F484401
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 877 | 733 | 349 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300042007|Ga0439449_0002061|Ga0439449_0002061_4091_4870 |
| Length | 259 |
| Sequence | MLWHSVSDAVPQAPARRLLAQNGENLRRADRTVDRRENSMSYAAYVFDAYGTLFDVHAAVRRHADAIGPDGQAFSELWRAKQLEYSWVRSLMGAYVDFWELTEQSLDYAFQRFPSADPGLKKPLLDAYWALDCYPEVPAVLKGLKERGARIAILSNGSPAMLASAVKNAALDIVIDDVFSVDAVKAFKTAPAVYDLVTTSYRLYPQAVSFQSSNRWDIAGATKFGFRTVWINRADGPDEYKDHGPSLILPSLESLQFGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 6 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 7 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 8 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 9 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 10 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 11 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 12 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 13 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 14 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 15 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 16 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 17 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 18 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 19 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 20 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 21 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 22 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 23 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 24 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 25 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 26 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 27 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 28 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 29 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 30 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 31 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 32 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 33 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 34 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 35 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 36 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 37 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 38 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 39 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 40 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 41 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 42 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 43 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 44 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 45 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 46 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 47 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 48 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 49 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 50 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 51 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 52 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 53 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 54 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 55 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 56 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 57 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 58 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 59 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 60 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 61 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 62 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 63 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 64 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 65 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 66 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 67 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 68 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 69 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 70 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 71 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 72 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 73 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 74 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 75 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 76 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 77 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 78 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 79 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 80 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 81 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 82 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 83 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 84 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 85 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 86 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 87 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 88 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 89 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 90 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 91 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 92 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 93 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 94 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 95 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 96 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 97 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 98 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 99 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 100 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 101 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 102 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 103 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 104 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 105 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 106 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 107 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 108 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 109 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 110 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 111 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 112 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 113 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 114 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 115 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 116 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 117 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 118 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 119 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 120 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 121 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 122 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 123 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 124 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 125 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 126 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 127 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 128 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 129 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 130 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 131 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 132 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 133 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 134 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 135 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 136 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 137 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 138 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 139 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 140 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 141 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 142 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 143 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 144 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 145 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 146 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 147 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 148 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 149 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 150 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 151 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 152 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 153 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 154 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 155 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 156 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 157 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 158 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 159 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 160 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 161 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 162 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 163 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 164 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 165 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 166 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 167 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 168 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 169 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 170 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 171 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 172 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 173 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 174 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 175 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 176 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 177 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 178 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 179 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 180 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 181 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 182 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 183 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 184 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 185 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 186 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 187 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 188 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 189 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 190 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 191 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 192 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 193 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 194 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 195 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 196 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 197 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 198 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 199 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 200 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 201 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 202 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 203 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 204 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 205 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 206 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 207 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 208 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 209 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 210 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 211 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 212 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 213 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 214 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 215 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 216 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 217 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 218 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 219 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 220 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 221 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 222 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 223 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 224 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 225 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 226 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 227 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 228 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 229 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 230 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 231 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 232 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 233 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 234 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 235 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 236 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 237 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 238 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 239 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 240 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 241 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 242 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 243 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 244 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 245 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 246 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 247 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 248 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 249 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 250 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 251 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 252 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 253 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 254 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 255 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 256 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 257 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 258 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 259 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 260 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 261 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 262 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 263 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 264 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 265 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 266 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 267 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 268 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 269 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 270 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 271 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 272 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 273 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 274 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 275 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 276 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 277 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 278 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 279 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 280 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 281 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 282 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 283 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 284 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 285 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 286 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 287 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 288 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 289 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 290 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 291 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 292 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 293 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 294 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 295 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 296 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 297 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 298 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 299 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 300 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 301 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 302 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 303 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 304 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 305 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 306 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 307 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 308 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 309 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 310 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 311 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 312 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 313 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 314 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 315 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 316 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 317 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 318 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 319 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 320 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 321 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 322 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 323 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 324 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 325 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 326 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 327 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 328 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 329 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 330 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 331 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 332 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 333 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 334 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 335 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 336 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 337 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 338 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 339 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 340 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 341 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 342 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 343 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 344 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 345 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 346 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 347 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 348 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 349 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 350 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 351 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 352 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 353 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 354 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 355 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 356 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 357 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 358 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 359 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 360 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 361 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 362 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 363 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 364 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 365 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 366 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 367 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 368 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 369 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 370 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 371 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 372 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 373 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 374 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 375 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 376 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 377 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 378 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 379 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 380 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 381 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 382 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 383 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 384 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 385 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 386 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 387 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 388 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 389 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 390 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 391 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 392 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 393 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 394 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 395 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 396 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 397 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 398 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 399 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 400 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 401 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 402 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 403 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 404 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 405 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 406 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 407 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 408 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 409 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 410 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 411 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 412 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 413 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 414 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 415 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 416 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 417 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 418 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 419 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 420 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 421 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 422 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 423 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 424 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 425 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 426 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 427 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 428 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 429 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 430 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 431 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 432 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 433 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 434 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 435 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 436 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 437 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 438 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 439 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 440 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 441 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 442 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 443 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 444 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 445 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 446 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 447 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 448 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 449 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 450 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 451 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 452 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 453 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 454 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 455 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 456 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 457 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 458 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 459 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 460 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 461 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 462 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 463 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 464 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 465 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 466 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 467 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 468 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 469 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 470 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 471 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 472 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 473 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 474 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 475 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 476 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 477 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 478 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 479 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 480 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 481 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 482 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 483 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 484 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 485 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 486 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 487 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 488 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 489 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 490 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 491 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 492 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 493 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 494 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 495 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 496 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 497 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 498 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 499 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 500 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 501 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 502 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 503 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 504 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 505 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 506 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 507 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 508 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 509 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 510 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 511 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 512 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 513 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 514 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 515 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 516 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 517 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 518 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 519 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 520 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 521 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 522 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 523 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 524 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 525 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 526 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 527 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 528 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 529 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 530 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 531 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 532 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 533 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 534 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 535 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 536 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 537 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 538 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 539 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 540 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 541 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 542 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 543 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 544 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 545 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 546 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 547 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 548 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 549 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 550 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 551 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 552 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 553 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 554 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 555 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 556 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 557 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 558 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 559 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 560 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 561 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 562 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 563 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 564 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 565 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 566 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 567 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 568 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 569 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 570 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 571 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 572 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 573 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 574 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 584 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 589 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 590 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 591 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 592 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 593 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 594 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 595 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 596 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 597 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 598 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 599 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 600 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 601 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 602 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 603 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 604 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 605 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 606 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 607 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 608 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 609 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 610 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 611 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 612 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 613 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 614 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 615 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 616 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 617 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 618 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 619 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 620 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 621 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 622 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 623 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 624 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 625 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 626 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 627 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 628 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 629 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 630 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 631 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 632 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 633 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 645 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 646 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 647 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 648 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 649 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 650 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 651 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 652 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 653 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 654 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 655 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 656 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 657 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 658 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 659 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 660 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 661 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 662 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 663 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 664 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 665 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 666 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 667 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 668 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 669 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 670 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 671 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 672 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 673 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 674 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 675 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 676 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 677 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 678 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 679 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 680 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 681 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 682 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 683 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 684 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 685 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 686 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 687 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 688 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 689 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 690 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 691 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 692 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 693 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 694 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 695 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 696 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 697 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 698 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 700 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 701 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 702 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 703 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 704 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 705 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 706 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 707 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 708 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 709 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 710 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 711 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 712 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 713 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 714 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 715 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 716 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 717 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 718 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 719 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 720 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 721 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 722 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 723 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 724 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 725 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 726 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 727 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 728 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 729 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 730 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 731 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 732 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 733 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 39.79 |
| Metatranscriptomes | 0 |
| Isolates | 60.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.41 |
| Nodule | 51.2 |
| Rhizoplane | 1.25 |
| Rhizosphere | 28.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009030 | 3300001979 | Bacteria | 3926 |
| 2 | JGI25158J39367_1001337 | 3300002739 | Bacteria | 4356 |
| 3 | JGI25159J45721_1000001 | 3300002987 | Bacteria | 303489 |
| 4 | JGI25151J46595_10008750 | 3300003187 | Bacteria | 4839 |
| 5 | JGI25151J46595_10025779 | 3300003187 | Bacteria | 2385 |
| 6 | JGI25165J46597_1000016 | 3300003214 | Bacteria | 377866 |
| 7 | rootH2_10339468 | 3300003320 | Bacteria | 1109 |
| 8 | JGI25160J50197_1000002 | 3300003354 | Bacteria | 561707 |
| 9 | Ga0055542_1004234 | 3300003762 | Bacteria | 3557 |
| 10 | Ga0055529_1006934 | 3300003763 | Bacteria | 1557 |
| 11 | Ga0055526_1001867 | 3300003771 | Bacteria | 14584 |
| 12 | Ga0055524_1000777 | 3300003775 | Bacteria | 21429 |
| 13 | Ga0055524_1024254 | 3300003775 | Bacteria | 1929 |
| 14 | Ga0055530_10040496 | 3300003791 | Bacteria | 1143 |
| 15 | Ga0055531_10031987 | 3300003794 | Bacteria | 1729 |
| 16 | Ga0055543_1000057 | 3300004625 | Bacteria | 102841 |
| 17 | Ga0065165_1000004 | 3300005262 | Bacteria | 377081 |
| 18 | Ga0070658_10391926 | 3300005327 | Bacteria | 1192 |
| 19 | Ga0070666_10095281 | 3300005335 | Bacteria | 2048 |
| 20 | Ga0070668_100298989 | 3300005347 | Bacteria | 1349 |
| 21 | Ga0070674_100184160 | 3300005356 | Bacteria | 1602 |
| 22 | Ga0070667_100430374 | 3300005367 | Bacteria | 1204 |
| 23 | Ga0070663_100110541 | 3300005455 | Bacteria | 2064 |
| 24 | Ga0070663_100645646 | 3300005455 | Bacteria | 894 |
| 25 | Ga0070678_100832481 | 3300005456 | Bacteria | 840 |
| 26 | Ga0068853_100043464 | 3300005539 | Bacteria | 3844 |
| 27 | Ga0070665_100034072 | 3300005548 | Bacteria | 5121 |
| 28 | Ga0070665_100471005 | 3300005548 | Bacteria | 1266 |
| 29 | Ga0068855_100162571 | 3300005563 | Bacteria | 2533 |
| 30 | Ga0070664_100750651 | 3300005564 | Bacteria | 911 |
| 31 | Ga0068857_100104451 | 3300005577 | Bacteria | 2543 |
| 32 | Ga0081455_10018339 | 3300005937 | Bacteria | 6670 |
| 33 | Ga0081540_1023624 | 3300005983 | Bacteria | 3590 |
| 34 | Ga0075365_10004422 | 3300006038 | Bacteria | 7442 |
| 35 | Ga0075365_10012641 | 3300006038 | Bacteria | 5022 |
| 36 | Ga0075363_100012543 | 3300006048 | Bacteria | 4091 |
| 37 | Ga0075363_100213756 | 3300006048 | Bacteria | 1104 |
| 38 | Ga0075362_10027138 | 3300006177 | Bacteria | 2450 |
| 39 | Ga0075362_10028394 | 3300006177 | Bacteria | 2403 |
| 40 | Ga0075367_10019586 | 3300006178 | Bacteria | 3754 |
| 41 | Ga0075369_10119954 | 3300006186 | Bacteria | 1190 |
| 42 | Ga0075370_10026164 | 3300006353 | Bacteria | 3231 |
| 43 | Ga0075370_10077522 | 3300006353 | Bacteria | 1907 |
| 44 | Ga0079104_1007485 | 3300006946 | Bacteria | 3950 |
| 45 | Ga0079104_1014594 | 3300006946 | Bacteria | 2364 |
| 46 | Ga0105240_10026413 | 3300009093 | Bacteria | 7617 |
| 47 | Ga0105240_10281473 | 3300009093 | Bacteria | 1910 |
| 48 | Ga0105237_10031482 | 3300009545 | Bacteria | 5378 |
| 49 | Ga0105237_10077156 | 3300009545 | Bacteria | 3322 |
| 50 | Ga0105237_10163975 | 3300009545 | Bacteria | 2221 |
| 51 | Ga0105237_10294357 | 3300009545 | Bacteria | 1626 |
| 52 | Ga0105238_10011809 | 3300009551 | Bacteria | 8800 |
| 53 | Ga0105239_10044001 | 3300010375 | Bacteria | 4895 |
| 54 | Ga0105239_10076181 | 3300010375 | Bacteria | 3689 |
| 55 | Ga0105239_10150471 | 3300010375 | Bacteria | 2598 |
| 56 | Ga0105239_10466871 | 3300010375 | Bacteria | 1433 |
| 57 | Ga0157370_10607504 | 3300013104 | Bacteria | 1001 |
| 58 | Ga0157369_10276630 | 3300013105 | Bacteria | 1749 |
| 59 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 60 | Ga0157374_10564917 | 3300013296 | Bacteria | 1146 |
| 61 | Ga0157378_10680137 | 3300013297 | Bacteria | 1047 |
| 62 | Ga0157372_10668351 | 3300013307 | Bacteria | 1209 |
| 63 | Ga0182008_10128964 | 3300014497 | Bacteria | 1260 |
| 64 | Ga0183363_1045 | 3300015690 | Bacteria | 40670 |
| 65 | Ga0214544_1000008 | 3300021320 | Bacteria | 326027 |
| 66 | Ga0214542_1000010 | 3300021321 | Bacteria | 262816 |
| 67 | Ga0214542_1015383 | 3300021321 | Bacteria | 8011 |
| 68 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 69 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 70 | Ga0228711_1000001 | 3300022739 | Bacteria | 357377 |
| 71 | Ga0228710_1000001 | 3300022740 | Bacteria | 314328 |
| 72 | Ga0209436_100122 | 3300025208 | Bacteria | 38333 |
| 73 | Ga0209563_105116 | 3300025230 | Bacteria | 2416 |
| 74 | Ga0209646_1011896 | 3300025246 | Bacteria | 1341 |
| 75 | Ga0209026_1000005 | 3300025250 | Bacteria | 731387 |
| 76 | Ga0209148_1000056 | 3300025254 | Bacteria | 363380 |
| 77 | Ga0209759_1000631 | 3300025256 | Bacteria | 33354 |
| 78 | Ga0209233_1000068 | 3300025261 | Bacteria | 377969 |
| 79 | Ga0209455_1000238 | 3300025272 | Bacteria | 68798 |
| 80 | Ga0209130_1000008 | 3300025284 | Bacteria | 581232 |
| 81 | Ga0209676_1002258 | 3300025292 | Bacteria | 14147 |
| 82 | Ga0209025_1000100 | 3300025294 | Bacteria | 229182 |
| 83 | Ga0209025_1000165 | 3300025294 | Bacteria | 164692 |
| 84 | Ga0209564_1000104 | 3300025295 | Bacteria | 219017 |
| 85 | Ga0209758_1005808 | 3300025297 | Bacteria | 9249 |
| 86 | Ga0209050_1015813 | 3300025298 | Bacteria | 3138 |
| 87 | Ga0209256_1000652 | 3300025299 | Bacteria | 47238 |
| 88 | Ga0209256_1002322 | 3300025299 | Bacteria | 15924 |
| 89 | Ga0207426_1000016 | 3300025302 | Bacteria | 581232 |
| 90 | Ga0207680_10098509 | 3300025903 | Bacteria | 1874 |
| 91 | Ga0207647_10053502 | 3300025904 | Bacteria | 2487 |
| 92 | Ga0207645_10077952 | 3300025907 | Bacteria | 2123 |
| 93 | Ga0207695_10333569 | 3300025913 | Bacteria | 1405 |
| 94 | Ga0207695_10824141 | 3300025913 | Bacteria | 808 |
| 95 | Ga0207671_10012030 | 3300025914 | Bacteria | 6990 |
| 96 | Ga0207671_10058466 | 3300025914 | Bacteria | 2858 |
| 97 | Ga0207671_10178806 | 3300025914 | Bacteria | 1650 |
| 98 | Ga0207657_10050734 | 3300025919 | Bacteria | 3609 |
| 99 | Ga0207694_10051200 | 3300025924 | Bacteria | 3200 |
| 100 | Ga0207694_10445342 | 3300025924 | Bacteria | 1081 |
| 101 | Ga0207706_10174245 | 3300025933 | Bacteria | 1890 |
| 102 | Ga0207669_10149290 | 3300025937 | Bacteria | 1635 |
| 103 | Ga0207691_10293169 | 3300025940 | Bacteria | 1399 |
| 104 | Ga0207668_10388562 | 3300025972 | Bacteria | 1177 |
| 105 | Ga0207639_10069737 | 3300026041 | Bacteria | 2743 |
| 106 | Ga0207678_10149256 | 3300026067 | Bacteria | 1996 |
| 107 | Ga0207674_10098525 | 3300026116 | Bacteria | 2907 |
| 108 | Ga0209281_1000164 | 3300027111 | Bacteria | 157372 |
| 109 | Ga0209281_1000626 | 3300027111 | Bacteria | 39130 |
| 110 | Ga0209282_1000007 | 3300027666 | Bacteria | 254917 |
| 111 | Ga0268266_10293056 | 3300028379 | Bacteria | 1516 |
| 112 | Ga0307515_10000420 | 3300028794 | Bacteria | 102216 |
| 113 | Ga0307515_10039061 | 3300028794 | Bacteria | 7565 |
| 114 | Ga0265330_10123466 | 3300031235 | Bacteria | 1103 |
| 115 | Ga0265325_10039985 | 3300031241 | Bacteria | 2465 |
| 116 | Ga0265325_10041422 | 3300031241 | Bacteria | 2413 |
| 117 | Ga0265340_10001536 | 3300031247 | Bacteria | 13246 |
| 118 | Ga0265340_10012513 | 3300031247 | Bacteria | 4478 |
| 119 | Ga0265340_10071750 | 3300031247 | Bacteria | 1641 |
| 120 | Ga0265339_10004396 | 3300031249 | Bacteria | 9613 |
| 121 | Ga0265339_10089722 | 3300031249 | Bacteria | 1613 |
| 122 | Ga0265339_10130413 | 3300031249 | Bacteria | 1286 |
| 123 | Ga0265316_10028899 | 3300031344 | Bacteria | 4566 |
| 124 | Ga0307513_10004196 | 3300031456 | Bacteria | 19276 |
| 125 | Ga0307408_100024952 | 3300031548 | Bacteria | 4089 |
| 126 | Ga0265313_10001426 | 3300031595 | Bacteria | 22387 |
| 127 | Ga0265313_10012669 | 3300031595 | Bacteria | 5125 |
| 128 | Ga0265314_10032908 | 3300031711 | Bacteria | 3808 |
| 129 | Ga0265342_10003927 | 3300031712 | Bacteria | 11938 |
| 130 | Ga0265342_10018567 | 3300031712 | Bacteria | 4501 |
| 131 | Ga0307406_10085121 | 3300031901 | Bacteria | 2113 |
| 132 | Ga0307412_10144470 | 3300031911 | Bacteria | 1747 |
| 133 | Ga0315914_1000006 | 3300031967 | Bacteria | 239817 |
| 134 | Ga0307409_100337798 | 3300031995 | Bacteria | 1416 |
| 135 | Ga0307416_100107466 | 3300032002 | Bacteria | 2449 |
| 136 | Ga0307416_101015167 | 3300032002 | Bacteria | 933 |
| 137 | Ga0315913_1000002 | 3300033430 | Bacteria | 241452 |
| 138 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 139 | Ga0316574_0520552 | 3300035398 | Bacteria | 740 |
| 140 | Ga0373931_0166482 | 3300035691 | Bacteria | 1296 |
| 141 | Ga0373935_0285059 | 3300035692 | Bacteria | 1164 |
| 142 | Ga0316582_0070662 | 3300036647 | Bacteria | 2259 |
| 143 | Ga0316584_0079499 | 3300036712 | Bacteria | 2457 |
| 144 | Ga0395900_0084548 | 3300037418 | Bacteria | 3261 |
| 145 | Ga0395900_0338598 | 3300037418 | Bacteria | 1480 |
| 146 | Ga0395898_0063483 | 3300037466 | Bacteria | 3584 |
| 147 | Ga0395898_0339865 | 3300037466 | Bacteria | 1432 |
| 148 | Ga0395905_0101818 | 3300037471 | Bacteria | 2696 |
| 149 | Ga0436364_1041655 | 3300037853 | Bacteria | 11173 |
| 150 | Ga0395901_0037442 | 3300038443 | Bacteria | 5017 |
| 151 | Ga0395901_0041612 | 3300038443 | Bacteria | 4763 |
| 152 | Ga0439461_0068124 | 3300041410 | Bacteria | 820 |
| 153 | Ga0439466_0092196 | 3300041411 | Bacteria | 949 |
| 154 | Ga0439465_0044479 | 3300041413 | Bacteria | 1443 |
| 155 | Ga0439442_066542 | 3300042002 | Bacteria | 766 |
| 156 | Ga0439432_081424 | 3300042006 | Bacteria | 980 |
| 157 | Ga0439449_0002061 | 3300042007 | Bacteria | 7913 |
| 158 | Ga0439462_0031769 | 3300042015 | Bacteria | 1399 |
| 159 | Ga0450906_026455 | 3300042145 | Bacteria | 1030 |
| 160 | Ga0450910_005161 | 3300042147 | Bacteria | 1778 |
| 161 | Ga0439458_0093151 | 3300042157 | Bacteria | 777 |
| 162 | Ga0450918_007376 | 3300042531 | Bacteria | 1946 |
| 163 | Ga0466972_0092202 | 3300044658 | Bacteria | 1436 |
| 164 | Ga0466972_0230596 | 3300044658 | Bacteria | 866 |
| 165 | Ga0466965_0237206 | 3300044683 | Bacteria | 976 |
| 166 | Ga0466960_0081836 | 3300044901 | Bacteria | 1629 |
| 167 | Ga0495638_0098581 | 3300046460 | Bacteria | 1751 |
| 168 | Ga0495585_0252728 | 3300046492 | Bacteria | 879 |
| 169 | Ga0495606_0053804 | 3300046507 | Bacteria | 2610 |
| 170 | Ga0495632_0048643 | 3300046519 | Bacteria | 2099 |
| 171 | Ga0495643_0070648 | 3300046522 | Bacteria | 1833 |
| 172 | Ga0495668_0044581 | 3300046616 | Bacteria | 2465 |
| 173 | Ga0495625_0021781 | 3300046660 | Bacteria | 4925 |
| 174 | Ga0495588_0099043 | 3300046674 | Bacteria | 1531 |
| 175 | Ga0495687_020699 | 3300047443 | Bacteria | 3202 |
| 176 | Ga0495602_0249634 | 3300048088 | Bacteria | 1323 |
| 177 | Ga0495602_0443161 | 3300048088 | Bacteria | 918 |
| 178 | Ga0495626_0056117 | 3300048091 | Bacteria | 1804 |
| 179 | Ga0496102_0831960 | 3300048905 | Bacteria | 845 |
| 180 | Ga0496104_0396809 | 3300048907 | Bacteria | 1292 |
| 181 | Ga0496105_0063843 | 3300048908 | Bacteria | 3039 |
| 182 | Ga0496110_0196310 | 3300048913 | Bacteria | 1833 |
| 183 | Ga0496110_0407293 | 3300048913 | Bacteria | 1240 |
| 184 | Ga0496112_0015726 | 3300048915 | Bacteria | 7068 |
| 185 | Ga0496112_0260718 | 3300048915 | Bacteria | 1683 |
| 186 | Ga0496113_0221816 | 3300048916 | Bacteria | 1507 |
| 187 | Ga0496114_0200085 | 3300048917 | Bacteria | 1750 |
| 188 | Ga0496117_0002204 | 3300048920 | Bacteria | 25295 |
| 189 | Ga0496118_0046814 | 3300048921 | Bacteria | 3360 |
| 190 | Ga0496120_0052491 | 3300048923 | Bacteria | 2322 |
| 191 | Ga0496121_0153319 | 3300048924 | Bacteria | 1693 |
| 192 | Ga0496122_0004346 | 3300048925 | Bacteria | 17714 |
| 193 | Ga0496122_0076809 | 3300048925 | Bacteria | 2348 |
| 194 | Ga0496123_0000103 | 3300048926 | Bacteria | 168232 |
| 195 | Ga0496123_0026920 | 3300048926 | Bacteria | 4295 |
| 196 | Ga0496124_0005072 | 3300048927 | Bacteria | 15019 |
| 197 | Ga0496124_0122222 | 3300048927 | Bacteria | 2079 |
| 198 | Ga0496125_0000879 | 3300048928 | Bacteria | 47630 |
| 199 | Ga0496125_0039027 | 3300048928 | Bacteria | 4098 |
| 200 | Ga0496126_0001336 | 3300048929 | Bacteria | 39105 |
| 201 | Ga0496126_0012132 | 3300048929 | Bacteria | 8846 |
| 202 | Ga0496126_0092384 | 3300048929 | Bacteria | 2659 |
| 203 | Ga0501290_000163 | 3300049513 | Bacteria | 10717 |
| 204 | Ga0501031_0005610 | 3300049568 | Bacteria | 8176 |
| 205 | Ga0501031_0035334 | 3300049568 | Bacteria | 3260 |
| 206 | Ga0501031_0177612 | 3300049568 | Bacteria | 1391 |
| 207 | Ga0501032_0000082 | 3300049569 | Bacteria | 82284 |
| 208 | Ga0501032_0006363 | 3300049569 | Bacteria | 8705 |
| 209 | Ga0501032_0077742 | 3300049569 | Bacteria | 2209 |
| 210 | Ga0501032_0163195 | 3300049569 | Bacteria | 1462 |
| 211 | Ga0501032_0242560 | 3300049569 | Bacteria | 1171 |
| 212 | Ga0501032_0323449 | 3300049569 | Bacteria | 995 |
| 213 | Ga0501032_0477858 | 3300049569 | Bacteria | 797 |
| 214 | Ga0501033_0000070 | 3300049570 | Bacteria | 97795 |
| 215 | Ga0501033_0000500 | 3300049570 | Bacteria | 36912 |
| 216 | Ga0501033_0000503 | 3300049570 | Bacteria | 36753 |
| 217 | Ga0501033_0007653 | 3300049570 | Bacteria | 8392 |
| 218 | Ga0501033_0016653 | 3300049570 | Bacteria | 5560 |
| 219 | Ga0501033_0111103 | 3300049570 | Bacteria | 1994 |
| 220 | Ga0501033_0332300 | 3300049570 | Bacteria | 1066 |
| 221 | Ga0501034_0000087 | 3300049571 | Bacteria | 166714 |
| 222 | Ga0501034_0277704 | 3300049571 | Bacteria | 1615 |
| 223 | Ga0501034_0500559 | 3300049571 | Bacteria | 1129 |
| 224 | Ga0501034_0614244 | 3300049571 | Bacteria | 991 |
| 225 | Ga0501034_0620168 | 3300049571 | Bacteria | 985 |
| 226 | Ga0501036_0000073 | 3300049572 | Bacteria | 61346 |
| 227 | Ga0501036_0100265 | 3300049572 | Bacteria | 2449 |
| 228 | Ga0501036_0119383 | 3300049572 | Bacteria | 2227 |
| 229 | Ga0501036_0167658 | 3300049572 | Bacteria | 1850 |
| 230 | Ga0501036_0297094 | 3300049572 | Bacteria | 1351 |
| 231 | Ga0501036_0698783 | 3300049572 | Bacteria | 838 |
| 232 | Ga0501037_0000014 | 3300049573 | Bacteria | 171015 |
| 233 | Ga0501037_0004549 | 3300049573 | Bacteria | 10085 |
| 234 | Ga0501037_0117480 | 3300049573 | Bacteria | 1914 |
| 235 | Ga0501037_0322388 | 3300049573 | Bacteria | 1069 |
| 236 | Ga0501037_0328514 | 3300049573 | Bacteria | 1058 |
| 237 | Ga0501037_0407722 | 3300049573 | Bacteria | 931 |
| 238 | Ga0501037_0409883 | 3300049573 | Bacteria | 929 |
| 239 | Ga0501038_0000023 | 3300049574 | Bacteria | 151469 |
| 240 | Ga0501038_0024807 | 3300049574 | Bacteria | 5345 |
| 241 | Ga0501038_0168640 | 3300049574 | Bacteria | 1774 |
| 242 | Ga0501039_0000044 | 3300049575 | Bacteria | 108828 |
| 243 | Ga0501039_0317168 | 3300049575 | Bacteria | 1225 |
| 244 | Ga0501039_0468183 | 3300049575 | Bacteria | 989 |
| 245 | Ga0501043_0000022 | 3300049579 | Bacteria | 154467 |
| 246 | Ga0501043_0000088 | 3300049579 | Bacteria | 82282 |
| 247 | Ga0501043_0017381 | 3300049579 | Bacteria | 5640 |
| 248 | Ga0501043_0291265 | 3300049579 | Bacteria | 1249 |
| 249 | Ga0501043_0453175 | 3300049579 | Bacteria | 963 |
| 250 | Ga0501046_0012919 | 3300049580 | Bacteria | 7099 |
| 251 | Ga0501046_0014815 | 3300049580 | Bacteria | 6563 |
| 252 | Ga0501046_0088424 | 3300049580 | Bacteria | 2386 |
| 253 | Ga0501047_0006539 | 3300049581 | Bacteria | 10972 |
| 254 | Ga0501047_0014062 | 3300049581 | Bacteria | 7606 |
| 255 | Ga0501047_0065071 | 3300049581 | Bacteria | 3515 |
| 256 | Ga0501047_0087503 | 3300049581 | Bacteria | 2993 |
| 257 | Ga0501047_0102861 | 3300049581 | Bacteria | 2736 |
| 258 | Ga0501047_0163561 | 3300049581 | Bacteria | 2096 |
| 259 | Ga0501047_0181467 | 3300049581 | Bacteria | 1971 |
| 260 | Ga0501047_0242905 | 3300049581 | Bacteria | 1651 |
| 261 | Ga0501047_0400807 | 3300049581 | Bacteria | 1205 |
| 262 | Ga0501047_0451074 | 3300049581 | Bacteria | 1115 |
| 263 | Ga0501047_0546877 | 3300049581 | Bacteria | 982 |
| 264 | Ga0501067_0022364 | 3300049583 | Bacteria | 3499 |
| 265 | Ga0501068_0031056 | 3300049584 | Bacteria | 3172 |
| 266 | Ga0501068_0222000 | 3300049584 | Bacteria | 1201 |
| 267 | Ga0501069_0000284 | 3300049585 | Bacteria | 23001 |
| 268 | Ga0501069_0017700 | 3300049585 | Bacteria | 3840 |
| 269 | Ga0501070_0000103 | 3300049586 | Bacteria | 74597 |
| 270 | Ga0501070_0007102 | 3300049586 | Bacteria | 9521 |
| 271 | Ga0501070_0014430 | 3300049586 | Bacteria | 6648 |
| 272 | Ga0501070_0134743 | 3300049586 | Bacteria | 2039 |
| 273 | Ga0501070_0152142 | 3300049586 | Bacteria | 1909 |
| 274 | Ga0501070_0246332 | 3300049586 | Bacteria | 1462 |
| 275 | Ga0501070_0367885 | 3300049586 | Bacteria | 1166 |
| 276 | Ga0501071_0050853 | 3300049587 | Bacteria | 2985 |
| 277 | Ga0501073_0016951 | 3300049589 | Bacteria | 5276 |
| 278 | Ga0501073_0062094 | 3300049589 | Bacteria | 2606 |
| 279 | Ga0501073_0081812 | 3300049589 | Bacteria | 2246 |
| 280 | Ga0501073_0254797 | 3300049589 | Bacteria | 1211 |
| 281 | Ga0501073_0392706 | 3300049589 | Bacteria | 958 |
| 282 | Ga0501074_0001426 | 3300049590 | Bacteria | 15945 |
| 283 | Ga0501074_0013544 | 3300049590 | Bacteria | 5928 |
| 284 | Ga0501074_0098204 | 3300049590 | Bacteria | 2096 |
| 285 | Ga0501074_0651818 | 3300049590 | Bacteria | 744 |
| 286 | Ga0501202_018881 | 3300049652 | Bacteria | 1358 |
| 287 | Ga0501222_001521 | 3300049662 | Bacteria | 3241 |
| 288 | Ga0501223_001150 | 3300049663 | Bacteria | 6232 |
| 289 | Ga0501224_006556 | 3300049664 | Bacteria | 1688 |
| 290 | Ga0501079_0467541 | 3300049741 | Bacteria | 991 |
| 291 | Ga0501080_0035831 | 3300049742 | Bacteria | 4631 |
| 292 | Ga0501080_0046275 | 3300049742 | Bacteria | 4051 |
| 293 | Ga0501080_0098650 | 3300049742 | Bacteria | 2711 |
| 294 | Ga0501080_0147726 | 3300049742 | Bacteria | 2173 |
| 295 | Ga0501080_0255827 | 3300049742 | Bacteria | 1596 |
| 296 | Ga0501080_0365547 | 3300049742 | Bacteria | 1301 |
| 297 | Ga0501083_0000374 | 3300049744 | Bacteria | 28288 |
| 298 | Ga0501280_000010 | 3300049776 | Bacteria | 63153 |
| 299 | Ga0501282_001568 | 3300049778 | Bacteria | 2526 |
| 300 | Ga0501035_0000047 | 3300049822 | Bacteria | 146497 |
| 301 | Ga0501035_0002644 | 3300049822 | Bacteria | 17442 |
| 302 | Ga0501035_0002789 | 3300049822 | Bacteria | 16895 |
| 303 | Ga0501035_0003617 | 3300049822 | Bacteria | 14753 |
| 304 | Ga0501035_0016993 | 3300049822 | Bacteria | 6705 |
| 305 | Ga0501035_0020300 | 3300049822 | Bacteria | 6099 |
| 306 | Ga0501035_0044652 | 3300049822 | Bacteria | 3990 |
| 307 | Ga0501035_0128449 | 3300049822 | Bacteria | 2211 |
| 308 | Ga0501035_0132124 | 3300049822 | Bacteria | 2175 |
| 309 | Ga0501035_0132746 | 3300049822 | Bacteria | 2169 |
| 310 | Ga0501044_0003500 | 3300049823 | Bacteria | 17677 |
| 311 | Ga0501044_0007915 | 3300049823 | Bacteria | 11686 |
| 312 | Ga0501044_0013751 | 3300049823 | Bacteria | 8747 |
| 313 | Ga0501044_0048111 | 3300049823 | Bacteria | 4407 |
| 314 | Ga0501044_0114660 | 3300049823 | Bacteria | 2700 |
| 315 | Ga0501044_0164871 | 3300049823 | Bacteria | 2190 |
| 316 | Ga0501044_0165646 | 3300049823 | Bacteria | 2184 |
| 317 | Ga0501044_0197805 | 3300049823 | Bacteria | 1969 |
| 318 | Ga0501044_0277499 | 3300049823 | Bacteria | 1610 |
| 319 | Ga0501044_0329332 | 3300049823 | Bacteria | 1450 |
| 320 | Ga0501044_0379739 | 3300049823 | Bacteria | 1328 |
| 321 | Ga0501044_0521416 | 3300049823 | Bacteria | 1088 |
| 322 | Ga0501045_0300157 | 3300049824 | Bacteria | 1195 |
| 323 | nmdc:mga03683_77172_c1 | 3300050489 | Bacteria | 1433 |
| 324 | nmdc:mga03n38_183648_c1 | 3300050490 | Bacteria | 1073 |
| 325 | nmdc:mga03n38_2998_c1 | 3300050490 | Bacteria | 5340 |
| 326 | nmdc:mga0yw44_1413_c1 | 3300050492 | Bacteria | 9522 |
| 327 | nmdc:mga0yw44_483546_c1 | 3300050492 | Bacteria | 840 |
| 328 | nmdc:mga0yw44_7220_c1 | 3300050492 | Bacteria | 5445 |
| 329 | nmdc:mga06z11_18329_c1 | 3300050494 | Bacteria | 3196 |
| 330 | nmdc:mga06z11_218415_c1 | 3300050494 | Bacteria | 1113 |
| 331 | nmdc:mga06z11_30040_c1 | 3300050494 | Bacteria | 2625 |
| 332 | nmdc:mga06z11_7530_c1 | 3300050494 | Bacteria | 4487 |
| 333 | nmdc:mga04h51_105845_c1 | 3300050495 | Bacteria | 1031 |
| 334 | nmdc:mga0sz30_1456_c1 | 3300050516 | Bacteria | 1103 |
| 335 | Ga0500610_0037028 | 3300053079 | Bacteria | 2510 |
| 336 | Ga0495655_0029661 | 3300053083 | Bacteria | 1317 |
| 337 | Ga0500578_0096475 | 3300053086 | Bacteria | 1874 |
| 338 | Ga0500643_000356 | 3300053087 | Bacteria | 36357 |
| 339 | Ga0500595_049433 | 3300053119 | Bacteria | 1310 |
| 340 | Ga0500658_0150608 | 3300053134 | Bacteria | 1048 |
| 341 | Ga0500568_0000209 | 3300053139 | Bacteria | 51143 |
| 342 | Ga0500604_0015119 | 3300053151 | Bacteria | 2109 |
| 343 | Ga0500604_0117993 | 3300053151 | Bacteria | 885 |
| 344 | Ga0500620_007680 | 3300053155 | Bacteria | 2680 |
| 345 | Ga0500624_036798 | 3300053157 | Bacteria | 865 |
| 346 | Ga0500627_0072549 | 3300053158 | Bacteria | 1526 |
| 347 | Ga0500611_028533 | 3300053727 | Bacteria | 1134 |
| 348 | Ga0500609_012103 | 3300053731 | Bacteria | 1167 |
| 349 | Ga0501082_0064688 | 3300060353 | Bacteria | 3150 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2979764755 | 2979770872 | 211 |
| 2 | 3300031241 | Ga0265325_10039985 | Ga0265325_100399851 | 212 |
| 3 | 3300031247 | Ga0265340_10012513 | Ga0265340_100125133 | 212 |
| 4 | 3300031249 | Ga0265339_10089722 | Ga0265339_100897222 | 212 |
| 5 | 3300031595 | Ga0265313_10012669 | Ga0265313_100126694 | 212 |
| 6 | 3300031712 | Ga0265342_10018567 | Ga0265342_100185673 | 212 |
| 7 | iso_pu_bacteria | 2513237159 | 2513999329 | 212 |
| 8 | iso_pu_bacteria | 2582581283 | 2585165338 | 212 |
| 9 | iso_pu_bacteria | 2582581306 | 2585266433 | 212 |
| 10 | iso_pu_bacteria | 2582581865 | 2585387411 | 212 |
| 11 | iso_pu_bacteria | 2582581866 | 2585394073 | 212 |
| 12 | iso_pu_bacteria | 2643221607 | 2644046791 | 212 |
| 13 | iso_pu_bacteria | 2643221636 | 2644202498 | 212 |
| 14 | iso_pu_bacteria | 2643221686 | 2644479580 | 212 |
| 15 | iso_pu_bacteria | 2643221688 | 2644493573 | 212 |
| 16 | iso_pu_bacteria | 2643221689 | 2644500767 | 212 |
| 17 | iso_pu_bacteria | 2738541317 | 2738945935 | 212 |
| 18 | iso_pu_bacteria | 2751185800 | 2753358885 | 212 |
| 19 | iso_pu_bacteria | 2842521101 | 2842525121 | 212 |
| 20 | iso_pu_bacteria | 2891373044 | 2891376483 | 212 |
| 21 | iso_pu_bacteria | 2899803654 | 2899806335 | 212 |
| 22 | iso_pu_bacteria | 2913308742 | 2913310379 | 212 |
| 23 | iso_pu_bacteria | 2989349275 | 2989355155 | 212 |
| 24 | iso_pu_bacteria | 8054558443 | 8054560086 | 212 |
| 25 | iso_pu_bacteria | 8054563764 | 8054567726 | 212 |
| 26 | 3300049581 | Ga0501047_0242905 | Ga0501047_0242905_382_1038 | 213 |
| 27 | iso_pu_bacteria | 2523231067 | 2523466202 | 213 |
| 28 | iso_pu_bacteria | 2738543031 | 2739347075 | 213 |
| 29 | iso_pu_bacteria | 2775507049 | 2776912365 | 213 |
| 30 | iso_pu_bacteria | 2989771324 | 2989775376 | 213 |
| 31 | iso_pu_bacteria | 3003930520 | 3003932410 | 213 |
| 32 | 3300031249 | Ga0265339_10130413 | Ga0265339_101304132 | 214 |
| 33 | 3300031711 | Ga0265314_10032908 | Ga0265314_100329083 | 214 |
| 34 | iso_pu_bacteria | 2508501122 | 2509107395 | 214 |
| 35 | iso_pu_bacteria | 2509276019 | 2509374615 | 214 |
| 36 | iso_pu_bacteria | 2510065057 | 2510304532 | 214 |
| 37 | iso_pu_bacteria | 2511231052 | 2511500849 | 214 |
| 38 | iso_pu_bacteria | 2512047086 | 2512532271 | 214 |
| 39 | iso_pu_bacteria | 2512875026 | 2512972398 | 214 |
| 40 | iso_pu_bacteria | 2513237086 | 2513585833 | 214 |
| 41 | iso_pu_bacteria | 2513237089 | 2513603477 | 214 |
| 42 | iso_pu_bacteria | 2513237091 | 2513619762 | 214 |
| 43 | iso_pu_bacteria | 2513237140 | 2513882825 | 214 |
| 44 | iso_pu_bacteria | 2513237143 | 2513906548 | 214 |
| 45 | iso_pu_bacteria | 2513237156 | 2513985429 | 214 |
| 46 | iso_pu_bacteria | 2513237160 | 2514004932 | 214 |
| 47 | iso_pu_bacteria | 2515154107 | 2515607977 | 214 |
| 48 | iso_pu_bacteria | 2516143018 | 2516208731 | 214 |
| 49 | iso_pu_bacteria | 2516653046 | 2516892122 | 214 |
| 50 | iso_pu_bacteria | 2517487022 | 2517568937 | 214 |
| 51 | iso_pu_bacteria | 2524023207 | 2524450171 | 214 |
| 52 | iso_pu_bacteria | 2551306084 | 2551681065 | 214 |
| 53 | iso_pu_bacteria | 2551306085 | 2551684813 | 214 |
| 54 | iso_pu_bacteria | 2551306086 | 2551695399 | 214 |
| 55 | iso_pu_bacteria | 2551306087 | 2551702340 | 214 |
| 56 | iso_pu_bacteria | 2551306089 | 2551714704 | 214 |
| 57 | iso_pu_bacteria | 2551306090 | 2551721668 | 214 |
| 58 | iso_pu_bacteria | 2551306091 | 2551724935 | 214 |
| 59 | iso_pu_bacteria | 2551306091 | 2551724966 | 214 |
| 60 | iso_pu_bacteria | 2551306092 | 2551733299 | 214 |
| 61 | iso_pu_bacteria | 2551306093 | 2551746567 | 214 |
| 62 | iso_pu_bacteria | 2558860100 | 2558863643 | 214 |
| 63 | iso_pu_bacteria | 2599185352 | 2600191758 | 214 |
| 64 | iso_pu_bacteria | 2643221551 | 2643774790 | 214 |
| 65 | iso_pu_bacteria | 2643221555 | 2643793234 | 214 |
| 66 | iso_pu_bacteria | 2643221557 | 2643807384 | 214 |
| 67 | iso_pu_bacteria | 2643221610 | 2644069796 | 214 |
| 68 | iso_pu_bacteria | 2643221618 | 2644109176 | 214 |
| 69 | iso_pu_bacteria | 2643221626 | 2644151698 | 214 |
| 70 | iso_pu_bacteria | 2643221655 | 2644311832 | 214 |
| 71 | iso_pu_bacteria | 2643221659 | 2644330104 | 214 |
| 72 | iso_pu_bacteria | 2643221668 | 2644380767 | 214 |
| 73 | iso_pu_bacteria | 2643221675 | 2644414672 | 214 |
| 74 | iso_pu_bacteria | 2643221680 | 2644448329 | 214 |
| 75 | iso_pu_bacteria | 2643221698 | 2644543142 | 214 |
| 76 | iso_pu_bacteria | 2643221712 | 2644617630 | 214 |
| 77 | iso_pu_bacteria | 2643221723 | 2644673726 | 214 |
| 78 | iso_pu_bacteria | 2643221726 | 2644689364 | 214 |
| 79 | iso_pu_bacteria | 2657244999 | 2657682163 | 214 |
| 80 | iso_pu_bacteria | 2690316117 | 2692316976 | 214 |
| 81 | iso_pu_bacteria | 2751185821 | 2753462969 | 214 |
| 82 | iso_pu_bacteria | 2791355082 | 2792584011 | 214 |
| 83 | iso_pu_bacteria | 2791355091 | 2792622187 | 214 |
| 84 | iso_pu_bacteria | 2791355092 | 2792628248 | 214 |
| 85 | iso_pu_bacteria | 2791355094 | 2792638494 | 214 |
| 86 | iso_pu_bacteria | 2802428858 | 2802717580 | 214 |
| 87 | iso_pu_bacteria | 2802428859 | 2802723493 | 214 |
| 88 | iso_pu_bacteria | 2802428860 | 2802731057 | 214 |
| 89 | iso_pu_bacteria | 2802428861 | 2802736063 | 214 |
| 90 | iso_pu_bacteria | 2802428862 | 2802743726 | 214 |
| 91 | iso_pu_bacteria | 2802428863 | 2802750562 | 214 |
| 92 | iso_pu_bacteria | 2802429268 | 2804751181 | 214 |
| 93 | iso_pu_bacteria | 2838074704 | 2838076284 | 214 |
| 94 | iso_pu_bacteria | 2844163670 | 2844163813 | 214 |
| 95 | iso_pu_bacteria | 2847417321 | 2847417955 | 214 |
| 96 | iso_pu_bacteria | 2848992105 | 2848992931 | 214 |
| 97 | iso_pu_bacteria | 2850079185 | 2850080317 | 214 |
| 98 | iso_pu_bacteria | 2855825444 | 2855832040 | 214 |
| 99 | iso_pu_bacteria | 2855839649 | 2855840326 | 214 |
| 100 | iso_pu_bacteria | 2855872281 | 2855878994 | 214 |
| 101 | iso_pu_bacteria | 2858800743 | 2858800857 | 214 |
| 102 | iso_pu_bacteria | 2896384573 | 2896386486 | 214 |
| 103 | iso_pu_bacteria | 2913295892 | 2913297591 | 214 |
| 104 | iso_pu_bacteria | 2915980308 | 2915984148 | 214 |
| 105 | iso_pu_bacteria | 2915986958 | 2915990236 | 214 |
| 106 | iso_pu_bacteria | 2915993759 | 2915997945 | 214 |
| 107 | iso_pu_bacteria | 2916000859 | 2916002336 | 214 |
| 108 | iso_pu_bacteria | 2916007675 | 2916008582 | 214 |
| 109 | iso_pu_bacteria | 2916014648 | 2916020393 | 214 |
| 110 | iso_pu_bacteria | 2916021584 | 2916023556 | 214 |
| 111 | iso_pu_bacteria | 2916028427 | 2916034549 | 214 |
| 112 | iso_pu_bacteria | 2916035215 | 2916035295 | 214 |
| 113 | iso_pu_bacteria | 2916041962 | 2916043336 | 214 |
| 114 | iso_pu_bacteria | 2916048683 | 2916051055 | 214 |
| 115 | iso_pu_bacteria | 2916055098 | 2916057652 | 214 |
| 116 | iso_pu_bacteria | 2916061851 | 2916067959 | 214 |
| 117 | iso_pu_bacteria | 2916068649 | 2916073406 | 214 |
| 118 | iso_pu_bacteria | 2916076590 | 2916080160 | 214 |
| 119 | iso_pu_bacteria | 2920760137 | 2920763030 | 214 |
| 120 | iso_pu_bacteria | 2920822456 | 2920823673 | 214 |
| 121 | iso_pu_bacteria | 2921201388 | 2921207632 | 214 |
| 122 | iso_pu_bacteria | 2921208531 | 2921212509 | 214 |
| 123 | iso_pu_bacteria | 2921237296 | 2921243873 | 214 |
| 124 | iso_pu_bacteria | 2921244191 | 2921245909 | 214 |
| 125 | iso_pu_bacteria | 2921250672 | 2921250843 | 214 |
| 126 | iso_pu_bacteria | 2921257292 | 2921261070 | 214 |
| 127 | iso_pu_bacteria | 2921263974 | 2921269299 | 214 |
| 128 | iso_pu_bacteria | 2921282425 | 2921283859 | 214 |
| 129 | iso_pu_bacteria | 2921289301 | 2921294810 | 214 |
| 130 | iso_pu_bacteria | 2921296804 | 2921301325 | 214 |
| 131 | iso_pu_bacteria | 2924144063 | 2924146979 | 214 |
| 132 | iso_pu_bacteria | 2924150972 | 2924155945 | 214 |
| 133 | iso_pu_bacteria | 2924158325 | 2924160451 | 214 |
| 134 | iso_pu_bacteria | 2924165586 | 2924169824 | 214 |
| 135 | iso_pu_bacteria | 2924172951 | 2924178605 | 214 |
| 136 | iso_pu_bacteria | 2924179722 | 2924180331 | 214 |
| 137 | iso_pu_bacteria | 2924186466 | 2924191395 | 214 |
| 138 | iso_pu_bacteria | 2924193448 | 2924196011 | 214 |
| 139 | iso_pu_bacteria | 2924200457 | 2924204446 | 214 |
| 140 | iso_pu_bacteria | 2924207177 | 2924207481 | 214 |
| 141 | iso_pu_bacteria | 2924214083 | 2924217016 | 214 |
| 142 | iso_pu_bacteria | 2924221636 | 2924228847 | 214 |
| 143 | iso_pu_bacteria | 2924228884 | 2924231396 | 214 |
| 144 | iso_pu_bacteria | 2936996657 | 2936999197 | 214 |
| 145 | iso_pu_bacteria | 2937002841 | 2937003334 | 214 |
| 146 | iso_pu_bacteria | 2937009748 | 2937010638 | 214 |
| 147 | iso_pu_bacteria | 2937016420 | 2937016795 | 214 |
| 148 | iso_pu_bacteria | 2937023124 | 2937028046 | 214 |
| 149 | iso_pu_bacteria | 2937029754 | 2937029979 | 214 |
| 150 | iso_pu_bacteria | 2937036028 | 2937038027 | 214 |
| 151 | iso_pu_bacteria | 2937042894 | 2937044649 | 214 |
| 152 | iso_pu_bacteria | 2937049772 | 2937052699 | 214 |
| 153 | iso_pu_bacteria | 2937056579 | 2937061655 | 214 |
| 154 | iso_pu_bacteria | 2937063883 | 2937066534 | 214 |
| 155 | iso_pu_bacteria | 2937071275 | 2937072374 | 214 |
| 156 | iso_pu_bacteria | 2937078374 | 2937083122 | 214 |
| 157 | iso_pu_bacteria | 2937084907 | 2937089123 | 214 |
| 158 | iso_pu_bacteria | 2937091812 | 2937097903 | 214 |
| 159 | iso_pu_bacteria | 2937098957 | 2937103749 | 214 |
| 160 | iso_pu_bacteria | 2937106411 | 2937107360 | 214 |
| 161 | iso_pu_bacteria | 2937113482 | 2937119800 | 214 |
| 162 | iso_pu_bacteria | 2937119839 | 2937120900 | 214 |
| 163 | iso_pu_bacteria | 2937126314 | 2937130207 | 214 |
| 164 | iso_pu_bacteria | 2941499720 | 2941500402 | 214 |
| 165 | iso_pu_bacteria | 2957375807 | 2957380138 | 214 |
| 166 | iso_pu_bacteria | 2957382221 | 2957385191 | 214 |
| 167 | iso_pu_bacteria | 2957388812 | 2957389253 | 214 |
| 168 | iso_pu_bacteria | 2957395598 | 2957397057 | 214 |
| 169 | iso_pu_bacteria | 2957402308 | 2957402728 | 214 |
| 170 | iso_pu_bacteria | 2957408893 | 2957415159 | 214 |
| 171 | iso_pu_bacteria | 2957415311 | 2957417215 | 214 |
| 172 | iso_pu_bacteria | 2957422303 | 2957423549 | 214 |
| 173 | iso_pu_bacteria | 2957430029 | 2957436451 | 214 |
| 174 | iso_pu_bacteria | 2957437181 | 2957439865 | 214 |
| 175 | iso_pu_bacteria | 2957443900 | 2957449962 | 214 |
| 176 | iso_pu_bacteria | 2957450854 | 2957453364 | 214 |
| 177 | iso_pu_bacteria | 2957457609 | 2957457882 | 214 |
| 178 | iso_pu_bacteria | 2957464669 | 2957466393 | 214 |
| 179 | iso_pu_bacteria | 2957471148 | 2957475054 | 214 |
| 180 | iso_pu_bacteria | 2957478035 | 2957483785 | 214 |
| 181 | iso_pu_bacteria | 2957484790 | 2957490521 | 214 |
| 182 | iso_pu_bacteria | 2957491536 | 2957495873 | 214 |
| 183 | iso_pu_bacteria | 2957498199 | 2957499273 | 214 |
| 184 | iso_pu_bacteria | 2957505466 | 2957507934 | 214 |
| 185 | iso_pu_bacteria | 2960584000 | 2960587957 | 214 |
| 186 | iso_pu_bacteria | 2960591022 | 2960595459 | 214 |
| 187 | iso_pu_bacteria | 2960597568 | 2960600697 | 214 |
| 188 | iso_pu_bacteria | 2960603979 | 2960604671 | 214 |
| 189 | iso_pu_bacteria | 2960610863 | 2960613853 | 214 |
| 190 | iso_pu_bacteria | 2960617483 | 2960617584 | 214 |
| 191 | iso_pu_bacteria | 2960624210 | 2960626668 | 214 |
| 192 | iso_pu_bacteria | 2960631154 | 2960633341 | 214 |
| 193 | iso_pu_bacteria | 2960637947 | 2960642094 | 214 |
| 194 | iso_pu_bacteria | 2960645483 | 2960649797 | 214 |
| 195 | iso_pu_bacteria | 2960652885 | 2960656850 | 214 |
| 196 | iso_pu_bacteria | 2960660292 | 2960662261 | 214 |
| 197 | iso_pu_bacteria | 2960667422 | 2960668487 | 214 |
| 198 | iso_pu_bacteria | 2960674078 | 2960677573 | 214 |
| 199 | iso_pu_bacteria | 2960680706 | 2960685728 | 214 |
| 200 | iso_pu_bacteria | 2960687367 | 2960690422 | 214 |
| 201 | iso_pu_bacteria | 2960693952 | 2960696259 | 214 |
| 202 | iso_pu_bacteria | 2964607997 | 2964612041 | 214 |
| 203 | iso_pu_bacteria | 2964615318 | 2964617562 | 214 |
| 204 | iso_pu_bacteria | 2964621998 | 2964622872 | 214 |
| 205 | iso_pu_bacteria | 2964628898 | 2964633662 | 214 |
| 206 | iso_pu_bacteria | 2964636051 | 2964642060 | 214 |
| 207 | iso_pu_bacteria | 2964643177 | 2964644401 | 214 |
| 208 | iso_pu_bacteria | 2964649959 | 2964652982 | 214 |
| 209 | iso_pu_bacteria | 2964656573 | 2964658192 | 214 |
| 210 | iso_pu_bacteria | 2964663802 | 2964666095 | 214 |
| 211 | iso_pu_bacteria | 2964670856 | 2964671134 | 214 |
| 212 | iso_pu_bacteria | 2964678106 | 2964684723 | 214 |
| 213 | iso_pu_bacteria | 2964685014 | 2964686166 | 214 |
| 214 | iso_pu_bacteria | 2964691889 | 2964693592 | 214 |
| 215 | iso_pu_bacteria | 2964698721 | 2964701935 | 214 |
| 216 | iso_pu_bacteria | 2964705432 | 2964712205 | 214 |
| 217 | iso_pu_bacteria | 2964712639 | 2964713579 | 214 |
| 218 | iso_pu_bacteria | 2964719344 | 2964726587 | 214 |
| 219 | iso_pu_bacteria | 2967664464 | 2967671459 | 214 |
| 220 | iso_pu_bacteria | 2967671571 | 2967673757 | 214 |
| 221 | iso_pu_bacteria | 2967678726 | 2967678803 | 214 |
| 222 | iso_pu_bacteria | 2967686174 | 2967686302 | 214 |
| 223 | iso_pu_bacteria | 2967693043 | 2967693124 | 214 |
| 224 | iso_pu_bacteria | 2967706974 | 2967713990 | 214 |
| 225 | iso_pu_bacteria | 2967714385 | 2967721386 | 214 |
| 226 | iso_pu_bacteria | 2967721400 | 2967724737 | 214 |
| 227 | iso_pu_bacteria | 2967728569 | 2967730679 | 214 |
| 228 | iso_pu_bacteria | 2967735183 | 2967741019 | 214 |
| 229 | iso_pu_bacteria | 2967742019 | 2967746961 | 214 |
| 230 | iso_pu_bacteria | 2967748971 | 2967752227 | 214 |
| 231 | iso_pu_bacteria | 2967755722 | 2967761069 | 214 |
| 232 | iso_pu_bacteria | 2967762386 | 2967763699 | 214 |
| 233 | iso_pu_bacteria | 2967769361 | 2967773178 | 214 |
| 234 | iso_pu_bacteria | 2967775926 | 2967779390 | 214 |
| 235 | iso_pu_bacteria | 2970019648 | 2970026721 | 214 |
| 236 | iso_pu_bacteria | 2970026789 | 2970030434 | 214 |
| 237 | iso_pu_bacteria | 2970033650 | 2970039199 | 214 |
| 238 | iso_pu_bacteria | 2970040964 | 2970042979 | 214 |
| 239 | iso_pu_bacteria | 2970047711 | 2970051615 | 214 |
| 240 | iso_pu_bacteria | 2970054988 | 2970058724 | 214 |
| 241 | iso_pu_bacteria | 2970061556 | 2970066989 | 214 |
| 242 | iso_pu_bacteria | 2970068827 | 2970074899 | 214 |
| 243 | iso_pu_bacteria | 2970076120 | 2970076486 | 214 |
| 244 | iso_pu_bacteria | 2970082768 | 2970083379 | 214 |
| 245 | iso_pu_bacteria | 2970088815 | 2970093526 | 214 |
| 246 | iso_pu_bacteria | 2970095765 | 2970100183 | 214 |
| 247 | iso_pu_bacteria | 2970102677 | 2970108444 | 214 |
| 248 | iso_pu_bacteria | 2970109326 | 2970112265 | 214 |
| 249 | iso_pu_bacteria | 2970116247 | 2970118088 | 214 |
| 250 | iso_pu_bacteria | 2970122695 | 2970128292 | 214 |
| 251 | iso_pu_bacteria | 2970129317 | 2970129397 | 214 |
| 252 | iso_pu_bacteria | 2970136068 | 2970143414 | 214 |
| 253 | iso_pu_bacteria | 2970143518 | 2970149030 | 214 |
| 254 | iso_pu_bacteria | 2970149975 | 2970151301 | 214 |
| 255 | iso_pu_bacteria | 2970156795 | 2970157152 | 214 |
| 256 | iso_pu_bacteria | 2970164137 | 2970167382 | 214 |
| 257 | iso_pu_bacteria | 2970170962 | 2970171483 | 214 |
| 258 | iso_pu_bacteria | 2970177841 | 2970182616 | 214 |
| 259 | iso_pu_bacteria | 2970184632 | 2970187466 | 214 |
| 260 | iso_pu_bacteria | 2970191845 | 2970196292 | 214 |
| 261 | iso_pu_bacteria | 2977516862 | 2977518583 | 214 |
| 262 | iso_pu_bacteria | 2977523885 | 2977525989 | 214 |
| 263 | iso_pu_bacteria | 2977530762 | 2977533305 | 214 |
| 264 | iso_pu_bacteria | 2977537788 | 2977537868 | 214 |
| 265 | iso_pu_bacteria | 2977544691 | 2977544818 | 214 |
| 266 | iso_pu_bacteria | 2977551784 | 2977551865 | 214 |
| 267 | iso_pu_bacteria | 2977558990 | 2977563077 | 214 |
| 268 | iso_pu_bacteria | 2977565890 | 2977568195 | 214 |
| 269 | iso_pu_bacteria | 2977572785 | 2977574833 | 214 |
| 270 | iso_pu_bacteria | 2977579622 | 2977581615 | 214 |
| 271 | iso_pu_bacteria | 643692032 | 643824929 | 214 |
| 272 | iso_pu_bacteria | 648276728 | 648737739 | 214 |
| 273 | iso_pu_bacteria | 8003992118 | 8003992740 | 214 |
| 274 | iso_pu_bacteria | 8003999396 | 8004000069 | 214 |
| 275 | iso_pu_bacteria | 8049293176 | 8049293761 | 214 |
| 276 | iso_pu_bacteria | 2503198000 | 2503203477 | 215 |
| 277 | iso_pu_bacteria | 2508501123 | 2509115895 | 215 |
| 278 | iso_pu_bacteria | 2509276018 | 2509373682 | 215 |
| 279 | iso_pu_bacteria | 2509276022 | 2509397894 | 215 |
| 280 | iso_pu_bacteria | 2510065059 | 2510316468 | 215 |
| 281 | iso_pu_bacteria | 2512875016 | 2512929640 | 215 |
| 282 | iso_pu_bacteria | 2512875024 | 2512964421 | 215 |
| 283 | iso_pu_bacteria | 2513237090 | 2513608295 | 215 |
| 284 | iso_pu_bacteria | 2513237164 | 2514036973 | 215 |
| 285 | iso_pu_bacteria | 2513237305 | 2514416728 | 215 |
| 286 | iso_pu_bacteria | 2513237351 | 2514591637 | 215 |
| 287 | iso_pu_bacteria | 2588253730 | 2588515219 | 215 |
| 288 | iso_pu_bacteria | 2599185301 | 2599939945 | 215 |
| 289 | iso_pu_bacteria | 2643221564 | 2643838626 | 215 |
| 290 | iso_pu_bacteria | 2643221595 | 2643989020 | 215 |
| 291 | iso_pu_bacteria | 2643221623 | 2644132742 | 215 |
| 292 | iso_pu_bacteria | 2643221627 | 2644152205 | 215 |
| 293 | iso_pu_bacteria | 2643221637 | 2644206397 | 215 |
| 294 | iso_pu_bacteria | 2643221718 | 2644650044 | 215 |
| 295 | iso_pu_bacteria | 2687453392 | 2688600308 | 215 |
| 296 | iso_pu_bacteria | 2693429783 | 2694631744 | 215 |
| 297 | iso_pu_bacteria | 2693429784 | 2694639796 | 215 |
| 298 | iso_pu_bacteria | 2721755686 | 2723577583 | 215 |
| 299 | iso_pu_bacteria | 2738543024 | 2739306639 | 215 |
| 300 | iso_pu_bacteria | 2756170246 | 2756673129 | 215 |
| 301 | iso_pu_bacteria | 2791355123 | 2792750872 | 215 |
| 302 | iso_pu_bacteria | 2791355253 | 2793283020 | 215 |
| 303 | iso_pu_bacteria | 2844002411 | 2844005580 | 215 |
| 304 | iso_pu_bacteria | 2844009547 | 2844015619 | 215 |
| 305 | iso_pu_bacteria | 2847670302 | 2847671987 | 215 |
| 306 | iso_pu_bacteria | 2847686936 | 2847688218 | 215 |
| 307 | iso_pu_bacteria | 2856314179 | 2856318281 | 215 |
| 308 | iso_pu_bacteria | 2856320880 | 2856324238 | 215 |
| 309 | iso_pu_bacteria | 2856328259 | 2856328603 | 215 |
| 310 | iso_pu_bacteria | 2856334872 | 2856338481 | 215 |
| 311 | iso_pu_bacteria | 2856364286 | 2856364816 | 215 |
| 312 | iso_pu_bacteria | 2857349434 | 2857354915 | 215 |
| 313 | iso_pu_bacteria | 2857367948 | 2857369616 | 215 |
| 314 | iso_pu_bacteria | 2869162929 | 2869165491 | 215 |
| 315 | iso_pu_bacteria | 2869169390 | 2869173889 | 215 |
| 316 | iso_pu_bacteria | 2869234852 | 2869241264 | 215 |
| 317 | iso_pu_bacteria | 2869242130 | 2869242478 | 215 |
| 318 | iso_pu_bacteria | 2869249662 | 2869256872 | 215 |
| 319 | iso_pu_bacteria | 2869256925 | 2869261680 | 215 |
| 320 | iso_pu_bacteria | 2869264136 | 2869264622 | 215 |
| 321 | iso_pu_bacteria | 2869271264 | 2869277320 | 215 |
| 322 | iso_pu_bacteria | 2869278585 | 2869281764 | 215 |
| 323 | iso_pu_bacteria | 2869285874 | 2869289735 | 215 |
| 324 | iso_pu_bacteria | 2871429161 | 2871431801 | 215 |
| 325 | iso_pu_bacteria | 2871435913 | 2871443119 | 215 |
| 326 | iso_pu_bacteria | 2871444079 | 2871445320 | 215 |
| 327 | iso_pu_bacteria | 2871451962 | 2871455126 | 215 |
| 328 | iso_pu_bacteria | 2871459585 | 2871465758 | 215 |
| 329 | iso_pu_bacteria | 2871466892 | 2871468503 | 215 |
| 330 | iso_pu_bacteria | 2871481445 | 2871488464 | 215 |
| 331 | iso_pu_bacteria | 2871495908 | 2871497517 | 215 |
| 332 | iso_pu_bacteria | 2874102143 | 2874108840 | 215 |
| 333 | iso_pu_bacteria | 2874109183 | 2874113636 | 215 |
| 334 | iso_pu_bacteria | 2874116593 | 2874122629 | 215 |
| 335 | iso_pu_bacteria | 2874123672 | 2874127730 | 215 |
| 336 | iso_pu_bacteria | 2874131515 | 2874132306 | 215 |
| 337 | iso_pu_bacteria | 2874139085 | 2874140568 | 215 |
| 338 | iso_pu_bacteria | 2874146452 | 2874155479 | 215 |
| 339 | iso_pu_bacteria | 2874155637 | 2874162336 | 215 |
| 340 | iso_pu_bacteria | 2874162495 | 2874166570 | 215 |
| 341 | iso_pu_bacteria | 2874168670 | 2874175273 | 215 |
| 342 | iso_pu_bacteria | 2876363079 | 2876366798 | 215 |
| 343 | iso_pu_bacteria | 2876377896 | 2876378548 | 215 |
| 344 | iso_pu_bacteria | 2876386047 | 2876390757 | 215 |
| 345 | iso_pu_bacteria | 2876392853 | 2876398754 | 215 |
| 346 | iso_pu_bacteria | 2876399893 | 2876400595 | 215 |
| 347 | iso_pu_bacteria | 2876406927 | 2876408796 | 215 |
| 348 | iso_pu_bacteria | 2876413966 | 2876420824 | 215 |
| 349 | iso_pu_bacteria | 2876420981 | 2876426966 | 215 |
| 350 | iso_pu_bacteria | 2878035449 | 2878037619 | 215 |
| 351 | iso_pu_bacteria | 2878738818 | 2878742352 | 215 |
| 352 | iso_pu_bacteria | 2878745973 | 2878748407 | 215 |
| 353 | iso_pu_bacteria | 2878760144 | 2878761735 | 215 |
| 354 | iso_pu_bacteria | 2878767105 | 2878768703 | 215 |
| 355 | iso_pu_bacteria | 2878774303 | 2878778689 | 215 |
| 356 | iso_pu_bacteria | 2878781027 | 2878788006 | 215 |
| 357 | iso_pu_bacteria | 2882632389 | 2882635350 | 215 |
| 358 | iso_pu_bacteria | 2885318864 | 2885322892 | 215 |
| 359 | iso_pu_bacteria | 2888337043 | 2888341482 | 215 |
| 360 | iso_pu_bacteria | 2888350351 | 2888350818 | 215 |
| 361 | iso_pu_bacteria | 2889010040 | 2889013160 | 215 |
| 362 | iso_pu_bacteria | 2889016732 | 2889021980 | 215 |
| 363 | iso_pu_bacteria | 2903448605 | 2903452973 | 215 |
| 364 | iso_pu_bacteria | 2903492973 | 2903506084 | 215 |
| 365 | iso_pu_bacteria | 2903513507 | 2903514942 | 215 |
| 366 | iso_pu_bacteria | 2903521522 | 2903524665 | 215 |
| 367 | iso_pu_bacteria | 2903528002 | 2903531092 | 215 |
| 368 | iso_pu_bacteria | 2903540706 | 2903542312 | 215 |
| 369 | iso_pu_bacteria | 2904659560 | 2904665286 | 215 |
| 370 | iso_pu_bacteria | 2906308376 | 2906312024 | 215 |
| 371 | iso_pu_bacteria | 2906321335 | 2906323762 | 215 |
| 372 | iso_pu_bacteria | 2906328253 | 2906331383 | 215 |
| 373 | iso_pu_bacteria | 2906354277 | 2906360348 | 215 |
| 374 | iso_pu_bacteria | 2906363423 | 2906364863 | 215 |
| 375 | iso_pu_bacteria | 2906370794 | 2906377928 | 215 |
| 376 | iso_pu_bacteria | 2906378014 | 2906383573 | 215 |
| 377 | iso_pu_bacteria | 2906386501 | 2906388958 | 215 |
| 378 | iso_pu_bacteria | 2906393657 | 2906395447 | 215 |
| 379 | iso_pu_bacteria | 2906401398 | 2906402444 | 215 |
| 380 | iso_pu_bacteria | 2906408224 | 2906408404 | 215 |
| 381 | iso_pu_bacteria | 2906414383 | 2906418318 | 215 |
| 382 | iso_pu_bacteria | 2906427513 | 2906435025 | 215 |
| 383 | iso_pu_bacteria | 2922130491 | 2922137594 | 215 |
| 384 | iso_pu_bacteria | 2922151315 | 2922153274 | 215 |
| 385 | iso_pu_bacteria | 2922158528 | 2922159744 | 215 |
| 386 | iso_pu_bacteria | 2922172374 | 2922178173 | 215 |
| 387 | iso_pu_bacteria | 2922178524 | 2922182441 | 215 |
| 388 | iso_pu_bacteria | 2922185730 | 2922193826 | 215 |
| 389 | iso_pu_bacteria | 2924718760 | 2924718829 | 215 |
| 390 | iso_pu_bacteria | 2924726620 | 2924728136 | 215 |
| 391 | iso_pu_bacteria | 2924733363 | 2924740377 | 215 |
| 392 | iso_pu_bacteria | 2924741084 | 2924742750 | 215 |
| 393 | iso_pu_bacteria | 2924748358 | 2924752574 | 215 |
| 394 | iso_pu_bacteria | 2924762789 | 2924764449 | 215 |
| 395 | iso_pu_bacteria | 2924776078 | 2924780152 | 215 |
| 396 | iso_pu_bacteria | 2937813078 | 2937818153 | 215 |
| 397 | iso_pu_bacteria | 2937822353 | 2937829086 | 215 |
| 398 | iso_pu_bacteria | 2937843397 | 2937846622 | 215 |
| 399 | iso_pu_bacteria | 2937861824 | 2937868726 | 215 |
| 400 | iso_pu_bacteria | 2937868953 | 2937873784 | 215 |
| 401 | iso_pu_bacteria | 2937877337 | 2937882672 | 215 |
| 402 | iso_pu_bacteria | 2937891427 | 2937892084 | 215 |
| 403 | iso_pu_bacteria | 2937972304 | 2937973355 | 215 |
| 404 | iso_pu_bacteria | 2937980651 | 2937988116 | 215 |
| 405 | iso_pu_bacteria | 2937994558 | 2937996167 | 215 |
| 406 | iso_pu_bacteria | 2938014810 | 2938015045 | 215 |
| 407 | iso_pu_bacteria | 2958034702 | 2958037725 | 215 |
| 408 | iso_pu_bacteria | 2958041894 | 2958047437 | 215 |
| 409 | iso_pu_bacteria | 2958064165 | 2958066105 | 215 |
| 410 | iso_pu_bacteria | 2958084443 | 2958089797 | 215 |
| 411 | iso_pu_bacteria | 2958092219 | 2958097711 | 215 |
| 412 | iso_pu_bacteria | 2958100919 | 2958107868 | 215 |
| 413 | iso_pu_bacteria | 2958108152 | 2958113009 | 215 |
| 414 | iso_pu_bacteria | 2958115193 | 2958116820 | 215 |
| 415 | iso_pu_bacteria | 2958122699 | 2958130021 | 215 |
| 416 | iso_pu_bacteria | 2958130278 | 2958134108 | 215 |
| 417 | iso_pu_bacteria | 2958137437 | 2958142803 | 215 |
| 418 | iso_pu_bacteria | 2958144490 | 2958146776 | 215 |
| 419 | iso_pu_bacteria | 2958158011 | 2958163468 | 215 |
| 420 | iso_pu_bacteria | 2958165035 | 2958166637 | 215 |
| 421 | iso_pu_bacteria | 2958179912 | 2958183754 | 215 |
| 422 | iso_pu_bacteria | 2961077736 | 2961081720 | 215 |
| 423 | iso_pu_bacteria | 2961114664 | 2961120286 | 215 |
| 424 | iso_pu_bacteria | 2961127735 | 2961132205 | 215 |
| 425 | iso_pu_bacteria | 2961136820 | 2961138637 | 215 |
| 426 | iso_pu_bacteria | 2961163497 | 2961165103 | 215 |
| 427 | iso_pu_bacteria | 2961183825 | 2961184175 | 215 |
| 428 | iso_pu_bacteria | 2963644680 | 2963649592 | 215 |
| 429 | iso_pu_bacteria | 2965018300 | 2965019927 | 215 |
| 430 | iso_pu_bacteria | 2965025482 | 2965026224 | 215 |
| 431 | iso_pu_bacteria | 2965032056 | 2965034295 | 215 |
| 432 | iso_pu_bacteria | 2965040258 | 2965046955 | 215 |
| 433 | iso_pu_bacteria | 2965047637 | 2965047959 | 215 |
| 434 | iso_pu_bacteria | 2965062239 | 2965064678 | 215 |
| 435 | iso_pu_bacteria | 2965089291 | 2965094493 | 215 |
| 436 | iso_pu_bacteria | 2965102966 | 2965106383 | 215 |
| 437 | iso_pu_bacteria | 2965110997 | 2965117264 | 215 |
| 438 | iso_pu_bacteria | 2968016561 | 2968019440 | 215 |
| 439 | iso_pu_bacteria | 2968083720 | 2968084754 | 215 |
| 440 | iso_pu_bacteria | 2968097103 | 2968101644 | 215 |
| 441 | iso_pu_bacteria | 2968110612 | 2968116753 | 215 |
| 442 | iso_pu_bacteria | 2968117919 | 2968118501 | 215 |
| 443 | iso_pu_bacteria | 2968128360 | 2968131834 | 215 |
| 444 | iso_pu_bacteria | 2968138860 | 2968143599 | 215 |
| 445 | iso_pu_bacteria | 2968171901 | 2968173504 | 215 |
| 446 | iso_pu_bacteria | 2970469710 | 2970472761 | 215 |
| 447 | iso_pu_bacteria | 2970489779 | 2970494753 | 215 |
| 448 | iso_pu_bacteria | 2970510686 | 2970515856 | 215 |
| 449 | iso_pu_bacteria | 2970532167 | 2970533346 | 215 |
| 450 | iso_pu_bacteria | 2970547951 | 2970550622 | 215 |
| 451 | iso_pu_bacteria | 2970554993 | 2970556593 | 215 |
| 452 | iso_pu_bacteria | 2970593180 | 2970596368 | 215 |
| 453 | iso_pu_bacteria | 2970619444 | 2970623651 | 215 |
| 454 | iso_pu_bacteria | 2970627176 | 2970630865 | 215 |
| 455 | iso_pu_bacteria | 2977843712 | 2977851249 | 215 |
| 456 | iso_pu_bacteria | 2977872689 | 2977875009 | 215 |
| 457 | iso_pu_bacteria | 2977907340 | 2977908116 | 215 |
| 458 | iso_pu_bacteria | 2977915119 | 2977916485 | 215 |
| 459 | iso_pu_bacteria | 2977935797 | 2977938644 | 215 |
| 460 | iso_pu_bacteria | 2977942078 | 2977946700 | 215 |
| 461 | iso_pu_bacteria | 2977950692 | 2977957068 | 215 |
| 462 | iso_pu_bacteria | 2977957713 | 2977959899 | 215 |
| 463 | iso_pu_bacteria | 2979772303 | 2979775108 | 215 |
| 464 | iso_pu_bacteria | 2979779861 | 2979785729 | 215 |
| 465 | iso_pu_bacteria | 2979793036 | 2979796255 | 215 |
| 466 | iso_pu_bacteria | 2987636660 | 2987643517 | 215 |
| 467 | iso_pu_bacteria | 2987645492 | 2987651588 | 215 |
| 468 | iso_pu_bacteria | 2987659509 | 2987661111 | 215 |
| 469 | iso_pu_bacteria | 2987666974 | 2987672707 | 215 |
| 470 | iso_pu_bacteria | 2987673487 | 2987673799 | 215 |
| 471 | iso_pu_bacteria | 2996310559 | 2996313146 | 215 |
| 472 | iso_pu_bacteria | 2996341866 | 2996348587 | 215 |
| 473 | iso_pu_bacteria | 2996348954 | 2996352120 | 215 |
| 474 | iso_pu_bacteria | 2996386984 | 2996391993 | 215 |
| 475 | iso_pu_bacteria | 3000135777 | 3000142029 | 215 |
| 476 | iso_pu_bacteria | 3004167301 | 3004171098 | 215 |
| 477 | iso_pu_bacteria | 3004188549 | 3004190161 | 215 |
| 478 | iso_pu_bacteria | 3004195979 | 3004203113 | 215 |
| 479 | iso_pu_bacteria | 3004203850 | 3004207062 | 215 |
| 480 | iso_pu_bacteria | 3004232784 | 3004233004 | 215 |
| 481 | iso_pu_bacteria | 3004239961 | 3004239994 | 215 |
| 482 | iso_pu_bacteria | 3004248173 | 3004249146 | 215 |
| 483 | iso_pu_bacteria | 3004268573 | 3004273382 | 215 |
| 484 | iso_pu_bacteria | 3004275668 | 3004278818 | 215 |
| 485 | iso_pu_bacteria | 3004334049 | 3004339227 | 215 |
| 486 | iso_pu_bacteria | 637000159 | 637079384 | 215 |
| 487 | iso_pu_bacteria | 649633066 | 649874772 | 215 |
| 488 | iso_pu_bacteria | 8002285264 | 8002287981 | 215 |
| 489 | iso_pu_bacteria | 8004300914 | 8004303442 | 215 |
| 490 | iso_pu_bacteria | 8004312739 | 8004318593 | 215 |
| 491 | iso_pu_bacteria | 8004361976 | 8004368148 | 215 |
| 492 | iso_pu_bacteria | 8004387939 | 8004391613 | 215 |
| 493 | iso_pu_bacteria | 8004445564 | 8004449705 | 215 |
| 494 | iso_pu_bacteria | 8004640170 | 8004641376 | 215 |
| 495 | iso_pu_bacteria | 8004695233 | 8004700007 | 215 |
| 496 | iso_pu_bacteria | 8004703790 | 8004710702 | 215 |
| 497 | iso_pu_bacteria | 8004714634 | 8004716982 | 215 |
| 498 | iso_pu_bacteria | 8004727605 | 8004733157 | 215 |
| 499 | iso_pu_bacteria | 8055617313 | 8055622867 | 215 |
| 500 | 3300003187 | JGI25151J46595_10008750 | JGI25151J46595_100087505 | 216 |
| 501 | 3300025294 | Ga0209025_1000165 | Ga0209025_1000165139 | 216 |
| 502 | 3300028794 | Ga0307515_10000420 | Ga0307515_1000042016 | 216 |
| 503 | 3300028794 | Ga0307515_10039061 | Ga0307515_100390614 | 216 |
| 504 | 3300031456 | Ga0307513_10004196 | Ga0307513_100041961 | 216 |
| 505 | 3300031548 | Ga0307408_100024952 | Ga0307408_1000249524 | 216 |
| 506 | 3300031911 | Ga0307412_10144470 | Ga0307412_101444702 | 216 |
| 507 | 3300031995 | Ga0307409_100337798 | Ga0307409_1003377981 | 216 |
| 508 | 3300032002 | Ga0307416_101015167 | Ga0307416_1010151672 | 216 |
| 509 | 3300036647 | Ga0316582_0070662 | Ga0316582_0070662_403_1053 | 216 |
| 510 | 3300036712 | Ga0316584_0079499 | Ga0316584_0079499_238_888 | 216 |
| 511 | 3300041410 | Ga0439461_0068124 | Ga0439461_0068124_99_749 | 216 |
| 512 | 3300041411 | Ga0439466_0092196 | Ga0439466_0092196_142_792 | 216 |
| 513 | 3300042002 | Ga0439442_066542 | Ga0439442_066542_99_749 | 216 |
| 514 | 3300042006 | Ga0439432_081424 | Ga0439432_081424_185_835 | 216 |
| 515 | 3300042145 | Ga0450906_026455 | Ga0450906_026455_331_981 | 216 |
| 516 | 3300042147 | Ga0450910_005161 | Ga0450910_005161_335_985 | 216 |
| 517 | 3300042531 | Ga0450918_007376 | Ga0450918_007376_660_1310 | 216 |
| 518 | 3300046674 | Ga0495588_0099043 | Ga0495588_0099043_185_835 | 216 |
| 519 | 3300048920 | Ga0496117_0002204 | Ga0496117_0002204_5544_6194 | 216 |
| 520 | 3300048925 | Ga0496122_0004346 | Ga0496122_0004346_2183_2833 | 216 |
| 521 | 3300048925 | Ga0496122_0076809 | Ga0496122_0076809_564_1238 | 216 |
| 522 | 3300048926 | Ga0496123_0000103 | Ga0496123_0000103_133811_134461 | 216 |
| 523 | 3300048926 | Ga0496123_0026920 | Ga0496123_0026920_939_1613 | 216 |
| 524 | 3300048927 | Ga0496124_0005072 | Ga0496124_0005072_4231_4881 | 216 |
| 525 | 3300048928 | Ga0496125_0000879 | Ga0496125_0000879_1940_2590 | 216 |
| 526 | 3300048928 | Ga0496125_0039027 | Ga0496125_0039027_939_1613 | 216 |
| 527 | 3300048929 | Ga0496126_0001336 | Ga0496126_0001336_4925_5575 | 216 |
| 528 | 3300048929 | Ga0496126_0012132 | Ga0496126_0012132_5219_5890 | 216 |
| 529 | 3300049513 | Ga0501290_000163 | Ga0501290_000163_7072_7722 | 216 |
| 530 | 3300049573 | Ga0501037_0117480 | Ga0501037_0117480_1042_1692 | 216 |
| 531 | 3300049652 | Ga0501202_018881 | Ga0501202_018881_517_1167 | 216 |
| 532 | 3300049662 | Ga0501222_001521 | Ga0501222_001521_888_1538 | 216 |
| 533 | 3300049663 | Ga0501223_001150 | Ga0501223_001150_3214_3864 | 216 |
| 534 | 3300049664 | Ga0501224_006556 | Ga0501224_006556_290_940 | 216 |
| 535 | 3300049776 | Ga0501280_000010 | Ga0501280_000010_48740_49390 | 216 |
| 536 | 3300049778 | Ga0501282_001568 | Ga0501282_001568_662_1312 | 216 |
| 537 | 3300049823 | Ga0501044_0521416 | Ga0501044_0521416_294_944 | 216 |
| 538 | 3300053157 | Ga0500624_036798 | Ga0500624_036798_76_726 | 216 |
| 539 | iso_pu_bacteria | 2894772417 | 2894776651 | 216 |
| 540 | 3300005937 | Ga0081455_10018339 | Ga0081455_100183395 | 217 |
| 541 | 3300025230 | Ga0209563_105116 | Ga0209563_1051162 | 217 |
| 542 | 3300031235 | Ga0265330_10123466 | Ga0265330_101234662 | 217 |
| 543 | 3300031901 | Ga0307406_10085121 | Ga0307406_100851212 | 217 |
| 544 | 3300037853 | Ga0436364_1041655 | Ga0436364_1041655_9250_9912 | 217 |
| 545 | 3300049570 | Ga0501033_0000503 | Ga0501033_0000503_5243_5896 | 217 |
| 546 | 3300049570 | Ga0501033_0111103 | Ga0501033_0111103_136_789 | 217 |
| 547 | 3300049571 | Ga0501034_0620168 | Ga0501034_0620168_136_789 | 217 |
| 548 | 3300049572 | Ga0501036_0167658 | Ga0501036_0167658_197_850 | 217 |
| 549 | 3300049573 | Ga0501037_0322388 | Ga0501037_0322388_136_789 | 217 |
| 550 | 3300049573 | Ga0501037_0328514 | Ga0501037_0328514_20_682 | 217 |
| 551 | 3300049574 | Ga0501038_0024807 | Ga0501038_0024807_3297_3950 | 217 |
| 552 | 3300049575 | Ga0501039_0317168 | Ga0501039_0317168_376_1029 | 217 |
| 553 | 3300049579 | Ga0501043_0291265 | Ga0501043_0291265_197_850 | 217 |
| 554 | 3300049581 | Ga0501047_0006539 | Ga0501047_0006539_4757_5419 | 217 |
| 555 | 3300049581 | Ga0501047_0163561 | Ga0501047_0163561_1323_1976 | 217 |
| 556 | 3300049586 | Ga0501070_0134743 | Ga0501070_0134743_169_822 | 217 |
| 557 | 3300049586 | Ga0501070_0367885 | Ga0501070_0367885_319_981 | 217 |
| 558 | 3300049589 | Ga0501073_0062094 | Ga0501073_0062094_736_1398 | 217 |
| 559 | 3300049742 | Ga0501080_0147726 | Ga0501080_0147726_1385_2038 | 217 |
| 560 | 3300049742 | Ga0501080_0255827 | Ga0501080_0255827_867_1529 | 217 |
| 561 | 3300049822 | Ga0501035_0020300 | Ga0501035_0020300_1718_2371 | 217 |
| 562 | 3300049822 | Ga0501035_0132746 | Ga0501035_0132746_1396_2049 | 217 |
| 563 | 3300049823 | Ga0501044_0165646 | Ga0501044_0165646_1396_2049 | 217 |
| 564 | 3300049823 | Ga0501044_0329332 | Ga0501044_0329332_634_1296 | 217 |
| 565 | 3300060353 | Ga0501082_0064688 | Ga0501082_0064688_1774_2433 | 217 |
| 566 | iso_pu_bacteria | 2837651117 | 2837652518 | 217 |
| 567 | 3300002739 | JGI25158J39367_1001337 | JGI25158J39367_10013373 | 218 |
| 568 | 3300002987 | JGI25159J45721_1000001 | JGI25159J45721_1000001225 | 218 |
| 569 | 3300003187 | JGI25151J46595_10025779 | JGI25151J46595_100257792 | 218 |
| 570 | 3300003354 | JGI25160J50197_1000002 | JGI25160J50197_100000290 | 218 |
| 571 | 3300003771 | Ga0055526_1001867 | Ga0055526_100186711 | 218 |
| 572 | 3300003775 | Ga0055524_1000777 | Ga0055524_100077711 | 218 |
| 573 | 3300003775 | Ga0055524_1024254 | Ga0055524_10242542 | 218 |
| 574 | 3300003791 | Ga0055530_10040496 | Ga0055530_100404961 | 218 |
| 575 | 3300003794 | Ga0055531_10031987 | Ga0055531_100319872 | 218 |
| 576 | 3300004625 | Ga0055543_1000057 | Ga0055543_1000057100 | 218 |
| 577 | 3300005262 | Ga0065165_1000004 | Ga0065165_1000004293 | 218 |
| 578 | 3300005335 | Ga0070666_10095281 | Ga0070666_100952812 | 218 |
| 579 | 3300006946 | Ga0079104_1007485 | Ga0079104_10074854 | 218 |
| 580 | 3300006946 | Ga0079104_1014594 | Ga0079104_10145942 | 218 |
| 581 | 3300013249 | Ga0171463_1001 | Ga0171463_1001401 | 218 |
| 582 | 3300015690 | Ga0183363_1045 | Ga0183363_104542 | 218 |
| 583 | 3300021320 | Ga0214544_1000008 | Ga0214544_1000008102 | 218 |
| 584 | 3300021321 | Ga0214542_1000010 | Ga0214542_100001058 | 218 |
| 585 | 3300021321 | Ga0214542_1015383 | Ga0214542_10153832 | 218 |
| 586 | 3300021327 | Ga0214543_1000003 | Ga0214543_1000003317 | 218 |
| 587 | 3300021327 | Ga0214543_1000004 | Ga0214543_100000480 | 218 |
| 588 | 3300022739 | Ga0228711_1000001 | Ga0228711_1000001229 | 218 |
| 589 | 3300022740 | Ga0228710_1000001 | Ga0228710_100000195 | 218 |
| 590 | 3300025208 | Ga0209436_100122 | Ga0209436_10012233 | 218 |
| 591 | 3300025284 | Ga0209130_1000008 | Ga0209130_1000008452 | 218 |
| 592 | 3300025292 | Ga0209676_1002258 | Ga0209676_10022588 | 218 |
| 593 | 3300025294 | Ga0209025_1000100 | Ga0209025_100010038 | 218 |
| 594 | 3300025295 | Ga0209564_1000104 | Ga0209564_1000104134 | 218 |
| 595 | 3300025298 | Ga0209050_1015813 | Ga0209050_10158134 | 218 |
| 596 | 3300025299 | Ga0209256_1000652 | Ga0209256_100065243 | 218 |
| 597 | 3300025299 | Ga0209256_1002322 | Ga0209256_10023224 | 218 |
| 598 | 3300025302 | Ga0207426_1000016 | Ga0207426_1000016111 | 218 |
| 599 | 3300025903 | Ga0207680_10098509 | Ga0207680_100985093 | 218 |
| 600 | 3300027111 | Ga0209281_1000164 | Ga0209281_1000164134 | 218 |
| 601 | 3300027111 | Ga0209281_1000626 | Ga0209281_100062627 | 218 |
| 602 | 3300027666 | Ga0209282_1000007 | Ga0209282_100000722 | 218 |
| 603 | 3300031241 | Ga0265325_10041422 | Ga0265325_100414222 | 218 |
| 604 | 3300031247 | Ga0265340_10001536 | Ga0265340_100015368 | 218 |
| 605 | 3300031247 | Ga0265340_10071750 | Ga0265340_100717502 | 218 |
| 606 | 3300031249 | Ga0265339_10004396 | Ga0265339_100043965 | 218 |
| 607 | 3300031344 | Ga0265316_10028899 | Ga0265316_100288992 | 218 |
| 608 | 3300031595 | Ga0265313_10001426 | Ga0265313_100014262 | 218 |
| 609 | 3300031712 | Ga0265342_10003927 | Ga0265342_100039276 | 218 |
| 610 | 3300031967 | Ga0315914_1000006 | Ga0315914_1000006220 | 218 |
| 611 | 3300033430 | Ga0315913_1000002 | Ga0315913_100000222 | 218 |
| 612 | 3300033464 | Ga0315915_1000001 | Ga0315915_1000001464 | 218 |
| 613 | 3300041413 | Ga0439465_0044479 | Ga0439465_0044479_686_1348 | 218 |
| 614 | 3300042007 | Ga0439449_0002061 | Ga0439449_0002061_4091_4870 | 218 |
| 615 | 3300042015 | Ga0439462_0031769 | Ga0439462_0031769_263_1042 | 218 |
| 616 | 3300049589 | Ga0501073_0081812 | Ga0501073_0081812_328_993 | 218 |
| 617 | 3300049742 | Ga0501080_0365547 | Ga0501080_0365547_80_745 | 218 |
| 618 | 3300053087 | Ga0500643_000356 | Ga0500643_000356_4428_5087 | 218 |
| 619 | iso_pu_bacteria | 2643221653 | 2644297109 | 218 |
| 620 | iso_pu_bacteria | 2643221719 | 2644655362 | 218 |
| 621 | iso_pu_bacteria | 2967699805 | 2967704298 | 218 |
| 622 | iso_pu_bacteria | 8005246636 | 8005246850 | 218 |
| 623 | 3300001979 | JGI24740J21852_10009030 | JGI24740J21852_100090303 | 219 |
| 624 | 3300003214 | JGI25165J46597_1000016 | JGI25165J46597_100001675 | 219 |
| 625 | 3300003320 | rootH2_10339468 | rootH2_103394681 | 219 |
| 626 | 3300003762 | Ga0055542_1004234 | Ga0055542_10042345 | 219 |
| 627 | 3300003763 | Ga0055529_1006934 | Ga0055529_10069341 | 219 |
| 628 | 3300005327 | Ga0070658_10391926 | Ga0070658_103919262 | 219 |
| 629 | 3300005347 | Ga0070668_100298989 | Ga0070668_1002989891 | 219 |
| 630 | 3300005356 | Ga0070674_100184160 | Ga0070674_1001841602 | 219 |
| 631 | 3300005367 | Ga0070667_100430374 | Ga0070667_1004303741 | 219 |
| 632 | 3300005455 | Ga0070663_100110541 | Ga0070663_1001105412 | 219 |
| 633 | 3300005455 | Ga0070663_100645646 | Ga0070663_1006456461 | 219 |
| 634 | 3300005456 | Ga0070678_100832481 | Ga0070678_1008324811 | 219 |
| 635 | 3300005539 | Ga0068853_100043464 | Ga0068853_1000434643 | 219 |
| 636 | 3300005548 | Ga0070665_100034072 | Ga0070665_1000340724 | 219 |
| 637 | 3300005548 | Ga0070665_100471005 | Ga0070665_1004710052 | 219 |
| 638 | 3300005563 | Ga0068855_100162571 | Ga0068855_1001625712 | 219 |
| 639 | 3300005564 | Ga0070664_100750651 | Ga0070664_1007506511 | 219 |
| 640 | 3300005577 | Ga0068857_100104451 | Ga0068857_1001044513 | 219 |
| 641 | 3300005983 | Ga0081540_1023624 | Ga0081540_10236245 | 219 |
| 642 | 3300006038 | Ga0075365_10004422 | Ga0075365_100044226 | 219 |
| 643 | 3300006038 | Ga0075365_10012641 | Ga0075365_100126415 | 219 |
| 644 | 3300006048 | Ga0075363_100012543 | Ga0075363_1000125433 | 219 |
| 645 | 3300006048 | Ga0075363_100213756 | Ga0075363_1002137562 | 219 |
| 646 | 3300006177 | Ga0075362_10027138 | Ga0075362_100271382 | 219 |
| 647 | 3300006177 | Ga0075362_10028394 | Ga0075362_100283943 | 219 |
| 648 | 3300006178 | Ga0075367_10019586 | Ga0075367_100195862 | 219 |
| 649 | 3300006186 | Ga0075369_10119954 | Ga0075369_101199541 | 219 |
| 650 | 3300006353 | Ga0075370_10026164 | Ga0075370_100261644 | 219 |
| 651 | 3300006353 | Ga0075370_10077522 | Ga0075370_100775222 | 219 |
| 652 | 3300009093 | Ga0105240_10026413 | Ga0105240_100264134 | 219 |
| 653 | 3300009093 | Ga0105240_10281473 | Ga0105240_102814732 | 219 |
| 654 | 3300009545 | Ga0105237_10031482 | Ga0105237_100314823 | 219 |
| 655 | 3300009545 | Ga0105237_10077156 | Ga0105237_100771562 | 219 |
| 656 | 3300009545 | Ga0105237_10163975 | Ga0105237_101639752 | 219 |
| 657 | 3300009545 | Ga0105237_10294357 | Ga0105237_102943572 | 219 |
| 658 | 3300009551 | Ga0105238_10011809 | Ga0105238_100118094 | 219 |
| 659 | 3300010375 | Ga0105239_10044001 | Ga0105239_100440011 | 219 |
| 660 | 3300010375 | Ga0105239_10076181 | Ga0105239_100761813 | 219 |
| 661 | 3300010375 | Ga0105239_10150471 | Ga0105239_101504713 | 219 |
| 662 | 3300010375 | Ga0105239_10466871 | Ga0105239_104668711 | 219 |
| 663 | 3300013104 | Ga0157370_10607504 | Ga0157370_106075041 | 219 |
| 664 | 3300013105 | Ga0157369_10276630 | Ga0157369_102766302 | 219 |
| 665 | 3300013296 | Ga0157374_10564917 | Ga0157374_105649172 | 219 |
| 666 | 3300013297 | Ga0157378_10680137 | Ga0157378_106801371 | 219 |
| 667 | 3300013307 | Ga0157372_10668351 | Ga0157372_106683512 | 219 |
| 668 | 3300014497 | Ga0182008_10128964 | Ga0182008_101289642 | 219 |
| 669 | 3300025246 | Ga0209646_1011896 | Ga0209646_10118962 | 219 |
| 670 | 3300025250 | Ga0209026_1000005 | Ga0209026_100000581 | 219 |
| 671 | 3300025254 | Ga0209148_1000056 | Ga0209148_100005663 | 219 |
| 672 | 3300025256 | Ga0209759_1000631 | Ga0209759_10006316 | 219 |
| 673 | 3300025261 | Ga0209233_1000068 | Ga0209233_100006875 | 219 |
| 674 | 3300025272 | Ga0209455_1000238 | Ga0209455_100023817 | 219 |
| 675 | 3300025297 | Ga0209758_1005808 | Ga0209758_10058087 | 219 |
| 676 | 3300025904 | Ga0207647_10053502 | Ga0207647_100535022 | 219 |
| 677 | 3300025907 | Ga0207645_10077952 | Ga0207645_100779522 | 219 |
| 678 | 3300025913 | Ga0207695_10333569 | Ga0207695_103335692 | 219 |
| 679 | 3300025913 | Ga0207695_10824141 | Ga0207695_108241411 | 219 |
| 680 | 3300025914 | Ga0207671_10012030 | Ga0207671_100120306 | 219 |
| 681 | 3300025914 | Ga0207671_10058466 | Ga0207671_100584662 | 219 |
| 682 | 3300025914 | Ga0207671_10178806 | Ga0207671_101788062 | 219 |
| 683 | 3300025919 | Ga0207657_10050734 | Ga0207657_100507343 | 219 |
| 684 | 3300025924 | Ga0207694_10051200 | Ga0207694_100512003 | 219 |
| 685 | 3300025924 | Ga0207694_10445342 | Ga0207694_104453421 | 219 |
| 686 | 3300025933 | Ga0207706_10174245 | Ga0207706_101742452 | 219 |
| 687 | 3300025937 | Ga0207669_10149290 | Ga0207669_101492903 | 219 |
| 688 | 3300025940 | Ga0207691_10293169 | Ga0207691_102931691 | 219 |
| 689 | 3300025972 | Ga0207668_10388562 | Ga0207668_103885622 | 219 |
| 690 | 3300026041 | Ga0207639_10069737 | Ga0207639_100697372 | 219 |
| 691 | 3300026067 | Ga0207678_10149256 | Ga0207678_101492561 | 219 |
| 692 | 3300026116 | Ga0207674_10098525 | Ga0207674_100985252 | 219 |
| 693 | 3300028379 | Ga0268266_10293056 | Ga0268266_102930562 | 219 |
| 694 | 3300032002 | Ga0307416_100107466 | Ga0307416_1001074662 | 219 |
| 695 | 3300035398 | Ga0316574_0520552 | Ga0316574_0520552_10_669 | 219 |
| 696 | 3300035691 | Ga0373931_0166482 | Ga0373931_0166482_82_744 | 219 |
| 697 | 3300035692 | Ga0373935_0285059 | Ga0373935_0285059_458_1117 | 219 |
| 698 | 3300037418 | Ga0395900_0084548 | Ga0395900_0084548_1733_2395 | 219 |
| 699 | 3300037418 | Ga0395900_0338598 | Ga0395900_0338598_172_834 | 219 |
| 700 | 3300037466 | Ga0395898_0063483 | Ga0395898_0063483_2749_3411 | 219 |
| 701 | 3300037466 | Ga0395898_0339865 | Ga0395898_0339865_206_868 | 219 |
| 702 | 3300037471 | Ga0395905_0101818 | Ga0395905_0101818_1238_1939 | 219 |
| 703 | 3300038443 | Ga0395901_0037442 | Ga0395901_0037442_3998_4699 | 219 |
| 704 | 3300038443 | Ga0395901_0041612 | Ga0395901_0041612_1351_2016 | 219 |
| 705 | 3300042157 | Ga0439458_0093151 | Ga0439458_0093151_14_676 | 219 |
| 706 | 3300044658 | Ga0466972_0092202 | Ga0466972_0092202_596_1258 | 219 |
| 707 | 3300044658 | Ga0466972_0230596 | Ga0466972_0230596_13_675 | 219 |
| 708 | 3300044683 | Ga0466965_0237206 | Ga0466965_0237206_86_748 | 219 |
| 709 | 3300044901 | Ga0466960_0081836 | Ga0466960_0081836_267_929 | 219 |
| 710 | 3300046460 | Ga0495638_0098581 | Ga0495638_0098581_484_1146 | 219 |
| 711 | 3300046492 | Ga0495585_0252728 | Ga0495585_0252728_27_704 | 219 |
| 712 | 3300046507 | Ga0495606_0053804 | Ga0495606_0053804_1844_2521 | 219 |
| 713 | 3300046519 | Ga0495632_0048643 | Ga0495632_0048643_721_1383 | 219 |
| 714 | 3300046522 | Ga0495643_0070648 | Ga0495643_0070648_988_1650 | 219 |
| 715 | 3300046616 | Ga0495668_0044581 | Ga0495668_0044581_1434_2096 | 219 |
| 716 | 3300046660 | Ga0495625_0021781 | Ga0495625_0021781_3591_4253 | 219 |
| 717 | 3300047443 | Ga0495687_020699 | Ga0495687_020699_2427_3089 | 219 |
| 718 | 3300048088 | Ga0495602_0249634 | Ga0495602_0249634_57_719 | 219 |
| 719 | 3300048088 | Ga0495602_0443161 | Ga0495602_0443161_80_739 | 219 |
| 720 | 3300048091 | Ga0495626_0056117 | Ga0495626_0056117_21_683 | 219 |
| 721 | 3300048905 | Ga0496102_0831960 | Ga0496102_0831960_151_813 | 219 |
| 722 | 3300048907 | Ga0496104_0396809 | Ga0496104_0396809_98_760 | 219 |
| 723 | 3300048908 | Ga0496105_0063843 | Ga0496105_0063843_1376_2038 | 219 |
| 724 | 3300048913 | Ga0496110_0196310 | Ga0496110_0196310_30_701 | 219 |
| 725 | 3300048913 | Ga0496110_0407293 | Ga0496110_0407293_221_883 | 219 |
| 726 | 3300048915 | Ga0496112_0015726 | Ga0496112_0015726_5018_5680 | 219 |
| 727 | 3300048915 | Ga0496112_0260718 | Ga0496112_0260718_645_1316 | 219 |
| 728 | 3300048916 | Ga0496113_0221816 | Ga0496113_0221816_612_1277 | 219 |
| 729 | 3300048917 | Ga0496114_0200085 | Ga0496114_0200085_834_1511 | 219 |
| 730 | 3300048921 | Ga0496118_0046814 | Ga0496118_0046814_1467_2129 | 219 |
| 731 | 3300048923 | Ga0496120_0052491 | Ga0496120_0052491_159_821 | 219 |
| 732 | 3300048924 | Ga0496121_0153319 | Ga0496121_0153319_303_965 | 219 |
| 733 | 3300048927 | Ga0496124_0122222 | Ga0496124_0122222_263_922 | 219 |
| 734 | 3300048929 | Ga0496126_0092384 | Ga0496126_0092384_1527_2189 | 219 |
| 735 | 3300049568 | Ga0501031_0005610 | Ga0501031_0005610_2490_3152 | 219 |
| 736 | 3300049568 | Ga0501031_0035334 | Ga0501031_0035334_1489_2151 | 219 |
| 737 | 3300049568 | Ga0501031_0177612 | Ga0501031_0177612_340_1002 | 219 |
| 738 | 3300049569 | Ga0501032_0000082 | Ga0501032_0000082_38110_38772 | 219 |
| 739 | 3300049569 | Ga0501032_0006363 | Ga0501032_0006363_5745_6407 | 219 |
| 740 | 3300049569 | Ga0501032_0077742 | Ga0501032_0077742_931_1593 | 219 |
| 741 | 3300049569 | Ga0501032_0163195 | Ga0501032_0163195_668_1327 | 219 |
| 742 | 3300049569 | Ga0501032_0242560 | Ga0501032_0242560_99_761 | 219 |
| 743 | 3300049569 | Ga0501032_0323449 | Ga0501032_0323449_162_824 | 219 |
| 744 | 3300049569 | Ga0501032_0477858 | Ga0501032_0477858_33_695 | 219 |
| 745 | 3300049570 | Ga0501033_0000070 | Ga0501033_0000070_43512_44174 | 219 |
| 746 | 3300049570 | Ga0501033_0000500 | Ga0501033_0000500_1099_1761 | 219 |
| 747 | 3300049570 | Ga0501033_0007653 | Ga0501033_0007653_6338_6997 | 219 |
| 748 | 3300049570 | Ga0501033_0016653 | Ga0501033_0016653_3004_3666 | 219 |
| 749 | 3300049570 | Ga0501033_0332300 | Ga0501033_0332300_162_824 | 219 |
| 750 | 3300049571 | Ga0501034_0000087 | Ga0501034_0000087_98802_99464 | 219 |
| 751 | 3300049571 | Ga0501034_0277704 | Ga0501034_0277704_50_712 | 219 |
| 752 | 3300049571 | Ga0501034_0500559 | Ga0501034_0500559_191_853 | 219 |
| 753 | 3300049571 | Ga0501034_0614244 | Ga0501034_0614244_197_856 | 219 |
| 754 | 3300049572 | Ga0501036_0000073 | Ga0501036_0000073_2445_3107 | 219 |
| 755 | 3300049572 | Ga0501036_0100265 | Ga0501036_0100265_395_1054 | 219 |
| 756 | 3300049572 | Ga0501036_0119383 | Ga0501036_0119383_1211_1873 | 219 |
| 757 | 3300049572 | Ga0501036_0297094 | Ga0501036_0297094_181_843 | 219 |
| 758 | 3300049572 | Ga0501036_0698783 | Ga0501036_0698783_143_805 | 219 |
| 759 | 3300049573 | Ga0501037_0000014 | Ga0501037_0000014_71572_72234 | 219 |
| 760 | 3300049573 | Ga0501037_0004549 | Ga0501037_0004549_6356_7018 | 219 |
| 761 | 3300049573 | Ga0501037_0407722 | Ga0501037_0407722_136_795 | 219 |
| 762 | 3300049573 | Ga0501037_0409883 | Ga0501037_0409883_164_826 | 219 |
| 763 | 3300049574 | Ga0501038_0000023 | Ga0501038_0000023_52014_52676 | 219 |
| 764 | 3300049574 | Ga0501038_0168640 | Ga0501038_0168640_334_996 | 219 |
| 765 | 3300049575 | Ga0501039_0000044 | Ga0501039_0000044_39560_40222 | 219 |
| 766 | 3300049575 | Ga0501039_0468183 | Ga0501039_0468183_197_856 | 219 |
| 767 | 3300049579 | Ga0501043_0000022 | Ga0501043_0000022_101570_102232 | 219 |
| 768 | 3300049579 | Ga0501043_0000088 | Ga0501043_0000088_38110_38772 | 219 |
| 769 | 3300049579 | Ga0501043_0017381 | Ga0501043_0017381_2712_3374 | 219 |
| 770 | 3300049579 | Ga0501043_0453175 | Ga0501043_0453175_108_767 | 219 |
| 771 | 3300049580 | Ga0501046_0012919 | Ga0501046_0012919_1959_2621 | 219 |
| 772 | 3300049580 | Ga0501046_0014815 | Ga0501046_0014815_5624_6283 | 219 |
| 773 | 3300049580 | Ga0501046_0088424 | Ga0501046_0088424_85_747 | 219 |
| 774 | 3300049581 | Ga0501047_0014062 | Ga0501047_0014062_5335_5997 | 219 |
| 775 | 3300049581 | Ga0501047_0065071 | Ga0501047_0065071_2115_2777 | 219 |
| 776 | 3300049581 | Ga0501047_0087503 | Ga0501047_0087503_1270_1932 | 219 |
| 777 | 3300049581 | Ga0501047_0102861 | Ga0501047_0102861_1227_1889 | 219 |
| 778 | 3300049581 | Ga0501047_0181467 | Ga0501047_0181467_1171_1833 | 219 |
| 779 | 3300049581 | Ga0501047_0400807 | Ga0501047_0400807_270_932 | 219 |
| 780 | 3300049581 | Ga0501047_0451074 | Ga0501047_0451074_321_980 | 219 |
| 781 | 3300049581 | Ga0501047_0546877 | Ga0501047_0546877_136_798 | 219 |
| 782 | 3300049583 | Ga0501067_0022364 | Ga0501067_0022364_2736_3398 | 219 |
| 783 | 3300049584 | Ga0501068_0031056 | Ga0501068_0031056_582_1244 | 219 |
| 784 | 3300049584 | Ga0501068_0222000 | Ga0501068_0222000_15_674 | 219 |
| 785 | 3300049585 | Ga0501069_0000284 | Ga0501069_0000284_9130_9792 | 219 |
| 786 | 3300049585 | Ga0501069_0017700 | Ga0501069_0017700_2072_2734 | 219 |
| 787 | 3300049586 | Ga0501070_0000103 | Ga0501070_0000103_48326_48988 | 219 |
| 788 | 3300049586 | Ga0501070_0007102 | Ga0501070_0007102_3014_3676 | 219 |
| 789 | 3300049586 | Ga0501070_0014430 | Ga0501070_0014430_180_842 | 219 |
| 790 | 3300049586 | Ga0501070_0152142 | Ga0501070_0152142_503_1165 | 219 |
| 791 | 3300049586 | Ga0501070_0246332 | Ga0501070_0246332_284_946 | 219 |
| 792 | 3300049587 | Ga0501071_0050853 | Ga0501071_0050853_1447_2109 | 219 |
| 793 | 3300049589 | Ga0501073_0016951 | Ga0501073_0016951_3671_4333 | 219 |
| 794 | 3300049589 | Ga0501073_0254797 | Ga0501073_0254797_461_1123 | 219 |
| 795 | 3300049589 | Ga0501073_0392706 | Ga0501073_0392706_70_732 | 219 |
| 796 | 3300049590 | Ga0501074_0001426 | Ga0501074_0001426_9693_10355 | 219 |
| 797 | 3300049590 | Ga0501074_0013544 | Ga0501074_0013544_1379_2041 | 219 |
| 798 | 3300049590 | Ga0501074_0098204 | Ga0501074_0098204_996_1658 | 219 |
| 799 | 3300049590 | Ga0501074_0651818 | Ga0501074_0651818_59_721 | 219 |
| 800 | 3300049741 | Ga0501079_0467541 | Ga0501079_0467541_87_749 | 219 |
| 801 | 3300049742 | Ga0501080_0035831 | Ga0501080_0035831_2778_3440 | 219 |
| 802 | 3300049742 | Ga0501080_0046275 | Ga0501080_0046275_2956_3618 | 219 |
| 803 | 3300049742 | Ga0501080_0098650 | Ga0501080_0098650_1249_1911 | 219 |
| 804 | 3300049744 | Ga0501083_0000374 | Ga0501083_0000374_14422_15084 | 219 |
| 805 | 3300049822 | Ga0501035_0000047 | Ga0501035_0000047_77229_77891 | 219 |
| 806 | 3300049822 | Ga0501035_0002644 | Ga0501035_0002644_13377_14039 | 219 |
| 807 | 3300049822 | Ga0501035_0002789 | Ga0501035_0002789_11566_12228 | 219 |
| 808 | 3300049822 | Ga0501035_0003617 | Ga0501035_0003617_13249_13911 | 219 |
| 809 | 3300049822 | Ga0501035_0016993 | Ga0501035_0016993_4966_5628 | 219 |
| 810 | 3300049822 | Ga0501035_0044652 | Ga0501035_0044652_895_1557 | 219 |
| 811 | 3300049822 | Ga0501035_0128449 | Ga0501035_0128449_1077_1739 | 219 |
| 812 | 3300049822 | Ga0501035_0132124 | Ga0501035_0132124_121_780 | 219 |
| 813 | 3300049823 | Ga0501044_0003500 | Ga0501044_0003500_11348_12010 | 219 |
| 814 | 3300049823 | Ga0501044_0007915 | Ga0501044_0007915_8490_9152 | 219 |
| 815 | 3300049823 | Ga0501044_0013751 | Ga0501044_0013751_3668_4330 | 219 |
| 816 | 3300049823 | Ga0501044_0048111 | Ga0501044_0048111_3502_4164 | 219 |
| 817 | 3300049823 | Ga0501044_0114660 | Ga0501044_0114660_700_1362 | 219 |
| 818 | 3300049823 | Ga0501044_0164871 | Ga0501044_0164871_136_795 | 219 |
| 819 | 3300049823 | Ga0501044_0197805 | Ga0501044_0197805_1196_1858 | 219 |
| 820 | 3300049823 | Ga0501044_0277499 | Ga0501044_0277499_364_1026 | 219 |
| 821 | 3300049823 | Ga0501044_0379739 | Ga0501044_0379739_251_913 | 219 |
| 822 | 3300049824 | Ga0501045_0300157 | Ga0501045_0300157_178_837 | 219 |
| 823 | 3300050489 | nmdc:mga03683_77172_c1 | nmdc:mga03683_77172_c1_406_1068 | 219 |
| 824 | 3300050490 | nmdc:mga03n38_183648_c1 | nmdc:mga03n38_183648_c1_163_825 | 219 |
| 825 | 3300050490 | nmdc:mga03n38_2998_c1 | nmdc:mga03n38_2998_c1_1084_1743 | 219 |
| 826 | 3300050492 | nmdc:mga0yw44_1413_c1 | nmdc:mga0yw44_1413_c1_2392_3054 | 219 |
| 827 | 3300050492 | nmdc:mga0yw44_483546_c1 | nmdc:mga0yw44_483546_c1_74_736 | 219 |
| 828 | 3300050492 | nmdc:mga0yw44_7220_c1 | nmdc:mga0yw44_7220_c1_122_781 | 219 |
| 829 | 3300050494 | nmdc:mga06z11_18329_c1 | nmdc:mga06z11_18329_c1_279_941 | 219 |
| 830 | 3300050494 | nmdc:mga06z11_218415_c1 | nmdc:mga06z11_218415_c1_397_1059 | 219 |
| 831 | 3300050494 | nmdc:mga06z11_30040_c1 | nmdc:mga06z11_30040_c1_491_1156 | 219 |
| 832 | 3300050494 | nmdc:mga06z11_7530_c1 | nmdc:mga06z11_7530_c1_2155_2814 | 219 |
| 833 | 3300050495 | nmdc:mga04h51_105845_c1 | nmdc:mga04h51_105845_c1_130_792 | 219 |
| 834 | 3300050516 | nmdc:mga0sz30_1456_c1 | nmdc:mga0sz30_1456_c1_92_754 | 219 |
| 835 | 3300053079 | Ga0500610_0037028 | Ga0500610_0037028_155_817 | 219 |
| 836 | 3300053083 | Ga0495655_0029661 | Ga0495655_0029661_145_807 | 219 |
| 837 | 3300053086 | Ga0500578_0096475 | Ga0500578_0096475_882_1550 | 219 |
| 838 | 3300053119 | Ga0500595_049433 | Ga0500595_049433_228_890 | 219 |
| 839 | 3300053134 | Ga0500658_0150608 | Ga0500658_0150608_10_672 | 219 |
| 840 | 3300053139 | Ga0500568_0000209 | Ga0500568_0000209_4226_4903 | 219 |
| 841 | 3300053151 | Ga0500604_0015119 | Ga0500604_0015119_355_1017 | 219 |
| 842 | 3300053151 | Ga0500604_0117993 | Ga0500604_0117993_16_678 | 219 |
| 843 | 3300053155 | Ga0500620_007680 | Ga0500620_007680_979_1641 | 219 |
| 844 | 3300053158 | Ga0500627_0072549 | Ga0500627_0072549_208_870 | 219 |
| 845 | 3300053727 | Ga0500611_028533 | Ga0500611_028533_218_880 | 219 |
| 846 | 3300053731 | Ga0500609_012103 | Ga0500609_012103_435_1097 | 219 |
| 847 | iso_pu_bacteria | 2597489875 | 2597815180 | 219 |
| 848 | iso_pu_bacteria | 2643221550 | 2643774108 | 219 |
| 849 | iso_pu_bacteria | 2856342000 | 2856345604 | 219 |
| 850 | iso_pu_bacteria | 2856349417 | 2856353688 | 219 |
| 851 | iso_pu_bacteria | 2876369609 | 2876376846 | 219 |
| 852 | iso_pu_bacteria | 2881147464 | 2881153845 | 219 |
| 853 | iso_pu_bacteria | 2881155292 | 2881157627 | 219 |
| 854 | iso_pu_bacteria | 2881161766 | 2881162989 | 219 |
| 855 | iso_pu_bacteria | 2881853255 | 2881853953 | 219 |
| 856 | iso_pu_bacteria | 2885305155 | 2885311780 | 219 |
| 857 | iso_pu_bacteria | 2885334103 | 2885340445 | 219 |
| 858 | iso_pu_bacteria | 2885342637 | 2885350004 | 219 |
| 859 | iso_pu_bacteria | 2885350715 | 2885350819 | 219 |
| 860 | iso_pu_bacteria | 2888343758 | 2888348629 | 219 |
| 861 | iso_pu_bacteria | 2924754689 | 2924761515 | 219 |
| 862 | iso_pu_bacteria | 2937836603 | 2937842738 | 219 |
| 863 | iso_pu_bacteria | 2937848649 | 2937850683 | 219 |
| 864 | iso_pu_bacteria | 2958071322 | 2958074952 | 219 |
| 865 | iso_pu_bacteria | 2958172287 | 2958178260 | 219 |
| 866 | iso_pu_bacteria | 2970524798 | 2970529562 | 219 |
| 867 | iso_pu_bacteria | 2970540015 | 2970545386 | 219 |
| 868 | iso_pu_bacteria | 2977858184 | 2977862213 | 219 |
| 869 | iso_pu_bacteria | 2977922695 | 2977927628 | 219 |
| 870 | iso_pu_bacteria | 2977971508 | 2977973200 | 219 |
| 871 | iso_pu_bacteria | 2977986579 | 2977987676 | 219 |
| 872 | iso_pu_bacteria | 2979710463 | 2979717613 | 219 |
| 873 | iso_pu_bacteria | 2979742915 | 2979744506 | 219 |
| 874 | iso_pu_bacteria | 2987652177 | 2987652214 | 219 |
| 875 | iso_pu_bacteria | 3004211236 | 3004214466 | 219 |
| 876 | iso_pu_bacteria | 3004218560 | 3004223569 | 219 |
| 877 | iso_pu_bacteria | 8004633249 | 8004633795 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2no4-assembly1.cif.gz_B | crystal structure analysis of a dehalogenase | 0.9785 | 3 | 215 |
| 2no5-assembly1.cif.gz_B | crystal structure analysis of a dehalogenase with intermediate complex | 0.9716 | 2 | 215 |
| 2no4-assembly1.cif.gz_B | crystal structure analysis of a dehalogenase | 0.952 | 3 | 215 |
| 3um9-assembly1.cif.gz_B | crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 | 0.9509 | 3 | 217 |
| 3umb-assembly1.cif.gz_A-2 | crystal structure of the l-2-haloacid dehalogenase rsc1362 | 0.9501 | 1 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2no5A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9869 | 92 | 215 | 3.40.50.1000 |
| 1zrmA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9583 | 3 | 217 | 3.40.50.1000 |
| 2no5B02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.9382 | 17 | 89 | 1.10.150.240 |
| 1zrmA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9324 | 3 | 217 | 3.40.50.1000 |
| 2w43A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9245 | 92 | 217 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A531M6S1-F1-model_v4 | (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) | 0.9978 | 1 | 171 |
GO:0018784
|
| AF-A0A434CLW1-F1-model_v4 | (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) | 0.9952 | 1 | 142 |
GO:0018784
|
| AF-X5R813-F1-model_v4 | (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) | 0.995 | 1 | 218 |
GO:0018784
|
| AF-A0A345ZV89-F1-model_v4 | (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) | 0.995 | 4 | 217 |
GO:0018784
|
| AF-A0A7X1HG32-F1-model_v4 | (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) | 0.9944 | 3 | 217 |
GO:0018784
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar