassified | 920 |
| 378 | Ga0099795_10322139 | 3300007788 | Unclassified | 685 |
| 379 | Ga0105251_10102011 | 3300009011 | Unclassified | 1311 |
| 380 | Ga0105250_10064250 | 3300009092 | Unclassified | 1478 |
| 381 | Ga0105240_10207866 | 3300009093 | Unclassified | 2289 |
| 382 | Ga0105240_10742268 | 3300009093 | Unclassified | 1068 |
| 383 | Ga0105240_12513509 | 3300009093 | Unclassified | 532 |
| 384 | Ga0111539_10009124 | 3300009094 | Bacteria | 12549 |
| 385 | Ga0111539_10112058 | 3300009094 | Bacteria | 3201 |
| 386 | Ga0111539_10285051 | 3300009094 | Unclassified | 1922 |
| 387 | Ga0111539_11608323 | 3300009094 | Unclassified | 754 |
| 388 | Ga0105245_10065278 | 3300009098 | Bacteria | 3291 |
| 389 | Ga0105245_10190950 | 3300009098 | Unclassified | 1962 |
| 390 | Ga0105245_10681008 | 3300009098 | Unclassified | 1060 |
| 391 | Ga0105245_11387472 | 3300009098 | Bacteria | 752 |
| 392 | Ga0105247_10367449 | 3300009101 | Bacteria | 1016 |
| 393 | Ga0114129_10059772 | 3300009147 | Bacteria | 5328 |
| 394 | Ga0114129_10100624 | 3300009147 | Bacteria | 4000 |
| 395 | Ga0114129_10143244 | 3300009147 | Unclassified | 3275 |
| 396 | Ga0114129_10221825 | 3300009147 | Bacteria | 2550 |
| 397 | Ga0114129_10641907 | 3300009147 | Bacteria | 1371 |
| 398 | Ga0114129_12631927 | 3300009147 | Unclassified | 600 |
| 399 | Ga0105243_10000318 | 3300009148 | Bacteria | 53066 |
| 400 | Ga0105243_10016886 | 3300009148 | Bacteria | 5519 |
| 401 | Ga0105243_10023043 | 3300009148 | Bacteria | 4737 |
| 402 | Ga0105243_10031300 | 3300009148 | Unclassified | 4101 |
| 403 | Ga0105243_10300389 | 3300009148 | Unclassified | 1455 |
| 404 | Ga0105243_10326389 | 3300009148 | Bacteria | 1400 |
| 405 | Ga0105243_10570034 | 3300009148 | Unclassified | 1085 |
| 406 | Ga0105243_10854462 | 3300009148 | Bacteria | 901 |
| 407 | Ga0105243_10944849 | 3300009148 | Unclassified | 861 |
| 408 | Ga0105241_10082841 | 3300009174 | Bacteria | 2515 |
| 409 | Ga0105241_10088421 | 3300009174 | Bacteria | 2440 |
| 410 | Ga0105241_10109205 | 3300009174 | Bacteria | 2212 |
| 411 | Ga0105241_10114218 | 3300009174 | Unclassified | 2166 |
| 412 | Ga0105241_10178643 | 3300009174 | Unclassified | 1759 |
| 413 | Ga0105241_10397644 | 3300009174 | Bacteria | 1208 |
| 414 | Ga0105241_10508517 | 3300009174 | Unclassified | 1075 |
| 415 | Ga0105241_10569560 | 3300009174 | Bacteria | 1019 |
| 416 | Ga0105241_10874921 | 3300009174 | Unclassified | 833 |
| 417 | Ga0105241_10887467 | 3300009174 | Unclassified | 827 |
| 418 | Ga0105242_10001437 | 3300009176 | Bacteria | 18752 |
| 419 | Ga0105242_10028000 | 3300009176 | Bacteria | 4482 |
| 420 | Ga0105242_10110788 | 3300009176 | Bacteria | 2339 |
| 421 | Ga0105242_10296659 | 3300009176 | Bacteria | 1474 |
| 422 | Ga0105242_10433115 | 3300009176 | Bacteria | 1235 |
| 423 | Ga0105242_12342458 | 3300009176 | Unclassified | 581 |
| 424 | Ga0105248_10001931 | 3300009177 | Bacteria | 23033 |
| 425 | Ga0105248_10087760 | 3300009177 | Bacteria | 3501 |
| 426 | Ga0105248_10093387 | 3300009177 | Bacteria | 3388 |
| 427 | Ga0105248_10222001 | 3300009177 | Unclassified | 2127 |
| 428 | Ga0105248_10231318 | 3300009177 | Bacteria | 2081 |
| 429 | Ga0105248_10796184 | 3300009177 | Unclassified | 1067 |
| 430 | Ga0105248_10998927 | 3300009177 | Bacteria | 945 |
| 431 | Ga0105237_10000264 | 3300009545 | Bacteria | 73957 |
| 432 | Ga0105237_10335234 | 3300009545 | Bacteria | 1517 |
| 433 | Ga0105238_10199865 | 3300009551 | Unclassified | 1974 |
| 434 | Ga0105249_10005195 | 3300009553 | Bacteria | 11237 |
| 435 | Ga0105249_10110974 | 3300009553 | Bacteria | 2592 |
| 436 | Ga0105249_10176258 | 3300009553 | Bacteria | 2077 |
| 437 | Ga0105249_10258421 | 3300009553 | Unclassified | 1729 |
| 438 | Ga0105249_11718089 | 3300009553 | Unclassified | 700 |
| 439 | Ga0105249_11931629 | 3300009553 | Unclassified | 663 |
| 440 | Ga0105239_10046859 | 3300010375 | Bacteria | 4736 |
| 441 | Ga0105239_10115932 | 3300010375 | Bacteria | 2972 |
| 442 | Ga0105239_10165716 | 3300010375 | Bacteria | 2471 |
| 443 | Ga0105239_10952718 | 3300010375 | Bacteria | 986 |
| 444 | Ga0105246_10006555 | 3300011119 | Bacteria | 7108 |
| 445 | Ga0105246_10026560 | 3300011119 | Bacteria | 3785 |
| 446 | Ga0105246_10172242 | 3300011119 | Unclassified | 1659 |
| 447 | Ga0105246_11108354 | 3300011119 | Unclassified | 723 |
| 448 | Ga0157373_10001007 | 3300013100 | Bacteria | 21766 |
| 449 | Ga0157371_10152206 | 3300013102 | Bacteria | 1650 |
| 450 | Ga0157371_10182579 | 3300013102 | Bacteria | 1501 |
| 451 | Ga0157374_10048415 | 3300013296 | Bacteria | 3944 |
| 452 | Ga0157374_10222733 | 3300013296 | Bacteria | 1851 |
| 453 | Ga0157378_10000679 | 3300013297 | Bacteria | 31993 |
| 454 | Ga0157378_10004360 | 3300013297 | Bacteria | 12453 |
| 455 | Ga0157378_10031045 | 3300013297 | Bacteria | 4718 |
| 456 | Ga0157378_10057879 | 3300013297 | Bacteria | 3455 |
| 457 | Ga0157378_10290592 | 3300013297 | Bacteria | 1579 |
| 458 | Ga0157378_10391757 | 3300013297 | Bacteria | 1367 |
| 459 | Ga0157378_10441303 | 3300013297 | Unclassified | 1290 |
| 460 | Ga0157378_10874900 | 3300013297 | Unclassified | 928 |
| 461 | Ga0157378_12108074 | 3300013297 | Unclassified | 614 |
| 462 | Ga0163162_10006297 | 3300013306 | Bacteria | 11494 |
| 463 | Ga0163162_10009333 | 3300013306 | Bacteria | 9539 |
| 464 | Ga0163162_10043160 | 3300013306 | Unclassified | 4515 |
| 465 | Ga0163162_10139253 | 3300013306 | Bacteria | 2539 |
| 466 | Ga0163162_10173158 | 3300013306 | Bacteria | 2283 |
| 467 | Ga0163162_10311373 | 3300013306 | Bacteria | 1707 |
| 468 | Ga0163162_10964984 | 3300013306 | Bacteria | 963 |
| 469 | Ga0163162_10972131 | 3300013306 | Bacteria | 959 |
| 470 | Ga0163162_12075002 | 3300013306 | Unclassified | 652 |
| 471 | Ga0157372_10064757 | 3300013307 | Bacteria | 4102 |
| 472 | Ga0157372_10315365 | 3300013307 | Unclassified | 1820 |
| 473 | Ga0157372_10332722 | 3300013307 | Bacteria | 1769 |
| 474 | Ga0157372_11156908 | 3300013307 | Bacteria | 894 |
| 475 | Ga0157372_13245896 | 3300013307 | Unclassified | 518 |
| 476 | Ga0157375_10016064 | 3300013308 | Bacteria | 6716 |
| 477 | Ga0157375_10108615 | 3300013308 | Bacteria | 2869 |
| 478 | Ga0157375_10111752 | 3300013308 | Bacteria | 2832 |
| 479 | Ga0157375_10167552 | 3300013308 | Bacteria | 2342 |
| 480 | Ga0157375_10306171 | 3300013308 | Bacteria | 1753 |
| 481 | Ga0157375_10585151 | 3300013308 | Unclassified | 1276 |
| 482 | Ga0157375_11059192 | 3300013308 | Bacteria | 948 |
| 483 | Ga0157375_11426255 | 3300013308 | Unclassified | 816 |
| 484 | Ga0157375_11545980 | 3300013308 | Unclassified | 784 |
| 485 | Ga0157375_11971150 | 3300013308 | Unclassified | 694 |
| 486 | Ga0163163_10007125 | 3300014325 | Bacteria | 9831 |
| 487 | Ga0163163_10058727 | 3300014325 | Bacteria | 3804 |
| 488 | Ga0163163_10110583 | 3300014325 | Unclassified | 2776 |
| 489 | Ga0163163_10133794 | 3300014325 | Bacteria | 2520 |
| 490 | Ga0163163_10142835 | 3300014325 | Unclassified | 2436 |
| 491 | Ga0163163_10628610 | 3300014325 | Bacteria | 1137 |
| 492 | Ga0163163_12062325 | 3300014325 | Bacteria | 630 |
| 493 | Ga0157380_10039822 | 3300014326 | Bacteria | 3657 |
| 494 | Ga0157380_10189324 | 3300014326 | Bacteria | 1815 |
| 495 | Ga0157380_11277256 | 3300014326 | Unclassified | 780 |
| 496 | Ga0157380_11471164 | 3300014326 | Unclassified | 733 |
| 497 | Ga0157380_11532048 | 3300014326 | Unclassified | 720 |
| 498 | Ga0157380_12371594 | 3300014326 | Unclassified | 596 |
| 499 | Ga0157380_12863915 | 3300014326 | Unclassified | 549 |
| 500 | Ga0157377_10034821 | 3300014745 | Bacteria | 2757 |
| 501 | Ga0157377_10125882 | 3300014745 | Bacteria | 1559 |
| 502 | Ga0157377_10619805 | 3300014745 | Bacteria | 774 |
| 503 | Ga0157377_10652202 | 3300014745 | Unclassified | 758 |
| 504 | Ga0157379_10030846 | 3300014968 | Bacteria | 4774 |
| 505 | Ga0157379_10067552 | 3300014968 | Unclassified | 3195 |
| 506 | Ga0157379_11399665 | 3300014968 | Unclassified | 678 |
| 507 | Ga0157376_10016049 | 3300014969 | Bacteria | 5674 |
| 508 | Ga0157376_10023330 | 3300014969 | Bacteria | 4841 |
| 509 | Ga0182007_10048583 | 3300015262 | Bacteria | 1402 |
| 510 | Ga0163161_10041016 | 3300017792 | Bacteria | 3325 |
| 511 | Ga0163161_10216153 | 3300017792 | Bacteria | 1483 |
| 512 | Ga0163161_10466354 | 3300017792 | Unclassified | 1023 |
| 513 | Ga0163161_10483521 | 3300017792 | Unclassified | 1006 |
| 514 | Ga0207697_10011469 | 3300025315 | Bacteria | 3747 |
| 515 | Ga0207656_10015588 | 3300025321 | Bacteria | 2944 |
| 516 | Ga0207656_10126172 | 3300025321 | Bacteria | 1195 |
| 517 | Ga0207713_1235717 | 3300025735 | Unclassified | 545 |
| 518 | Ga0207653_10000007 | 3300025885 | Bacteria | 198873 |
| 519 | Ga0207653_10005604 | 3300025885 | Bacteria | 3921 |
| 520 | Ga0207653_10179468 | 3300025885 | Bacteria | 791 |
| 521 | Ga0207642_10021395 | 3300025899 | Bacteria | 2545 |
| 522 | Ga0207710_10284773 | 3300025900 | Unclassified | 832 |
| 523 | Ga0207710_10689298 | 3300025900 | Bacteria | 536 |
| 524 | Ga0207688_10139016 | 3300025901 | Unclassified | 1429 |
| 525 | Ga0207680_10074275 | 3300025903 | Bacteria | 2117 |
| 526 | Ga0207680_10107490 | 3300025903 | Bacteria | 1803 |
| 527 | Ga0207647_10002956 | 3300025904 | Bacteria | 12789 |
| 528 | Ga0207647_10097786 | 3300025904 | Bacteria | 1745 |
| 529 | Ga0207647_10161374 | 3300025904 | Bacteria | 1307 |
| 530 | Ga0207647_10468030 | 3300025904 | Unclassified | 705 |
| 531 | Ga0207647_10524303 | 3300025904 | Bacteria | 659 |
| 532 | Ga0207645_10045469 | 3300025907 | Bacteria | 2806 |
| 533 | Ga0207645_10166097 | 3300025907 | Unclassified | 1445 |
| 534 | Ga0207645_10503921 | 3300025907 | Bacteria | 820 |
| 535 | Ga0207643_10001829 | 3300025908 | Bacteria | 11791 |
| 536 | Ga0207643_10059752 | 3300025908 | Bacteria | 2175 |
| 537 | Ga0207643_10090640 | 3300025908 | Unclassified | 1782 |
| 538 | Ga0207643_10409698 | 3300025908 | Unclassified | 858 |
| 539 | Ga0207684_10030926 | 3300025910 | Bacteria | 4556 |
| 540 | Ga0207684_10386569 | 3300025910 | Bacteria | 1203 |
| 541 | Ga0207684_10390673 | 3300025910 | Bacteria | 1196 |
| 542 | Ga0207654_10158161 | 3300025911 | Unclassified | 1461 |
| 543 | Ga0207654_10360657 | 3300025911 | Unclassified | 1003 |
| 544 | Ga0207654_10413801 | 3300025911 | Bacteria | 940 |
| 545 | Ga0207654_11145566 | 3300025911 | Unclassified | 567 |
| 546 | Ga0207654_11313743 | 3300025911 | Unclassified | 527 |
| 547 | Ga0207707_10089287 | 3300025912 | Bacteria | 2693 |
| 548 | Ga0207707_10434639 | 3300025912 | Unclassified | 1124 |
| 549 | Ga0207695_10934282 | 3300025913 | Bacteria | 747 |
| 550 | Ga0207671_10008288 | 3300025914 | Bacteria | 8836 |
| 551 | Ga0207660_10227126 | 3300025917 | Unclassified | 1467 |
| 552 | Ga0207660_10364606 | 3300025917 | Unclassified | 1159 |
| 553 | Ga0207660_10385109 | 3300025917 | Unclassified | 1128 |
| 554 | Ga0207662_10069177 | 3300025918 | Bacteria | 2133 |
| 555 | Ga0207662_10073440 | 3300025918 | Bacteria | 2075 |
| 556 | Ga0207662_10205957 | 3300025918 | Bacteria | 1275 |
| 557 | Ga0207662_10305816 | 3300025918 | Bacteria | 1058 |
| 558 | Ga0207662_10365573 | 3300025918 | Unclassified | 972 |
| 559 | Ga0207662_10387486 | 3300025918 | Unclassified | 945 |
| 560 | Ga0207662_10578203 | 3300025918 | Unclassified | 780 |
| 561 | Ga0207662_10874219 | 3300025918 | Unclassified | 636 |
| 562 | Ga0207657_10095149 | 3300025919 | Bacteria | 2479 |
| 563 | Ga0207649_10240720 | 3300025920 | Bacteria | 1299 |
| 564 | Ga0207652_10098469 | 3300025921 | Bacteria | 2579 |
| 565 | Ga0207646_10545600 | 3300025922 | Bacteria | 1043 |
| 566 | Ga0207681_10243072 | 3300025923 | Bacteria | 1402 |
| 567 | Ga0207681_10274487 | 3300025923 | Bacteria | 1325 |
| 568 | Ga0207681_10536469 | 3300025923 | Bacteria | 961 |
| 569 | Ga0207681_10538707 | 3300025923 | Unclassified | 960 |
| 570 | Ga0207681_10890791 | 3300025923 | Bacteria | 745 |
| 571 | Ga0207681_11527775 | 3300025923 | Bacteria | 560 |
| 572 | Ga0207694_10444576 | 3300025924 | Unclassified | 1082 |
| 573 | Ga0207650_10127319 | 3300025925 | Bacteria | 1989 |
| 574 | Ga0207650_10188670 | 3300025925 | Bacteria | 1646 |
| 575 | Ga0207650_10593913 | 3300025925 | Unclassified | 931 |
| 576 | Ga0207650_10851124 | 3300025925 | Unclassified | 774 |
| 577 | Ga0207650_10963907 | 3300025925 | Unclassified | 725 |
| 578 | Ga0207659_10085671 | 3300025926 | Bacteria | 2341 |
| 579 | Ga0207659_10178300 | 3300025926 | Bacteria | 1681 |
| 580 | Ga0207659_10411911 | 3300025926 | Bacteria | 1132 |
| 581 | Ga0207687_10910470 | 3300025927 | Unclassified | 753 |
| 582 | Ga0207687_10935663 | 3300025927 | Unclassified | 742 |
| 583 | Ga0207644_10117195 | 3300025931 | Bacteria | 2022 |
| 584 | Ga0207644_10225070 | 3300025931 | Bacteria | 1488 |
| 585 | Ga0207644_11008233 | 3300025931 | Bacteria | 699 |
| 586 | Ga0207690_10013344 | 3300025932 | Bacteria | 4936 |
| 587 | Ga0207690_10152284 | 3300025932 | Bacteria | 1715 |
| 588 | Ga0207690_10325785 | 3300025932 | Bacteria | 1209 |
| 589 | Ga0207690_10556621 | 3300025932 | Bacteria | 933 |
| 590 | Ga0207706_10898223 | 3300025933 | Bacteria | 748 |
| 591 | Ga0207706_11064088 | 3300025933 | Bacteria | 677 |
| 592 | Ga0207686_10001147 | 3300025934 | Bacteria | 15288 |
| 593 | Ga0207686_10001521 | 3300025934 | Bacteria | 13071 |
| 594 | Ga0207686_10308686 | 3300025934 | Unclassified | 1177 |
| 595 | Ga0207686_10798279 | 3300025934 | Bacteria | 756 |
| 596 | Ga0207709_10000009 | 3300025935 | Bacteria | 619238 |
| 597 | Ga0207709_10001210 | 3300025935 | Bacteria | 18549 |
| 598 | Ga0207709_10001346 | 3300025935 | Bacteria | 17288 |
| 599 | Ga0207709_10039349 | 3300025935 | Bacteria | 2824 |
| 600 | Ga0207709_10673525 | 3300025935 | Unclassified | 826 |
| 601 | Ga0207709_10939701 | 3300025935 | Unclassified | 704 |
| 602 | Ga0207709_11591332 | 3300025935 | Unclassified | 543 |
| 603 | Ga0207670_10002913 | 3300025936 | Bacteria | 9043 |
| 604 | Ga0207670_10110200 | 3300025936 | Bacteria | 1982 |
| 605 | Ga0207670_10135379 | 3300025936 | Bacteria | 1810 |
| 606 | Ga0207670_11007329 | 3300025936 | Bacteria | 701 |
| 607 | Ga0207670_11335817 | 3300025936 | Unclassified | 608 |
| 608 | Ga0207670_11668617 | 3300025936 | Unclassified | 542 |
| 609 | Ga0207670_11739941 | 3300025936 | Bacteria | 530 |
| 610 | Ga0207669_10517010 | 3300025937 | Unclassified | 958 |
| 611 | Ga0207704_10041191 | 3300025938 | Bacteria | 2706 |
| 612 | Ga0207704_10236882 | 3300025938 | Bacteria | 1361 |
| 613 | Ga0207704_10934495 | 3300025938 | Bacteria | 731 |
| 614 | Ga0207704_11076504 | 3300025938 | Bacteria | 682 |
| 615 | Ga0207691_10010300 | 3300025940 | Bacteria | 8968 |
| 616 | Ga0207691_10513614 | 3300025940 | Bacteria | 1017 |
| 617 | Ga0207691_10678931 | 3300025940 | Unclassified | 869 |
| 618 | Ga0207691_10953898 | 3300025940 | Unclassified | 717 |
| 619 | Ga0207711_10012250 | 3300025941 | Bacteria | 7129 |
| 620 | Ga0207711_10016873 | 3300025941 | Bacteria | 6064 |
| 621 | Ga0207711_10062975 | 3300025941 | Bacteria | 3200 |
| 622 | Ga0207711_10147141 | 3300025941 | Unclassified | 2123 |
| 623 | Ga0207711_10163832 | 3300025941 | Unclassified | 2014 |
| 624 | Ga0207711_10364444 | 3300025941 | Bacteria | 1339 |
| 625 | Ga0207711_10653222 | 3300025941 | Bacteria | 981 |
| 626 | Ga0207711_10772123 | 3300025941 | Bacteria | 895 |
| 627 | Ga0207711_10787371 | 3300025941 | Unclassified | 886 |
| 628 | Ga0207689_10004428 | 3300025942 | Bacteria | 12741 |
| 629 | Ga0207689_10012375 | 3300025942 | Bacteria | 7299 |
| 630 | Ga0207689_10073495 | 3300025942 | Bacteria | 2809 |
| 631 | Ga0207689_10124716 | 3300025942 | Bacteria | 2119 |
| 632 | Ga0207689_10207489 | 3300025942 | Unclassified | 1618 |
| 633 | Ga0207689_10512687 | 3300025942 | Unclassified | 1005 |
| 634 | Ga0207689_10614053 | 3300025942 | Bacteria | 915 |
| 635 | Ga0207689_10919482 | 3300025942 | Unclassified | 738 |
| 636 | Ga0207661_10628059 | 3300025944 | Bacteria | 987 |
| 637 | Ga0207679_10005977 | 3300025945 | Bacteria | 7656 |
| 638 | Ga0207679_10882642 | 3300025945 | Bacteria | 817 |
| 639 | Ga0207667_11062423 | 3300025949 | Bacteria | 794 |
| 640 | Ga0207667_11234200 | 3300025949 | Unclassified | 726 |
| 641 | Ga0207667_11492544 | 3300025949 | Unclassified | 647 |
| 642 | Ga0207651_10073471 | 3300025960 | Unclassified | 2432 |
| 643 | Ga0207651_10112797 | 3300025960 | Unclassified | 2044 |
| 644 | Ga0207651_10224267 | 3300025960 | Bacteria | 1521 |
| 645 | Ga0207651_10325554 | 3300025960 | Bacteria | 1286 |
| 646 | Ga0207651_10496563 | 3300025960 | Unclassified | 1054 |
| 647 | Ga0207651_10822385 | 3300025960 | Bacteria | 824 |
| 648 | Ga0207651_11336501 | 3300025960 | Bacteria | 645 |
| 649 | Ga0207651_11901424 | 3300025960 | Unclassified | 535 |
| 650 | Ga0207712_10041059 | 3300025961 | Bacteria | 3178 |
| 651 | Ga0207712_10119042 | 3300025961 | Bacteria | 1995 |
| 652 | Ga0207712_10299555 | 3300025961 | Bacteria | 1319 |
| 653 | Ga0207712_11278818 | 3300025961 | Bacteria | 655 |
| 654 | Ga0207640_10098369 | 3300025981 | Bacteria | 2045 |
| 655 | Ga0207640_10326166 | 3300025981 | Bacteria | 1224 |
| 656 | Ga0207640_10738397 | 3300025981 | Unclassified | 848 |
| 657 | Ga0207640_10844610 | 3300025981 | Unclassified | 796 |
| 658 | Ga0207640_11344160 | 3300025981 | Unclassified | 639 |
| 659 | Ga0207640_11806841 | 3300025981 | Unclassified | 552 |
| 660 | Ga0207658_10020766 | 3300025986 | Bacteria | 4550 |
| 661 | Ga0207658_10049212 | 3300025986 | Bacteria | 3096 |
| 662 | Ga0207677_10022258 | 3300026023 | Bacteria | 3892 |
| 663 | Ga0207677_10212281 | 3300026023 | Bacteria | 1546 |
| 664 | Ga0207677_10473065 | 3300026023 | Bacteria | 1078 |
| 665 | Ga0207677_11767162 | 3300026023 | Unclassified | 574 |
| 666 | Ga0207703_10030729 | 3300026035 | Bacteria | 4244 |
| 667 | Ga0207703_10077019 | 3300026035 | Bacteria | 2768 |
| 668 | Ga0207703_10094616 | 3300026035 | Bacteria | 2519 |
| 669 | Ga0207703_10271962 | 3300026035 | Bacteria | 1535 |
| 670 | Ga0207703_10445791 | 3300026035 | Unclassified | 1208 |
| 671 | Ga0207703_12071797 | 3300026035 | Bacteria | 545 |
| 672 | Ga0207639_10181503 | 3300026041 | Bacteria | 1790 |
| 673 | Ga0207639_10317048 | 3300026041 | Bacteria | 1383 |
| 674 | Ga0207678_10290034 | 3300026067 | Bacteria | 1405 |
| 675 | Ga0207708_10021921 | 3300026075 | Unclassified | 4821 |
| 676 | Ga0207708_10043381 | 3300026075 | Bacteria | 3428 |
| 677 | Ga0207708_10062555 | 3300026075 | Bacteria | 2843 |
| 678 | Ga0207708_10173124 | 3300026075 | Unclassified | 1711 |
| 679 | Ga0207708_10187692 | 3300026075 | Bacteria | 1644 |
| 680 | Ga0207708_10423061 | 3300026075 | Unclassified | 1105 |
| 681 | Ga0207708_11482944 | 3300026075 | Bacteria | 596 |
| 682 | Ga0207708_11912203 | 3300026075 | Bacteria | 520 |
| 683 | Ga0207641_10144435 | 3300026088 | Bacteria | 2150 |
| 684 | Ga0207641_10147528 | 3300026088 | Bacteria | 2128 |
| 685 | Ga0207641_10162416 | 3300026088 | Unclassified | 2032 |
| 686 | Ga0207641_10205718 | 3300026088 | Unclassified | 1817 |
| 687 | Ga0207641_10494842 | 3300026088 | Unclassified | 1187 |
| 688 | Ga0207641_10713953 | 3300026088 | Unclassified | 988 |
| 689 | Ga0207641_10759739 | 3300026088 | Bacteria | 957 |
| 690 | Ga0207648_10011861 | 3300026089 | Bacteria | 8191 |
| 691 | Ga0207648_10178237 | 3300026089 | Unclassified | 1880 |
| 692 | Ga0207648_10188550 | 3300026089 | Bacteria | 1827 |
| 693 | Ga0207648_10330066 | 3300026089 | Bacteria | 1372 |
| 694 | Ga0207648_11431573 | 3300026089 | Unclassified | 650 |
| 695 | Ga0207676_10009127 | 3300026095 | Bacteria | 7063 |
| 696 | Ga0207676_10028548 | 3300026095 | Bacteria | 4169 |
| 697 | Ga0207676_10108719 | 3300026095 | Bacteria | 2315 |
| 698 | Ga0207676_10151530 | 3300026095 | Bacteria | 1997 |
| 699 | Ga0207676_10165974 | 3300026095 | Bacteria | 1918 |
| 700 | Ga0207676_10256230 | 3300026095 | Bacteria | 1577 |
| 701 | Ga0207676_10361846 | 3300026095 | Unclassified | 1345 |
| 702 | Ga0207676_10621736 | 3300026095 | Bacteria | 1039 |
| 703 | Ga0207676_10717377 | 3300026095 | Bacteria | 970 |
| 704 | Ga0207674_10000391 | 3300026116 | Bacteria | 56809 |
| 705 | Ga0207674_10037994 | 3300026116 | Bacteria | 5002 |
| 706 | Ga0207674_10314984 | 3300026116 | Bacteria | 1514 |
| 707 | Ga0207674_10440985 | 3300026116 | Bacteria | 1259 |
| 708 | Ga0207675_100000187 | 3300026118 | Bacteria | 56148 |
| 709 | Ga0207675_100001515 | 3300026118 | Bacteria | 23286 |
| 710 | Ga0207675_100104912 | 3300026118 | Bacteria | 2664 |
| 711 | Ga0207675_100357977 | 3300026118 | Bacteria | 1431 |
| 712 | Ga0207675_101050629 | 3300026118 | Unclassified | 834 |
| 713 | Ga0207675_101704796 | 3300026118 | Unclassified | 650 |
| 714 | Ga0207683_10028711 | 3300026121 | Bacteria | 4812 |
| 715 | Ga0207683_10440588 | 3300026121 | Bacteria | 1201 |
| 716 | Ga0207683_10646006 | 3300026121 | Unclassified | 980 |
| 717 | Ga0207698_10226477 | 3300026142 | Bacteria | 1694 |
| 718 | Ga0207698_10270125 | 3300026142 | Bacteria | 1567 |
| 719 | Ga0207698_10357250 | 3300026142 | Bacteria | 1382 |
| 720 | Ga0207698_11122435 | 3300026142 | Unclassified | 799 |
| 721 | Ga0207428_10003831 | 3300027907 | Bacteria | 14426 |
| 722 | Ga0207428_10078721 | 3300027907 | Bacteria | 2579 |
| 723 | Ga0268266_10034047 | 3300028379 | Bacteria | 4331 |
| 724 | Ga0268266_10275232 | 3300028379 | Bacteria | 1564 |
| 725 | Ga0268265_10082594 | 3300028380 | Unclassified | 2541 |
| 726 | Ga0268265_10093042 | 3300028380 | Bacteria | 2414 |
| 727 | Ga0268265_10209294 | 3300028380 | Bacteria | 1698 |
| 728 | Ga0268265_11477166 | 3300028380 | Unclassified | 683 |
| 729 | Ga0268265_11691359 | 3300028380 | Unclassified | 638 |
| 730 | Ga0268265_12394837 | 3300028380 | Unclassified | 534 |
| 731 | Ga0268264_10223280 | 3300028381 | Bacteria | 1735 |
| 732 | Ga0268264_10232837 | 3300028381 | Bacteria | 1702 |
| 733 | Ga0268264_10260996 | 3300028381 | Unclassified | 1614 |
| 734 | Ga0268264_10276777 | 3300028381 | Bacteria | 1570 |
| 735 | Ga0268264_10909962 | 3300028381 | Bacteria | 883 |
| 736 | Ga0268264_11461448 | 3300028381 | Unclassified | 694 |
| 737 | Ga0268264_11684551 | 3300028381 | Unclassified | 645 |
| 738 | Ga0268264_11893179 | 3300028381 | Bacteria | 606 |
| 739 | Ga0307408_100826890 | 3300031548 | Unclassified | 842 |
| 740 | Ga0307408_101232719 | 3300031548 | Unclassified | 699 |
| 741 | Ga0307405_10443928 | 3300031731 | Unclassified | 1027 |
| 742 | Ga0307405_10479589 | 3300031731 | Unclassified | 992 |
| 743 | Ga0307410_10010140 | 3300031852 | Bacteria | 5325 |
| 744 | Ga0307410_11121230 | 3300031852 | Unclassified | 683 |
| 745 | Ga0307410_11418028 | 3300031852 | Unclassified | 610 |
| 746 | Ga0307406_10049362 | 3300031901 | Unclassified | 2663 |
| 747 | Ga0307406_10628196 | 3300031901 | Unclassified | 889 |
| 748 | Ga0307407_10660409 | 3300031903 | Unclassified | 784 |
| 749 | Ga0307412_10024058 | 3300031911 | Unclassified | 3756 |
| 750 | Ga0307412_10251172 | 3300031911 | Unclassified | 1373 |
| 751 | Ga0307409_100135427 | 3300031995 | Bacteria | 2113 |
| 752 | Ga0307409_101216362 | 3300031995 | Unclassified | 777 |
| 753 | Ga0307416_100329261 | 3300032002 | Unclassified | 1534 |
| 754 | Ga0307416_100480300 | 3300032002 | Unclassified | 1302 |
| 755 | Ga0307416_102969099 | 3300032002 | Unclassified | 567 |
| 756 | Ga0307414_10113158 | 3300032004 | Bacteria | 2071 |
| 757 | Ga0307414_10502658 | 3300032004 | Unclassified | 1073 |
| 758 | Ga0307414_10587700 | 3300032004 | Unclassified | 997 |
| 759 | Ga0307411_10074533 | 3300032005 | Bacteria | 2313 |
| 760 | Ga0307411_10798848 | 3300032005 | Unclassified | 831 |
| 761 | Ga0307415_100282351 | 3300032126 | Unclassified | 1366 |
| 762 | Ga0307415_100443212 | 3300032126 | Unclassified | 1120 |
| 763 | Ga0373942_0107750 | 3300035207 | Unclassified | 858 |
| 764 | Ga0373937_0321865 | 3300036401 | Unclassified | 1463 |
| 765 | Ga0439433_0023973 | 3300041999 | Bacteria | 1374 |
| 766 | Ga0439462_0014736 | 3300042015 | Unclassified | 2011 |
| 767 | Ga0439434_0041954 | 3300042435 | Unclassified | 1406 |
| 768 | Ga0451577_0140340 | 3300042876 | Unclassified | 2171 |
| 769 | Ga0451577_0404706 | 3300042876 | Unclassified | 1239 |
| 770 | Ga0453683_0041509 | 3300044673 | Bacteria | 2890 |
| 771 | Ga0453683_0056484 | 3300044673 | Unclassified | 2457 |
| 772 | Ga0453683_0136873 | 3300044673 | Unclassified | 1545 |
| 773 | Ga0453684_1285112 | 3300044712 | Unclassified | 764 |
| 774 | Ga0453684_1304376 | 3300044712 | Unclassified | 757 |
| 775 | Ga0451576_0029458 | 3300045051 | Archaea | 5873 |
| 776 | Ga0451576_0410233 | 3300045051 | Unclassified | 1421 |
| 777 | Ga0451576_2387108 | 3300045051 | Unclassified | 541 |
| 778 | Ga0495582_0378178 | 3300046473 | Bacteria | 816 |
| 779 | Ga0495598_0172372 | 3300046537 | Unclassified | 767 |
| 780 | Ga0495609_0307542 | 3300046538 | Unclassified | 645 |
| 781 | Ga0495621_0455843 | 3300046539 | Unclassified | 548 |
| 782 | Ga0495658_0097910 | 3300046683 | Bacteria | 1747 |
| 783 | Ga0495669_0194262 | 3300046684 | Bacteria | 969 |
| 784 | Ga0496101_0789078 | 3300048904 | Unclassified | 749 |
| 785 | Ga0496102_0662642 | 3300048905 | Unclassified | 967 |
| 786 | Ga0496102_1676142 | 3300048905 | Unclassified | 554 |
| 787 | Ga0496104_0739462 | 3300048907 | Unclassified | 891 |
| 788 | Ga0496106_0004793 | 3300048909 | Bacteria | 10005 |
| 789 | Ga0496106_1072112 | 3300048909 | Bacteria | 632 |
| 790 | Ga0496107_0080120 | 3300048910 | Bacteria | 2381 |
| 791 | Ga0496107_0327234 | 3300048910 | Bacteria | 1140 |
| 792 | Ga0496110_0922535 | 3300048913 | Unclassified | 780 |
| 793 | Ga0496111_0610611 | 3300048914 | Unclassified | 798 |
| 794 | Ga0496111_1130737 | 3300048914 | Unclassified | 557 |
| 795 | Ga0496112_1721060 | 3300048915 | Unclassified | 539 |
| 796 | Ga0496113_0217710 | 3300048916 | Bacteria | 1521 |
| 797 | Ga0496113_0447418 | 3300048916 | Bacteria | 1038 |
| 798 | Ga0496113_0501304 | 3300048916 | Unclassified | 975 |
| 799 | Ga0496113_1302593 | 3300048916 | Unclassified | 565 |
| 800 | Ga0501310_050247 | 3300049130 | Unclassified | 601 |
| 801 | Ga0501291_002632 | 3300049514 | Bacteria | 2170 |
| 802 | Ga0501292_004413 | 3300049515 | Unclassified | 1926 |
| 803 | Ga0501294_013602 | 3300049517 | Unclassified | 826 |
| 804 | Ga0501296_008480 | 3300049519 | Unclassified | 1192 |
| 805 | Ga0501296_023104 | 3300049519 | Unclassified | 804 |
| 806 | Ga0501297_001243 | 3300049520 | Unclassified | 2330 |
| 807 | Ga0501298_009963 | 3300049521 | Unclassified | 1626 |
| 808 | Ga0501299_002680 | 3300049522 | Bacteria | 2489 |
| 809 | Ga0501312_071016 | 3300049528 | Unclassified | 617 |
| 810 | Ga0501038_0113649 | 3300049574 | Bacteria | 2240 |
| 811 | Ga0501198_002996 | 3300049649 | Bacteria | 2301 |
| 812 | Ga0501198_007421 | 3300049649 | Bacteria | 1577 |
| 813 | Ga0501206_002162 | 3300049653 | Bacteria | 2483 |
| 814 | Ga0501209_022646 | 3300049656 | Unclassified | 1509 |
| 815 | Ga0501216_000852 | 3300049660 | Bacteria | 3852 |
| 816 | Ga0501216_016315 | 3300049660 | Unclassified | 1259 |
| 817 | Ga0501217_008765 | 3300049661 | Bacteria | 2191 |
| 818 | Ga0501217_165647 | 3300049661 | Unclassified | 669 |
| 819 | Ga0501223_018432 | 3300049663 | Unclassified | 1373 |
| 820 | Ga0501223_076697 | 3300049663 | Unclassified | 665 |
| 821 | Ga0501223_090870 | 3300049663 | Bacteria | 620 |
| 822 | Ga0501224_001118 | 3300049664 | Bacteria | 3494 |
| 823 | Ga0501227_001664 | 3300049665 | Bacteria | 4951 |
| 824 | Ga0501227_058698 | 3300049665 | Unclassified | 982 |
| 825 | Ga0501233_013375 | 3300049668 | Unclassified | 1662 |
| 826 | Ga0501233_034465 | 3300049668 | Bacteria | 1161 |
| 827 | Ga0501235_005315 | 3300049669 | Unclassified | 2801 |
| 828 | Ga0501238_035673 | 3300049671 | Unclassified | 725 |
| 829 | Ga0501240_000544 | 3300049673 | Bacteria | 3125 |
| 830 | Ga0501243_017783 | 3300049675 | Unclassified | 1154 |
| 831 | Ga0501246_002739 | 3300049676 | Unclassified | 1396 |
| 832 | Ga0501249_006708 | 3300049679 | Bacteria | 2371 |
| 833 | Ga0501251_080559 | 3300049681 | Unclassified | 570 |
| 834 | Ga0501253_133060 | 3300049683 | Unclassified | 613 |
| 835 | Ga0501256_005331 | 3300049685 | Unclassified | 1131 |
| 836 | Ga0501256_038940 | 3300049685 | Unclassified | 559 |
| 837 | Ga0501259_043382 | 3300049688 | Unclassified | 891 |
| 838 | Ga0501259_164031 | 3300049688 | Unclassified | 556 |
| 839 | Ga0501260_001515 | 3300049689 | Bacteria | 1927 |
| 840 | Ga0501221_006473 | 3300049704 | Unclassified | 1983 |
| 841 | Ga0501221_014700 | 3300049704 | Unclassified | 1459 |
| 842 | Ga0501225_0029635 | 3300049705 | Unclassified | 1504 |
| 843 | Ga0501225_0063380 | 3300049705 | Unclassified | 1042 |
| 844 | Ga0501229_008988 | 3300049706 | Unclassified | 1252 |
| 845 | Ga0501234_005255 | 3300049707 | Bacteria | 2026 |
| 846 | Ga0501234_006234 | 3300049707 | Bacteria | 1867 |
| 847 | Ga0501245_011276 | 3300049708 | Bacteria | 1298 |
| 848 | Ga0501232_036448 | 3300049757 | Unclassified | 707 |
| 849 | Ga0501268_000436 | 3300049765 | Bacteria | 4496 |
| 850 | Ga0501270_071711 | 3300049767 | Unclassified | 671 |
| 851 | Ga0501271_020441 | 3300049768 | Unclassified | 766 |
| 852 | Ga0501275_009284 | 3300049772 | Unclassified | 1028 |
| 853 | Ga0501278_001700 | 3300049774 | Unclassified | 1559 |
| 854 | Ga0501204_005715 | 3300049850 | Unclassified | 1370 |
| 855 | Ga0501212_004834 | 3300049851 | Bacteria | 1756 |
| 856 | Ga0501212_022512 | 3300049851 | Unclassified | 983 |
| 857 | Ga0501226_007950 | 3300049853 | Unclassified | 1187 |
| 858 | nmdc:mga05p37_114956_c1 | 3300050507 | Unclassified | 3308 |
| 859 | nmdc:mga05p37_11964_c2 | 3300050507 | Unclassified | 4702 |
| 860 | nmdc:mga05p37_176825_c1 | 3300050507 | Bacteria | 2600 |
| 861 | nmdc:mga05p37_653436_c1 | 3300050507 | Bacteria | 1177 |
| 862 | nmdc:mga09592_1158470_c1 | 3300050508 | Unclassified | 640 |
| 863 | nmdc:mga06r32_1415684_c1 | 3300050510 | Archaea | 637 |
| 864 | nmdc:mga08y16_1646788_c1 | 3300050511 | Unclassified | 598 |
| 865 | nmdc:mga08y16_180695_c1 | 3300050511 | Bacteria | 2191 |
| 866 | nmdc:mga08y16_560295_c1 | 3300050511 | Unclassified | 1156 |
| 867 | nmdc:mga0n895_243353_c1 | 3300050512 | Unclassified | 1826 |
| 868 | nmdc:mga0n895_278640_c1 | 3300050512 | Bacteria | 1696 |
| 869 | nmdc:mga0n895_422534_c1 | 3300050512 | Bacteria | 1347 |
| 870 | nmdc:mga0n895_62058_c1 | 3300050512 | Bacteria | 3692 |
| 871 | nmdc:mga0n895_79753_c1 | 3300050512 | Bacteria | 3260 |
| 872 | nmdc:mga0n895_834855_c1 | 3300050512 | Unclassified | 910 |
| 873 | nmdc:mga0a205_1498812_c1 | 3300050515 | Unclassified | 523 |
| 874 | nmdc:mga0a205_211437_c1 | 3300050515 | Bacteria | 1828 |
| 875 | nmdc:mga0a205_43932_c1 | 3300050515 | Bacteria | 4307 |
| 876 | nmdc:mga0a205_66588_c1 | 3300050515 | Unclassified | 3480 |
| 877 | nmdc:mga0a205_69857_c1 | 3300050515 | Bacteria | 3391 |
| 878 | nmdc:mga0a205_89674_c1 | 3300050515 | Bacteria | 2972 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009545 | Ga0105237_10335234 | Ga0105237_103352343 | 75 |
| 2 | 3300005330 | Ga0070690_100920714 | Ga0070690_1009207142 | 77 |
| 3 | 3300005337 | Ga0070682_101792981 | Ga0070682_1017929811 | 77 |
| 4 | 3300005365 | Ga0070688_100398923 | Ga0070688_1003989231 | 77 |
| 5 | 3300005444 | Ga0070694_100092392 | Ga0070694_1000923923 | 77 |
| 6 | 3300005457 | Ga0070662_100356909 | Ga0070662_1003569091 | 77 |
| 7 | 3300005545 | Ga0070695_101242033 | Ga0070695_1012420331 | 77 |
| 8 | 3300005617 | Ga0068859_100697995 | Ga0068859_1006979952 | 77 |
| 9 | 3300005718 | Ga0068866_10378908 | Ga0068866_103789082 | 77 |
| 10 | 3300005842 | Ga0068858_100622762 | Ga0068858_1006227623 | 77 |
| 11 | 3300005843 | Ga0068860_100073072 | Ga0068860_1000730724 | 77 |
| 12 | 3300006931 | Ga0097620_100697985 | Ga0097620_1006979852 | 77 |
| 13 | 3300009098 | Ga0105245_11387472 | Ga0105245_113874721 | 77 |
| 14 | 3300009148 | Ga0105243_10031300 | Ga0105243_100313004 | 77 |
| 15 | 3300009174 | Ga0105241_10109205 | Ga0105241_101092051 | 77 |
| 16 | 3300009176 | Ga0105242_10433115 | Ga0105242_104331153 | 77 |
| 17 | 3300046538 | Ga0495609_0307542 | Ga0495609_0307542_273_563 | 79 |
| 18 | 3300026088 | Ga0207641_10494842 | Ga0207641_104948422 | 80 |
| 19 | 3300014326 | Ga0157380_12863915 | Ga0157380_128639151 | 81 |
| 20 | 3300005334 | Ga0068869_100007615 | Ga0068869_1000076154 | 82 |
| 21 | 3300005338 | Ga0068868_100071761 | Ga0068868_1000717612 | 82 |
| 22 | 3300005341 | Ga0070691_10233917 | Ga0070691_102339171 | 82 |
| 23 | 3300005353 | Ga0070669_100981855 | Ga0070669_1009818551 | 82 |
| 24 | 3300005364 | Ga0070673_100039643 | Ga0070673_1000396433 | 82 |
| 25 | 3300005536 | Ga0070697_100073915 | Ga0070697_1000739152 | 82 |
| 26 | 3300005536 | Ga0070697_100573754 | Ga0070697_1005737541 | 82 |
| 27 | 3300005544 | Ga0070686_101096931 | Ga0070686_1010969311 | 82 |
| 28 | 3300005545 | Ga0070695_101290773 | Ga0070695_1012907731 | 82 |
| 29 | 3300005617 | Ga0068859_100072286 | Ga0068859_1000722866 | 82 |
| 30 | 3300005719 | Ga0068861_100003971 | Ga0068861_1000039716 | 82 |
| 31 | 3300005842 | Ga0068858_100036039 | Ga0068858_1000360392 | 82 |
| 32 | 3300006852 | Ga0075433_10050623 | Ga0075433_100506232 | 82 |
| 33 | 3300006881 | Ga0068865_100808407 | Ga0068865_1008084072 | 82 |
| 34 | 3300006931 | Ga0097620_100072284 | Ga0097620_1000722846 | 82 |
| 35 | 3300009098 | Ga0105245_10190950 | Ga0105245_101909502 | 82 |
| 36 | 3300009148 | Ga0105243_10000318 | Ga0105243_1000031824 | 82 |
| 37 | 3300009174 | Ga0105241_10874921 | Ga0105241_108749212 | 82 |
| 38 | 3300009176 | Ga0105242_10001437 | Ga0105242_1000143710 | 82 |
| 39 | 3300009177 | Ga0105248_10222001 | Ga0105248_102220013 | 82 |
| 40 | 3300009553 | Ga0105249_10005195 | Ga0105249_100051952 | 82 |
| 41 | 3300010375 | Ga0105239_10046859 | Ga0105239_100468594 | 82 |
| 42 | 3300013102 | Ga0157371_10152206 | Ga0157371_101522063 | 82 |
| 43 | 3300013297 | Ga0157378_10000679 | Ga0157378_1000067918 | 82 |
| 44 | 3300013297 | Ga0157378_10004360 | Ga0157378_100043602 | 82 |
| 45 | 3300013306 | Ga0163162_10006297 | Ga0163162_1000629710 | 82 |
| 46 | 3300013308 | Ga0157375_10016064 | Ga0157375_100160645 | 82 |
| 47 | 3300014745 | Ga0157377_10652202 | Ga0157377_106522021 | 82 |
| 48 | 3300017792 | Ga0163161_10466354 | Ga0163161_104663543 | 82 |
| 49 | 3300025901 | Ga0207688_10139016 | Ga0207688_101390162 | 82 |
| 50 | 3300025911 | Ga0207654_11313743 | Ga0207654_113137432 | 82 |
| 51 | 3300025918 | Ga0207662_10387486 | Ga0207662_103874862 | 82 |
| 52 | 3300025918 | Ga0207662_10874219 | Ga0207662_108742191 | 82 |
| 53 | 3300025927 | Ga0207687_10910470 | Ga0207687_109104701 | 82 |
| 54 | 3300025934 | Ga0207686_10001147 | Ga0207686_100011473 | 82 |
| 55 | 3300025935 | Ga0207709_10001210 | Ga0207709_100012103 | 82 |
| 56 | 3300025935 | Ga0207709_11591332 | Ga0207709_115913321 | 82 |
| 57 | 3300025938 | Ga0207704_11076504 | Ga0207704_110765041 | 82 |
| 58 | 3300025941 | Ga0207711_10147141 | Ga0207711_101471412 | 82 |
| 59 | 3300025942 | Ga0207689_10004428 | Ga0207689_100044288 | 82 |
| 60 | 3300025960 | Ga0207651_10112797 | Ga0207651_101127972 | 82 |
| 61 | 3300025981 | Ga0207640_10844610 | Ga0207640_108446102 | 82 |
| 62 | 3300026023 | Ga0207677_10473065 | Ga0207677_104730652 | 82 |
| 63 | 3300026035 | Ga0207703_10077019 | Ga0207703_100770191 | 82 |
| 64 | 3300026089 | Ga0207648_11431573 | Ga0207648_114315731 | 82 |
| 65 | 3300026118 | Ga0207675_100000187 | Ga0207675_10000018717 | 82 |
| 66 | 3300028381 | Ga0268264_10260996 | Ga0268264_102609962 | 82 |
| 67 | 3300042876 | Ga0451577_0140340 | Ga0451577_0140340_1667_1966 | 82 |
| 68 | 3300044673 | Ga0453683_0041509 | Ga0453683_0041509_666_965 | 82 |
| 69 | 3300044712 | Ga0453684_1285112 | Ga0453684_1285112_208_507 | 82 |
| 70 | 3300045051 | Ga0451576_0029458 | Ga0451576_0029458_586_885 | 82 |
| 71 | 3300048904 | Ga0496101_0789078 | Ga0496101_0789078_121_420 | 82 |
| 72 | 3300048909 | Ga0496106_0004793 | Ga0496106_0004793_8079_8378 | 82 |
| 73 | 3300050512 | nmdc:mga0n895_278640_c1 | nmdc:mga0n895_278640_c1_337_636 | 82 |
| 74 | 3300050515 | nmdc:mga0a205_89674_c1 | nmdc:mga0a205_89674_c1_1654_1953 | 82 |
| 75 | 3300005467 | Ga0070706_100007728 | Ga0070706_1000077282 | 83 |
| 76 | 3300005468 | Ga0070707_100192223 | Ga0070707_1001922232 | 83 |
| 77 | 3300005536 | Ga0070697_101431975 | Ga0070697_1014319751 | 83 |
| 78 | 3300006871 | Ga0075434_100094518 | Ga0075434_1000945184 | 83 |
| 79 | 3300025910 | Ga0207684_10030926 | Ga0207684_100309262 | 83 |
| 80 | 3300049705 | Ga0501225_0029635 | Ga0501225_0029635_118_387 | 83 |
| 81 | 3300050512 | nmdc:mga0n895_62058_c1 | nmdc:mga0n895_62058_c1_1324_1623 | 83 |
| 82 | 3300026075 | Ga0207708_10173124 | Ga0207708_101731241 | 84 |
| 83 | 3300007788 | Ga0099795_10322139 | Ga0099795_103221392 | 85 |
| 84 | 3300009147 | Ga0114129_10641907 | Ga0114129_106419072 | 85 |
| 85 | 3300025936 | Ga0207670_11739941 | Ga0207670_117399412 | 85 |
| 86 | 3300026075 | Ga0207708_11482944 | Ga0207708_114829442 | 85 |
| 87 | 3300050507 | nmdc:mga05p37_176825_c1 | nmdc:mga05p37_176825_c1_932_1231 | 85 |
| 88 | 3300005445 | Ga0070708_101005998 | Ga0070708_1010059982 | 86 |
| 89 | 3300005471 | Ga0070698_101823691 | Ga0070698_1018236911 | 86 |
| 90 | 3300005518 | Ga0070699_100189046 | Ga0070699_1001890463 | 86 |
| 91 | 3300005518 | Ga0070699_101013701 | Ga0070699_1010137012 | 86 |
| 92 | 3300005536 | Ga0070697_100029783 | Ga0070697_1000297833 | 86 |
| 93 | 3300005536 | Ga0070697_101788731 | Ga0070697_1017887312 | 86 |
| 94 | 3300005547 | Ga0070693_100067641 | Ga0070693_1000676412 | 86 |
| 95 | 3300005577 | Ga0068857_102279765 | Ga0068857_1022797652 | 86 |
| 96 | 3300009148 | Ga0105243_10944849 | Ga0105243_109448492 | 86 |
| 97 | 3300009176 | Ga0105242_10296659 | Ga0105242_102966591 | 86 |
| 98 | 3300013297 | Ga0157378_10290592 | Ga0157378_102905922 | 86 |
| 99 | 3300025910 | Ga0207684_10390673 | Ga0207684_103906731 | 86 |
| 100 | 3300005353 | Ga0070669_101424778 | Ga0070669_1014247781 | 87 |
| 101 | 3300005341 | Ga0070691_10622500 | Ga0070691_106225001 | 88 |
| 102 | 3300005353 | Ga0070669_100880280 | Ga0070669_1008802802 | 88 |
| 103 | 3300005364 | Ga0070673_100914368 | Ga0070673_1009143682 | 88 |
| 104 | 3300005440 | Ga0070705_101452650 | Ga0070705_1014526501 | 88 |
| 105 | 3300005444 | Ga0070694_101189282 | Ga0070694_1011892821 | 88 |
| 106 | 3300005468 | Ga0070707_100955195 | Ga0070707_1009551951 | 88 |
| 107 | 3300005471 | Ga0070698_100956787 | Ga0070698_1009567871 | 88 |
| 108 | 3300005549 | Ga0070704_100550630 | Ga0070704_1005506302 | 88 |
| 109 | 3300013297 | Ga0157378_10874900 | Ga0157378_108749002 | 88 |
| 110 | 3300025923 | Ga0207681_10243072 | Ga0207681_102430721 | 88 |
| 111 | 3300005441 | Ga0070700_100156737 | Ga0070700_1001567374 | 89 |
| 112 | 3300009094 | Ga0111539_11608323 | Ga0111539_116083232 | 89 |
| 113 | 3300014326 | Ga0157380_11532048 | Ga0157380_115320481 | 89 |
| 114 | 3300026118 | Ga0207675_101704796 | Ga0207675_1017047961 | 89 |
| 115 | 3300032002 | Ga0307416_100329261 | Ga0307416_1003292613 | 89 |
| 116 | 3300005456 | Ga0070678_100703867 | Ga0070678_1007038672 | 90 |
| 117 | 3300026121 | Ga0207683_10646006 | Ga0207683_106460062 | 90 |
| 118 | 3300000531 | CNBas_1011925 | CNBas_10119252 | 91 |
| 119 | 3300005290 | Ga0065712_10538609 | Ga0065712_105386092 | 91 |
| 120 | 3300005293 | Ga0065715_10768037 | Ga0065715_107680371 | 91 |
| 121 | 3300005295 | Ga0065707_10002981 | Ga0065707_100029816 | 91 |
| 122 | 3300005334 | Ga0068869_100417434 | Ga0068869_1004174342 | 91 |
| 123 | 3300005340 | Ga0070689_100349658 | Ga0070689_1003496582 | 91 |
| 124 | 3300005345 | Ga0070692_10252286 | Ga0070692_102522862 | 91 |
| 125 | 3300005353 | Ga0070669_100577530 | Ga0070669_1005775302 | 91 |
| 126 | 3300005353 | Ga0070669_101256046 | Ga0070669_1012560461 | 91 |
| 127 | 3300005354 | Ga0070675_100172009 | Ga0070675_1001720091 | 91 |
| 128 | 3300005364 | Ga0070673_100859255 | Ga0070673_1008592552 | 91 |
| 129 | 3300005367 | Ga0070667_102244271 | Ga0070667_1022442711 | 91 |
| 130 | 3300005438 | Ga0070701_10311688 | Ga0070701_103116881 | 91 |
| 131 | 3300005441 | Ga0070700_100065335 | Ga0070700_1000653352 | 91 |
| 132 | 3300005444 | Ga0070694_100327993 | Ga0070694_1003279932 | 91 |
| 133 | 3300005445 | Ga0070708_100305909 | Ga0070708_1003059092 | 91 |
| 134 | 3300005518 | Ga0070699_100057560 | Ga0070699_1000575605 | 91 |
| 135 | 3300005544 | Ga0070686_100259136 | Ga0070686_1002591362 | 91 |
| 136 | 3300005578 | Ga0068854_100697376 | Ga0068854_1006973761 | 91 |
| 137 | 3300005617 | Ga0068859_100021317 | Ga0068859_1000213175 | 91 |
| 138 | 3300005617 | Ga0068859_100297289 | Ga0068859_1002972892 | 91 |
| 139 | 3300005618 | Ga0068864_100064433 | Ga0068864_1000644333 | 91 |
| 140 | 3300005841 | Ga0068863_100459297 | Ga0068863_1004592973 | 91 |
| 141 | 3300005843 | Ga0068860_101492806 | Ga0068860_1014928062 | 91 |
| 142 | 3300005844 | Ga0068862_100118956 | Ga0068862_1001189562 | 91 |
| 143 | 3300006237 | Ga0097621_101758584 | Ga0097621_1017585842 | 91 |
| 144 | 3300006844 | Ga0075428_100088879 | Ga0075428_1000888797 | 91 |
| 145 | 3300006871 | Ga0075434_102520284 | Ga0075434_1025202841 | 91 |
| 146 | 3300006880 | Ga0075429_100013208 | Ga0075429_1000132082 | 91 |
| 147 | 3300006881 | Ga0068865_100488337 | Ga0068865_1004883372 | 91 |
| 148 | 3300006931 | Ga0097620_100021317 | Ga0097620_1000213175 | 91 |
| 149 | 3300006931 | Ga0097620_100297266 | Ga0097620_1002972662 | 91 |
| 150 | 3300007265 | Ga0099794_10246734 | Ga0099794_102467342 | 91 |
| 151 | 3300017792 | Ga0163161_10216153 | Ga0163161_102161532 | 91 |
| 152 | 3300025885 | Ga0207653_10000007 | Ga0207653_1000000722 | 91 |
| 153 | 3300025900 | Ga0207710_10284773 | Ga0207710_102847731 | 91 |
| 154 | 3300025918 | Ga0207662_10365573 | Ga0207662_103655732 | 91 |
| 155 | 3300025923 | Ga0207681_10274487 | Ga0207681_102744871 | 91 |
| 156 | 3300025926 | Ga0207659_10411911 | Ga0207659_104119112 | 91 |
| 157 | 3300025934 | Ga0207686_10308686 | Ga0207686_103086861 | 91 |
| 158 | 3300025935 | Ga0207709_10000009 | Ga0207709_1000000989 | 91 |
| 159 | 3300025936 | Ga0207670_11335817 | Ga0207670_113358171 | 91 |
| 160 | 3300025941 | Ga0207711_10653222 | Ga0207711_106532222 | 91 |
| 161 | 3300025942 | Ga0207689_10207489 | Ga0207689_102074892 | 91 |
| 162 | 3300025960 | Ga0207651_10073471 | Ga0207651_100734713 | 91 |
| 163 | 3300025961 | Ga0207712_10119042 | Ga0207712_101190422 | 91 |
| 164 | 3300025961 | Ga0207712_10299555 | Ga0207712_102995552 | 91 |
| 165 | 3300025981 | Ga0207640_11806841 | Ga0207640_118068411 | 91 |
| 166 | 3300026075 | Ga0207708_10021921 | Ga0207708_100219213 | 91 |
| 167 | 3300026088 | Ga0207641_10713953 | Ga0207641_107139532 | 91 |
| 168 | 3300026095 | Ga0207676_10028548 | Ga0207676_100285487 | 91 |
| 169 | 3300026118 | Ga0207675_100104912 | Ga0207675_1001049125 | 91 |
| 170 | 3300027907 | Ga0207428_10003831 | Ga0207428_1000383119 | 91 |
| 171 | 3300028380 | Ga0268265_10093042 | Ga0268265_100930422 | 91 |
| 172 | 3300028381 | Ga0268264_10223280 | Ga0268264_102232803 | 91 |
| 173 | 3300044673 | Ga0453683_0056484 | Ga0453683_0056484_801_1097 | 91 |
| 174 | 3300046537 | Ga0495598_0172372 | Ga0495598_0172372_88_378 | 91 |
| 175 | 2162886012 | MBSR1b_contig_1406643 | MBSR1b_0736.00003950 | 92 |
| 176 | 3300005290 | Ga0065712_10296637 | Ga0065712_102966372 | 92 |
| 177 | 3300005293 | Ga0065715_10151441 | Ga0065715_101514413 | 92 |
| 178 | 3300005293 | Ga0065715_11086307 | Ga0065715_110863072 | 92 |
| 179 | 3300005295 | Ga0065707_10494254 | Ga0065707_104942542 | 92 |
| 180 | 3300005328 | Ga0070676_10029420 | Ga0070676_100294202 | 92 |
| 181 | 3300005330 | Ga0070690_100511469 | Ga0070690_1005114692 | 92 |
| 182 | 3300005331 | Ga0070670_102155785 | Ga0070670_1021557852 | 92 |
| 183 | 3300005334 | Ga0068869_100046295 | Ga0068869_1000462952 | 92 |
| 184 | 3300005334 | Ga0068869_100050490 | Ga0068869_1000504904 | 92 |
| 185 | 3300005334 | Ga0068869_100214311 | Ga0068869_1002143113 | 92 |
| 186 | 3300005335 | Ga0070666_10027343 | Ga0070666_100273434 | 92 |
| 187 | 3300005336 | Ga0070680_100440711 | Ga0070680_1004407112 | 92 |
| 188 | 3300005337 | Ga0070682_100004309 | Ga0070682_1000043091 | 92 |
| 189 | 3300005338 | Ga0068868_100008836 | Ga0068868_1000088364 | 92 |
| 190 | 3300005338 | Ga0068868_100535836 | Ga0068868_1005358361 | 92 |
| 191 | 3300005340 | Ga0070689_100024564 | Ga0070689_1000245642 | 92 |
| 192 | 3300005340 | Ga0070689_102213828 | Ga0070689_1022138281 | 92 |
| 193 | 3300005343 | Ga0070687_100179326 | Ga0070687_1001793262 | 92 |
| 194 | 3300005343 | Ga0070687_100747814 | Ga0070687_1007478141 | 92 |
| 195 | 3300005344 | Ga0070661_100050445 | Ga0070661_1000504454 | 92 |
| 196 | 3300005345 | Ga0070692_10101095 | Ga0070692_101010952 | 92 |
| 197 | 3300005353 | Ga0070669_100588114 | Ga0070669_1005881142 | 92 |
| 198 | 3300005354 | Ga0070675_100299695 | Ga0070675_1002996952 | 92 |
| 199 | 3300005355 | Ga0070671_100830245 | Ga0070671_1008302451 | 92 |
| 200 | 3300005364 | Ga0070673_100092701 | Ga0070673_1000927013 | 92 |
| 201 | 3300005364 | Ga0070673_100363648 | Ga0070673_1003636482 | 92 |
| 202 | 3300005364 | Ga0070673_100365812 | Ga0070673_1003658122 | 92 |
| 203 | 3300005365 | Ga0070688_100942916 | Ga0070688_1009429162 | 92 |
| 204 | 3300005366 | Ga0070659_100384354 | Ga0070659_1003843541 | 92 |
| 205 | 3300005367 | Ga0070667_100016035 | Ga0070667_1000160356 | 92 |
| 206 | 3300005406 | Ga0070703_10473967 | Ga0070703_104739671 | 92 |
| 207 | 3300005438 | Ga0070701_10023135 | Ga0070701_100231354 | 92 |
| 208 | 3300005438 | Ga0070701_10314143 | Ga0070701_103141431 | 92 |
| 209 | 3300005440 | Ga0070705_100003326 | Ga0070705_1000033263 | 92 |
| 210 | 3300005440 | Ga0070705_100418967 | Ga0070705_1004189672 | 92 |
| 211 | 3300005441 | Ga0070700_100369952 | Ga0070700_1003699522 | 92 |
| 212 | 3300005441 | Ga0070700_101853551 | Ga0070700_1018535511 | 92 |
| 213 | 3300005444 | Ga0070694_100009516 | Ga0070694_1000095166 | 92 |
| 214 | 3300005444 | Ga0070694_100033450 | Ga0070694_1000334502 | 92 |
| 215 | 3300005456 | Ga0070678_100382597 | Ga0070678_1003825973 | 92 |
| 216 | 3300005457 | Ga0070662_100754410 | Ga0070662_1007544101 | 92 |
| 217 | 3300005459 | Ga0068867_100730767 | Ga0068867_1007307671 | 92 |
| 218 | 3300005466 | Ga0070685_10089330 | Ga0070685_100893302 | 92 |
| 219 | 3300005471 | Ga0070698_100087016 | Ga0070698_1000870162 | 92 |
| 220 | 3300005518 | Ga0070699_100854598 | Ga0070699_1008545982 | 92 |
| 221 | 3300005543 | Ga0070672_100322591 | Ga0070672_1003225913 | 92 |
| 222 | 3300005543 | Ga0070672_100991880 | Ga0070672_1009918802 | 92 |
| 223 | 3300005545 | Ga0070695_100093792 | Ga0070695_1000937922 | 92 |
| 224 | 3300005545 | Ga0070695_100129941 | Ga0070695_1001299414 | 92 |
| 225 | 3300005546 | Ga0070696_100011414 | Ga0070696_1000114145 | 92 |
| 226 | 3300005546 | Ga0070696_100634109 | Ga0070696_1006341091 | 92 |
| 227 | 3300005547 | Ga0070693_100014900 | Ga0070693_1000149002 | 92 |
| 228 | 3300005547 | Ga0070693_100056114 | Ga0070693_1000561142 | 92 |
| 229 | 3300005547 | Ga0070693_100327532 | Ga0070693_1003275322 | 92 |
| 230 | 3300005548 | Ga0070665_100031997 | Ga0070665_1000319976 | 92 |
| 231 | 3300005549 | Ga0070704_100089494 | Ga0070704_1000894941 | 92 |
| 232 | 3300005549 | Ga0070704_100247619 | Ga0070704_1002476193 | 92 |
| 233 | 3300005549 | Ga0070704_100634247 | Ga0070704_1006342472 | 92 |
| 234 | 3300005564 | Ga0070664_100319351 | Ga0070664_1003193513 | 92 |
| 235 | 3300005578 | Ga0068854_100251148 | Ga0068854_1002511483 | 92 |
| 236 | 3300005578 | Ga0068854_100673784 | Ga0068854_1006737842 | 92 |
| 237 | 3300005615 | Ga0070702_100036510 | Ga0070702_1000365104 | 92 |
| 238 | 3300005615 | Ga0070702_100072453 | Ga0070702_1000724533 | 92 |
| 239 | 3300005615 | Ga0070702_100133746 | Ga0070702_1001337462 | 92 |
| 240 | 3300005616 | Ga0068852_100100902 | Ga0068852_1001009023 | 92 |
| 241 | 3300005616 | Ga0068852_100122908 | Ga0068852_1001229083 | 92 |
| 242 | 3300005617 | Ga0068859_100007875 | Ga0068859_1000078755 | 92 |
| 243 | 3300005617 | Ga0068859_100018906 | Ga0068859_1000189064 | 92 |
| 244 | 3300005617 | Ga0068859_100395683 | Ga0068859_1003956832 | 92 |
| 245 | 3300005617 | Ga0068859_100631924 | Ga0068859_1006319242 | 92 |
| 246 | 3300005618 | Ga0068864_100006089 | Ga0068864_1000060896 | 92 |
| 247 | 3300005618 | Ga0068864_100015368 | Ga0068864_1000153682 | 92 |
| 248 | 3300005618 | Ga0068864_100088642 | Ga0068864_1000886423 | 92 |
| 249 | 3300005618 | Ga0068864_100494303 | Ga0068864_1004943031 | 92 |
| 250 | 3300005719 | Ga0068861_100177580 | Ga0068861_1001775803 | 92 |
| 251 | 3300005834 | Ga0068851_10008858 | Ga0068851_100088585 | 92 |
| 252 | 3300005834 | Ga0068851_10263785 | Ga0068851_102637852 | 92 |
| 253 | 3300005840 | Ga0068870_10199923 | Ga0068870_101999232 | 92 |
| 254 | 3300005840 | Ga0068870_10321325 | Ga0068870_103213253 | 92 |
| 255 | 3300005840 | Ga0068870_10417160 | Ga0068870_104171601 | 92 |
| 256 | 3300005841 | Ga0068863_100175325 | Ga0068863_1001753252 | 92 |
| 257 | 3300005841 | Ga0068863_100258389 | Ga0068863_1002583893 | 92 |
| 258 | 3300005841 | Ga0068863_101044610 | Ga0068863_1010446102 | 92 |
| 259 | 3300005842 | Ga0068858_100047010 | Ga0068858_1000470103 | 92 |
| 260 | 3300005842 | Ga0068858_100052664 | Ga0068858_1000526644 | 92 |
| 261 | 3300005842 | Ga0068858_100120538 | Ga0068858_1001205384 | 92 |
| 262 | 3300005843 | Ga0068860_100103993 | Ga0068860_1001039934 | 92 |
| 263 | 3300005844 | Ga0068862_100132150 | Ga0068862_1001321503 | 92 |
| 264 | 3300005937 | Ga0081455_10358536 | Ga0081455_103585362 | 92 |
| 265 | 3300006237 | Ga0097621_100002934 | Ga0097621_1000029346 | 92 |
| 266 | 3300006358 | Ga0068871_100002200 | Ga0068871_1000022007 | 92 |
| 267 | 3300006844 | Ga0075428_102594882 | Ga0075428_1025948822 | 92 |
| 268 | 3300006852 | Ga0075433_10008013 | Ga0075433_100080136 | 92 |
| 269 | 3300006852 | Ga0075433_10057467 | Ga0075433_100574672 | 92 |
| 270 | 3300006871 | Ga0075434_100051099 | Ga0075434_1000510992 | 92 |
| 271 | 3300006871 | Ga0075434_101268780 | Ga0075434_1012687802 | 92 |
| 272 | 3300006871 | Ga0075434_102548516 | Ga0075434_1025485162 | 92 |
| 273 | 3300006931 | Ga0097620_100007875 | Ga0097620_1000078755 | 92 |
| 274 | 3300006931 | Ga0097620_100018906 | Ga0097620_1000189064 | 92 |
| 275 | 3300006931 | Ga0097620_100395662 | Ga0097620_1003956622 | 92 |
| 276 | 3300006931 | Ga0097620_100632051 | Ga0097620_1006320512 | 92 |
| 277 | 3300009011 | Ga0105251_10102011 | Ga0105251_101020113 | 92 |
| 278 | 3300009093 | Ga0105240_10742268 | Ga0105240_107422682 | 92 |
| 279 | 3300009093 | Ga0105240_12513509 | Ga0105240_125135091 | 92 |
| 280 | 3300009094 | Ga0111539_10285051 | Ga0111539_102850513 | 92 |
| 281 | 3300009147 | Ga0114129_10143244 | Ga0114129_101432443 | 92 |
| 282 | 3300009147 | Ga0114129_10221825 | Ga0114129_102218254 | 92 |
| 283 | 3300009148 | Ga0105243_10300389 | Ga0105243_103003892 | 92 |
| 284 | 3300009174 | Ga0105241_10114218 | Ga0105241_101142182 | 92 |
| 285 | 3300009174 | Ga0105241_10569560 | Ga0105241_105695602 | 92 |
| 286 | 3300009174 | Ga0105241_10887467 | Ga0105241_108874672 | 92 |
| 287 | 3300009176 | Ga0105242_10110788 | Ga0105242_101107883 | 92 |
| 288 | 3300009177 | Ga0105248_10001931 | Ga0105248_1000193110 | 92 |
| 289 | 3300009177 | Ga0105248_10998927 | Ga0105248_109989272 | 92 |
| 290 | 3300009545 | Ga0105237_10000264 | Ga0105237_1000026428 | 92 |
| 291 | 3300009553 | Ga0105249_11718089 | Ga0105249_117180892 | 92 |
| 292 | 3300010375 | Ga0105239_10165716 | Ga0105239_101657163 | 92 |
| 293 | 3300011119 | Ga0105246_10026560 | Ga0105246_100265605 | 92 |
| 294 | 3300011119 | Ga0105246_10172242 | Ga0105246_101722423 | 92 |
| 295 | 3300013296 | Ga0157374_10048415 | Ga0157374_100484152 | 92 |
| 296 | 3300013297 | Ga0157378_10057879 | Ga0157378_100578796 | 92 |
| 297 | 3300013297 | Ga0157378_10391757 | Ga0157378_103917572 | 92 |
| 298 | 3300013306 | Ga0163162_10173158 | Ga0163162_101731583 | 92 |
| 299 | 3300013306 | Ga0163162_10311373 | Ga0163162_103113733 | 92 |
| 300 | 3300013306 | Ga0163162_12075002 | Ga0163162_120750022 | 92 |
| 301 | 3300013307 | Ga0157372_10064757 | Ga0157372_100647574 | 92 |
| 302 | 3300013307 | Ga0157372_11156908 | Ga0157372_111569082 | 92 |
| 303 | 3300013307 | Ga0157372_13245896 | Ga0157372_132458961 | 92 |
| 304 | 3300013308 | Ga0157375_10108615 | Ga0157375_101086154 | 92 |
| 305 | 3300013308 | Ga0157375_10111752 | Ga0157375_101117524 | 92 |
| 306 | 3300013308 | Ga0157375_11059192 | Ga0157375_110591923 | 92 |
| 307 | 3300014325 | Ga0163163_10007125 | Ga0163163_100071254 | 92 |
| 308 | 3300014325 | Ga0163163_10110583 | Ga0163163_101105832 | 92 |
| 309 | 3300014325 | Ga0163163_10628610 | Ga0163163_106286103 | 92 |
| 310 | 3300014326 | Ga0157380_10189324 | Ga0157380_101893243 | 92 |
| 311 | 3300014326 | Ga0157380_11277256 | Ga0157380_112772562 | 92 |
| 312 | 3300014326 | Ga0157380_12371594 | Ga0157380_123715942 | 92 |
| 313 | 3300014745 | Ga0157377_10125882 | Ga0157377_101258823 | 92 |
| 314 | 3300014968 | Ga0157379_10030846 | Ga0157379_100308464 | 92 |
| 315 | 3300014969 | Ga0157376_10016049 | Ga0157376_100160492 | 92 |
| 316 | 3300017792 | Ga0163161_10483521 | Ga0163161_104835212 | 92 |
| 317 | 3300025321 | Ga0207656_10015588 | Ga0207656_100155885 | 92 |
| 318 | 3300025321 | Ga0207656_10126172 | Ga0207656_101261722 | 92 |
| 319 | 3300025735 | Ga0207713_1235717 | Ga0207713_12357172 | 92 |
| 320 | 3300025885 | Ga0207653_10005604 | Ga0207653_100056044 | 92 |
| 321 | 3300025903 | Ga0207680_10074275 | Ga0207680_100742752 | 92 |
| 322 | 3300025904 | Ga0207647_10161374 | Ga0207647_101613743 | 92 |
| 323 | 3300025904 | Ga0207647_10524303 | Ga0207647_105243032 | 92 |
| 324 | 3300025907 | Ga0207645_10166097 | Ga0207645_101660972 | 92 |
| 325 | 3300025907 | Ga0207645_10503921 | Ga0207645_105039212 | 92 |
| 326 | 3300025908 | Ga0207643_10001829 | Ga0207643_100018295 | 92 |
| 327 | 3300025908 | Ga0207643_10409698 | Ga0207643_104096982 | 92 |
| 328 | 3300025911 | Ga0207654_10158161 | Ga0207654_101581613 | 92 |
| 329 | 3300025913 | Ga0207695_10934282 | Ga0207695_109342822 | 92 |
| 330 | 3300025914 | Ga0207671_10008288 | Ga0207671_100082886 | 92 |
| 331 | 3300025917 | Ga0207660_10385109 | Ga0207660_103851092 | 92 |
| 332 | 3300025918 | Ga0207662_10205957 | Ga0207662_102059573 | 92 |
| 333 | 3300025918 | Ga0207662_10305816 | Ga0207662_103058161 | 92 |
| 334 | 3300025923 | Ga0207681_11527775 | Ga0207681_115277751 | 92 |
| 335 | 3300025925 | Ga0207650_10127319 | Ga0207650_101273193 | 92 |
| 336 | 3300025926 | Ga0207659_10085671 | Ga0207659_100856712 | 92 |
| 337 | 3300025931 | Ga0207644_10117195 | Ga0207644_101171953 | 92 |
| 338 | 3300025932 | Ga0207690_10325785 | Ga0207690_103257851 | 92 |
| 339 | 3300025932 | Ga0207690_10556621 | Ga0207690_105566212 | 92 |
| 340 | 3300025933 | Ga0207706_11064088 | Ga0207706_110640881 | 92 |
| 341 | 3300025934 | Ga0207686_10001521 | Ga0207686_1000152114 | 92 |
| 342 | 3300025934 | Ga0207686_10798279 | Ga0207686_107982791 | 92 |
| 343 | 3300025935 | Ga0207709_10673525 | Ga0207709_106735252 | 92 |
| 344 | 3300025935 | Ga0207709_10939701 | Ga0207709_109397012 | 92 |
| 345 | 3300025936 | Ga0207670_10002913 | Ga0207670_100029139 | 92 |
| 346 | 3300025936 | Ga0207670_10110200 | Ga0207670_101102003 | 92 |
| 347 | 3300025938 | Ga0207704_10236882 | Ga0207704_102368822 | 92 |
| 348 | 3300025938 | Ga0207704_10934495 | Ga0207704_109344952 | 92 |
| 349 | 3300025940 | Ga0207691_10513614 | Ga0207691_105136141 | 92 |
| 350 | 3300025940 | Ga0207691_10678931 | Ga0207691_106789312 | 92 |
| 351 | 3300025941 | Ga0207711_10012250 | Ga0207711_100122506 | 92 |
| 352 | 3300025941 | Ga0207711_10016873 | Ga0207711_100168731 | 92 |
| 353 | 3300025941 | Ga0207711_10364444 | Ga0207711_103644442 | 92 |
| 354 | 3300025941 | Ga0207711_10772123 | Ga0207711_107721232 | 92 |
| 355 | 3300025942 | Ga0207689_10073495 | Ga0207689_100734952 | 92 |
| 356 | 3300025945 | Ga0207679_10882642 | Ga0207679_108826422 | 92 |
| 357 | 3300025960 | Ga0207651_10822385 | Ga0207651_108223852 | 92 |
| 358 | 3300025960 | Ga0207651_11336501 | Ga0207651_113365011 | 92 |
| 359 | 3300025960 | Ga0207651_11901424 | Ga0207651_119014242 | 92 |
| 360 | 3300025961 | Ga0207712_11278818 | Ga0207712_112788181 | 92 |
| 361 | 3300025981 | Ga0207640_10738397 | Ga0207640_107383972 | 92 |
| 362 | 3300025981 | Ga0207640_11344160 | Ga0207640_113441602 | 92 |
| 363 | 3300025986 | Ga0207658_10020766 | Ga0207658_100207664 | 92 |
| 364 | 3300026023 | Ga0207677_10022258 | Ga0207677_100222583 | 92 |
| 365 | 3300026035 | Ga0207703_10030729 | Ga0207703_100307299 | 92 |
| 366 | 3300026035 | Ga0207703_10094616 | Ga0207703_100946164 | 92 |
| 367 | 3300026035 | Ga0207703_12071797 | Ga0207703_120717971 | 92 |
| 368 | 3300026075 | Ga0207708_10187692 | Ga0207708_101876921 | 92 |
| 369 | 3300026075 | Ga0207708_11912203 | Ga0207708_119122032 | 92 |
| 370 | 3300026088 | Ga0207641_10162416 | Ga0207641_101624161 | 92 |
| 371 | 3300026088 | Ga0207641_10205718 | Ga0207641_102057183 | 92 |
| 372 | 3300026089 | Ga0207648_10188550 | Ga0207648_101885502 | 92 |
| 373 | 3300026089 | Ga0207648_10330066 | Ga0207648_103300662 | 92 |
| 374 | 3300026095 | Ga0207676_10009127 | Ga0207676_100091278 | 92 |
| 375 | 3300026095 | Ga0207676_10108719 | Ga0207676_101087193 | 92 |
| 376 | 3300026095 | Ga0207676_10256230 | Ga0207676_102562302 | 92 |
| 377 | 3300026095 | Ga0207676_10621736 | Ga0207676_106217362 | 92 |
| 378 | 3300026116 | Ga0207674_10037994 | Ga0207674_100379943 | 92 |
| 379 | 3300026116 | Ga0207674_10314984 | Ga0207674_103149844 | 92 |
| 380 | 3300026121 | Ga0207683_10440588 | Ga0207683_104405882 | 92 |
| 381 | 3300026142 | Ga0207698_10226477 | Ga0207698_102264771 | 92 |
| 382 | 3300026142 | Ga0207698_10270125 | Ga0207698_102701251 | 92 |
| 383 | 3300028379 | Ga0268266_10034047 | Ga0268266_100340474 | 92 |
| 384 | 3300028379 | Ga0268266_10275232 | Ga0268266_102752323 | 92 |
| 385 | 3300028380 | Ga0268265_10209294 | Ga0268265_102092943 | 92 |
| 386 | 3300028381 | Ga0268264_10276777 | Ga0268264_102767771 | 92 |
| 387 | 3300028381 | Ga0268264_10909962 | Ga0268264_109099621 | 92 |
| 388 | 3300028381 | Ga0268264_11684551 | Ga0268264_116845512 | 92 |
| 389 | 3300036401 | Ga0373937_0321865 | Ga0373937_0321865_760_1053 | 92 |
| 390 | 3300041999 | Ga0439433_0023973 | Ga0439433_0023973_715_1011 | 92 |
| 391 | 3300042015 | Ga0439462_0014736 | Ga0439462_0014736_889_1185 | 92 |
| 392 | 3300042435 | Ga0439434_0041954 | Ga0439434_0041954_606_902 | 92 |
| 393 | 3300044673 | Ga0453683_0136873 | Ga0453683_0136873_732_1028 | 92 |
| 394 | 3300045051 | Ga0451576_2387108 | Ga0451576_2387108_215_511 | 92 |
| 395 | 3300046473 | Ga0495582_0378178 | Ga0495582_0378178_470_763 | 92 |
| 396 | 3300046683 | Ga0495658_0097910 | Ga0495658_0097910_596_889 | 92 |
| 397 | 3300048905 | Ga0496102_0662642 | Ga0496102_0662642_458_760 | 92 |
| 398 | 3300048909 | Ga0496106_1072112 | Ga0496106_1072112_95_391 | 92 |
| 399 | 3300048913 | Ga0496110_0922535 | Ga0496110_0922535_202_495 | 92 |
| 400 | 3300048914 | Ga0496111_0610611 | Ga0496111_0610611_37_333 | 92 |
| 401 | 3300048915 | Ga0496112_1721060 | Ga0496112_1721060_196_489 | 92 |
| 402 | 3300048916 | Ga0496113_0217710 | Ga0496113_0217710_581_883 | 92 |
| 403 | 3300048916 | Ga0496113_0447418 | Ga0496113_0447418_90_383 | 92 |
| 404 | 3300049574 | Ga0501038_0113649 | Ga0501038_0113649_1614_1910 | 92 |
| 405 | 3300049663 | Ga0501223_090870 | Ga0501223_090870_269_565 | 92 |
| 406 | 3300049668 | Ga0501233_034465 | Ga0501233_034465_125_421 | 92 |
| 407 | 3300050507 | nmdc:mga05p37_11964_c2 | nmdc:mga05p37_11964_c2_211_507 | 92 |
| 408 | 3300050507 | nmdc:mga05p37_653436_c1 | nmdc:mga05p37_653436_c1_121_417 | 92 |
| 409 | 3300050511 | nmdc:mga08y16_1646788_c1 | nmdc:mga08y16_1646788_c1_164_460 | 92 |
| 410 | 3300050512 | nmdc:mga0n895_243353_c1 | nmdc:mga0n895_243353_c1_624_920 | 92 |
| 411 | 3300050512 | nmdc:mga0n895_834855_c1 | nmdc:mga0n895_834855_c1_48_344 | 92 |
| 412 | 3300050515 | nmdc:mga0a205_211437_c1 | nmdc:mga0a205_211437_c1_951_1247 | 92 |
| 413 | 3300050515 | nmdc:mga0a205_69857_c1 | nmdc:mga0a205_69857_c1_1680_1976 | 92 |
| 414 | 2162886012 | MBSR1b_contig_3385735 | MBSR1b_0259.00001710 | 93 |
| 415 | 3300005289 | Ga0065704_10166104 | Ga0065704_101661043 | 93 |
| 416 | 3300005290 | Ga0065712_10005040 | Ga0065712_100050405 | 93 |
| 417 | 3300005293 | Ga0065715_10047621 | Ga0065715_100476212 | 93 |
| 418 | 3300005295 | Ga0065707_10147838 | Ga0065707_101478383 | 93 |
| 419 | 3300005330 | Ga0070690_100027531 | Ga0070690_1000275313 | 93 |
| 420 | 3300005331 | Ga0070670_100380512 | Ga0070670_1003805123 | 93 |
| 421 | 3300005333 | Ga0070677_10218516 | Ga0070677_102185162 | 93 |
| 422 | 3300005334 | Ga0068869_100031026 | Ga0068869_1000310265 | 93 |
| 423 | 3300005334 | Ga0068869_100221420 | Ga0068869_1002214201 | 93 |
| 424 | 3300005335 | Ga0070666_10155061 | Ga0070666_101550613 | 93 |
| 425 | 3300005336 | Ga0070680_100005787 | Ga0070680_1000057879 | 93 |
| 426 | 3300005337 | Ga0070682_100259310 | Ga0070682_1002593102 | 93 |
| 427 | 3300005338 | Ga0068868_100089732 | Ga0068868_1000897322 | 93 |
| 428 | 3300005339 | Ga0070660_100292179 | Ga0070660_1002921791 | 93 |
| 429 | 3300005340 | Ga0070689_101400809 | Ga0070689_1014008091 | 93 |
| 430 | 3300005343 | Ga0070687_100099187 | Ga0070687_1000991872 | 93 |
| 431 | 3300005344 | Ga0070661_100286860 | Ga0070661_1002868602 | 93 |
| 432 | 3300005344 | Ga0070661_100506466 | Ga0070661_1005064661 | 93 |
| 433 | 3300005345 | Ga0070692_10016318 | Ga0070692_100163183 | 93 |
| 434 | 3300005345 | Ga0070692_10068731 | Ga0070692_100687315 | 93 |
| 435 | 3300005345 | Ga0070692_10471635 | Ga0070692_104716352 | 93 |
| 436 | 3300005353 | Ga0070669_100265288 | Ga0070669_1002652883 | 93 |
| 437 | 3300005353 | Ga0070669_100943334 | Ga0070669_1009433342 | 93 |
| 438 | 3300005354 | Ga0070675_100334410 | Ga0070675_1003344102 | 93 |
| 439 | 3300005355 | Ga0070671_100027395 | Ga0070671_1000273952 | 93 |
| 440 | 3300005364 | Ga0070673_100083222 | Ga0070673_1000832224 | 93 |
| 441 | 3300005364 | Ga0070673_100192685 | Ga0070673_1001926852 | 93 |
| 442 | 3300005365 | Ga0070688_100019538 | Ga0070688_1000195386 | 93 |
| 443 | 3300005366 | Ga0070659_100028338 | Ga0070659_1000283384 | 93 |
| 444 | 3300005367 | Ga0070667_100069166 | Ga0070667_1000691663 | 93 |
| 445 | 3300005438 | Ga0070701_10033699 | Ga0070701_100336993 | 93 |
| 446 | 3300005440 | Ga0070705_100017216 | Ga0070705_1000172164 | 93 |
| 447 | 3300005444 | Ga0070694_100103937 | Ga0070694_1001039373 | 93 |
| 448 | 3300005444 | Ga0070694_100126246 | Ga0070694_1001262463 | 93 |
| 449 | 3300005455 | Ga0070663_100366208 | Ga0070663_1003662082 | 93 |
| 450 | 3300005456 | Ga0070678_100028427 | Ga0070678_1000284273 | 93 |
| 451 | 3300005457 | Ga0070662_100345425 | Ga0070662_1003454251 | 93 |
| 452 | 3300005458 | Ga0070681_10008402 | Ga0070681_100084029 | 93 |
| 453 | 3300005459 | Ga0068867_100047917 | Ga0068867_1000479173 | 93 |
| 454 | 3300005471 | Ga0070698_100824118 | Ga0070698_1008241182 | 93 |
| 455 | 3300005518 | Ga0070699_101140029 | Ga0070699_1011400292 | 93 |
| 456 | 3300005530 | Ga0070679_100236447 | Ga0070679_1002364471 | 93 |
| 457 | 3300005535 | Ga0070684_100215481 | Ga0070684_1002154813 | 93 |
| 458 | 3300005539 | Ga0068853_100311168 | Ga0068853_1003111683 | 93 |
| 459 | 3300005543 | Ga0070672_100390632 | Ga0070672_1003906323 | 93 |
| 460 | 3300005544 | Ga0070686_100003078 | Ga0070686_1000030786 | 93 |
| 461 | 3300005546 | Ga0070696_100338084 | Ga0070696_1003380842 | 93 |
| 462 | 3300005548 | Ga0070665_100398630 | Ga0070665_1003986301 | 93 |
| 463 | 3300005549 | Ga0070704_102078181 | Ga0070704_1020781811 | 93 |
| 464 | 3300005563 | Ga0068855_101208435 | Ga0068855_1012084352 | 93 |
| 465 | 3300005564 | Ga0070664_100005565 | Ga0070664_1000055659 | 93 |
| 466 | 3300005564 | Ga0070664_100596731 | Ga0070664_1005967312 | 93 |
| 467 | 3300005577 | Ga0068857_100004581 | Ga0068857_1000045813 | 93 |
| 468 | 3300005577 | Ga0068857_100113003 | Ga0068857_1001130032 | 93 |
| 469 | 3300005578 | Ga0068854_100039363 | Ga0068854_1000393633 | 93 |
| 470 | 3300005615 | Ga0070702_100099509 | Ga0070702_1000995092 | 93 |
| 471 | 3300005616 | Ga0068852_100425659 | Ga0068852_1004256592 | 93 |
| 472 | 3300005617 | Ga0068859_100145099 | Ga0068859_1001450993 | 93 |
| 473 | 3300005617 | Ga0068859_100207003 | Ga0068859_1002070033 | 93 |
| 474 | 3300005617 | Ga0068859_102032671 | Ga0068859_1020326712 | 93 |
| 475 | 3300005618 | Ga0068864_100040916 | Ga0068864_1000409163 | 93 |
| 476 | 3300005618 | Ga0068864_101073602 | Ga0068864_1010736021 | 93 |
| 477 | 3300005718 | Ga0068866_10008901 | Ga0068866_100089013 | 93 |
| 478 | 3300005719 | Ga0068861_100040986 | Ga0068861_1000409865 | 93 |
| 479 | 3300005719 | Ga0068861_100778348 | Ga0068861_1007783481 | 93 |
| 480 | 3300005841 | Ga0068863_100416631 | Ga0068863_1004166311 | 93 |
| 481 | 3300005842 | Ga0068858_100010380 | Ga0068858_1000103808 | 93 |
| 482 | 3300005842 | Ga0068858_100098077 | Ga0068858_1000980774 | 93 |
| 483 | 3300005843 | Ga0068860_100047587 | Ga0068860_1000475873 | 93 |
| 484 | 3300005844 | Ga0068862_100012119 | Ga0068862_1000121193 | 93 |
| 485 | 3300005983 | Ga0081540_1288456 | Ga0081540_12884562 | 93 |
| 486 | 3300005985 | Ga0081539_10179258 | Ga0081539_101792582 | 93 |
| 487 | 3300006237 | Ga0097621_100161133 | Ga0097621_1001611332 | 93 |
| 488 | 3300006358 | Ga0068871_100109787 | Ga0068871_1001097871 | 93 |
| 489 | 3300006844 | Ga0075428_100017311 | Ga0075428_1000173112 | 93 |
| 490 | 3300006847 | Ga0075431_102149325 | Ga0075431_1021493252 | 93 |
| 491 | 3300006852 | Ga0075433_10012260 | Ga0075433_100122606 | 93 |
| 492 | 3300006852 | Ga0075433_10924548 | Ga0075433_109245482 | 93 |
| 493 | 3300006871 | Ga0075434_100394075 | Ga0075434_1003940752 | 93 |
| 494 | 3300006881 | Ga0068865_100002742 | Ga0068865_1000027427 | 93 |
| 495 | 3300006931 | Ga0097620_100145102 | Ga0097620_1001451022 | 93 |
| 496 | 3300006931 | Ga0097620_100207000 | Ga0097620_1002070003 | 93 |
| 497 | 3300006931 | Ga0097620_102033807 | Ga0097620_1020338072 | 93 |
| 498 | 3300009092 | Ga0105250_10064250 | Ga0105250_100642502 | 93 |
| 499 | 3300009094 | Ga0111539_10112058 | Ga0111539_101120584 | 93 |
| 500 | 3300009098 | Ga0105245_10065278 | Ga0105245_100652784 | 93 |
| 501 | 3300009147 | Ga0114129_10059772 | Ga0114129_100597726 | 93 |
| 502 | 3300009148 | Ga0105243_10016886 | Ga0105243_100168864 | 93 |
| 503 | 3300009174 | Ga0105241_10088421 | Ga0105241_100884214 | 93 |
| 504 | 3300009174 | Ga0105241_10397644 | Ga0105241_103976443 | 93 |
| 505 | 3300009176 | Ga0105242_10028000 | Ga0105242_100280003 | 93 |
| 506 | 3300009176 | Ga0105242_12342458 | Ga0105242_123424582 | 93 |
| 507 | 3300009177 | Ga0105248_10087760 | Ga0105248_100877602 | 93 |
| 508 | 3300009177 | Ga0105248_10796184 | Ga0105248_107961842 | 93 |
| 509 | 3300009553 | Ga0105249_10110974 | Ga0105249_101109742 | 93 |
| 510 | 3300009553 | Ga0105249_10258421 | Ga0105249_102584214 | 93 |
| 511 | 3300010375 | Ga0105239_10115932 | Ga0105239_101159323 | 93 |
| 512 | 3300011119 | Ga0105246_10006555 | Ga0105246_100065554 | 93 |
| 513 | 3300013296 | Ga0157374_10222733 | Ga0157374_102227333 | 93 |
| 514 | 3300013297 | Ga0157378_10031045 | Ga0157378_100310454 | 93 |
| 515 | 3300013297 | Ga0157378_10441303 | Ga0157378_104413032 | 93 |
| 516 | 3300013297 | Ga0157378_12108074 | Ga0157378_121080741 | 93 |
| 517 | 3300013306 | Ga0163162_10009333 | Ga0163162_100093337 | 93 |
| 518 | 3300013306 | Ga0163162_10964984 | Ga0163162_109649842 | 93 |
| 519 | 3300013307 | Ga0157372_10332722 | Ga0157372_103327223 | 93 |
| 520 | 3300013308 | Ga0157375_11426255 | Ga0157375_114262552 | 93 |
| 521 | 3300013308 | Ga0157375_11545980 | Ga0157375_115459802 | 93 |
| 522 | 3300013308 | Ga0157375_11971150 | Ga0157375_119711502 | 93 |
| 523 | 3300014325 | Ga0163163_10058727 | Ga0163163_100587273 | 93 |
| 524 | 3300014325 | Ga0163163_10133794 | Ga0163163_101337943 | 93 |
| 525 | 3300014325 | Ga0163163_10142835 | Ga0163163_101428353 | 93 |
| 526 | 3300014325 | Ga0163163_12062325 | Ga0163163_120623251 | 93 |
| 527 | 3300014326 | Ga0157380_10039822 | Ga0157380_100398222 | 93 |
| 528 | 3300014745 | Ga0157377_10034821 | Ga0157377_100348215 | 93 |
| 529 | 3300014968 | Ga0157379_11399665 | Ga0157379_113996651 | 93 |
| 530 | 3300014969 | Ga0157376_10023330 | Ga0157376_100233304 | 93 |
| 531 | 3300017792 | Ga0163161_10041016 | Ga0163161_100410163 | 93 |
| 532 | 3300025315 | Ga0207697_10011469 | Ga0207697_100114695 | 93 |
| 533 | 3300025899 | Ga0207642_10021395 | Ga0207642_100213951 | 93 |
| 534 | 3300025903 | Ga0207680_10107490 | Ga0207680_101074904 | 93 |
| 535 | 3300025904 | Ga0207647_10097786 | Ga0207647_100977863 | 93 |
| 536 | 3300025904 | Ga0207647_10468030 | Ga0207647_104680302 | 93 |
| 537 | 3300025907 | Ga0207645_10045469 | Ga0207645_100454692 | 93 |
| 538 | 3300025912 | Ga0207707_10089287 | Ga0207707_100892871 | 93 |
| 539 | 3300025917 | Ga0207660_10227126 | Ga0207660_102271263 | 93 |
| 540 | 3300025918 | Ga0207662_10069177 | Ga0207662_100691772 | 93 |
| 541 | 3300025919 | Ga0207657_10095149 | Ga0207657_100951493 | 93 |
| 542 | 3300025920 | Ga0207649_10240720 | Ga0207649_102407202 | 93 |
| 543 | 3300025921 | Ga0207652_10098469 | Ga0207652_100984694 | 93 |
| 544 | 3300025923 | Ga0207681_10536469 | Ga0207681_105364691 | 93 |
| 545 | 3300025923 | Ga0207681_10890791 | Ga0207681_108907912 | 93 |
| 546 | 3300025925 | Ga0207650_10963907 | Ga0207650_109639071 | 93 |
| 547 | 3300025926 | Ga0207659_10178300 | Ga0207659_101783002 | 93 |
| 548 | 3300025931 | Ga0207644_10225070 | Ga0207644_102250702 | 93 |
| 549 | 3300025932 | Ga0207690_10013344 | Ga0207690_100133441 | 93 |
| 550 | 3300025933 | Ga0207706_10898223 | Ga0207706_108982232 | 93 |
| 551 | 3300025935 | Ga0207709_10039349 | Ga0207709_100393494 | 93 |
| 552 | 3300025936 | Ga0207670_10135379 | Ga0207670_101353791 | 93 |
| 553 | 3300025937 | Ga0207669_10517010 | Ga0207669_105170102 | 93 |
| 554 | 3300025938 | Ga0207704_10041191 | Ga0207704_100411911 | 93 |
| 555 | 3300025940 | Ga0207691_10010300 | Ga0207691_100103006 | 93 |
| 556 | 3300025941 | Ga0207711_10062975 | Ga0207711_100629754 | 93 |
| 557 | 3300025941 | Ga0207711_10787371 | Ga0207711_107873712 | 93 |
| 558 | 3300025942 | Ga0207689_10012375 | Ga0207689_100123754 | 93 |
| 559 | 3300025942 | Ga0207689_10614053 | Ga0207689_106140531 | 93 |
| 560 | 3300025944 | Ga0207661_10628059 | Ga0207661_106280591 | 93 |
| 561 | 3300025945 | Ga0207679_10005977 | Ga0207679_1000597710 | 93 |
| 562 | 3300025949 | Ga0207667_11062423 | Ga0207667_110624231 | 93 |
| 563 | 3300025960 | Ga0207651_10224267 | Ga0207651_102242673 | 93 |
| 564 | 3300025960 | Ga0207651_10325554 | Ga0207651_103255541 | 93 |
| 565 | 3300025961 | Ga0207712_10041059 | Ga0207712_100410596 | 93 |
| 566 | 3300025981 | Ga0207640_10326166 | Ga0207640_103261662 | 93 |
| 567 | 3300025986 | Ga0207658_10049212 | Ga0207658_100492124 | 93 |
| 568 | 3300026023 | Ga0207677_10212281 | Ga0207677_102122813 | 93 |
| 569 | 3300026035 | Ga0207703_10271962 | Ga0207703_102719623 | 93 |
| 570 | 3300026041 | Ga0207639_10181503 | Ga0207639_101815032 | 93 |
| 571 | 3300026067 | Ga0207678_10290034 | Ga0207678_102900343 | 93 |
| 572 | 3300026088 | Ga0207641_10144435 | Ga0207641_101444352 | 93 |
| 573 | 3300026089 | Ga0207648_10011861 | Ga0207648_100118616 | 93 |
| 574 | 3300026095 | Ga0207676_10151530 | Ga0207676_101515303 | 93 |
| 575 | 3300026095 | Ga0207676_10165974 | Ga0207676_101659743 | 93 |
| 576 | 3300026116 | Ga0207674_10000391 | Ga0207674_1000039134 | 93 |
| 577 | 3300026116 | Ga0207674_10440985 | Ga0207674_104409852 | 93 |
| 578 | 3300026118 | Ga0207675_100001515 | Ga0207675_10000151511 | 93 |
| 579 | 3300026121 | Ga0207683_10028711 | Ga0207683_100287114 | 93 |
| 580 | 3300026142 | Ga0207698_10357250 | Ga0207698_103572503 | 93 |
| 581 | 3300028380 | Ga0268265_11691359 | Ga0268265_116913591 | 93 |
| 582 | 3300028381 | Ga0268264_10232837 | Ga0268264_102328373 | 93 |
| 583 | 3300042876 | Ga0451577_0404706 | Ga0451577_0404706_491_796 | 93 |
| 584 | 3300044712 | Ga0453684_1304376 | Ga0453684_1304376_47_352 | 93 |
| 585 | 3300045051 | Ga0451576_0410233 | Ga0451576_0410233_878_1183 | 93 |
| 586 | 3300046539 | Ga0495621_0455843 | Ga0495621_0455843_242_535 | 93 |
| 587 | 3300046684 | Ga0495669_0194262 | Ga0495669_0194262_100_393 | 93 |
| 588 | 3300048905 | Ga0496102_1676142 | Ga0496102_1676142_155_460 | 93 |
| 589 | 3300049130 | Ga0501310_050247 | Ga0501310_050247_215_520 | 93 |
| 590 | 3300049515 | Ga0501292_004413 | Ga0501292_004413_218_523 | 93 |
| 591 | 3300049519 | Ga0501296_008480 | Ga0501296_008480_764_1069 | 93 |
| 592 | 3300049521 | Ga0501298_009963 | Ga0501298_009963_922_1227 | 93 |
| 593 | 3300049528 | Ga0501312_071016 | Ga0501312_071016_144_449 | 93 |
| 594 | 3300049649 | Ga0501198_007421 | Ga0501198_007421_683_988 | 93 |
| 595 | 3300049660 | Ga0501216_016315 | Ga0501216_016315_285_590 | 93 |
| 596 | 3300049661 | Ga0501217_165647 | Ga0501217_165647_163_468 | 93 |
| 597 | 3300049663 | Ga0501223_018432 | Ga0501223_018432_529_834 | 93 |
| 598 | 3300049664 | Ga0501224_001118 | Ga0501224_001118_1871_2176 | 93 |
| 599 | 3300049665 | Ga0501227_001664 | Ga0501227_001664_1916_2221 | 93 |
| 600 | 3300049668 | Ga0501233_013375 | Ga0501233_013375_138_443 | 93 |
| 601 | 3300049673 | Ga0501240_000544 | Ga0501240_000544_1184_1489 | 93 |
| 602 | 3300049675 | Ga0501243_017783 | Ga0501243_017783_549_854 | 93 |
| 603 | 3300049676 | Ga0501246_002739 | Ga0501246_002739_121_426 | 93 |
| 604 | 3300049683 | Ga0501253_133060 | Ga0501253_133060_136_441 | 93 |
| 605 | 3300049685 | Ga0501256_038940 | Ga0501256_038940_129_434 | 93 |
| 606 | 3300049688 | Ga0501259_043382 | Ga0501259_043382_548_853 | 93 |
| 607 | 3300049689 | Ga0501260_001515 | Ga0501260_001515_1485_1790 | 93 |
| 608 | 3300049704 | Ga0501221_006473 | Ga0501221_006473_369_674 | 93 |
| 609 | 3300049706 | Ga0501229_008988 | Ga0501229_008988_377_682 | 93 |
| 610 | 3300049707 | Ga0501234_005255 | Ga0501234_005255_592_897 | 93 |
| 611 | 3300049708 | Ga0501245_011276 | Ga0501245_011276_651_956 | 93 |
| 612 | 3300049765 | Ga0501268_000436 | Ga0501268_000436_1360_1665 | 93 |
| 613 | 3300049767 | Ga0501270_071711 | Ga0501270_071711_85_390 | 93 |
| 614 | 3300049768 | Ga0501271_020441 | Ga0501271_020441_250_555 | 93 |
| 615 | 3300049851 | Ga0501212_022512 | Ga0501212_022512_127_432 | 93 |
| 616 | 3300049853 | Ga0501226_007950 | Ga0501226_007950_119_424 | 93 |
| 617 | 3300050507 | nmdc:mga05p37_114956_c1 | nmdc:mga05p37_114956_c1_1805_2110 | 93 |
| 618 | 3300050510 | nmdc:mga06r32_1415684_c1 | nmdc:mga06r32_1415684_c1_136_441 | 93 |
| 619 | 3300050511 | nmdc:mga08y16_560295_c1 | nmdc:mga08y16_560295_c1_267_572 | 93 |
| 620 | 3300050512 | nmdc:mga0n895_422534_c1 | nmdc:mga0n895_422534_c1_857_1162 | 93 |
| 621 | 3300050512 | nmdc:mga0n895_79753_c1 | nmdc:mga0n895_79753_c1_182_487 | 93 |
| 622 | 3300050515 | nmdc:mga0a205_1498812_c1 | nmdc:mga0a205_1498812_c1_110_415 | 93 |
| 623 | 3300050515 | nmdc:mga0a205_43932_c1 | nmdc:mga0a205_43932_c1_2146_2451 | 93 |
| 624 | 3300005288 | Ga0065714_10064435 | Ga0065714_1006443569 | 94 |
| 625 | 3300005290 | Ga0065712_10000118 | Ga0065712_1000011870 | 94 |
| 626 | 3300005293 | Ga0065715_10014122 | Ga0065715_100141222 | 94 |
| 627 | 3300005293 | Ga0065715_10088964 | Ga0065715_1008896412 | 94 |
| 628 | 3300005536 | Ga0070697_100374935 | Ga0070697_1003749352 | 94 |
| 629 | 3300031731 | Ga0307405_10479589 | Ga0307405_104795892 | 94 |
| 630 | 3300031852 | Ga0307410_10010140 | Ga0307410_100101406 | 94 |
| 631 | 3300031901 | Ga0307406_10049362 | Ga0307406_100493623 | 94 |
| 632 | 3300031911 | Ga0307412_10024058 | Ga0307412_100240584 | 94 |
| 633 | 3300031995 | Ga0307409_100135427 | Ga0307409_1001354273 | 94 |
| 634 | 3300032002 | Ga0307416_100480300 | Ga0307416_1004803002 | 94 |
| 635 | 3300032004 | Ga0307414_10113158 | Ga0307414_101131582 | 94 |
| 636 | 3300032005 | Ga0307411_10074533 | Ga0307411_100745334 | 94 |
| 637 | 3300032126 | Ga0307415_100443212 | Ga0307415_1004432122 | 94 |
| 638 | 3300048910 | Ga0496107_0080120 | Ga0496107_0080120_1548_1853 | 94 |
| 639 | 3300048910 | Ga0496107_0327234 | Ga0496107_0327234_447_752 | 94 |
| 640 | 3300049514 | Ga0501291_002632 | Ga0501291_002632_1322_1630 | 94 |
| 641 | 3300049517 | Ga0501294_013602 | Ga0501294_013602_305_613 | 94 |
| 642 | 3300049519 | Ga0501296_023104 | Ga0501296_023104_292_600 | 94 |
| 643 | 3300049520 | Ga0501297_001243 | Ga0501297_001243_921_1229 | 94 |
| 644 | 3300049522 | Ga0501299_002680 | Ga0501299_002680_1258_1566 | 94 |
| 645 | 3300049649 | Ga0501198_002996 | Ga0501198_002996_1033_1341 | 94 |
| 646 | 3300049653 | Ga0501206_002162 | Ga0501206_002162_2162_2470 | 94 |
| 647 | 3300049656 | Ga0501209_022646 | Ga0501209_022646_711_1019 | 94 |
| 648 | 3300049660 | Ga0501216_000852 | Ga0501216_000852_1239_1547 | 94 |
| 649 | 3300049661 | Ga0501217_008765 | Ga0501217_008765_896_1204 | 94 |
| 650 | 3300049663 | Ga0501223_076697 | Ga0501223_076697_185_493 | 94 |
| 651 | 3300049665 | Ga0501227_058698 | Ga0501227_058698_94_402 | 94 |
| 652 | 3300049669 | Ga0501235_005315 | Ga0501235_005315_1064_1372 | 94 |
| 653 | 3300049671 | Ga0501238_035673 | Ga0501238_035673_320_628 | 94 |
| 654 | 3300049679 | Ga0501249_006708 | Ga0501249_006708_1571_1879 | 94 |
| 655 | 3300049681 | Ga0501251_080559 | Ga0501251_080559_68_376 | 94 |
| 656 | 3300049685 | Ga0501256_005331 | Ga0501256_005331_469_777 | 94 |
| 657 | 3300049688 | Ga0501259_164031 | Ga0501259_164031_236_544 | 94 |
| 658 | 3300049704 | Ga0501221_014700 | Ga0501221_014700_194_502 | 94 |
| 659 | 3300049705 | Ga0501225_0063380 | Ga0501225_0063380_286_594 | 94 |
| 660 | 3300049707 | Ga0501234_006234 | Ga0501234_006234_1081_1389 | 94 |
| 661 | 3300049757 | Ga0501232_036448 | Ga0501232_036448_285_593 | 94 |
| 662 | 3300049772 | Ga0501275_009284 | Ga0501275_009284_600_908 | 94 |
| 663 | 3300049774 | Ga0501278_001700 | Ga0501278_001700_314_622 | 94 |
| 664 | 3300049850 | Ga0501204_005715 | Ga0501204_005715_368_676 | 94 |
| 665 | 3300049851 | Ga0501212_004834 | Ga0501212_004834_1340_1648 | 94 |
| 666 | 3300005331 | Ga0070670_100062091 | Ga0070670_1000620914 | 95 |
| 667 | 3300005563 | Ga0068855_102057399 | Ga0068855_1020573991 | 95 |
| 668 | 3300005577 | Ga0068857_101342870 | Ga0068857_1013428702 | 95 |
| 669 | 3300013307 | Ga0157372_10315365 | Ga0157372_103153651 | 95 |
| 670 | 3300013308 | Ga0157375_10306171 | Ga0157375_103061712 | 95 |
| 671 | 3300025925 | Ga0207650_10188670 | Ga0207650_101886704 | 95 |
| 672 | 3300025925 | Ga0207650_10593913 | Ga0207650_105939132 | 95 |
| 673 | 3300025949 | Ga0207667_11492544 | Ga0207667_114925442 | 95 |
| 674 | 3300031852 | Ga0307410_11121230 | Ga0307410_111212302 | 95 |
| 675 | 3300031903 | Ga0307407_10660409 | Ga0307407_106604091 | 95 |
| 676 | 3300032004 | Ga0307414_10587700 | Ga0307414_105877002 | 95 |
| 677 | 3300032126 | Ga0307415_100282351 | Ga0307415_1002823512 | 95 |
| 678 | 2088090001 | CNB_F6ESG4R02GJA28 | CNB_01007120 | 96 |
| 679 | 2162886007 | SwRhRL2b_contig_1394274 | SwRhRL2b_0202.00000890 | 96 |
| 680 | 3300000532 | CNAas_1001055 | CNAas_10010552 | 96 |
| 681 | 3300001904 | JGI24736J21556_1013466 | JGI24736J21556_10134663 | 96 |
| 682 | 3300001990 | JGI24737J22298_10053525 | JGI24737J22298_100535252 | 96 |
| 683 | 3300005289 | Ga0065704_10077444 | Ga0065704_100774447 | 96 |
| 684 | 3300005289 | Ga0065704_10288123 | Ga0065704_102881231 | 96 |
| 685 | 3300005290 | Ga0065712_10077663 | Ga0065712_100776635 | 96 |
| 686 | 3300005293 | Ga0065715_10126787 | Ga0065715_101267875 | 96 |
| 687 | 3300005293 | Ga0065715_10147568 | Ga0065715_101475683 | 96 |
| 688 | 3300005293 | Ga0065715_10184217 | Ga0065715_101842172 | 96 |
| 689 | 3300005293 | Ga0065715_10322335 | Ga0065715_103223352 | 96 |
| 690 | 3300005295 | Ga0065707_10086482 | Ga0065707_100864826 | 96 |
| 691 | 3300005295 | Ga0065707_10714456 | Ga0065707_107144561 | 96 |
| 692 | 3300005330 | Ga0070690_100480542 | Ga0070690_1004805422 | 96 |
| 693 | 3300005330 | Ga0070690_100782796 | Ga0070690_1007827962 | 96 |
| 694 | 3300005331 | Ga0070670_101398025 | Ga0070670_1013980251 | 96 |
| 695 | 3300005331 | Ga0070670_101723564 | Ga0070670_1017235641 | 96 |
| 696 | 3300005334 | Ga0068869_100150240 | Ga0068869_1001502403 | 96 |
| 697 | 3300005334 | Ga0068869_100940998 | Ga0068869_1009409982 | 96 |
| 698 | 3300005337 | Ga0070682_100058537 | Ga0070682_1000585373 | 96 |
| 699 | 3300005341 | Ga0070691_10541176 | Ga0070691_105411761 | 96 |
| 700 | 3300005343 | Ga0070687_100215779 | Ga0070687_1002157792 | 96 |
| 701 | 3300005345 | Ga0070692_10011688 | Ga0070692_100116886 | 96 |
| 702 | 3300005345 | Ga0070692_10141019 | Ga0070692_101410192 | 96 |
| 703 | 3300005345 | Ga0070692_10450084 | Ga0070692_104500842 | 96 |
| 704 | 3300005355 | Ga0070671_100759461 | Ga0070671_1007594612 | 96 |
| 705 | 3300005364 | Ga0070673_100461694 | Ga0070673_1004616943 | 96 |
| 706 | 3300005364 | Ga0070673_102245339 | Ga0070673_1022453391 | 96 |
| 707 | 3300005366 | Ga0070659_100175184 | Ga0070659_1001751842 | 96 |
| 708 | 3300005438 | Ga0070701_10332370 | Ga0070701_103323702 | 96 |
| 709 | 3300005438 | Ga0070701_10518120 | Ga0070701_105181202 | 96 |
| 710 | 3300005440 | Ga0070705_100082743 | Ga0070705_1000827432 | 96 |
| 711 | 3300005440 | Ga0070705_100451032 | Ga0070705_1004510322 | 96 |
| 712 | 3300005440 | Ga0070705_100573569 | Ga0070705_1005735692 | 96 |
| 713 | 3300005441 | Ga0070700_100106143 | Ga0070700_1001061432 | 96 |
| 714 | 3300005441 | Ga0070700_100106583 | Ga0070700_1001065832 | 96 |
| 715 | 3300005441 | Ga0070700_100142886 | Ga0070700_1001428863 | 96 |
| 716 | 3300005444 | Ga0070694_100020624 | Ga0070694_1000206244 | 96 |
| 717 | 3300005459 | Ga0068867_100060133 | Ga0068867_1000601333 | 96 |
| 718 | 3300005467 | Ga0070706_100337991 | Ga0070706_1003379912 | 96 |
| 719 | 3300005468 | Ga0070707_100126752 | Ga0070707_1001267523 | 96 |
| 720 | 3300005471 | Ga0070698_100017251 | Ga0070698_1000172517 | 96 |
| 721 | 3300005539 | Ga0068853_100964908 | Ga0068853_1009649081 | 96 |
| 722 | 3300005539 | Ga0068853_101245951 | Ga0068853_1012459511 | 96 |
| 723 | 3300005545 | Ga0070695_100181827 | Ga0070695_1001818272 | 96 |
| 724 | 3300005545 | Ga0070695_101229806 | Ga0070695_1012298062 | 96 |
| 725 | 3300005546 | Ga0070696_100457168 | Ga0070696_1004571681 | 96 |
| 726 | 3300005546 | Ga0070696_100581852 | Ga0070696_1005818521 | 96 |
| 727 | 3300005547 | Ga0070693_100052610 | Ga0070693_1000526104 | 96 |
| 728 | 3300005547 | Ga0070693_100960661 | Ga0070693_1009606611 | 96 |
| 729 | 3300005549 | Ga0070704_100300710 | Ga0070704_1003007103 | 96 |
| 730 | 3300005563 | Ga0068855_101086725 | Ga0068855_1010867251 | 96 |
| 731 | 3300005578 | Ga0068854_100802087 | Ga0068854_1008020872 | 96 |
| 732 | 3300005578 | Ga0068854_101583668 | Ga0068854_1015836682 | 96 |
| 733 | 3300005615 | Ga0070702_100007838 | Ga0070702_1000078383 | 96 |
| 734 | 3300005615 | Ga0070702_100016078 | Ga0070702_1000160783 | 96 |
| 735 | 3300005615 | Ga0070702_100027670 | Ga0070702_1000276703 | 96 |
| 736 | 3300005616 | Ga0068852_100711303 | Ga0068852_1007113032 | 96 |
| 737 | 3300005616 | Ga0068852_101796051 | Ga0068852_1017960512 | 96 |
| 738 | 3300005616 | Ga0068852_102033763 | Ga0068852_1020337631 | 96 |
| 739 | 3300005617 | Ga0068859_100084986 | Ga0068859_1000849863 | 96 |
| 740 | 3300005617 | Ga0068859_100415098 | Ga0068859_1004150983 | 96 |
| 741 | 3300005617 | Ga0068859_100871901 | Ga0068859_1008719011 | 96 |
| 742 | 3300005617 | Ga0068859_101042658 | Ga0068859_1010426581 | 96 |
| 743 | 3300005617 | Ga0068859_101094000 | Ga0068859_1010940001 | 96 |
| 744 | 3300005617 | Ga0068859_102865211 | Ga0068859_1028652112 | 96 |
| 745 | 3300005618 | Ga0068864_100108045 | Ga0068864_1001080454 | 96 |
| 746 | 3300005618 | Ga0068864_100232781 | Ga0068864_1002327814 | 96 |
| 747 | 3300005618 | Ga0068864_101253835 | Ga0068864_1012538351 | 96 |
| 748 | 3300005618 | Ga0068864_101579734 | Ga0068864_1015797342 | 96 |
| 749 | 3300005719 | Ga0068861_100016173 | Ga0068861_1000161733 | 96 |
| 750 | 3300005719 | Ga0068861_101108893 | Ga0068861_1011088932 | 96 |
| 751 | 3300005840 | Ga0068870_10042785 | Ga0068870_100427853 | 96 |
| 752 | 3300005840 | Ga0068870_10084560 | Ga0068870_100845602 | 96 |
| 753 | 3300005840 | Ga0068870_10655528 | Ga0068870_106555281 | 96 |
| 754 | 3300005841 | Ga0068863_100144756 | Ga0068863_1001447562 | 96 |
| 755 | 3300005841 | Ga0068863_100281389 | Ga0068863_1002813893 | 96 |
| 756 | 3300005841 | Ga0068863_100318022 | Ga0068863_1003180222 | 96 |
| 757 | 3300005842 | Ga0068858_100073298 | Ga0068858_1000732982 | 96 |
| 758 | 3300005842 | Ga0068858_100139543 | Ga0068858_1001395432 | 96 |
| 759 | 3300005843 | Ga0068860_100014717 | Ga0068860_1000147178 | 96 |
| 760 | 3300005843 | Ga0068860_100038855 | Ga0068860_1000388556 | 96 |
| 761 | 3300005843 | Ga0068860_101388501 | Ga0068860_1013885011 | 96 |
| 762 | 3300005844 | Ga0068862_100209823 | Ga0068862_1002098232 | 96 |
| 763 | 3300005844 | Ga0068862_100881643 | Ga0068862_1008816431 | 96 |
| 764 | 3300005844 | Ga0068862_101709812 | Ga0068862_1017098121 | 96 |
| 765 | 3300006237 | Ga0097621_100032607 | Ga0097621_1000326073 | 96 |
| 766 | 3300006358 | Ga0068871_100000516 | Ga0068871_10000051620 | 96 |
| 767 | 3300006358 | Ga0068871_100183442 | Ga0068871_1001834423 | 96 |
| 768 | 3300006358 | Ga0068871_101117860 | Ga0068871_1011178601 | 96 |
| 769 | 3300006844 | Ga0075428_100368523 | Ga0075428_1003685232 | 96 |
| 770 | 3300006846 | Ga0075430_101580639 | Ga0075430_1015806392 | 96 |
| 771 | 3300006871 | Ga0075434_100218039 | Ga0075434_1002180394 | 96 |
| 772 | 3300006880 | Ga0075429_100805804 | Ga0075429_1008058042 | 96 |
| 773 | 3300006931 | Ga0097620_100084998 | Ga0097620_1000849983 | 96 |
| 774 | 3300006931 | Ga0097620_100415085 | Ga0097620_1004150852 | 96 |
| 775 | 3300006931 | Ga0097620_100871905 | Ga0097620_1008719051 | 96 |
| 776 | 3300006931 | Ga0097620_101042772 | Ga0097620_1010427721 | 96 |
| 777 | 3300006931 | Ga0097620_101093933 | Ga0097620_1010939331 | 96 |
| 778 | 3300006931 | Ga0097620_102865164 | Ga0097620_1028651642 | 96 |
| 779 | 3300009093 | Ga0105240_10207866 | Ga0105240_102078661 | 96 |
| 780 | 3300009094 | Ga0111539_10009124 | Ga0111539_1000912412 | 96 |
| 781 | 3300009098 | Ga0105245_10681008 | Ga0105245_106810082 | 96 |
| 782 | 3300009101 | Ga0105247_10367449 | Ga0105247_103674491 | 96 |
| 783 | 3300009147 | Ga0114129_10100624 | Ga0114129_101006243 | 96 |
| 784 | 3300009147 | Ga0114129_12631927 | Ga0114129_126319271 | 96 |
| 785 | 3300009148 | Ga0105243_10023043 | Ga0105243_100230434 | 96 |
| 786 | 3300009148 | Ga0105243_10326389 | Ga0105243_103263893 | 96 |
| 787 | 3300009148 | Ga0105243_10570034 | Ga0105243_105700342 | 96 |
| 788 | 3300009148 | Ga0105243_10854462 | Ga0105243_108544621 | 96 |
| 789 | 3300009174 | Ga0105241_10082841 | Ga0105241_100828414 | 96 |
| 790 | 3300009174 | Ga0105241_10178643 | Ga0105241_101786433 | 96 |
| 791 | 3300009174 | Ga0105241_10508517 | Ga0105241_105085172 | 96 |
| 792 | 3300009177 | Ga0105248_10093387 | Ga0105248_100933875 | 96 |
| 793 | 3300009177 | Ga0105248_10231318 | Ga0105248_102313181 | 96 |
| 794 | 3300009551 | Ga0105238_10199865 | Ga0105238_101998653 | 96 |
| 795 | 3300009553 | Ga0105249_10176258 | Ga0105249_101762582 | 96 |
| 796 | 3300009553 | Ga0105249_11931629 | Ga0105249_119316291 | 96 |
| 797 | 3300010375 | Ga0105239_10952718 | Ga0105239_109527182 | 96 |
| 798 | 3300011119 | Ga0105246_11108354 | Ga0105246_111083542 | 96 |
| 799 | 3300013100 | Ga0157373_10001007 | Ga0157373_100010077 | 96 |
| 800 | 3300013102 | Ga0157371_10182579 | Ga0157371_101825793 | 96 |
| 801 | 3300013306 | Ga0163162_10043160 | Ga0163162_100431602 | 96 |
| 802 | 3300013306 | Ga0163162_10139253 | Ga0163162_101392532 | 96 |
| 803 | 3300013306 | Ga0163162_10972131 | Ga0163162_109721312 | 96 |
| 804 | 3300013308 | Ga0157375_10167552 | Ga0157375_101675524 | 96 |
| 805 | 3300013308 | Ga0157375_10585151 | Ga0157375_105851512 | 96 |
| 806 | 3300014326 | Ga0157380_11471164 | Ga0157380_114711642 | 96 |
| 807 | 3300014745 | Ga0157377_10619805 | Ga0157377_106198052 | 96 |
| 808 | 3300014968 | Ga0157379_10067552 | Ga0157379_100675524 | 96 |
| 809 | 3300015262 | Ga0182007_10048583 | Ga0182007_100485832 | 96 |
| 810 | 3300025885 | Ga0207653_10179468 | Ga0207653_101794681 | 96 |
| 811 | 3300025900 | Ga0207710_10689298 | Ga0207710_106892981 | 96 |
| 812 | 3300025904 | Ga0207647_10002956 | Ga0207647_100029569 | 96 |
| 813 | 3300025908 | Ga0207643_10059752 | Ga0207643_100597523 | 96 |
| 814 | 3300025908 | Ga0207643_10090640 | Ga0207643_100906404 | 96 |
| 815 | 3300025910 | Ga0207684_10386569 | Ga0207684_103865691 | 96 |
| 816 | 3300025911 | Ga0207654_10360657 | Ga0207654_103606572 | 96 |
| 817 | 3300025911 | Ga0207654_10413801 | Ga0207654_104138011 | 96 |
| 818 | 3300025911 | Ga0207654_11145566 | Ga0207654_111455662 | 96 |
| 819 | 3300025912 | Ga0207707_10434639 | Ga0207707_104346392 | 96 |
| 820 | 3300025917 | Ga0207660_10364606 | Ga0207660_103646062 | 96 |
| 821 | 3300025918 | Ga0207662_10073440 | Ga0207662_100734402 | 96 |
| 822 | 3300025918 | Ga0207662_10578203 | Ga0207662_105782032 | 96 |
| 823 | 3300025922 | Ga0207646_10545600 | Ga0207646_105456001 | 96 |
| 824 | 3300025923 | Ga0207681_10538707 | Ga0207681_105387071 | 96 |
| 825 | 3300025924 | Ga0207694_10444576 | Ga0207694_104445762 | 96 |
| 826 | 3300025925 | Ga0207650_10851124 | Ga0207650_108511242 | 96 |
| 827 | 3300025927 | Ga0207687_10935663 | Ga0207687_109356631 | 96 |
| 828 | 3300025931 | Ga0207644_11008233 | Ga0207644_110082331 | 96 |
| 829 | 3300025932 | Ga0207690_10152284 | Ga0207690_101522843 | 96 |
| 830 | 3300025935 | Ga0207709_10001346 | Ga0207709_100013463 | 96 |
| 831 | 3300025936 | Ga0207670_11007329 | Ga0207670_110073292 | 96 |
| 832 | 3300025936 | Ga0207670_11668617 | Ga0207670_116686171 | 96 |
| 833 | 3300025940 | Ga0207691_10953898 | Ga0207691_109538982 | 96 |
| 834 | 3300025941 | Ga0207711_10163832 | Ga0207711_101638323 | 96 |
| 835 | 3300025942 | Ga0207689_10124716 | Ga0207689_101247163 | 96 |
| 836 | 3300025942 | Ga0207689_10512687 | Ga0207689_105126873 | 96 |
| 837 | 3300025942 | Ga0207689_10919482 | Ga0207689_109194821 | 96 |
| 838 | 3300025949 | Ga0207667_11234200 | Ga0207667_112342002 | 96 |
| 839 | 3300025960 | Ga0207651_10496563 | Ga0207651_104965631 | 96 |
| 840 | 3300025981 | Ga0207640_10098369 | Ga0207640_100983693 | 96 |
| 841 | 3300026023 | Ga0207677_11767162 | Ga0207677_117671622 | 96 |
| 842 | 3300026035 | Ga0207703_10445791 | Ga0207703_104457912 | 96 |
| 843 | 3300026041 | Ga0207639_10317048 | Ga0207639_103170482 | 96 |
| 844 | 3300026075 | Ga0207708_10043381 | Ga0207708_100433814 | 96 |
| 845 | 3300026075 | Ga0207708_10062555 | Ga0207708_100625555 | 96 |
| 846 | 3300026075 | Ga0207708_10423061 | Ga0207708_104230611 | 96 |
| 847 | 3300026088 | Ga0207641_10147528 | Ga0207641_101475283 | 96 |
| 848 | 3300026088 | Ga0207641_10759739 | Ga0207641_107597392 | 96 |
| 849 | 3300026089 | Ga0207648_10178237 | Ga0207648_101782372 | 96 |
| 850 | 3300026095 | Ga0207676_10361846 | Ga0207676_103618463 | 96 |
| 851 | 3300026095 | Ga0207676_10717377 | Ga0207676_107173771 | 96 |
| 852 | 3300026118 | Ga0207675_100357977 | Ga0207675_1003579773 | 96 |
| 853 | 3300026118 | Ga0207675_101050629 | Ga0207675_1010506292 | 96 |
| 854 | 3300026142 | Ga0207698_11122435 | Ga0207698_111224352 | 96 |
| 855 | 3300027907 | Ga0207428_10078721 | Ga0207428_100787214 | 96 |
| 856 | 3300028380 | Ga0268265_10082594 | Ga0268265_100825944 | 96 |
| 857 | 3300028380 | Ga0268265_11477166 | Ga0268265_114771661 | 96 |
| 858 | 3300028380 | Ga0268265_12394837 | Ga0268265_123948371 | 96 |
| 859 | 3300028381 | Ga0268264_11461448 | Ga0268264_114614481 | 96 |
| 860 | 3300028381 | Ga0268264_11893179 | Ga0268264_118931791 | 96 |
| 861 | 3300031548 | Ga0307408_100826890 | Ga0307408_1008268902 | 96 |
| 862 | 3300031548 | Ga0307408_101232719 | Ga0307408_1012327191 | 96 |
| 863 | 3300031731 | Ga0307405_10443928 | Ga0307405_104439282 | 96 |
| 864 | 3300031852 | Ga0307410_11418028 | Ga0307410_114180282 | 96 |
| 865 | 3300031901 | Ga0307406_10628196 | Ga0307406_106281962 | 96 |
| 866 | 3300031911 | Ga0307412_10251172 | Ga0307412_102511723 | 96 |
| 867 | 3300031995 | Ga0307409_101216362 | Ga0307409_1012163622 | 96 |
| 868 | 3300032002 | Ga0307416_102969099 | Ga0307416_1029690991 | 96 |
| 869 | 3300032004 | Ga0307414_10502658 | Ga0307414_105026582 | 96 |
| 870 | 3300032005 | Ga0307411_10798848 | Ga0307411_107988482 | 96 |
| 871 | 3300035207 | Ga0373942_0107750 | Ga0373942_0107750_193_501 | 96 |
| 872 | 3300048907 | Ga0496104_0739462 | Ga0496104_0739462_502_813 | 96 |
| 873 | 3300048914 | Ga0496111_1130737 | Ga0496111_1130737_54_365 | 96 |
| 874 | 3300048916 | Ga0496113_0501304 | Ga0496113_0501304_381_692 | 96 |
| 875 | 3300048916 | Ga0496113_1302593 | Ga0496113_1302593_47_355 | 96 |
| 876 | 3300050508 | nmdc:mga09592_1158470_c1 | nmdc:mga09592_1158470_c1_293_601 | 96 |
| 877 | 3300050511 | nmdc:mga08y16_180695_c1 | nmdc:mga08y16_180695_c1_1692_2000 | 96 |
| 878 | 3300050515 | nmdc:mga0a205_66588_c1 | nmdc:mga0a205_66588_c1_2251_2559 | 96 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar