F484401

General Info

Members Datasets Scaffolds Average Seq Length
877 733 349 218

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0002061|Ga0439449_0002061_4091_4870
Length 259
Sequence MLWHSVSDAVPQAPARRLLAQNGENLRRADRTVDRRENSMSYAAYVFDAYGTLFDVHAAVRRHADAIGPDGQAFSELWRAKQLEYSWVRSLMGAYVDFWELTEQSLDYAFQRFPSADPGLKKPLLDAYWALDCYPEVPAVLKGLKERGARIAILSNGSPAMLASAVKNAALDIVIDDVFSVDAVKAFKTAPAVYDLVTTSYRLYPQAVSFQSSNRWDIAGATKFGFRTVWINRADGPDEYKDHGPSLILPSLESLQFGV

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
10 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
11 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
12 2512875024 Mesorhizobium loti R88b Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
15 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
16 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
17 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
18 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
19 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
20 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
21 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
22 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
23 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
24 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
25 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
26 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
27 2516143018 Ensifer sp. BR816 Isolate Nodule
28 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
29 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
30 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
31 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
32 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
33 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
34 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
35 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
36 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
37 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
38 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
39 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
40 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
41 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
42 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
43 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
44 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
45 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
46 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
47 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
48 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
49 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
50 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
51 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
52 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
53 2643221557 Ensifer sp. Root558 Isolate Unclassified
54 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
55 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
56 2643221607 Rhizobium sp. Root73 Isolate Unclassified
57 2643221610 Ensifer sp. Root74 Isolate Unclassified
58 2643221618 Ensifer sp. Root231 Isolate Unclassified
59 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
60 2643221626 Ensifer sp. Root31 Isolate Unclassified
61 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
62 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
63 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
64 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
65 2643221655 Ensifer sp. Root1252 Isolate Unclassified
66 2643221659 Ensifer sp. Root127 Isolate Unclassified
67 2643221668 Ensifer sp. Root423 Isolate Unclassified
68 2643221675 Ensifer sp. Root1298 Isolate Unclassified
69 2643221680 Ensifer sp. Root1312 Isolate Unclassified
70 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
71 2643221688 Rhizobium sp. Root482 Isolate Unclassified
72 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
73 2643221698 Ensifer sp. Root142 Isolate Unclassified
74 2643221712 Ensifer sp. Root258 Isolate Unclassified
75 2643221718 Rhizobium sp. Root268 Isolate Unclassified
76 2643221719 Rhizobium sp. Root274 Isolate Unclassified
77 2643221723 Ensifer sp. Root278 Isolate Unclassified
78 2643221726 Ensifer sp. Root954 Isolate Unclassified
79 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
80 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
81 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
82 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
83 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
84 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
85 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
86 2738543024 Aminobacter sp. AP02 Isolate Unclassified
87 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
88 2751185800 Brucella pituitosa AA2 Isolate Unclassified
89 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
90 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
91 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
92 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
93 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
94 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
95 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
96 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
97 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
98 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
99 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
100 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
101 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
102 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
103 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
104 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
105 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
106 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
107 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
108 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
109 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
110 2844163670 Ensifer sp. 1H6 Isolate Unclassified
111 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
112 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
113 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
114 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
115 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
116 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
117 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
118 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
119 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
120 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
121 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
122 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
123 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
124 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
125 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
126 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
127 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
128 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
129 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
130 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
131 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
132 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
133 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
134 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
135 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
136 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
137 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
138 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
139 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
140 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
141 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
142 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
143 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
144 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
145 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
146 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
147 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
148 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
149 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
150 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
151 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
152 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
153 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
154 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
155 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
156 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
157 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
158 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
159 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
160 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
161 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
162 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
163 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
164 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
165 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
166 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
167 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
168 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
169 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
170 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
171 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
172 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
173 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
174 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
175 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
176 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
177 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
178 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
179 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
180 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
181 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
182 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
183 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
184 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
185 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
186 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
187 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
188 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
189 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
190 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
191 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
192 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
193 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
194 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
195 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
196 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
197 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
198 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
199 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
200 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
201 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
202 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
203 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
204 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
205 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
206 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
207 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
208 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
209 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
210 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
211 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
212 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
213 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
214 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
215 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
216 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
217 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
218 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
219 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
220 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
221 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
222 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
223 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
224 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
225 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
226 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
227 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
228 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
229 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
230 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
231 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
232 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
233 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
234 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
235 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
236 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
237 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
238 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
239 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
240 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
241 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
242 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
243 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
244 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
245 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
246 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
247 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
248 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
249 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
250 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
251 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
252 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
253 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
254 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
255 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
256 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
257 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
258 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
259 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
260 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
261 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
262 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
263 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
264 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
265 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
266 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
267 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
268 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
269 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
270 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
271 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
272 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
273 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
274 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
275 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
276 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
277 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
278 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
279 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
280 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
281 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
282 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
283 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
284 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
285 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
286 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
287 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
288 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
289 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
290 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
291 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
292 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
293 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
294 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
295 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
296 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
297 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
298 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
299 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
300 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
301 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
302 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
303 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
304 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
305 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
306 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
307 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
308 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
309 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
310 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
311 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
312 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
313 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
314 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
315 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
316 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
317 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
318 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
319 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
320 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
321 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
322 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
323 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
324 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
325 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
326 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
327 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
328 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
329 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
330 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
331 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
332 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
333 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
334 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
335 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
336 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
337 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
338 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
339 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
340 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
341 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
342 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
343 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
344 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
345 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
346 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
347 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
348 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
349 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
350 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
351 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
352 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
353 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
354 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
355 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
356 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
357 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
358 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
359 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
360 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
361 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
362 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
363 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
364 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
365 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
366 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
367 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
368 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
369 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
370 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
371 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
372 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
373 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
374 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
375 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
376 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
377 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
378 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
379 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
380 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
381 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
382 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
383 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
384 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
385 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
386 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
387 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
388 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
389 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
390 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
391 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
392 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
393 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
394 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
395 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
396 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
397 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
398 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
399 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
400 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
401 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
402 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
403 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
404 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
405 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
406 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
407 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
408 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
409 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
410 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
411 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
412 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
413 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
414 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
415 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
416 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
417 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
418 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
419 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
420 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
421 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
422 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
423 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
424 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
425 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
426 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
427 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
428 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
429 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
430 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
431 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
432 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
433 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
434 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
435 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
436 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
437 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
438 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
439 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
440 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
441 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
442 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
443 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
444 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
445 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
446 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
447 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
448 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
449 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
450 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
451 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
452 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
453 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
454 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
455 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
456 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
457 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
458 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
459 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
460 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
461 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
462 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
463 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
464 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
465 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
466 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
467 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
468 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
469 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
470 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
471 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
472 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
473 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
474 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
475 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
476 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
477 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
478 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
479 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
480 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
481 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
482 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
483 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
484 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
485 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
486 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
487 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
488 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
489 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
490 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
491 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
492 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
493 3004167301 Mesorhizobium loti 582 Isolate Unclassified
494 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
495 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
496 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
497 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
498 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
499 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
500 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
501 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
502 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
503 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
504 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
505 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
506 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
507 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
508 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
509 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
510 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
511 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
512 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
513 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
514 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
515 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
516 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
517 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
518 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
519 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
520 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
521 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
522 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
523 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
524 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
525 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
526 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
527 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
528 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
529 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
530 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
531 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
532 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
533 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
534 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
535 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
536 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
537 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
538 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
539 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
540 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
541 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
542 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
543 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
544 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
545 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
546 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
547 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
548 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
549 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
550 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
551 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
552 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
553 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
554 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
555 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
556 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
557 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
558 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
559 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
560 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
561 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
562 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
563 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
564 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
565 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
566 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
567 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
568 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
569 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
570 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
571 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
572 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
573 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
574 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
575 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
576 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
586 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
588 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
589 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
590 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
592 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
593 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
594 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
595 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
596 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
597 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
598 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
599 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
600 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
601 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
602 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
603 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
604 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
605 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
606 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
607 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
608 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
609 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
610 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
611 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
612 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
613 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
614 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
615 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
616 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
617 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
618 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
619 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
620 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
621 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
622 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
623 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
624 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
625 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
626 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
627 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
628 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
629 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
630 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
631 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
632 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
633 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
634 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
635 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
636 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
637 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
638 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
639 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
640 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
641 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
642 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
643 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
644 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
645 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
646 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
647 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
648 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
649 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
650 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
651 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
652 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
653 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
654 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
655 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
656 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
657 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
658 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
659 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
660 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
661 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
662 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
663 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
664 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
665 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
666 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
667 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
668 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
669 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
670 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
671 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
672 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
673 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
674 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
675 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
676 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
677 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
678 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
679 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
680 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
681 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
682 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
683 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
684 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
685 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
686 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
687 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
688 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
689 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
690 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
691 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
692 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
693 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
694 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
695 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
696 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
697 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
698 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
699 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
700 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
701 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
702 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
703 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
704 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
705 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
706 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
707 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
708 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
709 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
710 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
711 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
712 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
713 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
714 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
715 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
716 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
717 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
718 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
719 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
720 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
721 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
722 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
723 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
724 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
725 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
726 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
727 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
728 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
729 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
730 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
731 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
732 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
733 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.79
Metatranscriptomes 0
Isolates 60.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.41
Nodule 51.2
Rhizoplane 1.25
Rhizosphere 28.62
Stem 0
Stem Tuber 0
Unclassified 11.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009030 3300001979 Bacteria 3926
2 JGI25158J39367_1001337 3300002739 Bacteria 4356
3 JGI25159J45721_1000001 3300002987 Bacteria 303489
4 JGI25151J46595_10008750 3300003187 Bacteria 4839
5 JGI25151J46595_10025779 3300003187 Bacteria 2385
6 JGI25165J46597_1000016 3300003214 Bacteria 377866
7 rootH2_10339468 3300003320 Bacteria 1109
8 JGI25160J50197_1000002 3300003354 Bacteria 561707
9 Ga0055542_1004234 3300003762 Bacteria 3557
10 Ga0055529_1006934 3300003763 Bacteria 1557
11 Ga0055526_1001867 3300003771 Bacteria 14584
12 Ga0055524_1000777 3300003775 Bacteria 21429
13 Ga0055524_1024254 3300003775 Bacteria 1929
14 Ga0055530_10040496 3300003791 Bacteria 1143
15 Ga0055531_10031987 3300003794 Bacteria 1729
16 Ga0055543_1000057 3300004625 Bacteria 102841
17 Ga0065165_1000004 3300005262 Bacteria 377081
18 Ga0070658_10391926 3300005327 Bacteria 1192
19 Ga0070666_10095281 3300005335 Bacteria 2048
20 Ga0070668_100298989 3300005347 Bacteria 1349
21 Ga0070674_100184160 3300005356 Bacteria 1602
22 Ga0070667_100430374 3300005367 Bacteria 1204
23 Ga0070663_100110541 3300005455 Bacteria 2064
24 Ga0070663_100645646 3300005455 Bacteria 894
25 Ga0070678_100832481 3300005456 Bacteria 840
26 Ga0068853_100043464 3300005539 Bacteria 3844
27 Ga0070665_100034072 3300005548 Bacteria 5121
28 Ga0070665_100471005 3300005548 Bacteria 1266
29 Ga0068855_100162571 3300005563 Bacteria 2533
30 Ga0070664_100750651 3300005564 Bacteria 911
31 Ga0068857_100104451 3300005577 Bacteria 2543
32 Ga0081455_10018339 3300005937 Bacteria 6670
33 Ga0081540_1023624 3300005983 Bacteria 3590
34 Ga0075365_10004422 3300006038 Bacteria 7442
35 Ga0075365_10012641 3300006038 Bacteria 5022
36 Ga0075363_100012543 3300006048 Bacteria 4091
37 Ga0075363_100213756 3300006048 Bacteria 1104
38 Ga0075362_10027138 3300006177 Bacteria 2450
39 Ga0075362_10028394 3300006177 Bacteria 2403
40 Ga0075367_10019586 3300006178 Bacteria 3754
41 Ga0075369_10119954 3300006186 Bacteria 1190
42 Ga0075370_10026164 3300006353 Bacteria 3231
43 Ga0075370_10077522 3300006353 Bacteria 1907
44 Ga0079104_1007485 3300006946 Bacteria 3950
45 Ga0079104_1014594 3300006946 Bacteria 2364
46 Ga0105240_10026413 3300009093 Bacteria 7617
47 Ga0105240_10281473 3300009093 Bacteria 1910
48 Ga0105237_10031482 3300009545 Bacteria 5378
49 Ga0105237_10077156 3300009545 Bacteria 3322
50 Ga0105237_10163975 3300009545 Bacteria 2221
51 Ga0105237_10294357 3300009545 Bacteria 1626
52 Ga0105238_10011809 3300009551 Bacteria 8800
53 Ga0105239_10044001 3300010375 Bacteria 4895
54 Ga0105239_10076181 3300010375 Bacteria 3689
55 Ga0105239_10150471 3300010375 Bacteria 2598
56 Ga0105239_10466871 3300010375 Bacteria 1433
57 Ga0157370_10607504 3300013104 Bacteria 1001
58 Ga0157369_10276630 3300013105 Bacteria 1749
59 Ga0171463_1001 3300013249 Bacteria 1406070
60 Ga0157374_10564917 3300013296 Bacteria 1146
61 Ga0157378_10680137 3300013297 Bacteria 1047
62 Ga0157372_10668351 3300013307 Bacteria 1209
63 Ga0182008_10128964 3300014497 Bacteria 1260
64 Ga0183363_1045 3300015690 Bacteria 40670
65 Ga0214544_1000008 3300021320 Bacteria 326027
66 Ga0214542_1000010 3300021321 Bacteria 262816
67 Ga0214542_1015383 3300021321 Bacteria 8011
68 Ga0214543_1000003 3300021327 Bacteria 692327
69 Ga0214543_1000004 3300021327 Bacteria 527190
70 Ga0228711_1000001 3300022739 Bacteria 357377
71 Ga0228710_1000001 3300022740 Bacteria 314328
72 Ga0209436_100122 3300025208 Bacteria 38333
73 Ga0209563_105116 3300025230 Bacteria 2416
74 Ga0209646_1011896 3300025246 Bacteria 1341
75 Ga0209026_1000005 3300025250 Bacteria 731387
76 Ga0209148_1000056 3300025254 Bacteria 363380
77 Ga0209759_1000631 3300025256 Bacteria 33354
78 Ga0209233_1000068 3300025261 Bacteria 377969
79 Ga0209455_1000238 3300025272 Bacteria 68798
80 Ga0209130_1000008 3300025284 Bacteria 581232
81 Ga0209676_1002258 3300025292 Bacteria 14147
82 Ga0209025_1000100 3300025294 Bacteria 229182
83 Ga0209025_1000165 3300025294 Bacteria 164692
84 Ga0209564_1000104 3300025295 Bacteria 219017
85 Ga0209758_1005808 3300025297 Bacteria 9249
86 Ga0209050_1015813 3300025298 Bacteria 3138
87 Ga0209256_1000652 3300025299 Bacteria 47238
88 Ga0209256_1002322 3300025299 Bacteria 15924
89 Ga0207426_1000016 3300025302 Bacteria 581232
90 Ga0207680_10098509 3300025903 Bacteria 1874
91 Ga0207647_10053502 3300025904 Bacteria 2487
92 Ga0207645_10077952 3300025907 Bacteria 2123
93 Ga0207695_10333569 3300025913 Bacteria 1405
94 Ga0207695_10824141 3300025913 Bacteria 808
95 Ga0207671_10012030 3300025914 Bacteria 6990
96 Ga0207671_10058466 3300025914 Bacteria 2858
97 Ga0207671_10178806 3300025914 Bacteria 1650
98 Ga0207657_10050734 3300025919 Bacteria 3609
99 Ga0207694_10051200 3300025924 Bacteria 3200
100 Ga0207694_10445342 3300025924 Bacteria 1081
101 Ga0207706_10174245 3300025933 Bacteria 1890
102 Ga0207669_10149290 3300025937 Bacteria 1635
103 Ga0207691_10293169 3300025940 Bacteria 1399
104 Ga0207668_10388562 3300025972 Bacteria 1177
105 Ga0207639_10069737 3300026041 Bacteria 2743
106 Ga0207678_10149256 3300026067 Bacteria 1996
107 Ga0207674_10098525 3300026116 Bacteria 2907
108 Ga0209281_1000164 3300027111 Bacteria 157372
109 Ga0209281_1000626 3300027111 Bacteria 39130
110 Ga0209282_1000007 3300027666 Bacteria 254917
111 Ga0268266_10293056 3300028379 Bacteria 1516
112 Ga0307515_10000420 3300028794 Bacteria 102216
113 Ga0307515_10039061 3300028794 Bacteria 7565
114 Ga0265330_10123466 3300031235 Bacteria 1103
115 Ga0265325_10039985 3300031241 Bacteria 2465
116 Ga0265325_10041422 3300031241 Bacteria 2413
117 Ga0265340_10001536 3300031247 Bacteria 13246
118 Ga0265340_10012513 3300031247 Bacteria 4478
119 Ga0265340_10071750 3300031247 Bacteria 1641
120 Ga0265339_10004396 3300031249 Bacteria 9613
121 Ga0265339_10089722 3300031249 Bacteria 1613
122 Ga0265339_10130413 3300031249 Bacteria 1286
123 Ga0265316_10028899 3300031344 Bacteria 4566
124 Ga0307513_10004196 3300031456 Bacteria 19276
125 Ga0307408_100024952 3300031548 Bacteria 4089
126 Ga0265313_10001426 3300031595 Bacteria 22387
127 Ga0265313_10012669 3300031595 Bacteria 5125
128 Ga0265314_10032908 3300031711 Bacteria 3808
129 Ga0265342_10003927 3300031712 Bacteria 11938
130 Ga0265342_10018567 3300031712 Bacteria 4501
131 Ga0307406_10085121 3300031901 Bacteria 2113
132 Ga0307412_10144470 3300031911 Bacteria 1747
133 Ga0315914_1000006 3300031967 Bacteria 239817
134 Ga0307409_100337798 3300031995 Bacteria 1416
135 Ga0307416_100107466 3300032002 Bacteria 2449
136 Ga0307416_101015167 3300032002 Bacteria 933
137 Ga0315913_1000002 3300033430 Bacteria 241452
138 Ga0315915_1000001 3300033464 Bacteria 481518
139 Ga0316574_0520552 3300035398 Bacteria 740
140 Ga0373931_0166482 3300035691 Bacteria 1296
141 Ga0373935_0285059 3300035692 Bacteria 1164
142 Ga0316582_0070662 3300036647 Bacteria 2259
143 Ga0316584_0079499 3300036712 Bacteria 2457
144 Ga0395900_0084548 3300037418 Bacteria 3261
145 Ga0395900_0338598 3300037418 Bacteria 1480
146 Ga0395898_0063483 3300037466 Bacteria 3584
147 Ga0395898_0339865 3300037466 Bacteria 1432
148 Ga0395905_0101818 3300037471 Bacteria 2696
149 Ga0436364_1041655 3300037853 Bacteria 11173
150 Ga0395901_0037442 3300038443 Bacteria 5017
151 Ga0395901_0041612 3300038443 Bacteria 4763
152 Ga0439461_0068124 3300041410 Bacteria 820
153 Ga0439466_0092196 3300041411 Bacteria 949
154 Ga0439465_0044479 3300041413 Bacteria 1443
155 Ga0439442_066542 3300042002 Bacteria 766
156 Ga0439432_081424 3300042006 Bacteria 980
157 Ga0439449_0002061 3300042007 Bacteria 7913
158 Ga0439462_0031769 3300042015 Bacteria 1399
159 Ga0450906_026455 3300042145 Bacteria 1030
160 Ga0450910_005161 3300042147 Bacteria 1778
161 Ga0439458_0093151 3300042157 Bacteria 777
162 Ga0450918_007376 3300042531 Bacteria 1946
163 Ga0466972_0092202 3300044658 Bacteria 1436
164 Ga0466972_0230596 3300044658 Bacteria 866
165 Ga0466965_0237206 3300044683 Bacteria 976
166 Ga0466960_0081836 3300044901 Bacteria 1629
167 Ga0495638_0098581 3300046460 Bacteria 1751
168 Ga0495585_0252728 3300046492 Bacteria 879
169 Ga0495606_0053804 3300046507 Bacteria 2610
170 Ga0495632_0048643 3300046519 Bacteria 2099
171 Ga0495643_0070648 3300046522 Bacteria 1833
172 Ga0495668_0044581 3300046616 Bacteria 2465
173 Ga0495625_0021781 3300046660 Bacteria 4925
174 Ga0495588_0099043 3300046674 Bacteria 1531
175 Ga0495687_020699 3300047443 Bacteria 3202
176 Ga0495602_0249634 3300048088 Bacteria 1323
177 Ga0495602_0443161 3300048088 Bacteria 918
178 Ga0495626_0056117 3300048091 Bacteria 1804
179 Ga0496102_0831960 3300048905 Bacteria 845
180 Ga0496104_0396809 3300048907 Bacteria 1292
181 Ga0496105_0063843 3300048908 Bacteria 3039
182 Ga0496110_0196310 3300048913 Bacteria 1833
183 Ga0496110_0407293 3300048913 Bacteria 1240
184 Ga0496112_0015726 3300048915 Bacteria 7068
185 Ga0496112_0260718 3300048915 Bacteria 1683
186 Ga0496113_0221816 3300048916 Bacteria 1507
187 Ga0496114_0200085 3300048917 Bacteria 1750
188 Ga0496117_0002204 3300048920 Bacteria 25295
189 Ga0496118_0046814 3300048921 Bacteria 3360
190 Ga0496120_0052491 3300048923 Bacteria 2322
191 Ga0496121_0153319 3300048924 Bacteria 1693
192 Ga0496122_0004346 3300048925 Bacteria 17714
193 Ga0496122_0076809 3300048925 Bacteria 2348
194 Ga0496123_0000103 3300048926 Bacteria 168232
195 Ga0496123_0026920 3300048926 Bacteria 4295
196 Ga0496124_0005072 3300048927 Bacteria 15019
197 Ga0496124_0122222 3300048927 Bacteria 2079
198 Ga0496125_0000879 3300048928 Bacteria 47630
199 Ga0496125_0039027 3300048928 Bacteria 4098
200 Ga0496126_0001336 3300048929 Bacteria 39105
201 Ga0496126_0012132 3300048929 Bacteria 8846
202 Ga0496126_0092384 3300048929 Bacteria 2659
203 Ga0501290_000163 3300049513 Bacteria 10717
204 Ga0501031_0005610 3300049568 Bacteria 8176
205 Ga0501031_0035334 3300049568 Bacteria 3260
206 Ga0501031_0177612 3300049568 Bacteria 1391
207 Ga0501032_0000082 3300049569 Bacteria 82284
208 Ga0501032_0006363 3300049569 Bacteria 8705
209 Ga0501032_0077742 3300049569 Bacteria 2209
210 Ga0501032_0163195 3300049569 Bacteria 1462
211 Ga0501032_0242560 3300049569 Bacteria 1171
212 Ga0501032_0323449 3300049569 Bacteria 995
213 Ga0501032_0477858 3300049569 Bacteria 797
214 Ga0501033_0000070 3300049570 Bacteria 97795
215 Ga0501033_0000500 3300049570 Bacteria 36912
216 Ga0501033_0000503 3300049570 Bacteria 36753
217 Ga0501033_0007653 3300049570 Bacteria 8392
218 Ga0501033_0016653 3300049570 Bacteria 5560
219 Ga0501033_0111103 3300049570 Bacteria 1994
220 Ga0501033_0332300 3300049570 Bacteria 1066
221 Ga0501034_0000087 3300049571 Bacteria 166714
222 Ga0501034_0277704 3300049571 Bacteria 1615
223 Ga0501034_0500559 3300049571 Bacteria 1129
224 Ga0501034_0614244 3300049571 Bacteria 991
225 Ga0501034_0620168 3300049571 Bacteria 985
226 Ga0501036_0000073 3300049572 Bacteria 61346
227 Ga0501036_0100265 3300049572 Bacteria 2449
228 Ga0501036_0119383 3300049572 Bacteria 2227
229 Ga0501036_0167658 3300049572 Bacteria 1850
230 Ga0501036_0297094 3300049572 Bacteria 1351
231 Ga0501036_0698783 3300049572 Bacteria 838
232 Ga0501037_0000014 3300049573 Bacteria 171015
233 Ga0501037_0004549 3300049573 Bacteria 10085
234 Ga0501037_0117480 3300049573 Bacteria 1914
235 Ga0501037_0322388 3300049573 Bacteria 1069
236 Ga0501037_0328514 3300049573 Bacteria 1058
237 Ga0501037_0407722 3300049573 Bacteria 931
238 Ga0501037_0409883 3300049573 Bacteria 929
239 Ga0501038_0000023 3300049574 Bacteria 151469
240 Ga0501038_0024807 3300049574 Bacteria 5345
241 Ga0501038_0168640 3300049574 Bacteria 1774
242 Ga0501039_0000044 3300049575 Bacteria 108828
243 Ga0501039_0317168 3300049575 Bacteria 1225
244 Ga0501039_0468183 3300049575 Bacteria 989
245 Ga0501043_0000022 3300049579 Bacteria 154467
246 Ga0501043_0000088 3300049579 Bacteria 82282
247 Ga0501043_0017381 3300049579 Bacteria 5640
248 Ga0501043_0291265 3300049579 Bacteria 1249
249 Ga0501043_0453175 3300049579 Bacteria 963
250 Ga0501046_0012919 3300049580 Bacteria 7099
251 Ga0501046_0014815 3300049580 Bacteria 6563
252 Ga0501046_0088424 3300049580 Bacteria 2386
253 Ga0501047_0006539 3300049581 Bacteria 10972
254 Ga0501047_0014062 3300049581 Bacteria 7606
255 Ga0501047_0065071 3300049581 Bacteria 3515
256 Ga0501047_0087503 3300049581 Bacteria 2993
257 Ga0501047_0102861 3300049581 Bacteria 2736
258 Ga0501047_0163561 3300049581 Bacteria 2096
259 Ga0501047_0181467 3300049581 Bacteria 1971
260 Ga0501047_0242905 3300049581 Bacteria 1651
261 Ga0501047_0400807 3300049581 Bacteria 1205
262 Ga0501047_0451074 3300049581 Bacteria 1115
263 Ga0501047_0546877 3300049581 Bacteria 982
264 Ga0501067_0022364 3300049583 Bacteria 3499
265 Ga0501068_0031056 3300049584 Bacteria 3172
266 Ga0501068_0222000 3300049584 Bacteria 1201
267 Ga0501069_0000284 3300049585 Bacteria 23001
268 Ga0501069_0017700 3300049585 Bacteria 3840
269 Ga0501070_0000103 3300049586 Bacteria 74597
270 Ga0501070_0007102 3300049586 Bacteria 9521
271 Ga0501070_0014430 3300049586 Bacteria 6648
272 Ga0501070_0134743 3300049586 Bacteria 2039
273 Ga0501070_0152142 3300049586 Bacteria 1909
274 Ga0501070_0246332 3300049586 Bacteria 1462
275 Ga0501070_0367885 3300049586 Bacteria 1166
276 Ga0501071_0050853 3300049587 Bacteria 2985
277 Ga0501073_0016951 3300049589 Bacteria 5276
278 Ga0501073_0062094 3300049589 Bacteria 2606
279 Ga0501073_0081812 3300049589 Bacteria 2246
280 Ga0501073_0254797 3300049589 Bacteria 1211
281 Ga0501073_0392706 3300049589 Bacteria 958
282 Ga0501074_0001426 3300049590 Bacteria 15945
283 Ga0501074_0013544 3300049590 Bacteria 5928
284 Ga0501074_0098204 3300049590 Bacteria 2096
285 Ga0501074_0651818 3300049590 Bacteria 744
286 Ga0501202_018881 3300049652 Bacteria 1358
287 Ga0501222_001521 3300049662 Bacteria 3241
288 Ga0501223_001150 3300049663 Bacteria 6232
289 Ga0501224_006556 3300049664 Bacteria 1688
290 Ga0501079_0467541 3300049741 Bacteria 991
291 Ga0501080_0035831 3300049742 Bacteria 4631
292 Ga0501080_0046275 3300049742 Bacteria 4051
293 Ga0501080_0098650 3300049742 Bacteria 2711
294 Ga0501080_0147726 3300049742 Bacteria 2173
295 Ga0501080_0255827 3300049742 Bacteria 1596
296 Ga0501080_0365547 3300049742 Bacteria 1301
297 Ga0501083_0000374 3300049744 Bacteria 28288
298 Ga0501280_000010 3300049776 Bacteria 63153
299 Ga0501282_001568 3300049778 Bacteria 2526
300 Ga0501035_0000047 3300049822 Bacteria 146497
301 Ga0501035_0002644 3300049822 Bacteria 17442
302 Ga0501035_0002789 3300049822 Bacteria 16895
303 Ga0501035_0003617 3300049822 Bacteria 14753
304 Ga0501035_0016993 3300049822 Bacteria 6705
305 Ga0501035_0020300 3300049822 Bacteria 6099
306 Ga0501035_0044652 3300049822 Bacteria 3990
307 Ga0501035_0128449 3300049822 Bacteria 2211
308 Ga0501035_0132124 3300049822 Bacteria 2175
309 Ga0501035_0132746 3300049822 Bacteria 2169
310 Ga0501044_0003500 3300049823 Bacteria 17677
311 Ga0501044_0007915 3300049823 Bacteria 11686
312 Ga0501044_0013751 3300049823 Bacteria 8747
313 Ga0501044_0048111 3300049823 Bacteria 4407
314 Ga0501044_0114660 3300049823 Bacteria 2700
315 Ga0501044_0164871 3300049823 Bacteria 2190
316 Ga0501044_0165646 3300049823 Bacteria 2184
317 Ga0501044_0197805 3300049823 Bacteria 1969
318 Ga0501044_0277499 3300049823 Bacteria 1610
319 Ga0501044_0329332 3300049823 Bacteria 1450
320 Ga0501044_0379739 3300049823 Bacteria 1328
321 Ga0501044_0521416 3300049823 Bacteria 1088
322 Ga0501045_0300157 3300049824 Bacteria 1195
323 nmdc:mga03683_77172_c1 3300050489 Bacteria 1433
324 nmdc:mga03n38_183648_c1 3300050490 Bacteria 1073
325 nmdc:mga03n38_2998_c1 3300050490 Bacteria 5340
326 nmdc:mga0yw44_1413_c1 3300050492 Bacteria 9522
327 nmdc:mga0yw44_483546_c1 3300050492 Bacteria 840
328 nmdc:mga0yw44_7220_c1 3300050492 Bacteria 5445
329 nmdc:mga06z11_18329_c1 3300050494 Bacteria 3196
330 nmdc:mga06z11_218415_c1 3300050494 Bacteria 1113
331 nmdc:mga06z11_30040_c1 3300050494 Bacteria 2625
332 nmdc:mga06z11_7530_c1 3300050494 Bacteria 4487
333 nmdc:mga04h51_105845_c1 3300050495 Bacteria 1031
334 nmdc:mga0sz30_1456_c1 3300050516 Bacteria 1103
335 Ga0500610_0037028 3300053079 Bacteria 2510
336 Ga0495655_0029661 3300053083 Bacteria 1317
337 Ga0500578_0096475 3300053086 Bacteria 1874
338 Ga0500643_000356 3300053087 Bacteria 36357
339 Ga0500595_049433 3300053119 Bacteria 1310
340 Ga0500658_0150608 3300053134 Bacteria 1048
341 Ga0500568_0000209 3300053139 Bacteria 51143
342 Ga0500604_0015119 3300053151 Bacteria 2109
343 Ga0500604_0117993 3300053151 Bacteria 885
344 Ga0500620_007680 3300053155 Bacteria 2680
345 Ga0500624_036798 3300053157 Bacteria 865
346 Ga0500627_0072549 3300053158 Bacteria 1526
347 Ga0500611_028533 3300053727 Bacteria 1134
348 Ga0500609_012103 3300053731 Bacteria 1167
349 Ga0501082_0064688 3300060353 Bacteria 3150

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2979764755 2979770872 211
2 3300031241 Ga0265325_10039985 Ga0265325_100399851 212
3 3300031247 Ga0265340_10012513 Ga0265340_100125133 212
4 3300031249 Ga0265339_10089722 Ga0265339_100897222 212
5 3300031595 Ga0265313_10012669 Ga0265313_100126694 212
6 3300031712 Ga0265342_10018567 Ga0265342_100185673 212
7 iso_pu_bacteria 2513237159 2513999329 212
8 iso_pu_bacteria 2582581283 2585165338 212
9 iso_pu_bacteria 2582581306 2585266433 212
10 iso_pu_bacteria 2582581865 2585387411 212
11 iso_pu_bacteria 2582581866 2585394073 212
12 iso_pu_bacteria 2643221607 2644046791 212
13 iso_pu_bacteria 2643221636 2644202498 212
14 iso_pu_bacteria 2643221686 2644479580 212
15 iso_pu_bacteria 2643221688 2644493573 212
16 iso_pu_bacteria 2643221689 2644500767 212
17 iso_pu_bacteria 2738541317 2738945935 212
18 iso_pu_bacteria 2751185800 2753358885 212
19 iso_pu_bacteria 2842521101 2842525121 212
20 iso_pu_bacteria 2891373044 2891376483 212
21 iso_pu_bacteria 2899803654 2899806335 212
22 iso_pu_bacteria 2913308742 2913310379 212
23 iso_pu_bacteria 2989349275 2989355155 212
24 iso_pu_bacteria 8054558443 8054560086 212
25 iso_pu_bacteria 8054563764 8054567726 212
26 3300049581 Ga0501047_0242905 Ga0501047_0242905_382_1038 213
27 iso_pu_bacteria 2523231067 2523466202 213
28 iso_pu_bacteria 2738543031 2739347075 213
29 iso_pu_bacteria 2775507049 2776912365 213
30 iso_pu_bacteria 2989771324 2989775376 213
31 iso_pu_bacteria 3003930520 3003932410 213
32 3300031249 Ga0265339_10130413 Ga0265339_101304132 214
33 3300031711 Ga0265314_10032908 Ga0265314_100329083 214
34 iso_pu_bacteria 2508501122 2509107395 214
35 iso_pu_bacteria 2509276019 2509374615 214
36 iso_pu_bacteria 2510065057 2510304532 214
37 iso_pu_bacteria 2511231052 2511500849 214
38 iso_pu_bacteria 2512047086 2512532271 214
39 iso_pu_bacteria 2512875026 2512972398 214
40 iso_pu_bacteria 2513237086 2513585833 214
41 iso_pu_bacteria 2513237089 2513603477 214
42 iso_pu_bacteria 2513237091 2513619762 214
43 iso_pu_bacteria 2513237140 2513882825 214
44 iso_pu_bacteria 2513237143 2513906548 214
45 iso_pu_bacteria 2513237156 2513985429 214
46 iso_pu_bacteria 2513237160 2514004932 214
47 iso_pu_bacteria 2515154107 2515607977 214
48 iso_pu_bacteria 2516143018 2516208731 214
49 iso_pu_bacteria 2516653046 2516892122 214
50 iso_pu_bacteria 2517487022 2517568937 214
51 iso_pu_bacteria 2524023207 2524450171 214
52 iso_pu_bacteria 2551306084 2551681065 214
53 iso_pu_bacteria 2551306085 2551684813 214
54 iso_pu_bacteria 2551306086 2551695399 214
55 iso_pu_bacteria 2551306087 2551702340 214
56 iso_pu_bacteria 2551306089 2551714704 214
57 iso_pu_bacteria 2551306090 2551721668 214
58 iso_pu_bacteria 2551306091 2551724935 214
59 iso_pu_bacteria 2551306091 2551724966 214
60 iso_pu_bacteria 2551306092 2551733299 214
61 iso_pu_bacteria 2551306093 2551746567 214
62 iso_pu_bacteria 2558860100 2558863643 214
63 iso_pu_bacteria 2599185352 2600191758 214
64 iso_pu_bacteria 2643221551 2643774790 214
65 iso_pu_bacteria 2643221555 2643793234 214
66 iso_pu_bacteria 2643221557 2643807384 214
67 iso_pu_bacteria 2643221610 2644069796 214
68 iso_pu_bacteria 2643221618 2644109176 214
69 iso_pu_bacteria 2643221626 2644151698 214
70 iso_pu_bacteria 2643221655 2644311832 214
71 iso_pu_bacteria 2643221659 2644330104 214
72 iso_pu_bacteria 2643221668 2644380767 214
73 iso_pu_bacteria 2643221675 2644414672 214
74 iso_pu_bacteria 2643221680 2644448329 214
75 iso_pu_bacteria 2643221698 2644543142 214
76 iso_pu_bacteria 2643221712 2644617630 214
77 iso_pu_bacteria 2643221723 2644673726 214
78 iso_pu_bacteria 2643221726 2644689364 214
79 iso_pu_bacteria 2657244999 2657682163 214
80 iso_pu_bacteria 2690316117 2692316976 214
81 iso_pu_bacteria 2751185821 2753462969 214
82 iso_pu_bacteria 2791355082 2792584011 214
83 iso_pu_bacteria 2791355091 2792622187 214
84 iso_pu_bacteria 2791355092 2792628248 214
85 iso_pu_bacteria 2791355094 2792638494 214
86 iso_pu_bacteria 2802428858 2802717580 214
87 iso_pu_bacteria 2802428859 2802723493 214
88 iso_pu_bacteria 2802428860 2802731057 214
89 iso_pu_bacteria 2802428861 2802736063 214
90 iso_pu_bacteria 2802428862 2802743726 214
91 iso_pu_bacteria 2802428863 2802750562 214
92 iso_pu_bacteria 2802429268 2804751181 214
93 iso_pu_bacteria 2838074704 2838076284 214
94 iso_pu_bacteria 2844163670 2844163813 214
95 iso_pu_bacteria 2847417321 2847417955 214
96 iso_pu_bacteria 2848992105 2848992931 214
97 iso_pu_bacteria 2850079185 2850080317 214
98 iso_pu_bacteria 2855825444 2855832040 214
99 iso_pu_bacteria 2855839649 2855840326 214
100 iso_pu_bacteria 2855872281 2855878994 214
101 iso_pu_bacteria 2858800743 2858800857 214
102 iso_pu_bacteria 2896384573 2896386486 214
103 iso_pu_bacteria 2913295892 2913297591 214
104 iso_pu_bacteria 2915980308 2915984148 214
105 iso_pu_bacteria 2915986958 2915990236 214
106 iso_pu_bacteria 2915993759 2915997945 214
107 iso_pu_bacteria 2916000859 2916002336 214
108 iso_pu_bacteria 2916007675 2916008582 214
109 iso_pu_bacteria 2916014648 2916020393 214
110 iso_pu_bacteria 2916021584 2916023556 214
111 iso_pu_bacteria 2916028427 2916034549 214
112 iso_pu_bacteria 2916035215 2916035295 214
113 iso_pu_bacteria 2916041962 2916043336 214
114 iso_pu_bacteria 2916048683 2916051055 214
115 iso_pu_bacteria 2916055098 2916057652 214
116 iso_pu_bacteria 2916061851 2916067959 214
117 iso_pu_bacteria 2916068649 2916073406 214
118 iso_pu_bacteria 2916076590 2916080160 214
119 iso_pu_bacteria 2920760137 2920763030 214
120 iso_pu_bacteria 2920822456 2920823673 214
121 iso_pu_bacteria 2921201388 2921207632 214
122 iso_pu_bacteria 2921208531 2921212509 214
123 iso_pu_bacteria 2921237296 2921243873 214
124 iso_pu_bacteria 2921244191 2921245909 214
125 iso_pu_bacteria 2921250672 2921250843 214
126 iso_pu_bacteria 2921257292 2921261070 214
127 iso_pu_bacteria 2921263974 2921269299 214
128 iso_pu_bacteria 2921282425 2921283859 214
129 iso_pu_bacteria 2921289301 2921294810 214
130 iso_pu_bacteria 2921296804 2921301325 214
131 iso_pu_bacteria 2924144063 2924146979 214
132 iso_pu_bacteria 2924150972 2924155945 214
133 iso_pu_bacteria 2924158325 2924160451 214
134 iso_pu_bacteria 2924165586 2924169824 214
135 iso_pu_bacteria 2924172951 2924178605 214
136 iso_pu_bacteria 2924179722 2924180331 214
137 iso_pu_bacteria 2924186466 2924191395 214
138 iso_pu_bacteria 2924193448 2924196011 214
139 iso_pu_bacteria 2924200457 2924204446 214
140 iso_pu_bacteria 2924207177 2924207481 214
141 iso_pu_bacteria 2924214083 2924217016 214
142 iso_pu_bacteria 2924221636 2924228847 214
143 iso_pu_bacteria 2924228884 2924231396 214
144 iso_pu_bacteria 2936996657 2936999197 214
145 iso_pu_bacteria 2937002841 2937003334 214
146 iso_pu_bacteria 2937009748 2937010638 214
147 iso_pu_bacteria 2937016420 2937016795 214
148 iso_pu_bacteria 2937023124 2937028046 214
149 iso_pu_bacteria 2937029754 2937029979 214
150 iso_pu_bacteria 2937036028 2937038027 214
151 iso_pu_bacteria 2937042894 2937044649 214
152 iso_pu_bacteria 2937049772 2937052699 214
153 iso_pu_bacteria 2937056579 2937061655 214
154 iso_pu_bacteria 2937063883 2937066534 214
155 iso_pu_bacteria 2937071275 2937072374 214
156 iso_pu_bacteria 2937078374 2937083122 214
157 iso_pu_bacteria 2937084907 2937089123 214
158 iso_pu_bacteria 2937091812 2937097903 214
159 iso_pu_bacteria 2937098957 2937103749 214
160 iso_pu_bacteria 2937106411 2937107360 214
161 iso_pu_bacteria 2937113482 2937119800 214
162 iso_pu_bacteria 2937119839 2937120900 214
163 iso_pu_bacteria 2937126314 2937130207 214
164 iso_pu_bacteria 2941499720 2941500402 214
165 iso_pu_bacteria 2957375807 2957380138 214
166 iso_pu_bacteria 2957382221 2957385191 214
167 iso_pu_bacteria 2957388812 2957389253 214
168 iso_pu_bacteria 2957395598 2957397057 214
169 iso_pu_bacteria 2957402308 2957402728 214
170 iso_pu_bacteria 2957408893 2957415159 214
171 iso_pu_bacteria 2957415311 2957417215 214
172 iso_pu_bacteria 2957422303 2957423549 214
173 iso_pu_bacteria 2957430029 2957436451 214
174 iso_pu_bacteria 2957437181 2957439865 214
175 iso_pu_bacteria 2957443900 2957449962 214
176 iso_pu_bacteria 2957450854 2957453364 214
177 iso_pu_bacteria 2957457609 2957457882 214
178 iso_pu_bacteria 2957464669 2957466393 214
179 iso_pu_bacteria 2957471148 2957475054 214
180 iso_pu_bacteria 2957478035 2957483785 214
181 iso_pu_bacteria 2957484790 2957490521 214
182 iso_pu_bacteria 2957491536 2957495873 214
183 iso_pu_bacteria 2957498199 2957499273 214
184 iso_pu_bacteria 2957505466 2957507934 214
185 iso_pu_bacteria 2960584000 2960587957 214
186 iso_pu_bacteria 2960591022 2960595459 214
187 iso_pu_bacteria 2960597568 2960600697 214
188 iso_pu_bacteria 2960603979 2960604671 214
189 iso_pu_bacteria 2960610863 2960613853 214
190 iso_pu_bacteria 2960617483 2960617584 214
191 iso_pu_bacteria 2960624210 2960626668 214
192 iso_pu_bacteria 2960631154 2960633341 214
193 iso_pu_bacteria 2960637947 2960642094 214
194 iso_pu_bacteria 2960645483 2960649797 214
195 iso_pu_bacteria 2960652885 2960656850 214
196 iso_pu_bacteria 2960660292 2960662261 214
197 iso_pu_bacteria 2960667422 2960668487 214
198 iso_pu_bacteria 2960674078 2960677573 214
199 iso_pu_bacteria 2960680706 2960685728 214
200 iso_pu_bacteria 2960687367 2960690422 214
201 iso_pu_bacteria 2960693952 2960696259 214
202 iso_pu_bacteria 2964607997 2964612041 214
203 iso_pu_bacteria 2964615318 2964617562 214
204 iso_pu_bacteria 2964621998 2964622872 214
205 iso_pu_bacteria 2964628898 2964633662 214
206 iso_pu_bacteria 2964636051 2964642060 214
207 iso_pu_bacteria 2964643177 2964644401 214
208 iso_pu_bacteria 2964649959 2964652982 214
209 iso_pu_bacteria 2964656573 2964658192 214
210 iso_pu_bacteria 2964663802 2964666095 214
211 iso_pu_bacteria 2964670856 2964671134 214
212 iso_pu_bacteria 2964678106 2964684723 214
213 iso_pu_bacteria 2964685014 2964686166 214
214 iso_pu_bacteria 2964691889 2964693592 214
215 iso_pu_bacteria 2964698721 2964701935 214
216 iso_pu_bacteria 2964705432 2964712205 214
217 iso_pu_bacteria 2964712639 2964713579 214
218 iso_pu_bacteria 2964719344 2964726587 214
219 iso_pu_bacteria 2967664464 2967671459 214
220 iso_pu_bacteria 2967671571 2967673757 214
221 iso_pu_bacteria 2967678726 2967678803 214
222 iso_pu_bacteria 2967686174 2967686302 214
223 iso_pu_bacteria 2967693043 2967693124 214
224 iso_pu_bacteria 2967706974 2967713990 214
225 iso_pu_bacteria 2967714385 2967721386 214
226 iso_pu_bacteria 2967721400 2967724737 214
227 iso_pu_bacteria 2967728569 2967730679 214
228 iso_pu_bacteria 2967735183 2967741019 214
229 iso_pu_bacteria 2967742019 2967746961 214
230 iso_pu_bacteria 2967748971 2967752227 214
231 iso_pu_bacteria 2967755722 2967761069 214
232 iso_pu_bacteria 2967762386 2967763699 214
233 iso_pu_bacteria 2967769361 2967773178 214
234 iso_pu_bacteria 2967775926 2967779390 214
235 iso_pu_bacteria 2970019648 2970026721 214
236 iso_pu_bacteria 2970026789 2970030434 214
237 iso_pu_bacteria 2970033650 2970039199 214
238 iso_pu_bacteria 2970040964 2970042979 214
239 iso_pu_bacteria 2970047711 2970051615 214
240 iso_pu_bacteria 2970054988 2970058724 214
241 iso_pu_bacteria 2970061556 2970066989 214
242 iso_pu_bacteria 2970068827 2970074899 214
243 iso_pu_bacteria 2970076120 2970076486 214
244 iso_pu_bacteria 2970082768 2970083379 214
245 iso_pu_bacteria 2970088815 2970093526 214
246 iso_pu_bacteria 2970095765 2970100183 214
247 iso_pu_bacteria 2970102677 2970108444 214
248 iso_pu_bacteria 2970109326 2970112265 214
249 iso_pu_bacteria 2970116247 2970118088 214
250 iso_pu_bacteria 2970122695 2970128292 214
251 iso_pu_bacteria 2970129317 2970129397 214
252 iso_pu_bacteria 2970136068 2970143414 214
253 iso_pu_bacteria 2970143518 2970149030 214
254 iso_pu_bacteria 2970149975 2970151301 214
255 iso_pu_bacteria 2970156795 2970157152 214
256 iso_pu_bacteria 2970164137 2970167382 214
257 iso_pu_bacteria 2970170962 2970171483 214
258 iso_pu_bacteria 2970177841 2970182616 214
259 iso_pu_bacteria 2970184632 2970187466 214
260 iso_pu_bacteria 2970191845 2970196292 214
261 iso_pu_bacteria 2977516862 2977518583 214
262 iso_pu_bacteria 2977523885 2977525989 214
263 iso_pu_bacteria 2977530762 2977533305 214
264 iso_pu_bacteria 2977537788 2977537868 214
265 iso_pu_bacteria 2977544691 2977544818 214
266 iso_pu_bacteria 2977551784 2977551865 214
267 iso_pu_bacteria 2977558990 2977563077 214
268 iso_pu_bacteria 2977565890 2977568195 214
269 iso_pu_bacteria 2977572785 2977574833 214
270 iso_pu_bacteria 2977579622 2977581615 214
271 iso_pu_bacteria 643692032 643824929 214
272 iso_pu_bacteria 648276728 648737739 214
273 iso_pu_bacteria 8003992118 8003992740 214
274 iso_pu_bacteria 8003999396 8004000069 214
275 iso_pu_bacteria 8049293176 8049293761 214
276 iso_pu_bacteria 2503198000 2503203477 215
277 iso_pu_bacteria 2508501123 2509115895 215
278 iso_pu_bacteria 2509276018 2509373682 215
279 iso_pu_bacteria 2509276022 2509397894 215
280 iso_pu_bacteria 2510065059 2510316468 215
281 iso_pu_bacteria 2512875016 2512929640 215
282 iso_pu_bacteria 2512875024 2512964421 215
283 iso_pu_bacteria 2513237090 2513608295 215
284 iso_pu_bacteria 2513237164 2514036973 215
285 iso_pu_bacteria 2513237305 2514416728 215
286 iso_pu_bacteria 2513237351 2514591637 215
287 iso_pu_bacteria 2588253730 2588515219 215
288 iso_pu_bacteria 2599185301 2599939945 215
289 iso_pu_bacteria 2643221564 2643838626 215
290 iso_pu_bacteria 2643221595 2643989020 215
291 iso_pu_bacteria 2643221623 2644132742 215
292 iso_pu_bacteria 2643221627 2644152205 215
293 iso_pu_bacteria 2643221637 2644206397 215
294 iso_pu_bacteria 2643221718 2644650044 215
295 iso_pu_bacteria 2687453392 2688600308 215
296 iso_pu_bacteria 2693429783 2694631744 215
297 iso_pu_bacteria 2693429784 2694639796 215
298 iso_pu_bacteria 2721755686 2723577583 215
299 iso_pu_bacteria 2738543024 2739306639 215
300 iso_pu_bacteria 2756170246 2756673129 215
301 iso_pu_bacteria 2791355123 2792750872 215
302 iso_pu_bacteria 2791355253 2793283020 215
303 iso_pu_bacteria 2844002411 2844005580 215
304 iso_pu_bacteria 2844009547 2844015619 215
305 iso_pu_bacteria 2847670302 2847671987 215
306 iso_pu_bacteria 2847686936 2847688218 215
307 iso_pu_bacteria 2856314179 2856318281 215
308 iso_pu_bacteria 2856320880 2856324238 215
309 iso_pu_bacteria 2856328259 2856328603 215
310 iso_pu_bacteria 2856334872 2856338481 215
311 iso_pu_bacteria 2856364286 2856364816 215
312 iso_pu_bacteria 2857349434 2857354915 215
313 iso_pu_bacteria 2857367948 2857369616 215
314 iso_pu_bacteria 2869162929 2869165491 215
315 iso_pu_bacteria 2869169390 2869173889 215
316 iso_pu_bacteria 2869234852 2869241264 215
317 iso_pu_bacteria 2869242130 2869242478 215
318 iso_pu_bacteria 2869249662 2869256872 215
319 iso_pu_bacteria 2869256925 2869261680 215
320 iso_pu_bacteria 2869264136 2869264622 215
321 iso_pu_bacteria 2869271264 2869277320 215
322 iso_pu_bacteria 2869278585 2869281764 215
323 iso_pu_bacteria 2869285874 2869289735 215
324 iso_pu_bacteria 2871429161 2871431801 215
325 iso_pu_bacteria 2871435913 2871443119 215
326 iso_pu_bacteria 2871444079 2871445320 215
327 iso_pu_bacteria 2871451962 2871455126 215
328 iso_pu_bacteria 2871459585 2871465758 215
329 iso_pu_bacteria 2871466892 2871468503 215
330 iso_pu_bacteria 2871481445 2871488464 215
331 iso_pu_bacteria 2871495908 2871497517 215
332 iso_pu_bacteria 2874102143 2874108840 215
333 iso_pu_bacteria 2874109183 2874113636 215
334 iso_pu_bacteria 2874116593 2874122629 215
335 iso_pu_bacteria 2874123672 2874127730 215
336 iso_pu_bacteria 2874131515 2874132306 215
337 iso_pu_bacteria 2874139085 2874140568 215
338 iso_pu_bacteria 2874146452 2874155479 215
339 iso_pu_bacteria 2874155637 2874162336 215
340 iso_pu_bacteria 2874162495 2874166570 215
341 iso_pu_bacteria 2874168670 2874175273 215
342 iso_pu_bacteria 2876363079 2876366798 215
343 iso_pu_bacteria 2876377896 2876378548 215
344 iso_pu_bacteria 2876386047 2876390757 215
345 iso_pu_bacteria 2876392853 2876398754 215
346 iso_pu_bacteria 2876399893 2876400595 215
347 iso_pu_bacteria 2876406927 2876408796 215
348 iso_pu_bacteria 2876413966 2876420824 215
349 iso_pu_bacteria 2876420981 2876426966 215
350 iso_pu_bacteria 2878035449 2878037619 215
351 iso_pu_bacteria 2878738818 2878742352 215
352 iso_pu_bacteria 2878745973 2878748407 215
353 iso_pu_bacteria 2878760144 2878761735 215
354 iso_pu_bacteria 2878767105 2878768703 215
355 iso_pu_bacteria 2878774303 2878778689 215
356 iso_pu_bacteria 2878781027 2878788006 215
357 iso_pu_bacteria 2882632389 2882635350 215
358 iso_pu_bacteria 2885318864 2885322892 215
359 iso_pu_bacteria 2888337043 2888341482 215
360 iso_pu_bacteria 2888350351 2888350818 215
361 iso_pu_bacteria 2889010040 2889013160 215
362 iso_pu_bacteria 2889016732 2889021980 215
363 iso_pu_bacteria 2903448605 2903452973 215
364 iso_pu_bacteria 2903492973 2903506084 215
365 iso_pu_bacteria 2903513507 2903514942 215
366 iso_pu_bacteria 2903521522 2903524665 215
367 iso_pu_bacteria 2903528002 2903531092 215
368 iso_pu_bacteria 2903540706 2903542312 215
369 iso_pu_bacteria 2904659560 2904665286 215
370 iso_pu_bacteria 2906308376 2906312024 215
371 iso_pu_bacteria 2906321335 2906323762 215
372 iso_pu_bacteria 2906328253 2906331383 215
373 iso_pu_bacteria 2906354277 2906360348 215
374 iso_pu_bacteria 2906363423 2906364863 215
375 iso_pu_bacteria 2906370794 2906377928 215
376 iso_pu_bacteria 2906378014 2906383573 215
377 iso_pu_bacteria 2906386501 2906388958 215
378 iso_pu_bacteria 2906393657 2906395447 215
379 iso_pu_bacteria 2906401398 2906402444 215
380 iso_pu_bacteria 2906408224 2906408404 215
381 iso_pu_bacteria 2906414383 2906418318 215
382 iso_pu_bacteria 2906427513 2906435025 215
383 iso_pu_bacteria 2922130491 2922137594 215
384 iso_pu_bacteria 2922151315 2922153274 215
385 iso_pu_bacteria 2922158528 2922159744 215
386 iso_pu_bacteria 2922172374 2922178173 215
387 iso_pu_bacteria 2922178524 2922182441 215
388 iso_pu_bacteria 2922185730 2922193826 215
389 iso_pu_bacteria 2924718760 2924718829 215
390 iso_pu_bacteria 2924726620 2924728136 215
391 iso_pu_bacteria 2924733363 2924740377 215
392 iso_pu_bacteria 2924741084 2924742750 215
393 iso_pu_bacteria 2924748358 2924752574 215
394 iso_pu_bacteria 2924762789 2924764449 215
395 iso_pu_bacteria 2924776078 2924780152 215
396 iso_pu_bacteria 2937813078 2937818153 215
397 iso_pu_bacteria 2937822353 2937829086 215
398 iso_pu_bacteria 2937843397 2937846622 215
399 iso_pu_bacteria 2937861824 2937868726 215
400 iso_pu_bacteria 2937868953 2937873784 215
401 iso_pu_bacteria 2937877337 2937882672 215
402 iso_pu_bacteria 2937891427 2937892084 215
403 iso_pu_bacteria 2937972304 2937973355 215
404 iso_pu_bacteria 2937980651 2937988116 215
405 iso_pu_bacteria 2937994558 2937996167 215
406 iso_pu_bacteria 2938014810 2938015045 215
407 iso_pu_bacteria 2958034702 2958037725 215
408 iso_pu_bacteria 2958041894 2958047437 215
409 iso_pu_bacteria 2958064165 2958066105 215
410 iso_pu_bacteria 2958084443 2958089797 215
411 iso_pu_bacteria 2958092219 2958097711 215
412 iso_pu_bacteria 2958100919 2958107868 215
413 iso_pu_bacteria 2958108152 2958113009 215
414 iso_pu_bacteria 2958115193 2958116820 215
415 iso_pu_bacteria 2958122699 2958130021 215
416 iso_pu_bacteria 2958130278 2958134108 215
417 iso_pu_bacteria 2958137437 2958142803 215
418 iso_pu_bacteria 2958144490 2958146776 215
419 iso_pu_bacteria 2958158011 2958163468 215
420 iso_pu_bacteria 2958165035 2958166637 215
421 iso_pu_bacteria 2958179912 2958183754 215
422 iso_pu_bacteria 2961077736 2961081720 215
423 iso_pu_bacteria 2961114664 2961120286 215
424 iso_pu_bacteria 2961127735 2961132205 215
425 iso_pu_bacteria 2961136820 2961138637 215
426 iso_pu_bacteria 2961163497 2961165103 215
427 iso_pu_bacteria 2961183825 2961184175 215
428 iso_pu_bacteria 2963644680 2963649592 215
429 iso_pu_bacteria 2965018300 2965019927 215
430 iso_pu_bacteria 2965025482 2965026224 215
431 iso_pu_bacteria 2965032056 2965034295 215
432 iso_pu_bacteria 2965040258 2965046955 215
433 iso_pu_bacteria 2965047637 2965047959 215
434 iso_pu_bacteria 2965062239 2965064678 215
435 iso_pu_bacteria 2965089291 2965094493 215
436 iso_pu_bacteria 2965102966 2965106383 215
437 iso_pu_bacteria 2965110997 2965117264 215
438 iso_pu_bacteria 2968016561 2968019440 215
439 iso_pu_bacteria 2968083720 2968084754 215
440 iso_pu_bacteria 2968097103 2968101644 215
441 iso_pu_bacteria 2968110612 2968116753 215
442 iso_pu_bacteria 2968117919 2968118501 215
443 iso_pu_bacteria 2968128360 2968131834 215
444 iso_pu_bacteria 2968138860 2968143599 215
445 iso_pu_bacteria 2968171901 2968173504 215
446 iso_pu_bacteria 2970469710 2970472761 215
447 iso_pu_bacteria 2970489779 2970494753 215
448 iso_pu_bacteria 2970510686 2970515856 215
449 iso_pu_bacteria 2970532167 2970533346 215
450 iso_pu_bacteria 2970547951 2970550622 215
451 iso_pu_bacteria 2970554993 2970556593 215
452 iso_pu_bacteria 2970593180 2970596368 215
453 iso_pu_bacteria 2970619444 2970623651 215
454 iso_pu_bacteria 2970627176 2970630865 215
455 iso_pu_bacteria 2977843712 2977851249 215
456 iso_pu_bacteria 2977872689 2977875009 215
457 iso_pu_bacteria 2977907340 2977908116 215
458 iso_pu_bacteria 2977915119 2977916485 215
459 iso_pu_bacteria 2977935797 2977938644 215
460 iso_pu_bacteria 2977942078 2977946700 215
461 iso_pu_bacteria 2977950692 2977957068 215
462 iso_pu_bacteria 2977957713 2977959899 215
463 iso_pu_bacteria 2979772303 2979775108 215
464 iso_pu_bacteria 2979779861 2979785729 215
465 iso_pu_bacteria 2979793036 2979796255 215
466 iso_pu_bacteria 2987636660 2987643517 215
467 iso_pu_bacteria 2987645492 2987651588 215
468 iso_pu_bacteria 2987659509 2987661111 215
469 iso_pu_bacteria 2987666974 2987672707 215
470 iso_pu_bacteria 2987673487 2987673799 215
471 iso_pu_bacteria 2996310559 2996313146 215
472 iso_pu_bacteria 2996341866 2996348587 215
473 iso_pu_bacteria 2996348954 2996352120 215
474 iso_pu_bacteria 2996386984 2996391993 215
475 iso_pu_bacteria 3000135777 3000142029 215
476 iso_pu_bacteria 3004167301 3004171098 215
477 iso_pu_bacteria 3004188549 3004190161 215
478 iso_pu_bacteria 3004195979 3004203113 215
479 iso_pu_bacteria 3004203850 3004207062 215
480 iso_pu_bacteria 3004232784 3004233004 215
481 iso_pu_bacteria 3004239961 3004239994 215
482 iso_pu_bacteria 3004248173 3004249146 215
483 iso_pu_bacteria 3004268573 3004273382 215
484 iso_pu_bacteria 3004275668 3004278818 215
485 iso_pu_bacteria 3004334049 3004339227 215
486 iso_pu_bacteria 637000159 637079384 215
487 iso_pu_bacteria 649633066 649874772 215
488 iso_pu_bacteria 8002285264 8002287981 215
489 iso_pu_bacteria 8004300914 8004303442 215
490 iso_pu_bacteria 8004312739 8004318593 215
491 iso_pu_bacteria 8004361976 8004368148 215
492 iso_pu_bacteria 8004387939 8004391613 215
493 iso_pu_bacteria 8004445564 8004449705 215
494 iso_pu_bacteria 8004640170 8004641376 215
495 iso_pu_bacteria 8004695233 8004700007 215
496 iso_pu_bacteria 8004703790 8004710702 215
497 iso_pu_bacteria 8004714634 8004716982 215
498 iso_pu_bacteria 8004727605 8004733157 215
499 iso_pu_bacteria 8055617313 8055622867 215
500 3300003187 JGI25151J46595_10008750 JGI25151J46595_100087505 216
501 3300025294 Ga0209025_1000165 Ga0209025_1000165139 216
502 3300028794 Ga0307515_10000420 Ga0307515_1000042016 216
503 3300028794 Ga0307515_10039061 Ga0307515_100390614 216
504 3300031456 Ga0307513_10004196 Ga0307513_100041961 216
505 3300031548 Ga0307408_100024952 Ga0307408_1000249524 216
506 3300031911 Ga0307412_10144470 Ga0307412_101444702 216
507 3300031995 Ga0307409_100337798 Ga0307409_1003377981 216
508 3300032002 Ga0307416_101015167 Ga0307416_1010151672 216
509 3300036647 Ga0316582_0070662 Ga0316582_0070662_403_1053 216
510 3300036712 Ga0316584_0079499 Ga0316584_0079499_238_888 216
511 3300041410 Ga0439461_0068124 Ga0439461_0068124_99_749 216
512 3300041411 Ga0439466_0092196 Ga0439466_0092196_142_792 216
513 3300042002 Ga0439442_066542 Ga0439442_066542_99_749 216
514 3300042006 Ga0439432_081424 Ga0439432_081424_185_835 216
515 3300042145 Ga0450906_026455 Ga0450906_026455_331_981 216
516 3300042147 Ga0450910_005161 Ga0450910_005161_335_985 216
517 3300042531 Ga0450918_007376 Ga0450918_007376_660_1310 216
518 3300046674 Ga0495588_0099043 Ga0495588_0099043_185_835 216
519 3300048920 Ga0496117_0002204 Ga0496117_0002204_5544_6194 216
520 3300048925 Ga0496122_0004346 Ga0496122_0004346_2183_2833 216
521 3300048925 Ga0496122_0076809 Ga0496122_0076809_564_1238 216
522 3300048926 Ga0496123_0000103 Ga0496123_0000103_133811_134461 216
523 3300048926 Ga0496123_0026920 Ga0496123_0026920_939_1613 216
524 3300048927 Ga0496124_0005072 Ga0496124_0005072_4231_4881 216
525 3300048928 Ga0496125_0000879 Ga0496125_0000879_1940_2590 216
526 3300048928 Ga0496125_0039027 Ga0496125_0039027_939_1613 216
527 3300048929 Ga0496126_0001336 Ga0496126_0001336_4925_5575 216
528 3300048929 Ga0496126_0012132 Ga0496126_0012132_5219_5890 216
529 3300049513 Ga0501290_000163 Ga0501290_000163_7072_7722 216
530 3300049573 Ga0501037_0117480 Ga0501037_0117480_1042_1692 216
531 3300049652 Ga0501202_018881 Ga0501202_018881_517_1167 216
532 3300049662 Ga0501222_001521 Ga0501222_001521_888_1538 216
533 3300049663 Ga0501223_001150 Ga0501223_001150_3214_3864 216
534 3300049664 Ga0501224_006556 Ga0501224_006556_290_940 216
535 3300049776 Ga0501280_000010 Ga0501280_000010_48740_49390 216
536 3300049778 Ga0501282_001568 Ga0501282_001568_662_1312 216
537 3300049823 Ga0501044_0521416 Ga0501044_0521416_294_944 216
538 3300053157 Ga0500624_036798 Ga0500624_036798_76_726 216
539 iso_pu_bacteria 2894772417 2894776651 216
540 3300005937 Ga0081455_10018339 Ga0081455_100183395 217
541 3300025230 Ga0209563_105116 Ga0209563_1051162 217
542 3300031235 Ga0265330_10123466 Ga0265330_101234662 217
543 3300031901 Ga0307406_10085121 Ga0307406_100851212 217
544 3300037853 Ga0436364_1041655 Ga0436364_1041655_9250_9912 217
545 3300049570 Ga0501033_0000503 Ga0501033_0000503_5243_5896 217
546 3300049570 Ga0501033_0111103 Ga0501033_0111103_136_789 217
547 3300049571 Ga0501034_0620168 Ga0501034_0620168_136_789 217
548 3300049572 Ga0501036_0167658 Ga0501036_0167658_197_850 217
549 3300049573 Ga0501037_0322388 Ga0501037_0322388_136_789 217
550 3300049573 Ga0501037_0328514 Ga0501037_0328514_20_682 217
551 3300049574 Ga0501038_0024807 Ga0501038_0024807_3297_3950 217
552 3300049575 Ga0501039_0317168 Ga0501039_0317168_376_1029 217
553 3300049579 Ga0501043_0291265 Ga0501043_0291265_197_850 217
554 3300049581 Ga0501047_0006539 Ga0501047_0006539_4757_5419 217
555 3300049581 Ga0501047_0163561 Ga0501047_0163561_1323_1976 217
556 3300049586 Ga0501070_0134743 Ga0501070_0134743_169_822 217
557 3300049586 Ga0501070_0367885 Ga0501070_0367885_319_981 217
558 3300049589 Ga0501073_0062094 Ga0501073_0062094_736_1398 217
559 3300049742 Ga0501080_0147726 Ga0501080_0147726_1385_2038 217
560 3300049742 Ga0501080_0255827 Ga0501080_0255827_867_1529 217
561 3300049822 Ga0501035_0020300 Ga0501035_0020300_1718_2371 217
562 3300049822 Ga0501035_0132746 Ga0501035_0132746_1396_2049 217
563 3300049823 Ga0501044_0165646 Ga0501044_0165646_1396_2049 217
564 3300049823 Ga0501044_0329332 Ga0501044_0329332_634_1296 217
565 3300060353 Ga0501082_0064688 Ga0501082_0064688_1774_2433 217
566 iso_pu_bacteria 2837651117 2837652518 217
567 3300002739 JGI25158J39367_1001337 JGI25158J39367_10013373 218
568 3300002987 JGI25159J45721_1000001 JGI25159J45721_1000001225 218
569 3300003187 JGI25151J46595_10025779 JGI25151J46595_100257792 218
570 3300003354 JGI25160J50197_1000002 JGI25160J50197_100000290 218
571 3300003771 Ga0055526_1001867 Ga0055526_100186711 218
572 3300003775 Ga0055524_1000777 Ga0055524_100077711 218
573 3300003775 Ga0055524_1024254 Ga0055524_10242542 218
574 3300003791 Ga0055530_10040496 Ga0055530_100404961 218
575 3300003794 Ga0055531_10031987 Ga0055531_100319872 218
576 3300004625 Ga0055543_1000057 Ga0055543_1000057100 218
577 3300005262 Ga0065165_1000004 Ga0065165_1000004293 218
578 3300005335 Ga0070666_10095281 Ga0070666_100952812 218
579 3300006946 Ga0079104_1007485 Ga0079104_10074854 218
580 3300006946 Ga0079104_1014594 Ga0079104_10145942 218
581 3300013249 Ga0171463_1001 Ga0171463_1001401 218
582 3300015690 Ga0183363_1045 Ga0183363_104542 218
583 3300021320 Ga0214544_1000008 Ga0214544_1000008102 218
584 3300021321 Ga0214542_1000010 Ga0214542_100001058 218
585 3300021321 Ga0214542_1015383 Ga0214542_10153832 218
586 3300021327 Ga0214543_1000003 Ga0214543_1000003317 218
587 3300021327 Ga0214543_1000004 Ga0214543_100000480 218
588 3300022739 Ga0228711_1000001 Ga0228711_1000001229 218
589 3300022740 Ga0228710_1000001 Ga0228710_100000195 218
590 3300025208 Ga0209436_100122 Ga0209436_10012233 218
591 3300025284 Ga0209130_1000008 Ga0209130_1000008452 218
592 3300025292 Ga0209676_1002258 Ga0209676_10022588 218
593 3300025294 Ga0209025_1000100 Ga0209025_100010038 218
594 3300025295 Ga0209564_1000104 Ga0209564_1000104134 218
595 3300025298 Ga0209050_1015813 Ga0209050_10158134 218
596 3300025299 Ga0209256_1000652 Ga0209256_100065243 218
597 3300025299 Ga0209256_1002322 Ga0209256_10023224 218
598 3300025302 Ga0207426_1000016 Ga0207426_1000016111 218
599 3300025903 Ga0207680_10098509 Ga0207680_100985093 218
600 3300027111 Ga0209281_1000164 Ga0209281_1000164134 218
601 3300027111 Ga0209281_1000626 Ga0209281_100062627 218
602 3300027666 Ga0209282_1000007 Ga0209282_100000722 218
603 3300031241 Ga0265325_10041422 Ga0265325_100414222 218
604 3300031247 Ga0265340_10001536 Ga0265340_100015368 218
605 3300031247 Ga0265340_10071750 Ga0265340_100717502 218
606 3300031249 Ga0265339_10004396 Ga0265339_100043965 218
607 3300031344 Ga0265316_10028899 Ga0265316_100288992 218
608 3300031595 Ga0265313_10001426 Ga0265313_100014262 218
609 3300031712 Ga0265342_10003927 Ga0265342_100039276 218
610 3300031967 Ga0315914_1000006 Ga0315914_1000006220 218
611 3300033430 Ga0315913_1000002 Ga0315913_100000222 218
612 3300033464 Ga0315915_1000001 Ga0315915_1000001464 218
613 3300041413 Ga0439465_0044479 Ga0439465_0044479_686_1348 218
614 3300042007 Ga0439449_0002061 Ga0439449_0002061_4091_4870 218
615 3300042015 Ga0439462_0031769 Ga0439462_0031769_263_1042 218
616 3300049589 Ga0501073_0081812 Ga0501073_0081812_328_993 218
617 3300049742 Ga0501080_0365547 Ga0501080_0365547_80_745 218
618 3300053087 Ga0500643_000356 Ga0500643_000356_4428_5087 218
619 iso_pu_bacteria 2643221653 2644297109 218
620 iso_pu_bacteria 2643221719 2644655362 218
621 iso_pu_bacteria 2967699805 2967704298 218
622 iso_pu_bacteria 8005246636 8005246850 218
623 3300001979 JGI24740J21852_10009030 JGI24740J21852_100090303 219
624 3300003214 JGI25165J46597_1000016 JGI25165J46597_100001675 219
625 3300003320 rootH2_10339468 rootH2_103394681 219
626 3300003762 Ga0055542_1004234 Ga0055542_10042345 219
627 3300003763 Ga0055529_1006934 Ga0055529_10069341 219
628 3300005327 Ga0070658_10391926 Ga0070658_103919262 219
629 3300005347 Ga0070668_100298989 Ga0070668_1002989891 219
630 3300005356 Ga0070674_100184160 Ga0070674_1001841602 219
631 3300005367 Ga0070667_100430374 Ga0070667_1004303741 219
632 3300005455 Ga0070663_100110541 Ga0070663_1001105412 219
633 3300005455 Ga0070663_100645646 Ga0070663_1006456461 219
634 3300005456 Ga0070678_100832481 Ga0070678_1008324811 219
635 3300005539 Ga0068853_100043464 Ga0068853_1000434643 219
636 3300005548 Ga0070665_100034072 Ga0070665_1000340724 219
637 3300005548 Ga0070665_100471005 Ga0070665_1004710052 219
638 3300005563 Ga0068855_100162571 Ga0068855_1001625712 219
639 3300005564 Ga0070664_100750651 Ga0070664_1007506511 219
640 3300005577 Ga0068857_100104451 Ga0068857_1001044513 219
641 3300005983 Ga0081540_1023624 Ga0081540_10236245 219
642 3300006038 Ga0075365_10004422 Ga0075365_100044226 219
643 3300006038 Ga0075365_10012641 Ga0075365_100126415 219
644 3300006048 Ga0075363_100012543 Ga0075363_1000125433 219
645 3300006048 Ga0075363_100213756 Ga0075363_1002137562 219
646 3300006177 Ga0075362_10027138 Ga0075362_100271382 219
647 3300006177 Ga0075362_10028394 Ga0075362_100283943 219
648 3300006178 Ga0075367_10019586 Ga0075367_100195862 219
649 3300006186 Ga0075369_10119954 Ga0075369_101199541 219
650 3300006353 Ga0075370_10026164 Ga0075370_100261644 219
651 3300006353 Ga0075370_10077522 Ga0075370_100775222 219
652 3300009093 Ga0105240_10026413 Ga0105240_100264134 219
653 3300009093 Ga0105240_10281473 Ga0105240_102814732 219
654 3300009545 Ga0105237_10031482 Ga0105237_100314823 219
655 3300009545 Ga0105237_10077156 Ga0105237_100771562 219
656 3300009545 Ga0105237_10163975 Ga0105237_101639752 219
657 3300009545 Ga0105237_10294357 Ga0105237_102943572 219
658 3300009551 Ga0105238_10011809 Ga0105238_100118094 219
659 3300010375 Ga0105239_10044001 Ga0105239_100440011 219
660 3300010375 Ga0105239_10076181 Ga0105239_100761813 219
661 3300010375 Ga0105239_10150471 Ga0105239_101504713 219
662 3300010375 Ga0105239_10466871 Ga0105239_104668711 219
663 3300013104 Ga0157370_10607504 Ga0157370_106075041 219
664 3300013105 Ga0157369_10276630 Ga0157369_102766302 219
665 3300013296 Ga0157374_10564917 Ga0157374_105649172 219
666 3300013297 Ga0157378_10680137 Ga0157378_106801371 219
667 3300013307 Ga0157372_10668351 Ga0157372_106683512 219
668 3300014497 Ga0182008_10128964 Ga0182008_101289642 219
669 3300025246 Ga0209646_1011896 Ga0209646_10118962 219
670 3300025250 Ga0209026_1000005 Ga0209026_100000581 219
671 3300025254 Ga0209148_1000056 Ga0209148_100005663 219
672 3300025256 Ga0209759_1000631 Ga0209759_10006316 219
673 3300025261 Ga0209233_1000068 Ga0209233_100006875 219
674 3300025272 Ga0209455_1000238 Ga0209455_100023817 219
675 3300025297 Ga0209758_1005808 Ga0209758_10058087 219
676 3300025904 Ga0207647_10053502 Ga0207647_100535022 219
677 3300025907 Ga0207645_10077952 Ga0207645_100779522 219
678 3300025913 Ga0207695_10333569 Ga0207695_103335692 219
679 3300025913 Ga0207695_10824141 Ga0207695_108241411 219
680 3300025914 Ga0207671_10012030 Ga0207671_100120306 219
681 3300025914 Ga0207671_10058466 Ga0207671_100584662 219
682 3300025914 Ga0207671_10178806 Ga0207671_101788062 219
683 3300025919 Ga0207657_10050734 Ga0207657_100507343 219
684 3300025924 Ga0207694_10051200 Ga0207694_100512003 219
685 3300025924 Ga0207694_10445342 Ga0207694_104453421 219
686 3300025933 Ga0207706_10174245 Ga0207706_101742452 219
687 3300025937 Ga0207669_10149290 Ga0207669_101492903 219
688 3300025940 Ga0207691_10293169 Ga0207691_102931691 219
689 3300025972 Ga0207668_10388562 Ga0207668_103885622 219
690 3300026041 Ga0207639_10069737 Ga0207639_100697372 219
691 3300026067 Ga0207678_10149256 Ga0207678_101492561 219
692 3300026116 Ga0207674_10098525 Ga0207674_100985252 219
693 3300028379 Ga0268266_10293056 Ga0268266_102930562 219
694 3300032002 Ga0307416_100107466 Ga0307416_1001074662 219
695 3300035398 Ga0316574_0520552 Ga0316574_0520552_10_669 219
696 3300035691 Ga0373931_0166482 Ga0373931_0166482_82_744 219
697 3300035692 Ga0373935_0285059 Ga0373935_0285059_458_1117 219
698 3300037418 Ga0395900_0084548 Ga0395900_0084548_1733_2395 219
699 3300037418 Ga0395900_0338598 Ga0395900_0338598_172_834 219
700 3300037466 Ga0395898_0063483 Ga0395898_0063483_2749_3411 219
701 3300037466 Ga0395898_0339865 Ga0395898_0339865_206_868 219
702 3300037471 Ga0395905_0101818 Ga0395905_0101818_1238_1939 219
703 3300038443 Ga0395901_0037442 Ga0395901_0037442_3998_4699 219
704 3300038443 Ga0395901_0041612 Ga0395901_0041612_1351_2016 219
705 3300042157 Ga0439458_0093151 Ga0439458_0093151_14_676 219
706 3300044658 Ga0466972_0092202 Ga0466972_0092202_596_1258 219
707 3300044658 Ga0466972_0230596 Ga0466972_0230596_13_675 219
708 3300044683 Ga0466965_0237206 Ga0466965_0237206_86_748 219
709 3300044901 Ga0466960_0081836 Ga0466960_0081836_267_929 219
710 3300046460 Ga0495638_0098581 Ga0495638_0098581_484_1146 219
711 3300046492 Ga0495585_0252728 Ga0495585_0252728_27_704 219
712 3300046507 Ga0495606_0053804 Ga0495606_0053804_1844_2521 219
713 3300046519 Ga0495632_0048643 Ga0495632_0048643_721_1383 219
714 3300046522 Ga0495643_0070648 Ga0495643_0070648_988_1650 219
715 3300046616 Ga0495668_0044581 Ga0495668_0044581_1434_2096 219
716 3300046660 Ga0495625_0021781 Ga0495625_0021781_3591_4253 219
717 3300047443 Ga0495687_020699 Ga0495687_020699_2427_3089 219
718 3300048088 Ga0495602_0249634 Ga0495602_0249634_57_719 219
719 3300048088 Ga0495602_0443161 Ga0495602_0443161_80_739 219
720 3300048091 Ga0495626_0056117 Ga0495626_0056117_21_683 219
721 3300048905 Ga0496102_0831960 Ga0496102_0831960_151_813 219
722 3300048907 Ga0496104_0396809 Ga0496104_0396809_98_760 219
723 3300048908 Ga0496105_0063843 Ga0496105_0063843_1376_2038 219
724 3300048913 Ga0496110_0196310 Ga0496110_0196310_30_701 219
725 3300048913 Ga0496110_0407293 Ga0496110_0407293_221_883 219
726 3300048915 Ga0496112_0015726 Ga0496112_0015726_5018_5680 219
727 3300048915 Ga0496112_0260718 Ga0496112_0260718_645_1316 219
728 3300048916 Ga0496113_0221816 Ga0496113_0221816_612_1277 219
729 3300048917 Ga0496114_0200085 Ga0496114_0200085_834_1511 219
730 3300048921 Ga0496118_0046814 Ga0496118_0046814_1467_2129 219
731 3300048923 Ga0496120_0052491 Ga0496120_0052491_159_821 219
732 3300048924 Ga0496121_0153319 Ga0496121_0153319_303_965 219
733 3300048927 Ga0496124_0122222 Ga0496124_0122222_263_922 219
734 3300048929 Ga0496126_0092384 Ga0496126_0092384_1527_2189 219
735 3300049568 Ga0501031_0005610 Ga0501031_0005610_2490_3152 219
736 3300049568 Ga0501031_0035334 Ga0501031_0035334_1489_2151 219
737 3300049568 Ga0501031_0177612 Ga0501031_0177612_340_1002 219
738 3300049569 Ga0501032_0000082 Ga0501032_0000082_38110_38772 219
739 3300049569 Ga0501032_0006363 Ga0501032_0006363_5745_6407 219
740 3300049569 Ga0501032_0077742 Ga0501032_0077742_931_1593 219
741 3300049569 Ga0501032_0163195 Ga0501032_0163195_668_1327 219
742 3300049569 Ga0501032_0242560 Ga0501032_0242560_99_761 219
743 3300049569 Ga0501032_0323449 Ga0501032_0323449_162_824 219
744 3300049569 Ga0501032_0477858 Ga0501032_0477858_33_695 219
745 3300049570 Ga0501033_0000070 Ga0501033_0000070_43512_44174 219
746 3300049570 Ga0501033_0000500 Ga0501033_0000500_1099_1761 219
747 3300049570 Ga0501033_0007653 Ga0501033_0007653_6338_6997 219
748 3300049570 Ga0501033_0016653 Ga0501033_0016653_3004_3666 219
749 3300049570 Ga0501033_0332300 Ga0501033_0332300_162_824 219
750 3300049571 Ga0501034_0000087 Ga0501034_0000087_98802_99464 219
751 3300049571 Ga0501034_0277704 Ga0501034_0277704_50_712 219
752 3300049571 Ga0501034_0500559 Ga0501034_0500559_191_853 219
753 3300049571 Ga0501034_0614244 Ga0501034_0614244_197_856 219
754 3300049572 Ga0501036_0000073 Ga0501036_0000073_2445_3107 219
755 3300049572 Ga0501036_0100265 Ga0501036_0100265_395_1054 219
756 3300049572 Ga0501036_0119383 Ga0501036_0119383_1211_1873 219
757 3300049572 Ga0501036_0297094 Ga0501036_0297094_181_843 219
758 3300049572 Ga0501036_0698783 Ga0501036_0698783_143_805 219
759 3300049573 Ga0501037_0000014 Ga0501037_0000014_71572_72234 219
760 3300049573 Ga0501037_0004549 Ga0501037_0004549_6356_7018 219
761 3300049573 Ga0501037_0407722 Ga0501037_0407722_136_795 219
762 3300049573 Ga0501037_0409883 Ga0501037_0409883_164_826 219
763 3300049574 Ga0501038_0000023 Ga0501038_0000023_52014_52676 219
764 3300049574 Ga0501038_0168640 Ga0501038_0168640_334_996 219
765 3300049575 Ga0501039_0000044 Ga0501039_0000044_39560_40222 219
766 3300049575 Ga0501039_0468183 Ga0501039_0468183_197_856 219
767 3300049579 Ga0501043_0000022 Ga0501043_0000022_101570_102232 219
768 3300049579 Ga0501043_0000088 Ga0501043_0000088_38110_38772 219
769 3300049579 Ga0501043_0017381 Ga0501043_0017381_2712_3374 219
770 3300049579 Ga0501043_0453175 Ga0501043_0453175_108_767 219
771 3300049580 Ga0501046_0012919 Ga0501046_0012919_1959_2621 219
772 3300049580 Ga0501046_0014815 Ga0501046_0014815_5624_6283 219
773 3300049580 Ga0501046_0088424 Ga0501046_0088424_85_747 219
774 3300049581 Ga0501047_0014062 Ga0501047_0014062_5335_5997 219
775 3300049581 Ga0501047_0065071 Ga0501047_0065071_2115_2777 219
776 3300049581 Ga0501047_0087503 Ga0501047_0087503_1270_1932 219
777 3300049581 Ga0501047_0102861 Ga0501047_0102861_1227_1889 219
778 3300049581 Ga0501047_0181467 Ga0501047_0181467_1171_1833 219
779 3300049581 Ga0501047_0400807 Ga0501047_0400807_270_932 219
780 3300049581 Ga0501047_0451074 Ga0501047_0451074_321_980 219
781 3300049581 Ga0501047_0546877 Ga0501047_0546877_136_798 219
782 3300049583 Ga0501067_0022364 Ga0501067_0022364_2736_3398 219
783 3300049584 Ga0501068_0031056 Ga0501068_0031056_582_1244 219
784 3300049584 Ga0501068_0222000 Ga0501068_0222000_15_674 219
785 3300049585 Ga0501069_0000284 Ga0501069_0000284_9130_9792 219
786 3300049585 Ga0501069_0017700 Ga0501069_0017700_2072_2734 219
787 3300049586 Ga0501070_0000103 Ga0501070_0000103_48326_48988 219
788 3300049586 Ga0501070_0007102 Ga0501070_0007102_3014_3676 219
789 3300049586 Ga0501070_0014430 Ga0501070_0014430_180_842 219
790 3300049586 Ga0501070_0152142 Ga0501070_0152142_503_1165 219
791 3300049586 Ga0501070_0246332 Ga0501070_0246332_284_946 219
792 3300049587 Ga0501071_0050853 Ga0501071_0050853_1447_2109 219
793 3300049589 Ga0501073_0016951 Ga0501073_0016951_3671_4333 219
794 3300049589 Ga0501073_0254797 Ga0501073_0254797_461_1123 219
795 3300049589 Ga0501073_0392706 Ga0501073_0392706_70_732 219
796 3300049590 Ga0501074_0001426 Ga0501074_0001426_9693_10355 219
797 3300049590 Ga0501074_0013544 Ga0501074_0013544_1379_2041 219
798 3300049590 Ga0501074_0098204 Ga0501074_0098204_996_1658 219
799 3300049590 Ga0501074_0651818 Ga0501074_0651818_59_721 219
800 3300049741 Ga0501079_0467541 Ga0501079_0467541_87_749 219
801 3300049742 Ga0501080_0035831 Ga0501080_0035831_2778_3440 219
802 3300049742 Ga0501080_0046275 Ga0501080_0046275_2956_3618 219
803 3300049742 Ga0501080_0098650 Ga0501080_0098650_1249_1911 219
804 3300049744 Ga0501083_0000374 Ga0501083_0000374_14422_15084 219
805 3300049822 Ga0501035_0000047 Ga0501035_0000047_77229_77891 219
806 3300049822 Ga0501035_0002644 Ga0501035_0002644_13377_14039 219
807 3300049822 Ga0501035_0002789 Ga0501035_0002789_11566_12228 219
808 3300049822 Ga0501035_0003617 Ga0501035_0003617_13249_13911 219
809 3300049822 Ga0501035_0016993 Ga0501035_0016993_4966_5628 219
810 3300049822 Ga0501035_0044652 Ga0501035_0044652_895_1557 219
811 3300049822 Ga0501035_0128449 Ga0501035_0128449_1077_1739 219
812 3300049822 Ga0501035_0132124 Ga0501035_0132124_121_780 219
813 3300049823 Ga0501044_0003500 Ga0501044_0003500_11348_12010 219
814 3300049823 Ga0501044_0007915 Ga0501044_0007915_8490_9152 219
815 3300049823 Ga0501044_0013751 Ga0501044_0013751_3668_4330 219
816 3300049823 Ga0501044_0048111 Ga0501044_0048111_3502_4164 219
817 3300049823 Ga0501044_0114660 Ga0501044_0114660_700_1362 219
818 3300049823 Ga0501044_0164871 Ga0501044_0164871_136_795 219
819 3300049823 Ga0501044_0197805 Ga0501044_0197805_1196_1858 219
820 3300049823 Ga0501044_0277499 Ga0501044_0277499_364_1026 219
821 3300049823 Ga0501044_0379739 Ga0501044_0379739_251_913 219
822 3300049824 Ga0501045_0300157 Ga0501045_0300157_178_837 219
823 3300050489 nmdc:mga03683_77172_c1 nmdc:mga03683_77172_c1_406_1068 219
824 3300050490 nmdc:mga03n38_183648_c1 nmdc:mga03n38_183648_c1_163_825 219
825 3300050490 nmdc:mga03n38_2998_c1 nmdc:mga03n38_2998_c1_1084_1743 219
826 3300050492 nmdc:mga0yw44_1413_c1 nmdc:mga0yw44_1413_c1_2392_3054 219
827 3300050492 nmdc:mga0yw44_483546_c1 nmdc:mga0yw44_483546_c1_74_736 219
828 3300050492 nmdc:mga0yw44_7220_c1 nmdc:mga0yw44_7220_c1_122_781 219
829 3300050494 nmdc:mga06z11_18329_c1 nmdc:mga06z11_18329_c1_279_941 219
830 3300050494 nmdc:mga06z11_218415_c1 nmdc:mga06z11_218415_c1_397_1059 219
831 3300050494 nmdc:mga06z11_30040_c1 nmdc:mga06z11_30040_c1_491_1156 219
832 3300050494 nmdc:mga06z11_7530_c1 nmdc:mga06z11_7530_c1_2155_2814 219
833 3300050495 nmdc:mga04h51_105845_c1 nmdc:mga04h51_105845_c1_130_792 219
834 3300050516 nmdc:mga0sz30_1456_c1 nmdc:mga0sz30_1456_c1_92_754 219
835 3300053079 Ga0500610_0037028 Ga0500610_0037028_155_817 219
836 3300053083 Ga0495655_0029661 Ga0495655_0029661_145_807 219
837 3300053086 Ga0500578_0096475 Ga0500578_0096475_882_1550 219
838 3300053119 Ga0500595_049433 Ga0500595_049433_228_890 219
839 3300053134 Ga0500658_0150608 Ga0500658_0150608_10_672 219
840 3300053139 Ga0500568_0000209 Ga0500568_0000209_4226_4903 219
841 3300053151 Ga0500604_0015119 Ga0500604_0015119_355_1017 219
842 3300053151 Ga0500604_0117993 Ga0500604_0117993_16_678 219
843 3300053155 Ga0500620_007680 Ga0500620_007680_979_1641 219
844 3300053158 Ga0500627_0072549 Ga0500627_0072549_208_870 219
845 3300053727 Ga0500611_028533 Ga0500611_028533_218_880 219
846 3300053731 Ga0500609_012103 Ga0500609_012103_435_1097 219
847 iso_pu_bacteria 2597489875 2597815180 219
848 iso_pu_bacteria 2643221550 2643774108 219
849 iso_pu_bacteria 2856342000 2856345604 219
850 iso_pu_bacteria 2856349417 2856353688 219
851 iso_pu_bacteria 2876369609 2876376846 219
852 iso_pu_bacteria 2881147464 2881153845 219
853 iso_pu_bacteria 2881155292 2881157627 219
854 iso_pu_bacteria 2881161766 2881162989 219
855 iso_pu_bacteria 2881853255 2881853953 219
856 iso_pu_bacteria 2885305155 2885311780 219
857 iso_pu_bacteria 2885334103 2885340445 219
858 iso_pu_bacteria 2885342637 2885350004 219
859 iso_pu_bacteria 2885350715 2885350819 219
860 iso_pu_bacteria 2888343758 2888348629 219
861 iso_pu_bacteria 2924754689 2924761515 219
862 iso_pu_bacteria 2937836603 2937842738 219
863 iso_pu_bacteria 2937848649 2937850683 219
864 iso_pu_bacteria 2958071322 2958074952 219
865 iso_pu_bacteria 2958172287 2958178260 219
866 iso_pu_bacteria 2970524798 2970529562 219
867 iso_pu_bacteria 2970540015 2970545386 219
868 iso_pu_bacteria 2977858184 2977862213 219
869 iso_pu_bacteria 2977922695 2977927628 219
870 iso_pu_bacteria 2977971508 2977973200 219
871 iso_pu_bacteria 2977986579 2977987676 219
872 iso_pu_bacteria 2979710463 2979717613 219
873 iso_pu_bacteria 2979742915 2979744506 219
874 iso_pu_bacteria 2987652177 2987652214 219
875 iso_pu_bacteria 3004211236 3004214466 219
876 iso_pu_bacteria 3004218560 3004223569 219
877 iso_pu_bacteria 8004633249 8004633795 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

121

231

0.97

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

42

225

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2no4-assembly1.cif.gz_B crystal structure analysis of a dehalogenase 0.9785 3 215
2no5-assembly1.cif.gz_B crystal structure analysis of a dehalogenase with intermediate complex 0.9716 2 215
2no4-assembly1.cif.gz_B crystal structure analysis of a dehalogenase 0.952 3 215
3um9-assembly1.cif.gz_B crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 0.9509 3 217
3umb-assembly1.cif.gz_A-2 crystal structure of the l-2-haloacid dehalogenase rsc1362 0.9501 1 218
ID Description Score Start End Superfamily
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9869 92 215 3.40.50.1000
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9583 3 217 3.40.50.1000
2no5B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9382 17 89 1.10.150.240
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9324 3 217 3.40.50.1000
2w43A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9245 92 217 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A531M6S1-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9978 1 171 GO:0018784
AF-A0A434CLW1-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9952 1 142 GO:0018784
AF-X5R813-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.995 1 218 GO:0018784
AF-A0A345ZV89-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.995 4 217 GO:0018784
AF-A0A7X1HG32-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9944 3 217 GO:0018784

Feature Viewer

pLDDT pTM Quality
95.16 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map