F484389

General Info

Members Datasets Scaffolds Average Seq Length
877 295 1754 149

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10260748|Ga0157373_102607482
Length 156
Sequence VNEMNQPQSQGVTLEIQDIVRLLPHRYPFLLVDRILNVDGDNSCIGIKNVTVNEPFFPGHFPARPVMPGVLLIEGMAQTAGAICTLSRMDKKPPKSVLFLTVDKAKFRRPVVPGDVVEYHMTKKSQRKLMWWFRGEAKVRGELVAEAEVGAMIVDE

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
238 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
295 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 1.71
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 9.01
Rhizosphere 89.4
Stem 0
Stem Tuber 0
Unclassified 5.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10260748 3300013100 Bacteria 1226
2 Ga0070658_10077027 3300005327 Bacteria 2735
3 Ga0070658_10119088 3300005327 Bacteria 2193
4 Ga0070658_10240372 3300005327 Bacteria 1535
5 Ga0070658_10286934 3300005327 Bacteria 1402
6 Ga0070683_100098993 3300005329 Bacteria 2744
7 Ga0070680_100046688 3300005336 Bacteria 3524
8 Ga0070680_100148285 3300005336 Bacteria 1969
9 Ga0070680_100340398 3300005336 Bacteria 1274
10 Ga0070680_100696672 3300005336 Bacteria 874
11 Ga0070682_100000772 3300005337 Bacteria 18888
12 Ga0070682_100235764 3300005337 Bacteria 1311
13 Ga0070682_100591179 3300005337 Bacteria 875
14 Ga0068868_101152761 3300005338 Bacteria 715
15 Ga0070660_100025106 3300005339 Bacteria 4427
16 Ga0070660_100062235 3300005339 Bacteria 2899
17 Ga0070660_100085622 3300005339 Bacteria 2479
18 Ga0070660_100138224 3300005339 Bacteria 1953
19 Ga0070660_100397188 3300005339 Bacteria 1140
20 Ga0070660_100691423 3300005339 Bacteria 855
21 Ga0070660_100779159 3300005339 Unclassified 804
22 Ga0070691_10134671 3300005341 Bacteria 1255
23 Ga0070661_100313734 3300005344 Bacteria 1223
24 Ga0070661_100982745 3300005344 Bacteria 700
25 Ga0070692_10551980 3300005345 Bacteria 755
26 Ga0070675_101010204 3300005354 Bacteria 764
27 Ga0070675_101194960 3300005354 Bacteria 700
28 Ga0070671_100298514 3300005355 Bacteria 1371
29 Ga0070671_100520779 3300005355 Bacteria 1024
30 Ga0070703_10073215 3300005406 Bacteria 1149
31 Ga0070709_10069891 3300005434 Bacteria 2262
32 Ga0070709_10277901 3300005434 Bacteria 1216
33 Ga0070714_100001442 3300005435 Bacteria 17314
34 Ga0070714_100001730 3300005435 Bacteria 15912
35 Ga0070714_100008154 3300005435 Bacteria 8164
36 Ga0070714_100028037 3300005435 Bacteria 4668
37 Ga0070714_100120683 3300005435 Bacteria 2331
38 Ga0070714_100137599 3300005435 Unclassified 2189
39 Ga0070714_100316964 3300005435 Bacteria 1457
40 Ga0070714_101084003 3300005435 Bacteria 780
41 Ga0070713_100027513 3300005436 Bacteria 4477
42 Ga0070713_100029682 3300005436 Bacteria 4333
43 Ga0070713_100097436 3300005436 Bacteria 2541
44 Ga0070713_100214119 3300005436 Bacteria 1745
45 Ga0070713_100813950 3300005436 Bacteria 896
46 Ga0070710_10004523 3300005437 Bacteria 6575
47 Ga0070711_100032777 3300005439 Bacteria 3457
48 Ga0070711_100088200 3300005439 Bacteria 2229
49 Ga0070711_100194348 3300005439 Bacteria 1561
50 Ga0070711_100284269 3300005439 Bacteria 1310
51 Ga0070711_100596461 3300005439 Bacteria 921
52 Ga0070711_100968706 3300005439 Bacteria 729
53 Ga0070694_100043187 3300005444 Bacteria 3014
54 Ga0070708_100140293 3300005445 Bacteria 2241
55 Ga0070708_100263613 3300005445 Bacteria 1620
56 Ga0070708_100897480 3300005445 Bacteria 832
57 Ga0070663_100676971 3300005455 Bacteria 875
58 Ga0070681_10027297 3300005458 Bacteria 5739
59 Ga0070681_10036000 3300005458 Bacteria 4972
60 Ga0070681_10051344 3300005458 Bacteria 4113
61 Ga0070681_10057780 3300005458 Bacteria 3860
62 Ga0070681_10262884 3300005458 Bacteria 1637
63 Ga0070681_10555920 3300005458 Bacteria 1061
64 Ga0070681_11071621 3300005458 Bacteria 726
65 Ga0070707_100001128 3300005468 Bacteria 26352
66 Ga0070707_100097095 3300005468 Bacteria 2854
67 Ga0070707_100139777 3300005468 Bacteria 2357
68 Ga0070707_100229155 3300005468 Bacteria 1809
69 Ga0070707_100344411 3300005468 Bacteria 1448
70 Ga0070707_100426793 3300005468 Bacteria 1286
71 Ga0070698_100023352 3300005471 Bacteria 6464
72 Ga0070698_100066288 3300005471 Bacteria 3635
73 Ga0070698_100096124 3300005471 Bacteria 2939
74 Ga0070698_100375402 3300005471 Bacteria 1354
75 Ga0070679_100051987 3300005530 Bacteria 4082
76 Ga0070679_100065672 3300005530 Bacteria 3616
77 Ga0070679_100080703 3300005530 Bacteria 3242
78 Ga0070679_100321897 3300005530 Bacteria 1495
79 Ga0070679_101215223 3300005530 Unclassified 699
80 Ga0070684_100230630 3300005535 Bacteria 1691
81 Ga0070684_100518743 3300005535 Bacteria 1104
82 Ga0070697_100037020 3300005536 Bacteria 3942
83 Ga0070697_100718080 3300005536 Bacteria 882
84 Ga0070697_101063564 3300005536 Bacteria 720
85 Ga0068853_100362468 3300005539 Bacteria 1350
86 Ga0070686_100113072 3300005544 Bacteria 1853
87 Ga0070695_100000029 3300005545 Bacteria 53859
88 Ga0070696_100367656 3300005546 Bacteria 1118
89 Ga0070693_100182825 3300005547 Bacteria 1351
90 Ga0070693_100947917 3300005547 Bacteria 648
91 Ga0070704_100669133 3300005549 Bacteria 918
92 Ga0068855_100044799 3300005563 Bacteria 5234
93 Ga0068855_100070085 3300005563 Bacteria 4080
94 Ga0068855_100980471 3300005563 Bacteria 889
95 Ga0068855_101612890 3300005563 Bacteria 664
96 Ga0070664_100088058 3300005564 Bacteria 2685
97 Ga0068857_100103084 3300005577 Bacteria 2562
98 Ga0068856_100098363 3300005614 Bacteria 2916
99 Ga0068856_101264215 3300005614 Unclassified 754
100 Ga0068856_101584317 3300005614 Bacteria 668
101 Ga0070702_100284521 3300005615 Bacteria 1137
102 Ga0068852_100316316 3300005616 Bacteria 1515
103 Ga0068852_100834755 3300005616 Bacteria 937
104 Ga0068852_101648512 3300005616 Bacteria 664
105 Ga0068851_10586558 3300005834 Bacteria 677
106 Ga0068863_100191810 3300005841 Bacteria 1964
107 Ga0081538_10033321 3300005981 Bacteria 3432
108 Ga0070717_10016372 3300006028 Bacteria 5748
109 Ga0070717_10029414 3300006028 Bacteria 4407
110 Ga0070717_10031104 3300006028 Bacteria 4292
111 Ga0070717_10080120 3300006028 Bacteria 2739
112 Ga0070717_10145688 3300006028 Bacteria 2045
113 Ga0070717_10158291 3300006028 Bacteria 1963
114 Ga0070717_10860777 3300006028 Bacteria 825
115 Ga0075364_10003592 3300006051 Bacteria 8834
116 Ga0070715_10250386 3300006163 Bacteria 926
117 Ga0070716_100041828 3300006173 Bacteria 2555
118 Ga0070716_100471412 3300006173 Bacteria 920
119 Ga0070712_100052688 3300006175 Bacteria 2839
120 Ga0070712_100087058 3300006175 Bacteria 2278
121 Ga0070712_100210926 3300006175 Bacteria 1531
122 Ga0070712_100513907 3300006175 Bacteria 1005
123 Ga0075367_10093994 3300006178 Bacteria 1827
124 Ga0075367_10146206 3300006178 Bacteria 1466
125 Ga0075433_10688127 3300006852 Bacteria 896
126 Ga0075434_100002359 3300006871 Bacteria 16542
127 Ga0075434_100042304 3300006871 Bacteria 4517
128 Ga0075436_100003536 3300006914 Bacteria 10715
129 Ga0075436_100142117 3300006914 Bacteria 1687
130 Ga0075436_100287087 3300006914 Bacteria 1177
131 Ga0075436_100454671 3300006914 Bacteria 933
132 Ga0075435_100112723 3300007076 Bacteria 2263
133 Ga0075435_100796061 3300007076 Bacteria 823
134 Ga0105240_10010108 3300009093 Bacteria 13279
135 Ga0105240_10023072 3300009093 Bacteria 8241
136 Ga0105240_10036412 3300009093 Bacteria 6331
137 Ga0105240_10186268 3300009093 Bacteria 2445
138 Ga0105245_10730365 3300009098 Bacteria 1025
139 Ga0105241_10596901 3300009174 Bacteria 997
140 Ga0105248_10246668 3300009177 Bacteria 2010
141 Ga0105237_10064368 3300009545 Bacteria 3663
142 Ga0105237_10413288 3300009545 Bacteria 1354
143 Ga0105237_11385020 3300009545 Bacteria 710
144 Ga0105237_11918162 3300009545 Bacteria 600
145 Ga0105238_10093907 3300009551 Bacteria 2988
146 Ga0105238_10457848 3300009551 Bacteria 1273
147 Ga0099796_10054239 3300010159 Unclassified 1401
148 Ga0105239_10058833 3300010375 Bacteria 4217
149 Ga0105239_11000878 3300010375 Bacteria 961
150 Ga0157373_10043309 3300013100 Bacteria 3215
151 Ga0157373_10472871 3300013100 Bacteria 904
152 Ga0157373_10553350 3300013100 Bacteria 835
153 Ga0157373_11454715 3300013100 Bacteria 522
154 Ga0157371_10636437 3300013102 Bacteria 795
155 Ga0157370_10013425 3300013104 Bacteria 8439
156 Ga0157370_10088032 3300013104 Bacteria 2916
157 Ga0157370_10915501 3300013104 Unclassified 795
158 Ga0157369_10013174 3300013105 Bacteria 9357
159 Ga0157369_10033465 3300013105 Bacteria 5648
160 Ga0157369_10283362 3300013105 Bacteria 1726
161 Ga0157369_10369988 3300013105 Bacteria 1488
162 Ga0157369_10402020 3300013105 Bacteria 1421
163 Ga0157369_10481476 3300013105 Unclassified 1284
164 Ga0157369_11260523 3300013105 Bacteria 754
165 Ga0157374_10702232 3300013296 Bacteria 1025
166 Ga0157374_11850541 3300013296 Bacteria 629
167 Ga0157378_10744068 3300013297 Bacteria 1003
168 Ga0163162_10154082 3300013306 Bacteria 2417
169 Ga0157372_10007615 3300013307 Bacteria 11515
170 Ga0157372_10353420 3300013307 Bacteria 1712
171 Ga0157372_10588257 3300013307 Bacteria 1297
172 Ga0157372_11080743 3300013307 Bacteria 928
173 Ga0157375_12465529 3300013308 Unclassified 621
174 Ga0163163_10571131 3300014325 Bacteria 1194
175 Ga0182008_10003425 3300014497 Bacteria 9576
176 Ga0182008_10025785 3300014497 Bacteria 2985
177 Ga0182008_10188646 3300014497 Unclassified 1045
178 Ga0157379_11785684 3300014968 Bacteria 604
179 Ga0157376_10031446 3300014969 Bacteria 4250
180 Ga0182006_1013195 3300015261 Bacteria 3591
181 Ga0182007_10013137 3300015262 Bacteria 3169
182 Ga0182005_1139216 3300015265 Bacteria 700
183 Ga0197907_11037992 3300020069 Bacteria 1851
184 Ga0206356_10027961 3300020070 Bacteria 1681
185 Ga0206356_11522396 3300020070 Bacteria 2193
186 Ga0206356_11548852 3300020070 Bacteria 1478
187 Ga0206354_10162523 3300020081 Bacteria 760
188 Ga0206354_10280470 3300020081 Bacteria 1223
189 Ga0206354_10581218 3300020081 Bacteria 1274
190 Ga0206354_11352109 3300020081 Bacteria 684
191 Ga0206354_11453059 3300020081 Bacteria 2634
192 Ga0206353_10217476 3300020082 Bacteria 1790
193 Ga0206353_10335970 3300020082 Bacteria 1193
194 Ga0206353_10928214 3300020082 Bacteria 2944
195 Ga0206353_11341242 3300020082 Bacteria 2465
196 Ga0206353_12063638 3300020082 Bacteria 3769
197 Ga0224712_10026165 3300022467 Bacteria 2060
198 Ga0207692_10047524 3300025898 Bacteria 2155
199 Ga0207692_10187343 3300025898 Bacteria 1209
200 Ga0207692_10476687 3300025898 Bacteria 789
201 Ga0207685_10114734 3300025905 Bacteria 1173
202 Ga0207699_10005456 3300025906 Bacteria 6086
203 Ga0207699_10260711 3300025906 Bacteria 1198
204 Ga0207705_10009302 3300025909 Bacteria 7146
205 Ga0207705_10090975 3300025909 Bacteria 2234
206 Ga0207705_10107552 3300025909 Bacteria 2058
207 Ga0207705_10272643 3300025909 Bacteria 1294
208 Ga0207705_10342036 3300025909 Bacteria 1152
209 Ga0207705_11098974 3300025909 Bacteria 612
210 Ga0207707_10013404 3300025912 Bacteria 7147
211 Ga0207707_10018329 3300025912 Bacteria 6102
212 Ga0207707_10073051 3300025912 Bacteria 2990
213 Ga0207707_10084670 3300025912 Bacteria 2769
214 Ga0207707_10183900 3300025912 Bacteria 1824
215 Ga0207707_10269275 3300025912 Bacteria 1476
216 Ga0207707_10927744 3300025912 Bacteria 718
217 Ga0207695_10030376 3300025913 Bacteria 5948
218 Ga0207695_10654536 3300025913 Bacteria 931
219 Ga0207695_11728477 3300025913 Bacteria 507
220 Ga0207671_10375002 3300025914 Bacteria 1130
221 Ga0207693_10020457 3300025915 Bacteria 5264
222 Ga0207693_10052882 3300025915 Bacteria 3186
223 Ga0207693_10241259 3300025915 Bacteria 1418
224 Ga0207693_11286048 3300025915 Bacteria 548
225 Ga0207663_10161964 3300025916 Bacteria 1580
226 Ga0207663_10183229 3300025916 Bacteria 1497
227 Ga0207663_10285313 3300025916 Bacteria 1228
228 Ga0207663_10515222 3300025916 Bacteria 931
229 Ga0207663_10573485 3300025916 Bacteria 884
230 Ga0207660_10098505 3300025917 Unclassified 2181
231 Ga0207660_10242086 3300025917 Bacteria 1421
232 Ga0207660_10311739 3300025917 Bacteria 1255
233 Ga0207660_10800396 3300025917 Unclassified 769
234 Ga0207660_11104569 3300025917 Bacteria 646
235 Ga0207657_10013743 3300025919 Bacteria 7926
236 Ga0207657_10028373 3300025919 Bacteria 5106
237 Ga0207657_10053710 3300025919 Bacteria 3489
238 Ga0207657_10061747 3300025919 Bacteria 3211
239 Ga0207657_10307677 3300025919 Bacteria 1255
240 Ga0207657_10320892 3300025919 Bacteria 1225
241 Ga0207649_10722288 3300025920 Bacteria 774
242 Ga0207652_10114951 3300025921 Bacteria 2390
243 Ga0207652_10159422 3300025921 Bacteria 2022
244 Ga0207652_10262398 3300025921 Bacteria 1558
245 Ga0207652_10279447 3300025921 Bacteria 1506
246 Ga0207652_11015729 3300025921 Unclassified 728
247 Ga0207652_11394116 3300025921 Bacteria 604
248 Ga0207646_10003943 3300025922 Bacteria 16459
249 Ga0207646_10266726 3300025922 Bacteria 1548
250 Ga0207646_10289617 3300025922 Bacteria 1480
251 Ga0207646_10529585 3300025922 Bacteria 1060
252 Ga0207694_10139557 3300025924 Bacteria 1948
253 Ga0207687_10121658 3300025927 Bacteria 1953
254 Ga0207700_10154134 3300025928 Bacteria 1902
255 Ga0207700_10568213 3300025928 Bacteria 1008
256 Ga0207664_10007454 3300025929 Bacteria 7588
257 Ga0207664_10019236 3300025929 Bacteria 5044
258 Ga0207664_10025643 3300025929 Bacteria 4445
259 Ga0207664_10049060 3300025929 Bacteria 3322
260 Ga0207664_10059156 3300025929 Unclassified 3051
261 Ga0207664_10242555 3300025929 Bacteria 1570
262 Ga0207664_10251574 3300025929 Bacteria 1542
263 Ga0207664_10317572 3300025929 Bacteria 1374
264 Ga0207664_10317877 3300025929 Bacteria 1373
265 Ga0207664_10319332 3300025929 Bacteria 1370
266 Ga0207664_10555673 3300025929 Bacteria 1030
267 Ga0207644_10091555 3300025931 Bacteria 2268
268 Ga0207686_10810993 3300025934 Bacteria 751
269 Ga0207665_10001348 3300025939 Bacteria 16557
270 Ga0207665_10102769 3300025939 Bacteria 1998
271 Ga0207665_10260740 3300025939 Bacteria 1284
272 Ga0207665_10310301 3300025939 Bacteria 1181
273 Ga0207665_10604255 3300025939 Bacteria 857
274 Ga0207711_10517683 3300025941 Bacteria 1112
275 Ga0207661_10181222 3300025944 Bacteria 1840
276 Ga0207661_10244532 3300025944 Bacteria 1593
277 Ga0207661_11100131 3300025944 Bacteria 732
278 Ga0207667_10186001 3300025949 Bacteria 2132
279 Ga0207667_10244522 3300025949 Bacteria 1836
280 Ga0207667_10258869 3300025949 Bacteria 1779
281 Ga0207667_10416902 3300025949 Bacteria 1366
282 Ga0207667_10683456 3300025949 Bacteria 1030
283 Ga0207667_10837863 3300025949 Bacteria 914
284 Ga0207712_10178408 3300025961 Bacteria 1666
285 Ga0207640_10141303 3300025981 Bacteria 1755
286 Ga0207639_10558783 3300026041 Bacteria 1051
287 Ga0207639_11055357 3300026041 Bacteria 762
288 Ga0207678_10417337 3300026067 Bacteria 1163
289 Ga0207702_10113980 3300026078 Bacteria 2408
290 Ga0207702_10148408 3300026078 Bacteria 2131
291 Ga0207702_10544779 3300026078 Bacteria 1134
292 Ga0207641_10039645 3300026088 Bacteria 3941
293 Ga0207698_10422343 3300026142 Bacteria 1280
294 Ga0207698_10447569 3300026142 Bacteria 1246
295 Ga0207698_10918802 3300026142 Bacteria 883
296 Ga0209813_10258041 3300027866 Bacteria 664
297 Ga0265326_10036019 3300028558 Bacteria 1407
298 Ga0265326_10128514 3300028558 Bacteria 722
299 Ga0265319_1006111 3300028563 Bacteria 5631
300 Ga0265319_1039562 3300028563 Bacteria 1597
301 Ga0265334_10014826 3300028573 Bacteria 3244
302 Ga0265334_10020139 3300028573 Bacteria 2734
303 Ga0265318_10000691 3300028577 Bacteria 22716
304 Ga0265318_10100256 3300028577 Bacteria 1066
305 Ga0265323_10013669 3300028653 Bacteria 3231
306 Ga0265323_10079191 3300028653 Unclassified 1112
307 Ga0265322_10009294 3300028654 Bacteria 2855
308 Ga0265336_10019405 3300028666 Bacteria 2193
309 Ga0265338_10001048 3300028800 Bacteria 46186
310 Ga0265338_10003605 3300028800 Bacteria 21613
311 Ga0265338_10007115 3300028800 Bacteria 14011
312 Ga0265338_10022563 3300028800 Bacteria 6510
313 Ga0265338_10039236 3300028800 Bacteria 4472
314 Ga0265338_10102538 3300028800 Bacteria 2326
315 Ga0265338_10231610 3300028800 Bacteria 1373
316 Ga0265338_10478762 3300028800 Bacteria 879
317 Ga0265324_10011053 3300029957 Bacteria 3455
318 Ga0265324_10060109 3300029957 Unclassified 1299
319 Ga0265330_10028366 3300031235 Bacteria 2523
320 Ga0265330_10063169 3300031235 Unclassified 1609
321 Ga0265330_10302547 3300031235 Bacteria 674
322 Ga0265328_10019067 3300031239 Bacteria 2639
323 Ga0265320_10017612 3300031240 Bacteria 3960
324 Ga0265320_10030136 3300031240 Bacteria 2801
325 Ga0265325_10000102 3300031241 Bacteria 59998
326 Ga0265325_10203959 3300031241 Bacteria 911
327 Ga0265325_10246858 3300031241 Unclassified 809
328 Ga0265329_10086720 3300031242 Unclassified 992
329 Ga0265340_10009900 3300031247 Bacteria 5108
330 Ga0265340_10167127 3300031247 Unclassified 997
331 Ga0265339_10011424 3300031249 Bacteria 5465
332 Ga0265339_10150598 3300031249 Bacteria 1177
333 Ga0265331_10061744 3300031250 Bacteria 1768
334 Ga0265331_10095560 3300031250 Unclassified 1371
335 Ga0265327_10025194 3300031251 Bacteria 3474
336 Ga0265327_10124888 3300031251 Bacteria 1216
337 Ga0265327_10135228 3300031251 Unclassified 1156
338 Ga0265316_10021633 3300031344 Bacteria 5441
339 Ga0265313_10006148 3300031595 Bacteria 8619
340 Ga0265313_10090527 3300031595 Bacteria 1374
341 Ga0265314_10003427 3300031711 Bacteria 15325
342 Ga0265342_10038790 3300031712 Bacteria 2899
343 Ga0316583_10014535 3300032133 Bacteria 2837
344 Ga0316583_10038708 3300032133 Bacteria 1690
345 Ga0316583_10039538 3300032133 Bacteria 1670
346 Ga0373934_0037792 3300035086 Bacteria 1901
347 Ga0373923_0254471 3300035111 Bacteria 823
348 Ga0373936_0176263 3300035113 Bacteria 936
349 Ga0373941_0254590 3300035115 Bacteria 687
350 Ga0373945_0005783 3300035116 Bacteria 3968
351 Ga0373945_0209764 3300035116 Bacteria 811
352 Ga0373954_0155027 3300035118 Unclassified 1120
353 Ga0373956_0042005 3300035119 Bacteria 2032
354 Ga0373956_0372871 3300035119 Bacteria 681
355 Ga0373957_0090977 3300035120 Bacteria 1213
356 Ga0373960_0120036 3300035121 Bacteria 872
357 Ga0373943_0002704 3300035170 Bacteria 8056
358 Ga0373943_0365015 3300035170 Bacteria 829
359 Ga0373946_0021452 3300035171 Bacteria 2505
360 Ga0373955_0016364 3300035172 Bacteria 3649
361 Ga0373955_0159308 3300035172 Bacteria 1331
362 Ga0373955_0309974 3300035172 Bacteria 953
363 Ga0373955_0340373 3300035172 Unclassified 908
364 Ga0373924_0049640 3300035410 Bacteria 1737
365 Ga0373924_0089194 3300035410 Bacteria 1318
366 Ga0373924_0179913 3300035410 Bacteria 930
367 Ga0373931_0180163 3300035691 Bacteria 1251
368 Ga0373931_0259568 3300035691 Bacteria 1060
369 Ga0373933_0156210 3300035724 Bacteria 1447
370 Ga0373947_0556874 3300035725 Bacteria 781
371 Ga0373937_0003562 3300036401 Bacteria 13119
372 Ga0373937_1031926 3300036401 Bacteria 771
373 Ga0373925_0001320 3300037068 Bacteria 21707
374 Ga0373925_0484484 3300037068 Bacteria 1015
375 Ga0395899_0161575 3300037312 Bacteria 1582
376 Ga0395899_0167975 3300037312 Bacteria 1546
377 Ga0395900_0101231 3300037418 Bacteria 2959
378 Ga0395900_0153540 3300037418 Bacteria 2352
379 Ga0395900_0160762 3300037418 Bacteria 2291
380 Ga0395900_0222339 3300037418 Bacteria 1902
381 Ga0395900_0229986 3300037418 Bacteria 1865
382 Ga0395900_0673417 3300037418 Bacteria 970
383 Ga0395900_0804888 3300037418 Bacteria 867
384 Ga0395900_0902665 3300037418 Bacteria 807
385 Ga0395900_0994576 3300037418 Unclassified 759
386 Ga0395900_1428488 3300037418 Bacteria 605
387 Ga0395900_1470170 3300037418 Bacteria 594
388 Ga0395898_0018968 3300037466 Bacteria 7008
389 Ga0395898_0067856 3300037466 Bacteria 3452
390 Ga0395898_0088361 3300037466 Bacteria 2983
391 Ga0395898_0114073 3300037466 Bacteria 2589
392 Ga0395898_1105813 3300037466 Bacteria 726
393 Ga0395898_1819768 3300037466 Bacteria 530
394 Ga0395905_0000386 3300037471 Bacteria 62786
395 Ga0395905_0114323 3300037471 Bacteria 2536
396 Ga0395905_0121213 3300037471 Bacteria 2458
397 Ga0395905_0131737 3300037471 Bacteria 2351
398 Ga0395905_0501725 3300037471 Unclassified 1114
399 Ga0395905_0973689 3300037471 Bacteria 751
400 Ga0395901_0054876 3300038443 Bacteria 4142
401 Ga0395901_0124900 3300038443 Bacteria 2704
402 Ga0395901_0130218 3300038443 Bacteria 2643
403 Ga0395901_0147806 3300038443 Bacteria 2470
404 Ga0395901_0603215 3300038443 Bacteria 1107
405 Ga0242420_054419 3300038996 Bacteria 788
406 Ga0436365_0252739 3300039437 Bacteria 707
407 Ga0436360_0556007 3300039438 Bacteria 1634
408 Ga0436363_1430576 3300039450 Unclassified 603
409 Ga0436363_1463861 3300039450 Bacteria 976
410 Ga0451853_1828558 3300041512 Bacteria 1124
411 Ga0451853_3430042 3300041512 Bacteria 780
412 Ga0466969_0032043 3300044656 Bacteria 2673
413 Ga0466965_0011754 3300044683 Bacteria 4108
414 Ga0466965_0056962 3300044683 Bacteria 1947
415 Ga0466966_0003176 3300044684 Bacteria 10817
416 Ga0466966_0040188 3300044684 Bacteria 3010
417 Ga0466966_0243719 3300044684 Bacteria 1083
418 Ga0466966_0572357 3300044684 Bacteria 680
419 Ga0466966_0903747 3300044684 Bacteria 532
420 Ga0466961_0012817 3300044693 Bacteria 5366
421 Ga0466961_0022246 3300044693 Bacteria 4079
422 Ga0466961_0129285 3300044693 Bacteria 1583
423 Ga0466961_0245992 3300044693 Bacteria 1099
424 Ga0466961_0732636 3300044693 Bacteria 591
425 Ga0466961_0747228 3300044693 Bacteria 585
426 Ga0466961_0803150 3300044693 Unclassified 561
427 Ga0466963_0001433 3300044694 Bacteria 12841
428 Ga0466963_0002189 3300044694 Bacteria 10808
429 Ga0466963_0003641 3300044694 Bacteria 8854
430 Ga0466963_0006990 3300044694 Bacteria 6716
431 Ga0466963_0007093 3300044694 Bacteria 6673
432 Ga0466963_0008418 3300044694 Bacteria 6181
433 Ga0466963_0010262 3300044694 Bacteria 5667
434 Ga0466963_0013063 3300044694 Bacteria 5092
435 Ga0466963_0016356 3300044694 Bacteria 4612
436 Ga0466963_0021819 3300044694 Bacteria 4045
437 Ga0466963_0043897 3300044694 Bacteria 2941
438 Ga0466963_0097428 3300044694 Bacteria 2009
439 Ga0466963_0103608 3300044694 Bacteria 1949
440 Ga0466963_0213516 3300044694 Bacteria 1351
441 Ga0466963_0424630 3300044694 Bacteria 937
442 Ga0466963_0959202 3300044694 Unclassified 602
443 Ga0466963_1023291 3300044694 Bacteria 581
444 Ga0466964_0016378 3300044706 Bacteria 2830
445 Ga0466964_0019203 3300044706 Bacteria 2626
446 Ga0466964_0038264 3300044706 Bacteria 1928
447 Ga0466964_0044192 3300044706 Bacteria 1809
448 Ga0466964_0063715 3300044706 Bacteria 1540
449 Ga0466964_0072368 3300044706 Bacteria 1461
450 Ga0466964_0077099 3300044706 Bacteria 1422
451 Ga0466964_0078199 3300044706 Bacteria 1414
452 Ga0466964_0114655 3300044706 Bacteria 1206
453 Ga0466964_0345219 3300044706 Bacteria 763
454 Ga0466964_0378874 3300044706 Bacteria 734
455 Ga0453684_0644134 3300044712 Bacteria 1157
456 Ga0466971_0000170 3300044719 Bacteria 24398
457 Ga0466971_0007771 3300044719 Bacteria 4674
458 Ga0466971_0027006 3300044719 Bacteria 2569
459 Ga0466971_0034096 3300044719 Bacteria 2281
460 Ga0466971_0654262 3300044719 Unclassified 526
461 Ga0466968_0001006 3300044735 Bacteria 9928
462 Ga0466968_0019982 3300044735 Bacteria 2700
463 Ga0466968_0021702 3300044735 Bacteria 2602
464 Ga0466968_0046529 3300044735 Bacteria 1843
465 Ga0466968_0127171 3300044735 Bacteria 1157
466 Ga0466968_0132526 3300044735 Bacteria 1135
467 Ga0466968_0198853 3300044735 Bacteria 938
468 Ga0466968_0212394 3300044735 Bacteria 909
469 Ga0466968_0313522 3300044735 Bacteria 756
470 Ga0466970_0000806 3300044765 Bacteria 15112
471 Ga0466970_0015951 3300044765 Bacteria 3868
472 Ga0466970_0020042 3300044765 Bacteria 3471
473 Ga0466957_0000671 3300044842 Bacteria 17426
474 Ga0466957_0003280 3300044842 Bacteria 8862
475 Ga0466957_0004865 3300044842 Bacteria 7519
476 Ga0466957_0009740 3300044842 Bacteria 5488
477 Ga0466957_0011646 3300044842 Bacteria 5082
478 Ga0466957_0030148 3300044842 Bacteria 3238
479 Ga0466957_0031191 3300044842 Bacteria 3184
480 Ga0466957_0045424 3300044842 Bacteria 2664
481 Ga0466957_0063127 3300044842 Bacteria 2276
482 Ga0466957_0075551 3300044842 Bacteria 2091
483 Ga0466957_0139000 3300044842 Bacteria 1563
484 Ga0466957_0188090 3300044842 Bacteria 1351
485 Ga0466957_0205312 3300044842 Bacteria 1296
486 Ga0466957_0211372 3300044842 Bacteria 1277
487 Ga0466957_0318204 3300044842 Bacteria 1049
488 Ga0466957_0329970 3300044842 Bacteria 1031
489 Ga0466960_0031765 3300044901 Bacteria 2438
490 Ga0466960_0146023 3300044901 Bacteria 1260
491 Ga0466959_0000274 3300045049 Bacteria 31486
492 Ga0466959_0003637 3300045049 Bacteria 10171
493 Ga0466959_0005938 3300045049 Bacteria 8416
494 Ga0466959_0028480 3300045049 Bacteria 4142
495 Ga0466959_0066806 3300045049 Bacteria 2608
496 Ga0466959_0111214 3300045049 Bacteria 1954
497 Ga0466959_0181500 3300045049 Unclassified 1472
498 Ga0466959_0236750 3300045049 Unclassified 1262
499 Ga0466959_0458591 3300045049 Bacteria 864
500 Ga0466959_0965759 3300045049 Bacteria 568
501 Ga0466958_0000300 3300045836 Bacteria 19385
502 Ga0466958_0001062 3300045836 Bacteria 12591
503 Ga0466958_0006904 3300045836 Bacteria 6208
504 Ga0466958_0017529 3300045836 Bacteria 4143
505 Ga0466958_0021115 3300045836 Bacteria 3801
506 Ga0466958_0022617 3300045836 Bacteria 3684
507 Ga0466958_0040385 3300045836 Bacteria 2804
508 Ga0466958_0068946 3300045836 Bacteria 2162
509 Ga0466958_0116018 3300045836 Bacteria 1673
510 Ga0466958_0120128 3300045836 Bacteria 1645
511 Ga0466958_0350377 3300045836 Bacteria 950
512 Ga0466958_0424269 3300045836 Bacteria 860
513 Ga0466967_0000828 3300045976 Bacteria 16293
514 Ga0466967_0002114 3300045976 Bacteria 12193
515 Ga0466967_0002908 3300045976 Bacteria 10915
516 Ga0466967_0003311 3300045976 Bacteria 10465
517 Ga0466967_0009149 3300045976 Bacteria 7328
518 Ga0466967_0010698 3300045976 Bacteria 6897
519 Ga0466967_0012395 3300045976 Bacteria 6517
520 Ga0466967_0023141 3300045976 Bacteria 5087
521 Ga0466967_0027027 3300045976 Bacteria 4766
522 Ga0466967_0029636 3300045976 Bacteria 4583
523 Ga0466967_0033811 3300045976 Bacteria 4332
524 Ga0466967_0034791 3300045976 Bacteria 4280
525 Ga0466967_0042827 3300045976 Bacteria 3915
526 Ga0466967_0067487 3300045976 Bacteria 3190
527 Ga0466967_0072640 3300045976 Unclassified 3084
528 Ga0466967_0081515 3300045976 Bacteria 2922
529 Ga0466967_0098579 3300045976 Bacteria 2668
530 Ga0466967_0105618 3300045976 Bacteria 2580
531 Ga0466967_0107460 3300045976 Bacteria 2559
532 Ga0466967_0117557 3300045976 Bacteria 2451
533 Ga0466967_0169647 3300045976 Bacteria 2052
534 Ga0466967_0184316 3300045976 Bacteria 1970
535 Ga0466967_0204330 3300045976 Bacteria 1872
536 Ga0466967_0207943 3300045976 Bacteria 1855
537 Ga0466967_0211135 3300045976 Bacteria 1841
538 Ga0466967_0236924 3300045976 Bacteria 1739
539 Ga0466967_0255654 3300045976 Bacteria 1675
540 Ga0466967_0323107 3300045976 Bacteria 1488
541 Ga0466967_0479525 3300045976 Bacteria 1218
542 Ga0466967_0716912 3300045976 Bacteria 991
543 Ga0466967_1430949 3300045976 Bacteria 688
544 Ga0466967_1519522 3300045976 Bacteria 667
545 Ga0495592_0014141 3300046454 Bacteria 6063
546 Ga0495592_0038050 3300046454 Bacteria 3620
547 Ga0495592_0185722 3300046454 Bacteria 1412
548 Ga0495592_0223762 3300046454 Bacteria 1257
549 Ga0495603_0053526 3300046455 Bacteria 2394
550 Ga0495603_0520239 3300046455 Bacteria 681
551 Ga0495603_0604889 3300046455 Bacteria 628
552 Ga0495590_0095049 3300046457 Bacteria 1056
553 Ga0495629_0001816 3300046459 Bacteria 16725
554 Ga0495629_0320029 3300046459 Bacteria 1060
555 Ga0495629_0567865 3300046459 Bacteria 760
556 Ga0495641_0007480 3300046461 Bacteria 6809
557 Ga0495641_0142465 3300046461 Bacteria 1071
558 Ga0495641_0184946 3300046461 Bacteria 933
559 Ga0495651_0000028 3300046462 Bacteria 105473
560 Ga0495651_0111389 3300046462 Bacteria 2023
561 Ga0495653_0000965 3300046463 Bacteria 22058
562 Ga0495653_0019134 3300046463 Bacteria 5556
563 Ga0495653_0023889 3300046463 Bacteria 4933
564 Ga0495653_0061020 3300046463 Bacteria 2854
565 Ga0495653_0081081 3300046463 Bacteria 2398
566 Ga0495653_0185791 3300046463 Bacteria 1422
567 Ga0495580_0042963 3300046472 Bacteria 3217
568 Ga0495582_0012985 3300046473 Bacteria 4588
569 Ga0495582_0016268 3300046473 Bacteria 4074
570 Ga0495582_0031507 3300046473 Bacteria 2914
571 Ga0495639_0000630 3300046475 Bacteria 16276
572 Ga0495662_0001339 3300046476 Bacteria 12171
573 Ga0495662_0024242 3300046476 Bacteria 2928
574 Ga0495664_0032023 3300046477 Bacteria 3083
575 Ga0495664_0082635 3300046477 Bacteria 1926
576 Ga0495664_0105740 3300046477 Bacteria 1697
577 Ga0495664_0117867 3300046477 Bacteria 1605
578 Ga0495664_0162973 3300046477 Bacteria 1353
579 Ga0495584_0051193 3300046491 Bacteria 2080
580 Ga0495584_0713903 3300046491 Bacteria 511
581 Ga0495607_0081915 3300046501 Bacteria 1772
582 Ga0495608_0008137 3300046511 Bacteria 7364
583 Ga0495608_0008892 3300046511 Bacteria 7021
584 Ga0495608_0100374 3300046511 Bacteria 1866
585 Ga0495608_0228967 3300046511 Bacteria 1164
586 Ga0495608_0259131 3300046511 Unclassified 1083
587 Ga0495608_0339532 3300046511 Unclassified 926
588 Ga0495618_0012985 3300046514 Bacteria 5063
589 Ga0495618_0052048 3300046514 Bacteria 2587
590 Ga0495618_0113992 3300046514 Bacteria 1731
591 Ga0495618_0331322 3300046514 Bacteria 941
592 Ga0495618_0491674 3300046514 Bacteria 741
593 Ga0495618_0560170 3300046514 Bacteria 683
594 Ga0495628_0000069 3300046516 Bacteria 82366
595 Ga0495628_0041826 3300046516 Bacteria 3657
596 Ga0495628_0052488 3300046516 Bacteria 3220
597 Ga0495628_0084398 3300046516 Bacteria 2464
598 Ga0495628_0656994 3300046516 Bacteria 744
599 Ga0495628_0952469 3300046516 Bacteria 593
600 Ga0495630_0005233 3300046517 Bacteria 9144
601 Ga0495630_0015336 3300046517 Bacteria 5595
602 Ga0495630_0033318 3300046517 Bacteria 3841
603 Ga0495630_0052803 3300046517 Bacteria 3043
604 Ga0495630_0232839 3300046517 Bacteria 1407
605 Ga0495630_0284413 3300046517 Bacteria 1263
606 Ga0495630_0300788 3300046517 Bacteria 1226
607 Ga0495630_0536166 3300046517 Bacteria 897
608 Ga0495630_0651016 3300046517 Unclassified 807
609 Ga0495643_0042252 3300046522 Bacteria 2484
610 Ga0495644_0010118 3300046523 Bacteria 3634
611 Ga0495666_0000145 3300046526 Bacteria 29818
612 Ga0495642_0054501 3300046528 Bacteria 1649
613 Ga0495652_0010813 3300046529 Bacteria 8270
614 Ga0495652_0011205 3300046529 Bacteria 8119
615 Ga0495652_0040217 3300046529 Bacteria 4041
616 Ga0495652_0130565 3300046529 Bacteria 1989
617 Ga0495665_0005590 3300046531 Bacteria 6775
618 Ga0495665_0086666 3300046531 Bacteria 1646
619 Ga0495640_0017850 3300046533 Bacteria 5277
620 Ga0495640_0128572 3300046533 Bacteria 1641
621 Ga0495640_0164965 3300046533 Bacteria 1417
622 Ga0495586_0101960 3300046535 Bacteria 1593
623 Ga0495586_0202814 3300046535 Bacteria 1124
624 Ga0495586_0515229 3300046535 Bacteria 690
625 Ga0495586_0871299 3300046535 Unclassified 519
626 Ga0495587_0000062 3300046536 Bacteria 91862
627 Ga0495587_0029172 3300046536 Bacteria 3351
628 Ga0495587_0104275 3300046536 Bacteria 1632
629 Ga0495609_0027478 3300046538 Bacteria 2600
630 Ga0495645_0000418 3300046543 Bacteria 29334
631 Ga0495645_0108936 3300046543 Bacteria 1961
632 Ga0495645_0265141 3300046543 Bacteria 1135
633 Ga0495645_0426764 3300046543 Bacteria 840
634 Ga0495622_0469107 3300046557 Bacteria 539
635 Ga0495667_0006358 3300046559 Bacteria 8013
636 Ga0495667_0123792 3300046559 Bacteria 1669
637 Ga0495667_0133183 3300046559 Bacteria 1603
638 Ga0495667_0138025 3300046559 Bacteria 1572
639 Ga0495656_0005449 3300046615 Bacteria 4394
640 Ga0495668_0715484 3300046616 Bacteria 554
641 Ga0495634_0169783 3300046642 Bacteria 1371
642 Ga0495625_0194649 3300046660 Bacteria 1341
643 Ga0495635_0009289 3300046663 Bacteria 6870
644 Ga0495635_0029747 3300046663 Bacteria 3799
645 Ga0495635_0040696 3300046663 Bacteria 3211
646 Ga0495635_0045955 3300046663 Bacteria 3012
647 Ga0495635_0060045 3300046663 Bacteria 2614
648 Ga0495635_0063064 3300046663 Bacteria 2545
649 Ga0495659_0017863 3300046664 Bacteria 2357
650 Ga0495588_0257393 3300046674 Bacteria 920
651 Ga0495657_0020111 3300046675 Bacteria 4803
652 Ga0495657_0045579 3300046675 Bacteria 2975
653 Ga0495657_0081438 3300046675 Bacteria 2093
654 Ga0495657_0131452 3300046675 Bacteria 1568
655 Ga0495599_0000542 3300046678 Bacteria 21674
656 Ga0495599_0009394 3300046678 Bacteria 5975
657 Ga0495599_0146908 3300046678 Bacteria 1461
658 Ga0495599_0447111 3300046678 Bacteria 765
659 Ga0495623_0000435 3300046679 Bacteria 27481
660 Ga0495623_0041600 3300046679 Bacteria 2930
661 Ga0495623_0168006 3300046679 Bacteria 1284
662 Ga0495646_0007673 3300046680 Bacteria 6857
663 Ga0495646_0023000 3300046680 Bacteria 3925
664 Ga0495646_0031340 3300046680 Bacteria 3314
665 Ga0495647_0000560 3300046681 Bacteria 10950
666 Ga0495647_0026163 3300046681 Bacteria 2135
667 Ga0495647_0044993 3300046681 Bacteria 1694
668 Ga0495647_0340079 3300046681 Bacteria 682
669 Ga0495658_0001373 3300046683 Bacteria 12760
670 Ga0495658_0336681 3300046683 Bacteria 958
671 Ga0495613_0024193 3300046689 Bacteria 4525
672 Ga0495613_0129368 3300046689 Bacteria 1809
673 Ga0495624_0000753 3300046690 Bacteria 25488
674 Ga0495624_0028902 3300046690 Bacteria 3618
675 Ga0495624_0211407 3300046690 Bacteria 1177
676 Ga0495670_0627108 3300046691 Bacteria 586
677 Ga0495589_0139208 3300046794 Bacteria 1163
678 Ga0495600_0023999 3300046809 Bacteria 3926
679 Ga0495600_0031656 3300046809 Bacteria 3428
680 Ga0495600_0172723 3300046809 Bacteria 1395
681 Ga0495600_0328107 3300046809 Bacteria 961
682 Ga0495581_0000407 3300047315 Bacteria 21707
683 Ga0495581_0302065 3300047315 Unclassified 935
684 Ga0495581_0785678 3300047315 Bacteria 547
685 Ga0495604_0009317 3300047317 Bacteria 7773
686 Ga0495604_0052634 3300047317 Bacteria 3151
687 Ga0495604_0054650 3300047317 Bacteria 3081
688 Ga0495604_0192278 3300047317 Bacteria 1421
689 Ga0495636_0191294 3300047318 Bacteria 932
690 Ga0495674_0031730 3300047319 Bacteria 4796
691 Ga0495674_0041557 3300047319 Bacteria 4106
692 Ga0495674_0997152 3300047319 Bacteria 642
693 Ga0495676_0002534 3300047321 Bacteria 16250
694 Ga0495676_0233414 3300047321 Bacteria 1263
695 Ga0495680_0009043 3300047322 Bacteria 8999
696 Ga0495680_0032626 3300047322 Bacteria 4224
697 Ga0495680_0115359 3300047322 Bacteria 1987
698 Ga0495680_0182791 3300047322 Bacteria 1512
699 Ga0495680_0227464 3300047322 Bacteria 1329
700 Ga0495680_0312242 3300047322 Unclassified 1102
701 Ga0495680_0479211 3300047322 Bacteria 847
702 Ga0495683_0299687 3300047323 Bacteria 691
703 Ga0495675_0004323 3300047444 Bacteria 8594
704 Ga0495677_0078693 3300047445 Bacteria 1234
705 Ga0495679_061237 3300047446 Bacteria 1103
706 Ga0495685_058678 3300047447 Bacteria 1299
707 Ga0495684_0005543 3300047471 Bacteria 9838
708 Ga0495684_0012597 3300047471 Bacteria 6522
709 Ga0495684_0042031 3300047471 Bacteria 3502
710 Ga0495684_0087933 3300047471 Bacteria 2355
711 Ga0495684_0199122 3300047471 Bacteria 1477
712 Ga0495684_0488488 3300047471 Unclassified 849
713 Ga0495684_0612038 3300047471 Bacteria 733
714 Ga0495593_0000807 3300047673 Bacteria 18118
715 Ga0495593_0327020 3300047673 Bacteria 766
716 Ga0495602_0005881 3300048088 Bacteria 12881
717 Ga0495602_0035846 3300048088 Bacteria 4622
718 Ga0495614_0487952 3300048089 Unclassified 585
719 Ga0496100_0129890 3300048903 Bacteria 1773
720 Ga0496100_0164748 3300048903 Bacteria 1591
721 Ga0496100_0373763 3300048903 Bacteria 1081
722 Ga0496100_0474291 3300048903 Bacteria 962
723 Ga0496100_0625398 3300048903 Bacteria 837
724 Ga0496101_0034217 3300048904 Bacteria 3587
725 Ga0496101_0183464 3300048904 Bacteria 1612
726 Ga0496102_0008078 3300048905 Bacteria 9002
727 Ga0496102_0141612 3300048905 Bacteria 2255
728 Ga0496102_0156809 3300048905 Bacteria 2140
729 Ga0496102_0349065 3300048905 Bacteria 1393
730 Ga0496102_0542661 3300048905 Bacteria 1085
731 Ga0496103_0006222 3300048906 Bacteria 7132
732 Ga0496103_0066505 3300048906 Bacteria 2250
733 Ga0496103_0147329 3300048906 Bacteria 1507
734 Ga0496103_0896542 3300048906 Bacteria 556
735 Ga0496104_0002502 3300048907 Bacteria 15814
736 Ga0496104_0014077 3300048907 Bacteria 7220
737 Ga0496104_0032821 3300048907 Bacteria 4832
738 Ga0496104_0175680 3300048907 Bacteria 2052
739 Ga0496104_0189567 3300048907 Bacteria 1967
740 Ga0496104_1560155 3300048907 Unclassified 563
741 Ga0496105_0025913 3300048908 Bacteria 4777
742 Ga0496105_0185988 3300048908 Bacteria 1700
743 Ga0496105_0243832 3300048908 Bacteria 1457
744 Ga0496105_0363319 3300048908 Bacteria 1154
745 Ga0496106_0012693 3300048909 Bacteria 6223
746 Ga0496106_0925459 3300048909 Bacteria 688
747 Ga0496107_0001925 3300048910 Bacteria 13179
748 Ga0496107_0011878 3300048910 Bacteria 6083
749 Ga0496107_0145920 3300048910 Bacteria 1750
750 Ga0496107_0166116 3300048910 Bacteria 1636
751 Ga0496107_0205978 3300048910 Bacteria 1462
752 Ga0496107_0226044 3300048910 Bacteria 1392
753 Ga0496108_0021721 3300048911 Bacteria 5277
754 Ga0496108_0054644 3300048911 Bacteria 3351
755 Ga0496108_0088376 3300048911 Bacteria 2633
756 Ga0496108_0387977 3300048911 Bacteria 1219
757 Ga0496108_1282525 3300048911 Bacteria 617
758 Ga0496109_0012739 3300048912 Bacteria 7266
759 Ga0496109_0049496 3300048912 Bacteria 3825
760 Ga0496109_0051890 3300048912 Bacteria 3736
761 Ga0496109_0068013 3300048912 Bacteria 3264
762 Ga0496109_0335950 3300048912 Bacteria 1427
763 Ga0496110_0014622 3300048913 Bacteria 6521
764 Ga0496110_0021211 3300048913 Bacteria 5495
765 Ga0496110_0249670 3300048913 Bacteria 1615
766 Ga0496111_0011695 3300048914 Bacteria 5924
767 Ga0496111_0302555 3300048914 Bacteria 1185
768 Ga0496111_1053393 3300048914 Bacteria 581
769 Ga0496112_0000598 3300048915 Bacteria 24854
770 Ga0496112_0027644 3300048915 Bacteria 5470
771 Ga0496112_0042134 3300048915 Bacteria 4467
772 Ga0496112_0074888 3300048915 Bacteria 3348
773 Ga0496112_0110368 3300048915 Bacteria 2721
774 Ga0496112_0153892 3300048915 Bacteria 2267
775 Ga0496112_0228515 3300048915 Bacteria 1815
776 Ga0496112_0299204 3300048915 Bacteria 1554
777 Ga0496112_0531464 3300048915 Bacteria 1110
778 Ga0496112_0552184 3300048915 Bacteria 1085
779 Ga0496112_0689560 3300048915 Bacteria 950
780 Ga0496113_0014459 3300048916 Bacteria 5385
781 Ga0496113_0121522 3300048916 Bacteria 2042
782 Ga0496113_0342819 3300048916 Bacteria 1198
783 Ga0496113_0417180 3300048916 Bacteria 1078
784 Ga0496113_0671954 3300048916 Bacteria 828
785 Ga0496113_0824065 3300048916 Bacteria 736
786 Ga0496114_0008459 3300048917 Bacteria 8154
787 Ga0496114_0015753 3300048917 Bacteria 6083
788 Ga0496114_0268079 3300048917 Bacteria 1504
789 Ga0496114_0376562 3300048917 Bacteria 1257
790 Ga0496115_0025452 3300048918 Bacteria 4607
791 Ga0496115_0040946 3300048918 Bacteria 3684
792 Ga0496115_0075583 3300048918 Bacteria 2736
793 Ga0496115_0081726 3300048918 Bacteria 2631
794 Ga0496115_0090806 3300048918 Bacteria 2495
795 Ga0496115_0123748 3300048918 Bacteria 2129
796 Ga0496115_0818320 3300048918 Bacteria 724
797 Ga0496121_0007276 3300048924 Bacteria 13395
798 Ga0501032_0246372 3300049569 Bacteria 1160
799 Ga0501033_0060902 3300049570 Bacteria 2783
800 Ga0501034_0007715 3300049571 Bacteria 11447
801 Ga0501034_0124122 3300049571 Bacteria 2567
802 Ga0501036_0058299 3300049572 Bacteria 3271
803 Ga0501038_0022061 3300049574 Bacteria 5710
804 Ga0501039_0771570 3300049575 Bacteria 750
805 Ga0501043_0028409 3300049579 Bacteria 4391
806 Ga0501047_0056599 3300049581 Bacteria 3792
807 Ga0501047_0951122 3300049581 Unclassified 672
808 Ga0501047_1254183 3300049581 Bacteria 555
809 Ga0501067_0028554 3300049583 Bacteria 3092
810 Ga0501067_0227031 3300049583 Bacteria 1039
811 Ga0501067_0594662 3300049583 Unclassified 620
812 Ga0501068_0047842 3300049584 Bacteria 2581
813 Ga0501069_0049386 3300049585 Bacteria 2338
814 Ga0501069_0146152 3300049585 Bacteria 1357
815 Ga0501069_0178115 3300049585 Bacteria 1228
816 Ga0501070_0015295 3300049586 Bacteria 6457
817 Ga0501070_0112052 3300049586 Bacteria 2255
818 Ga0501070_0547174 3300049586 Bacteria 927
819 Ga0501071_0010326 3300049587 Bacteria 6254
820 Ga0501072_0005175 3300049588 Bacteria 9919
821 Ga0501072_0015653 3300049588 Bacteria 5812
822 Ga0501073_0022725 3300049589 Bacteria 4512
823 Ga0501073_0051428 3300049589 Bacteria 2886
824 Ga0501074_0023509 3300049590 Bacteria 4479
825 Ga0501074_0261133 3300049590 Bacteria 1231
826 Ga0501076_0029667 3300049592 Bacteria 4255
827 Ga0501079_0010628 3300049741 Bacteria 7005
828 Ga0501080_0002078 3300049742 Bacteria 17369
829 Ga0501080_0079478 3300049742 Bacteria 3049
830 Ga0501081_0322464 3300049743 Bacteria 1136
831 Ga0501083_0010820 3300049744 Bacteria 6416
832 Ga0501044_0029300 3300049823 Bacteria 5805
833 nmdc:mga00v17_704_c2 3300050491 Bacteria 10003
834 nmdc:mga06z11_269765_c1 3300050494 Bacteria 1006
835 nmdc:mga06z11_38335_c1 3300050494 Bacteria 2379
836 nmdc:mga0n895_469_c1 3300050512 Bacteria 27118
837 nmdc:mga0n895_801181_c1 3300050512 Bacteria 932
838 nmdc:mga0n895_98228_c1 3300050512 Bacteria 2935
839 nmdc:mga0rr50_499690_c1 3300050513 Bacteria 1034
840 nmdc:mga0rr50_85581_c1 3300050513 Unclassified 2443
841 nmdc:mga0rr50_887505_c1 3300050513 Bacteria 760
842 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
843 nmdc:mga08x19_72638_c1 3300050514 Bacteria 2244
844 Ga0495601_0004004 3300053077 Bacteria 8484
845 Ga0495601_0027217 3300053077 Bacteria 3534
846 Ga0495601_0034847 3300053077 Bacteria 3140
847 Ga0495601_0070843 3300053077 Bacteria 2225
848 Ga0495601_0747048 3300053077 Bacteria 623
849 Ga0495612_0002367 3300053078 Bacteria 7771
850 Ga0495612_0156875 3300053078 Bacteria 992
851 Ga0495612_0251963 3300053078 Bacteria 785
852 Ga0495595_0013724 3300053084 Bacteria 3426
853 Ga0495595_0019382 3300053084 Bacteria 2951
854 Ga0495595_0027118 3300053084 Bacteria 2550
855 Ga0495595_0319667 3300053084 Bacteria 781
856 Ga0495595_0483344 3300053084 Bacteria 630
857 Ga0495619_0000123 3300053085 Bacteria 57052
858 Ga0495619_0001783 3300053085 Bacteria 14316
859 Ga0495619_0025730 3300053085 Bacteria 3782
860 Ga0495619_0027860 3300053085 Bacteria 3643
861 Ga0495619_0051013 3300053085 Bacteria 2733
862 Ga0495619_0077113 3300053085 Bacteria 2238
863 Ga0495619_0293391 3300053085 Bacteria 1126
864 Ga0495619_0384735 3300053085 Bacteria 969
865 Ga0495619_0587197 3300053085 Bacteria 763
866 Ga0500616_0053634 3300053153 Bacteria 2115
867 Ga0501084_0084482 3300054114 Bacteria 2664
868 Ga0501084_0162537 3300054114 Bacteria 1884
869 Ga0466962_0000436 3300061719 Bacteria 18149
870 Ga0466962_0106140 3300061719 Bacteria 1350
871 Ga0466962_0158131 3300061719 Bacteria 1101
872 Ga0466962_0301241 3300061719 Bacteria 793
873 Ga0466962_0686962 3300061719 Bacteria 525
874 Ga0530510_0018159 3300061734 Bacteria 4987
875 Ga0530510_0175883 3300061734 Bacteria 1586
876 Ga0530510_0912664 3300061734 Bacteria 671
877 2561466289 2558860983 Bacteria 4133860
878 Ga0157373_10260748
879 Ga0070658_10077027
880 Ga0070658_10119088
881 Ga0070658_10240372
882 Ga0070658_10286934
883 Ga0070683_100098993
884 Ga0070680_100046688
885 Ga0070680_100148285
886 Ga0070680_100340398
887 Ga0070680_100696672
888 Ga0070682_100000772
889 Ga0070682_100235764
890 Ga0070682_100591179
891 Ga0068868_101152761
892 Ga0070660_100025106
893 Ga0070660_100062235
894 Ga0070660_100085622
895 Ga0070660_100138224
896 Ga0070660_100397188
897 Ga0070660_100691423
898 Ga0070660_100779159
899 Ga0070691_10134671
900 Ga0070661_100313734
901 Ga0070661_100982745
902 Ga0070692_10551980
903 Ga0070675_101010204
904 Ga0070675_101194960
905 Ga0070671_100298514
906 Ga0070671_100520779
907 Ga0070703_10073215
908 Ga0070709_10069891
909 Ga0070709_10277901
910 Ga0070714_100001442
911 Ga0070714_100001730
912 Ga0070714_100008154
913 Ga0070714_100028037
914 Ga0070714_100120683
915 Ga0070714_100137599
916 Ga0070714_100316964
917 Ga0070714_101084003
918 Ga0070713_100027513
919 Ga0070713_100029682
920 Ga0070713_100097436
921 Ga0070713_100214119
922 Ga0070713_100813950
923 Ga0070710_10004523
924 Ga0070711_100032777
925 Ga0070711_100088200
926 Ga0070711_100194348
927 Ga0070711_100284269
928 Ga0070711_100596461
929 Ga0070711_100968706
930 Ga0070694_100043187
931 Ga0070708_100140293
932 Ga0070708_100263613
933 Ga0070708_100897480
934 Ga0070663_100676971
935 Ga0070681_10027297
936 Ga0070681_10036000
937 Ga0070681_10051344
938 Ga0070681_10057780
939 Ga0070681_10262884
940 Ga0070681_10555920
941 Ga0070681_11071621
942 Ga0070707_100001128
943 Ga0070707_100097095
944 Ga0070707_100139777
945 Ga0070707_100229155
946 Ga0070707_100344411
947 Ga0070707_100426793
948 Ga0070698_100023352
949 Ga0070698_100066288
950 Ga0070698_100096124
951 Ga0070698_100375402
952 Ga0070679_100051987
953 Ga0070679_100065672
954 Ga0070679_100080703
955 Ga0070679_100321897
956 Ga0070679_101215223
957 Ga0070684_100230630
958 Ga0070684_100518743
959 Ga0070697_100037020
960 Ga0070697_100718080
961 Ga0070697_101063564
962 Ga0068853_100362468
963 Ga0070686_100113072
964 Ga0070695_100000029
965 Ga0070696_100367656
966 Ga0070693_100182825
967 Ga0070693_100947917
968 Ga0070704_100669133
969 Ga0068855_100044799
970 Ga0068855_100070085
971 Ga0068855_100980471
972 Ga0068855_101612890
973 Ga0070664_100088058
974 Ga0068857_100103084
975 Ga0068856_100098363
976 Ga0068856_101264215
977 Ga0068856_101584317
978 Ga0070702_100284521
979 Ga0068852_100316316
980 Ga0068852_100834755
981 Ga0068852_101648512
982 Ga0068851_10586558
983 Ga0068863_100191810
984 Ga0081538_10033321
985 Ga0070717_10016372
986 Ga0070717_10029414
987 Ga0070717_10031104
988 Ga0070717_10080120
989 Ga0070717_10145688
990 Ga0070717_10158291
991 Ga0070717_10860777
992 Ga0075364_10003592
993 Ga0070715_10250386
994 Ga0070716_100041828
995 Ga0070716_100471412
996 Ga0070712_100052688
997 Ga0070712_100087058
998 Ga0070712_100210926
999 Ga0070712_100513907
1000 Ga0075367_10093994
1001 Ga0075367_10146206
1002 Ga0075433_10688127
1003 Ga0075434_100002359
1004 Ga0075434_100042304
1005 Ga0075436_100003536
1006 Ga0075436_100142117
1007 Ga0075436_100287087
1008 Ga0075436_100454671
1009 Ga0075435_100112723
1010 Ga0075435_100796061
1011 Ga0105240_10010108
1012 Ga0105240_10023072
1013 Ga0105240_10036412
1014 Ga0105240_10186268
1015 Ga0105245_10730365
1016 Ga0105241_10596901
1017 Ga0105248_10246668
1018 Ga0105237_10064368
1019 Ga0105237_10413288
1020 Ga0105237_11385020
1021 Ga0105237_11918162
1022 Ga0105238_10093907
1023 Ga0105238_10457848
1024 Ga0099796_10054239
1025 Ga0105239_10058833
1026 Ga0105239_11000878
1027 Ga0157373_10043309
1028 Ga0157373_10472871
1029 Ga0157373_10553350
1030 Ga0157373_11454715
1031 Ga0157371_10636437
1032 Ga0157370_10013425
1033 Ga0157370_10088032
1034 Ga0157370_10915501
1035 Ga0157369_10013174
1036 Ga0157369_10033465
1037 Ga0157369_10283362
1038 Ga0157369_10369988
1039 Ga0157369_10402020
1040 Ga0157369_10481476
1041 Ga0157369_11260523
1042 Ga0157374_10702232
1043 Ga0157374_11850541
1044 Ga0157378_10744068
1045 Ga0163162_10154082
1046 Ga0157372_10007615
1047 Ga0157372_10353420
1048 Ga0157372_10588257
1049 Ga0157372_11080743
1050 Ga0157375_12465529
1051 Ga0163163_10571131
1052 Ga0182008_10003425
1053 Ga0182008_10025785
1054 Ga0182008_10188646
1055 Ga0157379_11785684
1056 Ga0157376_10031446
1057 Ga0182006_1013195
1058 Ga0182007_10013137
1059 Ga0182005_1139216
1060 Ga0197907_11037992
1061 Ga0206356_10027961
1062 Ga0206356_11522396
1063 Ga0206356_11548852
1064 Ga0206354_10162523
1065 Ga0206354_10280470
1066 Ga0206354_10581218
1067 Ga0206354_11352109
1068 Ga0206354_11453059
1069 Ga0206353_10217476
1070 Ga0206353_10335970
1071 Ga0206353_10928214
1072 Ga0206353_11341242
1073 Ga0206353_12063638
1074 Ga0224712_10026165
1075 Ga0207692_10047524
1076 Ga0207692_10187343
1077 Ga0207692_10476687
1078 Ga0207685_10114734
1079 Ga0207699_10005456
1080 Ga0207699_10260711
1081 Ga0207705_10009302
1082 Ga0207705_10090975
1083 Ga0207705_10107552
1084 Ga0207705_10272643
1085 Ga0207705_10342036
1086 Ga0207705_11098974
1087 Ga0207707_10013404
1088 Ga0207707_10018329
1089 Ga0207707_10073051
1090 Ga0207707_10084670
1091 Ga0207707_10183900
1092 Ga0207707_10269275
1093 Ga0207707_10927744
1094 Ga0207695_10030376
1095 Ga0207695_10654536
1096 Ga0207695_11728477
1097 Ga0207671_10375002
1098 Ga0207693_10020457
1099 Ga0207693_10052882
1100 Ga0207693_10241259
1101 Ga0207693_11286048
1102 Ga0207663_10161964
1103 Ga0207663_10183229
1104 Ga0207663_10285313
1105 Ga0207663_10515222
1106 Ga0207663_10573485
1107 Ga0207660_10098505
1108 Ga0207660_10242086
1109 Ga0207660_10311739
1110 Ga0207660_10800396
1111 Ga0207660_11104569
1112 Ga0207657_10013743
1113 Ga0207657_10028373
1114 Ga0207657_10053710
1115 Ga0207657_10061747
1116 Ga0207657_10307677
1117 Ga0207657_10320892
1118 Ga0207649_10722288
1119 Ga0207652_10114951
1120 Ga0207652_10159422
1121 Ga0207652_10262398
1122 Ga0207652_10279447
1123 Ga0207652_11015729
1124 Ga0207652_11394116
1125 Ga0207646_10003943
1126 Ga0207646_10266726
1127 Ga0207646_10289617
1128 Ga0207646_10529585
1129 Ga0207694_10139557
1130 Ga0207687_10121658
1131 Ga0207700_10154134
1132 Ga0207700_10568213
1133 Ga0207664_10007454
1134 Ga0207664_10019236
1135 Ga0207664_10025643
1136 Ga0207664_10049060
1137 Ga0207664_10059156
1138 Ga0207664_10242555
1139 Ga0207664_10251574
1140 Ga0207664_10317572
1141 Ga0207664_10317877
1142 Ga0207664_10319332
1143 Ga0207664_10555673
1144 Ga0207644_10091555
1145 Ga0207686_10810993
1146 Ga0207665_10001348
1147 Ga0207665_10102769
1148 Ga0207665_10260740
1149 Ga0207665_10310301
1150 Ga0207665_10604255
1151 Ga0207711_10517683
1152 Ga0207661_10181222
1153 Ga0207661_10244532
1154 Ga0207661_11100131
1155 Ga0207667_10186001
1156 Ga0207667_10244522
1157 Ga0207667_10258869
1158 Ga0207667_10416902
1159 Ga0207667_10683456
1160 Ga0207667_10837863
1161 Ga0207712_10178408
1162 Ga0207640_10141303
1163 Ga0207639_10558783
1164 Ga0207639_11055357
1165 Ga0207678_10417337
1166 Ga0207702_10113980
1167 Ga0207702_10148408
1168 Ga0207702_10544779
1169 Ga0207641_10039645
1170 Ga0207698_10422343
1171 Ga0207698_10447569
1172 Ga0207698_10918802
1173 Ga0209813_10258041
1174 Ga0265326_10036019
1175 Ga0265326_10128514
1176 Ga0265319_1006111
1177 Ga0265319_1039562
1178 Ga0265334_10014826
1179 Ga0265334_10020139
1180 Ga0265318_10000691
1181 Ga0265318_10100256
1182 Ga0265323_10013669
1183 Ga0265323_10079191
1184 Ga0265322_10009294
1185 Ga0265336_10019405
1186 Ga0265338_10001048
1187 Ga0265338_10003605
1188 Ga0265338_10007115
1189 Ga0265338_10022563
1190 Ga0265338_10039236
1191 Ga0265338_10102538
1192 Ga0265338_10231610
1193 Ga0265338_10478762
1194 Ga0265324_10011053
1195 Ga0265324_10060109
1196 Ga0265330_10028366
1197 Ga0265330_10063169
1198 Ga0265330_10302547
1199 Ga0265328_10019067
1200 Ga0265320_10017612
1201 Ga0265320_10030136
1202 Ga0265325_10000102
1203 Ga0265325_10203959
1204 Ga0265325_10246858
1205 Ga0265329_10086720
1206 Ga0265340_10009900
1207 Ga0265340_10167127
1208 Ga0265339_10011424
1209 Ga0265339_10150598
1210 Ga0265331_10061744
1211 Ga0265331_10095560
1212 Ga0265327_10025194
1213 Ga0265327_10124888
1214 Ga0265327_10135228
1215 Ga0265316_10021633
1216 Ga0265313_10006148
1217 Ga0265313_10090527
1218 Ga0265314_10003427
1219 Ga0265342_10038790
1220 Ga0316583_10014535
1221 Ga0316583_10038708
1222 Ga0316583_10039538
1223 Ga0373934_0037792
1224 Ga0373923_0254471
1225 Ga0373936_0176263
1226 Ga0373941_0254590
1227 Ga0373945_0005783
1228 Ga0373945_0209764
1229 Ga0373954_0155027
1230 Ga0373956_0042005
1231 Ga0373956_0372871
1232 Ga0373957_0090977
1233 Ga0373960_0120036
1234 Ga0373943_0002704
1235 Ga0373943_0365015
1236 Ga0373946_0021452
1237 Ga0373955_0016364
1238 Ga0373955_0159308
1239 Ga0373955_0309974
1240 Ga0373955_0340373
1241 Ga0373924_0049640
1242 Ga0373924_0089194
1243 Ga0373924_0179913
1244 Ga0373931_0180163
1245 Ga0373931_0259568
1246 Ga0373933_0156210
1247 Ga0373947_0556874
1248 Ga0373937_0003562
1249 Ga0373937_1031926
1250 Ga0373925_0001320
1251 Ga0373925_0484484
1252 Ga0395899_0161575
1253 Ga0395899_0167975
1254 Ga0395900_0101231
1255 Ga0395900_0153540
1256 Ga0395900_0160762
1257 Ga0395900_0222339
1258 Ga0395900_0229986
1259 Ga0395900_0673417
1260 Ga0395900_0804888
1261 Ga0395900_0902665
1262 Ga0395900_0994576
1263 Ga0395900_1428488
1264 Ga0395900_1470170
1265 Ga0395898_0018968
1266 Ga0395898_0067856
1267 Ga0395898_0088361
1268 Ga0395898_0114073
1269 Ga0395898_1105813
1270 Ga0395898_1819768
1271 Ga0395905_0000386
1272 Ga0395905_0114323
1273 Ga0395905_0121213
1274 Ga0395905_0131737
1275 Ga0395905_0501725
1276 Ga0395905_0973689
1277 Ga0395901_0054876
1278 Ga0395901_0124900
1279 Ga0395901_0130218
1280 Ga0395901_0147806
1281 Ga0395901_0603215
1282 Ga0242420_054419
1283 Ga0436365_0252739
1284 Ga0436360_0556007
1285 Ga0436363_1430576
1286 Ga0436363_1463861
1287 Ga0451853_1828558
1288 Ga0451853_3430042
1289 Ga0466969_0032043
1290 Ga0466965_0011754
1291 Ga0466965_0056962
1292 Ga0466966_0003176
1293 Ga0466966_0040188
1294 Ga0466966_0243719
1295 Ga0466966_0572357
1296 Ga0466966_0903747
1297 Ga0466961_0012817
1298 Ga0466961_0022246
1299 Ga0466961_0129285
1300 Ga0466961_0245992
1301 Ga0466961_0732636
1302 Ga0466961_0747228
1303 Ga0466961_0803150
1304 Ga0466963_0001433
1305 Ga0466963_0002189
1306 Ga0466963_0003641
1307 Ga0466963_0006990
1308 Ga0466963_0007093
1309 Ga0466963_0008418
1310 Ga0466963_0010262
1311 Ga0466963_0013063
1312 Ga0466963_0016356
1313 Ga0466963_0021819
1314 Ga0466963_0043897
1315 Ga0466963_0097428
1316 Ga0466963_0103608
1317 Ga0466963_0213516
1318 Ga0466963_0424630
1319 Ga0466963_0959202
1320 Ga0466963_1023291
1321 Ga0466964_0016378
1322 Ga0466964_0019203
1323 Ga0466964_0038264
1324 Ga0466964_0044192
1325 Ga0466964_0063715
1326 Ga0466964_0072368
1327 Ga0466964_0077099
1328 Ga0466964_0078199
1329 Ga0466964_0114655
1330 Ga0466964_0345219
1331 Ga0466964_0378874
1332 Ga0453684_0644134
1333 Ga0466971_0000170
1334 Ga0466971_0007771
1335 Ga0466971_0027006
1336 Ga0466971_0034096
1337 Ga0466971_0654262
1338 Ga0466968_0001006
1339 Ga0466968_0019982
1340 Ga0466968_0021702
1341 Ga0466968_0046529
1342 Ga0466968_0127171
1343 Ga0466968_0132526
1344 Ga0466968_0198853
1345 Ga0466968_0212394
1346 Ga0466968_0313522
1347 Ga0466970_0000806
1348 Ga0466970_0015951
1349 Ga0466970_0020042
1350 Ga0466957_0000671
1351 Ga0466957_0003280
1352 Ga0466957_0004865
1353 Ga0466957_0009740
1354 Ga0466957_0011646
1355 Ga0466957_0030148
1356 Ga0466957_0031191
1357 Ga0466957_0045424
1358 Ga0466957_0063127
1359 Ga0466957_0075551
1360 Ga0466957_0139000
1361 Ga0466957_0188090
1362 Ga0466957_0205312
1363 Ga0466957_0211372
1364 Ga0466957_0318204
1365 Ga0466957_0329970
1366 Ga0466960_0031765
1367 Ga0466960_0146023
1368 Ga0466959_0000274
1369 Ga0466959_0003637
1370 Ga0466959_0005938
1371 Ga0466959_0028480
1372 Ga0466959_0066806
1373 Ga0466959_0111214
1374 Ga0466959_0181500
1375 Ga0466959_0236750
1376 Ga0466959_0458591
1377 Ga0466959_0965759
1378 Ga0466958_0000300
1379 Ga0466958_0001062
1380 Ga0466958_0006904
1381 Ga0466958_0017529
1382 Ga0466958_0021115
1383 Ga0466958_0022617
1384 Ga0466958_0040385
1385 Ga0466958_0068946
1386 Ga0466958_0116018
1387 Ga0466958_0120128
1388 Ga0466958_0350377
1389 Ga0466958_0424269
1390 Ga0466967_0000828
1391 Ga0466967_0002114
1392 Ga0466967_0002908
1393 Ga0466967_0003311
1394 Ga0466967_0009149
1395 Ga0466967_0010698
1396 Ga0466967_0012395
1397 Ga0466967_0023141
1398 Ga0466967_0027027
1399 Ga0466967_0029636
1400 Ga0466967_0033811
1401 Ga0466967_0034791
1402 Ga0466967_0042827
1403 Ga0466967_0067487
1404 Ga0466967_0072640
1405 Ga0466967_0081515
1406 Ga0466967_0098579
1407 Ga0466967_0105618
1408 Ga0466967_0107460
1409 Ga0466967_0117557
1410 Ga0466967_0169647
1411 Ga0466967_0184316
1412 Ga0466967_0204330
1413 Ga0466967_0207943
1414 Ga0466967_0211135
1415 Ga0466967_0236924
1416 Ga0466967_0255654
1417 Ga0466967_0323107
1418 Ga0466967_0479525
1419 Ga0466967_0716912
1420 Ga0466967_1430949
1421 Ga0466967_1519522
1422 Ga0495592_0014141
1423 Ga0495592_0038050
1424 Ga0495592_0185722
1425 Ga0495592_0223762
1426 Ga0495603_0053526
1427 Ga0495603_0520239
1428 Ga0495603_0604889
1429 Ga0495590_0095049
1430 Ga0495629_0001816
1431 Ga0495629_0320029
1432 Ga0495629_0567865
1433 Ga0495641_0007480
1434 Ga0495641_0142465
1435 Ga0495641_0184946
1436 Ga0495651_0000028
1437 Ga0495651_0111389
1438 Ga0495653_0000965
1439 Ga0495653_0019134
1440 Ga0495653_0023889
1441 Ga0495653_0061020
1442 Ga0495653_0081081
1443 Ga0495653_0185791
1444 Ga0495580_0042963
1445 Ga0495582_0012985
1446 Ga0495582_0016268
1447 Ga0495582_0031507
1448 Ga0495639_0000630
1449 Ga0495662_0001339
1450 Ga0495662_0024242
1451 Ga0495664_0032023
1452 Ga0495664_0082635
1453 Ga0495664_0105740
1454 Ga0495664_0117867
1455 Ga0495664_0162973
1456 Ga0495584_0051193
1457 Ga0495584_0713903
1458 Ga0495607_0081915
1459 Ga0495608_0008137
1460 Ga0495608_0008892
1461 Ga0495608_0100374
1462 Ga0495608_0228967
1463 Ga0495608_0259131
1464 Ga0495608_0339532
1465 Ga0495618_0012985
1466 Ga0495618_0052048
1467 Ga0495618_0113992
1468 Ga0495618_0331322
1469 Ga0495618_0491674
1470 Ga0495618_0560170
1471 Ga0495628_0000069
1472 Ga0495628_0041826
1473 Ga0495628_0052488
1474 Ga0495628_0084398
1475 Ga0495628_0656994
1476 Ga0495628_0952469
1477 Ga0495630_0005233
1478 Ga0495630_0015336
1479 Ga0495630_0033318
1480 Ga0495630_0052803
1481 Ga0495630_0232839
1482 Ga0495630_0284413
1483 Ga0495630_0300788
1484 Ga0495630_0536166
1485 Ga0495630_0651016
1486 Ga0495643_0042252
1487 Ga0495644_0010118
1488 Ga0495666_0000145
1489 Ga0495642_0054501
1490 Ga0495652_0010813
1491 Ga0495652_0011205
1492 Ga0495652_0040217
1493 Ga0495652_0130565
1494 Ga0495665_0005590
1495 Ga0495665_0086666
1496 Ga0495640_0017850
1497 Ga0495640_0128572
1498 Ga0495640_0164965
1499 Ga0495586_0101960
1500 Ga0495586_0202814
1501 Ga0495586_0515229
1502 Ga0495586_0871299
1503 Ga0495587_0000062
1504 Ga0495587_0029172
1505 Ga0495587_0104275
1506 Ga0495609_0027478
1507 Ga0495645_0000418
1508 Ga0495645_0108936
1509 Ga0495645_0265141
1510 Ga0495645_0426764
1511 Ga0495622_0469107
1512 Ga0495667_0006358
1513 Ga0495667_0123792
1514 Ga0495667_0133183
1515 Ga0495667_0138025
1516 Ga0495656_0005449
1517 Ga0495668_0715484
1518 Ga0495634_0169783
1519 Ga0495625_0194649
1520 Ga0495635_0009289
1521 Ga0495635_0029747
1522 Ga0495635_0040696
1523 Ga0495635_0045955
1524 Ga0495635_0060045
1525 Ga0495635_0063064
1526 Ga0495659_0017863
1527 Ga0495588_0257393
1528 Ga0495657_0020111
1529 Ga0495657_0045579
1530 Ga0495657_0081438
1531 Ga0495657_0131452
1532 Ga0495599_0000542
1533 Ga0495599_0009394
1534 Ga0495599_0146908
1535 Ga0495599_0447111
1536 Ga0495623_0000435
1537 Ga0495623_0041600
1538 Ga0495623_0168006
1539 Ga0495646_0007673
1540 Ga0495646_0023000
1541 Ga0495646_0031340
1542 Ga0495647_0000560
1543 Ga0495647_0026163
1544 Ga0495647_0044993
1545 Ga0495647_0340079
1546 Ga0495658_0001373
1547 Ga0495658_0336681
1548 Ga0495613_0024193
1549 Ga0495613_0129368
1550 Ga0495624_0000753
1551 Ga0495624_0028902
1552 Ga0495624_0211407
1553 Ga0495670_0627108
1554 Ga0495589_0139208
1555 Ga0495600_0023999
1556 Ga0495600_0031656
1557 Ga0495600_0172723
1558 Ga0495600_0328107
1559 Ga0495581_0000407
1560 Ga0495581_0302065
1561 Ga0495581_0785678
1562 Ga0495604_0009317
1563 Ga0495604_0052634
1564 Ga0495604_0054650
1565 Ga0495604_0192278
1566 Ga0495636_0191294
1567 Ga0495674_0031730
1568 Ga0495674_0041557
1569 Ga0495674_0997152
1570 Ga0495676_0002534
1571 Ga0495676_0233414
1572 Ga0495680_0009043
1573 Ga0495680_0032626
1574 Ga0495680_0115359
1575 Ga0495680_0182791
1576 Ga0495680_0227464
1577 Ga0495680_0312242
1578 Ga0495680_0479211
1579 Ga0495683_0299687
1580 Ga0495675_0004323
1581 Ga0495677_0078693
1582 Ga0495679_061237
1583 Ga0495685_058678
1584 Ga0495684_0005543
1585 Ga0495684_0012597
1586 Ga0495684_0042031
1587 Ga0495684_0087933
1588 Ga0495684_0199122
1589 Ga0495684_0488488
1590 Ga0495684_0612038
1591 Ga0495593_0000807
1592 Ga0495593_0327020
1593 Ga0495602_0005881
1594 Ga0495602_0035846
1595 Ga0495614_0487952
1596 Ga0496100_0129890
1597 Ga0496100_0164748
1598 Ga0496100_0373763
1599 Ga0496100_0474291
1600 Ga0496100_0625398
1601 Ga0496101_0034217
1602 Ga0496101_0183464
1603 Ga0496102_0008078
1604 Ga0496102_0141612
1605 Ga0496102_0156809
1606 Ga0496102_0349065
1607 Ga0496102_0542661
1608 Ga0496103_0006222
1609 Ga0496103_0066505
1610 Ga0496103_0147329
1611 Ga0496103_0896542
1612 Ga0496104_0002502
1613 Ga0496104_0014077
1614 Ga0496104_0032821
1615 Ga0496104_0175680
1616 Ga0496104_0189567
1617 Ga0496104_1560155
1618 Ga0496105_0025913
1619 Ga0496105_0185988
1620 Ga0496105_0243832
1621 Ga0496105_0363319
1622 Ga0496106_0012693
1623 Ga0496106_0925459
1624 Ga0496107_0001925
1625 Ga0496107_0011878
1626 Ga0496107_0145920
1627 Ga0496107_0166116
1628 Ga0496107_0205978
1629 Ga0496107_0226044
1630 Ga0496108_0021721
1631 Ga0496108_0054644
1632 Ga0496108_0088376
1633 Ga0496108_0387977
1634 Ga0496108_1282525
1635 Ga0496109_0012739
1636 Ga0496109_0049496
1637 Ga0496109_0051890
1638 Ga0496109_0068013
1639 Ga0496109_0335950
1640 Ga0496110_0014622
1641 Ga0496110_0021211
1642 Ga0496110_0249670
1643 Ga0496111_0011695
1644 Ga0496111_0302555
1645 Ga0496111_1053393
1646 Ga0496112_0000598
1647 Ga0496112_0027644
1648 Ga0496112_0042134
1649 Ga0496112_0074888
1650 Ga0496112_0110368
1651 Ga0496112_0153892
1652 Ga0496112_0228515
1653 Ga0496112_0299204
1654 Ga0496112_0531464
1655 Ga0496112_0552184
1656 Ga0496112_0689560
1657 Ga0496113_0014459
1658 Ga0496113_0121522
1659 Ga0496113_0342819
1660 Ga0496113_0417180
1661 Ga0496113_0671954
1662 Ga0496113_0824065
1663 Ga0496114_0008459
1664 Ga0496114_0015753
1665 Ga0496114_0268079
1666 Ga0496114_0376562
1667 Ga0496115_0025452
1668 Ga0496115_0040946
1669 Ga0496115_0075583
1670 Ga0496115_0081726
1671 Ga0496115_0090806
1672 Ga0496115_0123748
1673 Ga0496115_0818320
1674 Ga0496121_0007276
1675 Ga0501032_0246372
1676 Ga0501033_0060902
1677 Ga0501034_0007715
1678 Ga0501034_0124122
1679 Ga0501036_0058299
1680 Ga0501038_0022061
1681 Ga0501039_0771570
1682 Ga0501043_0028409
1683 Ga0501047_0056599
1684 Ga0501047_0951122
1685 Ga0501047_1254183
1686 Ga0501067_0028554
1687 Ga0501067_0227031
1688 Ga0501067_0594662
1689 Ga0501068_0047842
1690 Ga0501069_0049386
1691 Ga0501069_0146152
1692 Ga0501069_0178115
1693 Ga0501070_0015295
1694 Ga0501070_0112052
1695 Ga0501070_0547174
1696 Ga0501071_0010326
1697 Ga0501072_0005175
1698 Ga0501072_0015653
1699 Ga0501073_0022725
1700 Ga0501073_0051428
1701 Ga0501074_0023509
1702 Ga0501074_0261133
1703 Ga0501076_0029667
1704 Ga0501079_0010628
1705 Ga0501080_0002078
1706 Ga0501080_0079478
1707 Ga0501081_0322464
1708 Ga0501083_0010820
1709 Ga0501044_0029300
1710 nmdc:mga00v17_704_c2
1711 nmdc:mga06z11_269765_c1
1712 nmdc:mga06z11_38335_c1
1713 nmdc:mga0n895_469_c1
1714 nmdc:mga0n895_801181_c1
1715 nmdc:mga0n895_98228_c1
1716 nmdc:mga0rr50_499690_c1
1717 nmdc:mga0rr50_85581_c1
1718 nmdc:mga0rr50_887505_c1
1719 nmdc:mga08x19_14_c1
1720 nmdc:mga08x19_72638_c1
1721 Ga0495601_0004004
1722 Ga0495601_0027217
1723 Ga0495601_0034847
1724 Ga0495601_0070843
1725 Ga0495601_0747048
1726 Ga0495612_0002367
1727 Ga0495612_0156875
1728 Ga0495612_0251963
1729 Ga0495595_0013724
1730 Ga0495595_0019382
1731 Ga0495595_0027118
1732 Ga0495595_0319667
1733 Ga0495595_0483344
1734 Ga0495619_0000123
1735 Ga0495619_0001783
1736 Ga0495619_0025730
1737 Ga0495619_0027860
1738 Ga0495619_0051013
1739 Ga0495619_0077113
1740 Ga0495619_0293391
1741 Ga0495619_0384735
1742 Ga0495619_0587197
1743 Ga0500616_0053634
1744 Ga0501084_0084482
1745 Ga0501084_0162537
1746 Ga0466962_0000436
1747 Ga0466962_0106140
1748 Ga0466962_0158131
1749 Ga0466962_0301241
1750 Ga0466962_0686962
1751 Ga0530510_0018159
1752 Ga0530510_0175883
1753 Ga0530510_0912664
1754 2561466289

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

23

148

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6x-assembly1.cif.gz_D crystal structure of campylobacter jejuni fabz 0.9737 5 143
4h4g-assembly1.cif.gz_B crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 0.9717 5 138
3d6x-assembly1.cif.gz_B crystal structure of campylobacter jejuni fabz 0.9716 5 144
3az8-assembly1.cif.gz_E beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from plasmodium falciparum in complex with nas21 0.9644 4 140
1z6b-assembly4.cif.gz_B crystal structure of plasmodium falciparum fabz at 2.1 a 0.9638 3 141
ID Description Score Start End Superfamily
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9891 5 144 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9737 8 140 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9615 5 144 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9605 3 141 3.10.129.10
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9553 5 144 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2N6AMG0-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9937 5 143 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A354CN62-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.59) 0.9922 5 143 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-C7G5K8-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.59) 0.9917 5 143 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A3D5R9H4-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9912 5 143 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A7V4X7V6-F1-model_v4 Multifunctional fusion protein [Includes: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase); UDP-3-O-acyl-N-acetylglucosamine deacetylase (UDP-3-O-acyl-GlcNAc deacetylase) (EC 3.5.1.108) (UDP-3-O-[R-3-hydroxymyristoyl]-N-acetylglucosamine deacetylase)] 0.9912 3 144 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0016836
GO:0046872
GO:0103117

Map