F484389
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 877 | 295 | 1754 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10260748|Ga0157373_102607482 |
| Length | 156 |
| Sequence | VNEMNQPQSQGVTLEIQDIVRLLPHRYPFLLVDRILNVDGDNSCIGIKNVTVNEPFFPGHFPARPVMPGVLLIEGMAQTAGAICTLSRMDKKPPKSVLFLTVDKAKFRRPVVPGDVVEYHMTKKSQRKLMWWFRGEAKVRGELVAEAEVGAMIVDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 118 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 124 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 126 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 136 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 139 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 140 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 141 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 143 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 144 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 151 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 155 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 160 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 161 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 162 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 163 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 164 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 165 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 166 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 169 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 172 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 173 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 283 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 294 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 295 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.18 |
| Metatranscriptomes | 1.71 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.91 |
| Nodule | 0 |
| Rhizoplane | 9.01 |
| Rhizosphere | 89.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157373_10260748 | 3300013100 | Bacteria | 1226 |
| 2 | Ga0070658_10077027 | 3300005327 | Bacteria | 2735 |
| 3 | Ga0070658_10119088 | 3300005327 | Bacteria | 2193 |
| 4 | Ga0070658_10240372 | 3300005327 | Bacteria | 1535 |
| 5 | Ga0070658_10286934 | 3300005327 | Bacteria | 1402 |
| 6 | Ga0070683_100098993 | 3300005329 | Bacteria | 2744 |
| 7 | Ga0070680_100046688 | 3300005336 | Bacteria | 3524 |
| 8 | Ga0070680_100148285 | 3300005336 | Bacteria | 1969 |
| 9 | Ga0070680_100340398 | 3300005336 | Bacteria | 1274 |
| 10 | Ga0070680_100696672 | 3300005336 | Bacteria | 874 |
| 11 | Ga0070682_100000772 | 3300005337 | Bacteria | 18888 |
| 12 | Ga0070682_100235764 | 3300005337 | Bacteria | 1311 |
| 13 | Ga0070682_100591179 | 3300005337 | Bacteria | 875 |
| 14 | Ga0068868_101152761 | 3300005338 | Bacteria | 715 |
| 15 | Ga0070660_100025106 | 3300005339 | Bacteria | 4427 |
| 16 | Ga0070660_100062235 | 3300005339 | Bacteria | 2899 |
| 17 | Ga0070660_100085622 | 3300005339 | Bacteria | 2479 |
| 18 | Ga0070660_100138224 | 3300005339 | Bacteria | 1953 |
| 19 | Ga0070660_100397188 | 3300005339 | Bacteria | 1140 |
| 20 | Ga0070660_100691423 | 3300005339 | Bacteria | 855 |
| 21 | Ga0070660_100779159 | 3300005339 | Unclassified | 804 |
| 22 | Ga0070691_10134671 | 3300005341 | Bacteria | 1255 |
| 23 | Ga0070661_100313734 | 3300005344 | Bacteria | 1223 |
| 24 | Ga0070661_100982745 | 3300005344 | Bacteria | 700 |
| 25 | Ga0070692_10551980 | 3300005345 | Bacteria | 755 |
| 26 | Ga0070675_101010204 | 3300005354 | Bacteria | 764 |
| 27 | Ga0070675_101194960 | 3300005354 | Bacteria | 700 |
| 28 | Ga0070671_100298514 | 3300005355 | Bacteria | 1371 |
| 29 | Ga0070671_100520779 | 3300005355 | Bacteria | 1024 |
| 30 | Ga0070703_10073215 | 3300005406 | Bacteria | 1149 |
| 31 | Ga0070709_10069891 | 3300005434 | Bacteria | 2262 |
| 32 | Ga0070709_10277901 | 3300005434 | Bacteria | 1216 |
| 33 | Ga0070714_100001442 | 3300005435 | Bacteria | 17314 |
| 34 | Ga0070714_100001730 | 3300005435 | Bacteria | 15912 |
| 35 | Ga0070714_100008154 | 3300005435 | Bacteria | 8164 |
| 36 | Ga0070714_100028037 | 3300005435 | Bacteria | 4668 |
| 37 | Ga0070714_100120683 | 3300005435 | Bacteria | 2331 |
| 38 | Ga0070714_100137599 | 3300005435 | Unclassified | 2189 |
| 39 | Ga0070714_100316964 | 3300005435 | Bacteria | 1457 |
| 40 | Ga0070714_101084003 | 3300005435 | Bacteria | 780 |
| 41 | Ga0070713_100027513 | 3300005436 | Bacteria | 4477 |
| 42 | Ga0070713_100029682 | 3300005436 | Bacteria | 4333 |
| 43 | Ga0070713_100097436 | 3300005436 | Bacteria | 2541 |
| 44 | Ga0070713_100214119 | 3300005436 | Bacteria | 1745 |
| 45 | Ga0070713_100813950 | 3300005436 | Bacteria | 896 |
| 46 | Ga0070710_10004523 | 3300005437 | Bacteria | 6575 |
| 47 | Ga0070711_100032777 | 3300005439 | Bacteria | 3457 |
| 48 | Ga0070711_100088200 | 3300005439 | Bacteria | 2229 |
| 49 | Ga0070711_100194348 | 3300005439 | Bacteria | 1561 |
| 50 | Ga0070711_100284269 | 3300005439 | Bacteria | 1310 |
| 51 | Ga0070711_100596461 | 3300005439 | Bacteria | 921 |
| 52 | Ga0070711_100968706 | 3300005439 | Bacteria | 729 |
| 53 | Ga0070694_100043187 | 3300005444 | Bacteria | 3014 |
| 54 | Ga0070708_100140293 | 3300005445 | Bacteria | 2241 |
| 55 | Ga0070708_100263613 | 3300005445 | Bacteria | 1620 |
| 56 | Ga0070708_100897480 | 3300005445 | Bacteria | 832 |
| 57 | Ga0070663_100676971 | 3300005455 | Bacteria | 875 |
| 58 | Ga0070681_10027297 | 3300005458 | Bacteria | 5739 |
| 59 | Ga0070681_10036000 | 3300005458 | Bacteria | 4972 |
| 60 | Ga0070681_10051344 | 3300005458 | Bacteria | 4113 |
| 61 | Ga0070681_10057780 | 3300005458 | Bacteria | 3860 |
| 62 | Ga0070681_10262884 | 3300005458 | Bacteria | 1637 |
| 63 | Ga0070681_10555920 | 3300005458 | Bacteria | 1061 |
| 64 | Ga0070681_11071621 | 3300005458 | Bacteria | 726 |
| 65 | Ga0070707_100001128 | 3300005468 | Bacteria | 26352 |
| 66 | Ga0070707_100097095 | 3300005468 | Bacteria | 2854 |
| 67 | Ga0070707_100139777 | 3300005468 | Bacteria | 2357 |
| 68 | Ga0070707_100229155 | 3300005468 | Bacteria | 1809 |
| 69 | Ga0070707_100344411 | 3300005468 | Bacteria | 1448 |
| 70 | Ga0070707_100426793 | 3300005468 | Bacteria | 1286 |
| 71 | Ga0070698_100023352 | 3300005471 | Bacteria | 6464 |
| 72 | Ga0070698_100066288 | 3300005471 | Bacteria | 3635 |
| 73 | Ga0070698_100096124 | 3300005471 | Bacteria | 2939 |
| 74 | Ga0070698_100375402 | 3300005471 | Bacteria | 1354 |
| 75 | Ga0070679_100051987 | 3300005530 | Bacteria | 4082 |
| 76 | Ga0070679_100065672 | 3300005530 | Bacteria | 3616 |
| 77 | Ga0070679_100080703 | 3300005530 | Bacteria | 3242 |
| 78 | Ga0070679_100321897 | 3300005530 | Bacteria | 1495 |
| 79 | Ga0070679_101215223 | 3300005530 | Unclassified | 699 |
| 80 | Ga0070684_100230630 | 3300005535 | Bacteria | 1691 |
| 81 | Ga0070684_100518743 | 3300005535 | Bacteria | 1104 |
| 82 | Ga0070697_100037020 | 3300005536 | Bacteria | 3942 |
| 83 | Ga0070697_100718080 | 3300005536 | Bacteria | 882 |
| 84 | Ga0070697_101063564 | 3300005536 | Bacteria | 720 |
| 85 | Ga0068853_100362468 | 3300005539 | Bacteria | 1350 |
| 86 | Ga0070686_100113072 | 3300005544 | Bacteria | 1853 |
| 87 | Ga0070695_100000029 | 3300005545 | Bacteria | 53859 |
| 88 | Ga0070696_100367656 | 3300005546 | Bacteria | 1118 |
| 89 | Ga0070693_100182825 | 3300005547 | Bacteria | 1351 |
| 90 | Ga0070693_100947917 | 3300005547 | Bacteria | 648 |
| 91 | Ga0070704_100669133 | 3300005549 | Bacteria | 918 |
| 92 | Ga0068855_100044799 | 3300005563 | Bacteria | 5234 |
| 93 | Ga0068855_100070085 | 3300005563 | Bacteria | 4080 |
| 94 | Ga0068855_100980471 | 3300005563 | Bacteria | 889 |
| 95 | Ga0068855_101612890 | 3300005563 | Bacteria | 664 |
| 96 | Ga0070664_100088058 | 3300005564 | Bacteria | 2685 |
| 97 | Ga0068857_100103084 | 3300005577 | Bacteria | 2562 |
| 98 | Ga0068856_100098363 | 3300005614 | Bacteria | 2916 |
| 99 | Ga0068856_101264215 | 3300005614 | Unclassified | 754 |
| 100 | Ga0068856_101584317 | 3300005614 | Bacteria | 668 |
| 101 | Ga0070702_100284521 | 3300005615 | Bacteria | 1137 |
| 102 | Ga0068852_100316316 | 3300005616 | Bacteria | 1515 |
| 103 | Ga0068852_100834755 | 3300005616 | Bacteria | 937 |
| 104 | Ga0068852_101648512 | 3300005616 | Bacteria | 664 |
| 105 | Ga0068851_10586558 | 3300005834 | Bacteria | 677 |
| 106 | Ga0068863_100191810 | 3300005841 | Bacteria | 1964 |
| 107 | Ga0081538_10033321 | 3300005981 | Bacteria | 3432 |
| 108 | Ga0070717_10016372 | 3300006028 | Bacteria | 5748 |
| 109 | Ga0070717_10029414 | 3300006028 | Bacteria | 4407 |
| 110 | Ga0070717_10031104 | 3300006028 | Bacteria | 4292 |
| 111 | Ga0070717_10080120 | 3300006028 | Bacteria | 2739 |
| 112 | Ga0070717_10145688 | 3300006028 | Bacteria | 2045 |
| 113 | Ga0070717_10158291 | 3300006028 | Bacteria | 1963 |
| 114 | Ga0070717_10860777 | 3300006028 | Bacteria | 825 |
| 115 | Ga0075364_10003592 | 3300006051 | Bacteria | 8834 |
| 116 | Ga0070715_10250386 | 3300006163 | Bacteria | 926 |
| 117 | Ga0070716_100041828 | 3300006173 | Bacteria | 2555 |
| 118 | Ga0070716_100471412 | 3300006173 | Bacteria | 920 |
| 119 | Ga0070712_100052688 | 3300006175 | Bacteria | 2839 |
| 120 | Ga0070712_100087058 | 3300006175 | Bacteria | 2278 |
| 121 | Ga0070712_100210926 | 3300006175 | Bacteria | 1531 |
| 122 | Ga0070712_100513907 | 3300006175 | Bacteria | 1005 |
| 123 | Ga0075367_10093994 | 3300006178 | Bacteria | 1827 |
| 124 | Ga0075367_10146206 | 3300006178 | Bacteria | 1466 |
| 125 | Ga0075433_10688127 | 3300006852 | Bacteria | 896 |
| 126 | Ga0075434_100002359 | 3300006871 | Bacteria | 16542 |
| 127 | Ga0075434_100042304 | 3300006871 | Bacteria | 4517 |
| 128 | Ga0075436_100003536 | 3300006914 | Bacteria | 10715 |
| 129 | Ga0075436_100142117 | 3300006914 | Bacteria | 1687 |
| 130 | Ga0075436_100287087 | 3300006914 | Bacteria | 1177 |
| 131 | Ga0075436_100454671 | 3300006914 | Bacteria | 933 |
| 132 | Ga0075435_100112723 | 3300007076 | Bacteria | 2263 |
| 133 | Ga0075435_100796061 | 3300007076 | Bacteria | 823 |
| 134 | Ga0105240_10010108 | 3300009093 | Bacteria | 13279 |
| 135 | Ga0105240_10023072 | 3300009093 | Bacteria | 8241 |
| 136 | Ga0105240_10036412 | 3300009093 | Bacteria | 6331 |
| 137 | Ga0105240_10186268 | 3300009093 | Bacteria | 2445 |
| 138 | Ga0105245_10730365 | 3300009098 | Bacteria | 1025 |
| 139 | Ga0105241_10596901 | 3300009174 | Bacteria | 997 |
| 140 | Ga0105248_10246668 | 3300009177 | Bacteria | 2010 |
| 141 | Ga0105237_10064368 | 3300009545 | Bacteria | 3663 |
| 142 | Ga0105237_10413288 | 3300009545 | Bacteria | 1354 |
| 143 | Ga0105237_11385020 | 3300009545 | Bacteria | 710 |
| 144 | Ga0105237_11918162 | 3300009545 | Bacteria | 600 |
| 145 | Ga0105238_10093907 | 3300009551 | Bacteria | 2988 |
| 146 | Ga0105238_10457848 | 3300009551 | Bacteria | 1273 |
| 147 | Ga0099796_10054239 | 3300010159 | Unclassified | 1401 |
| 148 | Ga0105239_10058833 | 3300010375 | Bacteria | 4217 |
| 149 | Ga0105239_11000878 | 3300010375 | Bacteria | 961 |
| 150 | Ga0157373_10043309 | 3300013100 | Bacteria | 3215 |
| 151 | Ga0157373_10472871 | 3300013100 | Bacteria | 904 |
| 152 | Ga0157373_10553350 | 3300013100 | Bacteria | 835 |
| 153 | Ga0157373_11454715 | 3300013100 | Bacteria | 522 |
| 154 | Ga0157371_10636437 | 3300013102 | Bacteria | 795 |
| 155 | Ga0157370_10013425 | 3300013104 | Bacteria | 8439 |
| 156 | Ga0157370_10088032 | 3300013104 | Bacteria | 2916 |
| 157 | Ga0157370_10915501 | 3300013104 | Unclassified | 795 |
| 158 | Ga0157369_10013174 | 3300013105 | Bacteria | 9357 |
| 159 | Ga0157369_10033465 | 3300013105 | Bacteria | 5648 |
| 160 | Ga0157369_10283362 | 3300013105 | Bacteria | 1726 |
| 161 | Ga0157369_10369988 | 3300013105 | Bacteria | 1488 |
| 162 | Ga0157369_10402020 | 3300013105 | Bacteria | 1421 |
| 163 | Ga0157369_10481476 | 3300013105 | Unclassified | 1284 |
| 164 | Ga0157369_11260523 | 3300013105 | Bacteria | 754 |
| 165 | Ga0157374_10702232 | 3300013296 | Bacteria | 1025 |
| 166 | Ga0157374_11850541 | 3300013296 | Bacteria | 629 |
| 167 | Ga0157378_10744068 | 3300013297 | Bacteria | 1003 |
| 168 | Ga0163162_10154082 | 3300013306 | Bacteria | 2417 |
| 169 | Ga0157372_10007615 | 3300013307 | Bacteria | 11515 |
| 170 | Ga0157372_10353420 | 3300013307 | Bacteria | 1712 |
| 171 | Ga0157372_10588257 | 3300013307 | Bacteria | 1297 |
| 172 | Ga0157372_11080743 | 3300013307 | Bacteria | 928 |
| 173 | Ga0157375_12465529 | 3300013308 | Unclassified | 621 |
| 174 | Ga0163163_10571131 | 3300014325 | Bacteria | 1194 |
| 175 | Ga0182008_10003425 | 3300014497 | Bacteria | 9576 |
| 176 | Ga0182008_10025785 | 3300014497 | Bacteria | 2985 |
| 177 | Ga0182008_10188646 | 3300014497 | Unclassified | 1045 |
| 178 | Ga0157379_11785684 | 3300014968 | Bacteria | 604 |
| 179 | Ga0157376_10031446 | 3300014969 | Bacteria | 4250 |
| 180 | Ga0182006_1013195 | 3300015261 | Bacteria | 3591 |
| 181 | Ga0182007_10013137 | 3300015262 | Bacteria | 3169 |
| 182 | Ga0182005_1139216 | 3300015265 | Bacteria | 700 |
| 183 | Ga0197907_11037992 | 3300020069 | Bacteria | 1851 |
| 184 | Ga0206356_10027961 | 3300020070 | Bacteria | 1681 |
| 185 | Ga0206356_11522396 | 3300020070 | Bacteria | 2193 |
| 186 | Ga0206356_11548852 | 3300020070 | Bacteria | 1478 |
| 187 | Ga0206354_10162523 | 3300020081 | Bacteria | 760 |
| 188 | Ga0206354_10280470 | 3300020081 | Bacteria | 1223 |
| 189 | Ga0206354_10581218 | 3300020081 | Bacteria | 1274 |
| 190 | Ga0206354_11352109 | 3300020081 | Bacteria | 684 |
| 191 | Ga0206354_11453059 | 3300020081 | Bacteria | 2634 |
| 192 | Ga0206353_10217476 | 3300020082 | Bacteria | 1790 |
| 193 | Ga0206353_10335970 | 3300020082 | Bacteria | 1193 |
| 194 | Ga0206353_10928214 | 3300020082 | Bacteria | 2944 |
| 195 | Ga0206353_11341242 | 3300020082 | Bacteria | 2465 |
| 196 | Ga0206353_12063638 | 3300020082 | Bacteria | 3769 |
| 197 | Ga0224712_10026165 | 3300022467 | Bacteria | 2060 |
| 198 | Ga0207692_10047524 | 3300025898 | Bacteria | 2155 |
| 199 | Ga0207692_10187343 | 3300025898 | Bacteria | 1209 |
| 200 | Ga0207692_10476687 | 3300025898 | Bacteria | 789 |
| 201 | Ga0207685_10114734 | 3300025905 | Bacteria | 1173 |
| 202 | Ga0207699_10005456 | 3300025906 | Bacteria | 6086 |
| 203 | Ga0207699_10260711 | 3300025906 | Bacteria | 1198 |
| 204 | Ga0207705_10009302 | 3300025909 | Bacteria | 7146 |
| 205 | Ga0207705_10090975 | 3300025909 | Bacteria | 2234 |
| 206 | Ga0207705_10107552 | 3300025909 | Bacteria | 2058 |
| 207 | Ga0207705_10272643 | 3300025909 | Bacteria | 1294 |
| 208 | Ga0207705_10342036 | 3300025909 | Bacteria | 1152 |
| 209 | Ga0207705_11098974 | 3300025909 | Bacteria | 612 |
| 210 | Ga0207707_10013404 | 3300025912 | Bacteria | 7147 |
| 211 | Ga0207707_10018329 | 3300025912 | Bacteria | 6102 |
| 212 | Ga0207707_10073051 | 3300025912 | Bacteria | 2990 |
| 213 | Ga0207707_10084670 | 3300025912 | Bacteria | 2769 |
| 214 | Ga0207707_10183900 | 3300025912 | Bacteria | 1824 |
| 215 | Ga0207707_10269275 | 3300025912 | Bacteria | 1476 |
| 216 | Ga0207707_10927744 | 3300025912 | Bacteria | 718 |
| 217 | Ga0207695_10030376 | 3300025913 | Bacteria | 5948 |
| 218 | Ga0207695_10654536 | 3300025913 | Bacteria | 931 |
| 219 | Ga0207695_11728477 | 3300025913 | Bacteria | 507 |
| 220 | Ga0207671_10375002 | 3300025914 | Bacteria | 1130 |
| 221 | Ga0207693_10020457 | 3300025915 | Bacteria | 5264 |
| 222 | Ga0207693_10052882 | 3300025915 | Bacteria | 3186 |
| 223 | Ga0207693_10241259 | 3300025915 | Bacteria | 1418 |
| 224 | Ga0207693_11286048 | 3300025915 | Bacteria | 548 |
| 225 | Ga0207663_10161964 | 3300025916 | Bacteria | 1580 |
| 226 | Ga0207663_10183229 | 3300025916 | Bacteria | 1497 |
| 227 | Ga0207663_10285313 | 3300025916 | Bacteria | 1228 |
| 228 | Ga0207663_10515222 | 3300025916 | Bacteria | 931 |
| 229 | Ga0207663_10573485 | 3300025916 | Bacteria | 884 |
| 230 | Ga0207660_10098505 | 3300025917 | Unclassified | 2181 |
| 231 | Ga0207660_10242086 | 3300025917 | Bacteria | 1421 |
| 232 | Ga0207660_10311739 | 3300025917 | Bacteria | 1255 |
| 233 | Ga0207660_10800396 | 3300025917 | Unclassified | 769 |
| 234 | Ga0207660_11104569 | 3300025917 | Bacteria | 646 |
| 235 | Ga0207657_10013743 | 3300025919 | Bacteria | 7926 |
| 236 | Ga0207657_10028373 | 3300025919 | Bacteria | 5106 |
| 237 | Ga0207657_10053710 | 3300025919 | Bacteria | 3489 |
| 238 | Ga0207657_10061747 | 3300025919 | Bacteria | 3211 |
| 239 | Ga0207657_10307677 | 3300025919 | Bacteria | 1255 |
| 240 | Ga0207657_10320892 | 3300025919 | Bacteria | 1225 |
| 241 | Ga0207649_10722288 | 3300025920 | Bacteria | 774 |
| 242 | Ga0207652_10114951 | 3300025921 | Bacteria | 2390 |
| 243 | Ga0207652_10159422 | 3300025921 | Bacteria | 2022 |
| 244 | Ga0207652_10262398 | 3300025921 | Bacteria | 1558 |
| 245 | Ga0207652_10279447 | 3300025921 | Bacteria | 1506 |
| 246 | Ga0207652_11015729 | 3300025921 | Unclassified | 728 |
| 247 | Ga0207652_11394116 | 3300025921 | Bacteria | 604 |
| 248 | Ga0207646_10003943 | 3300025922 | Bacteria | 16459 |
| 249 | Ga0207646_10266726 | 3300025922 | Bacteria | 1548 |
| 250 | Ga0207646_10289617 | 3300025922 | Bacteria | 1480 |
| 251 | Ga0207646_10529585 | 3300025922 | Bacteria | 1060 |
| 252 | Ga0207694_10139557 | 3300025924 | Bacteria | 1948 |
| 253 | Ga0207687_10121658 | 3300025927 | Bacteria | 1953 |
| 254 | Ga0207700_10154134 | 3300025928 | Bacteria | 1902 |
| 255 | Ga0207700_10568213 | 3300025928 | Bacteria | 1008 |
| 256 | Ga0207664_10007454 | 3300025929 | Bacteria | 7588 |
| 257 | Ga0207664_10019236 | 3300025929 | Bacteria | 5044 |
| 258 | Ga0207664_10025643 | 3300025929 | Bacteria | 4445 |
| 259 | Ga0207664_10049060 | 3300025929 | Bacteria | 3322 |
| 260 | Ga0207664_10059156 | 3300025929 | Unclassified | 3051 |
| 261 | Ga0207664_10242555 | 3300025929 | Bacteria | 1570 |
| 262 | Ga0207664_10251574 | 3300025929 | Bacteria | 1542 |
| 263 | Ga0207664_10317572 | 3300025929 | Bacteria | 1374 |
| 264 | Ga0207664_10317877 | 3300025929 | Bacteria | 1373 |
| 265 | Ga0207664_10319332 | 3300025929 | Bacteria | 1370 |
| 266 | Ga0207664_10555673 | 3300025929 | Bacteria | 1030 |
| 267 | Ga0207644_10091555 | 3300025931 | Bacteria | 2268 |
| 268 | Ga0207686_10810993 | 3300025934 | Bacteria | 751 |
| 269 | Ga0207665_10001348 | 3300025939 | Bacteria | 16557 |
| 270 | Ga0207665_10102769 | 3300025939 | Bacteria | 1998 |
| 271 | Ga0207665_10260740 | 3300025939 | Bacteria | 1284 |
| 272 | Ga0207665_10310301 | 3300025939 | Bacteria | 1181 |
| 273 | Ga0207665_10604255 | 3300025939 | Bacteria | 857 |
| 274 | Ga0207711_10517683 | 3300025941 | Bacteria | 1112 |
| 275 | Ga0207661_10181222 | 3300025944 | Bacteria | 1840 |
| 276 | Ga0207661_10244532 | 3300025944 | Bacteria | 1593 |
| 277 | Ga0207661_11100131 | 3300025944 | Bacteria | 732 |
| 278 | Ga0207667_10186001 | 3300025949 | Bacteria | 2132 |
| 279 | Ga0207667_10244522 | 3300025949 | Bacteria | 1836 |
| 280 | Ga0207667_10258869 | 3300025949 | Bacteria | 1779 |
| 281 | Ga0207667_10416902 | 3300025949 | Bacteria | 1366 |
| 282 | Ga0207667_10683456 | 3300025949 | Bacteria | 1030 |
| 283 | Ga0207667_10837863 | 3300025949 | Bacteria | 914 |
| 284 | Ga0207712_10178408 | 3300025961 | Bacteria | 1666 |
| 285 | Ga0207640_10141303 | 3300025981 | Bacteria | 1755 |
| 286 | Ga0207639_10558783 | 3300026041 | Bacteria | 1051 |
| 287 | Ga0207639_11055357 | 3300026041 | Bacteria | 762 |
| 288 | Ga0207678_10417337 | 3300026067 | Bacteria | 1163 |
| 289 | Ga0207702_10113980 | 3300026078 | Bacteria | 2408 |
| 290 | Ga0207702_10148408 | 3300026078 | Bacteria | 2131 |
| 291 | Ga0207702_10544779 | 3300026078 | Bacteria | 1134 |
| 292 | Ga0207641_10039645 | 3300026088 | Bacteria | 3941 |
| 293 | Ga0207698_10422343 | 3300026142 | Bacteria | 1280 |
| 294 | Ga0207698_10447569 | 3300026142 | Bacteria | 1246 |
| 295 | Ga0207698_10918802 | 3300026142 | Bacteria | 883 |
| 296 | Ga0209813_10258041 | 3300027866 | Bacteria | 664 |
| 297 | Ga0265326_10036019 | 3300028558 | Bacteria | 1407 |
| 298 | Ga0265326_10128514 | 3300028558 | Bacteria | 722 |
| 299 | Ga0265319_1006111 | 3300028563 | Bacteria | 5631 |
| 300 | Ga0265319_1039562 | 3300028563 | Bacteria | 1597 |
| 301 | Ga0265334_10014826 | 3300028573 | Bacteria | 3244 |
| 302 | Ga0265334_10020139 | 3300028573 | Bacteria | 2734 |
| 303 | Ga0265318_10000691 | 3300028577 | Bacteria | 22716 |
| 304 | Ga0265318_10100256 | 3300028577 | Bacteria | 1066 |
| 305 | Ga0265323_10013669 | 3300028653 | Bacteria | 3231 |
| 306 | Ga0265323_10079191 | 3300028653 | Unclassified | 1112 |
| 307 | Ga0265322_10009294 | 3300028654 | Bacteria | 2855 |
| 308 | Ga0265336_10019405 | 3300028666 | Bacteria | 2193 |
| 309 | Ga0265338_10001048 | 3300028800 | Bacteria | 46186 |
| 310 | Ga0265338_10003605 | 3300028800 | Bacteria | 21613 |
| 311 | Ga0265338_10007115 | 3300028800 | Bacteria | 14011 |
| 312 | Ga0265338_10022563 | 3300028800 | Bacteria | 6510 |
| 313 | Ga0265338_10039236 | 3300028800 | Bacteria | 4472 |
| 314 | Ga0265338_10102538 | 3300028800 | Bacteria | 2326 |
| 315 | Ga0265338_10231610 | 3300028800 | Bacteria | 1373 |
| 316 | Ga0265338_10478762 | 3300028800 | Bacteria | 879 |
| 317 | Ga0265324_10011053 | 3300029957 | Bacteria | 3455 |
| 318 | Ga0265324_10060109 | 3300029957 | Unclassified | 1299 |
| 319 | Ga0265330_10028366 | 3300031235 | Bacteria | 2523 |
| 320 | Ga0265330_10063169 | 3300031235 | Unclassified | 1609 |
| 321 | Ga0265330_10302547 | 3300031235 | Bacteria | 674 |
| 322 | Ga0265328_10019067 | 3300031239 | Bacteria | 2639 |
| 323 | Ga0265320_10017612 | 3300031240 | Bacteria | 3960 |
| 324 | Ga0265320_10030136 | 3300031240 | Bacteria | 2801 |
| 325 | Ga0265325_10000102 | 3300031241 | Bacteria | 59998 |
| 326 | Ga0265325_10203959 | 3300031241 | Bacteria | 911 |
| 327 | Ga0265325_10246858 | 3300031241 | Unclassified | 809 |
| 328 | Ga0265329_10086720 | 3300031242 | Unclassified | 992 |
| 329 | Ga0265340_10009900 | 3300031247 | Bacteria | 5108 |
| 330 | Ga0265340_10167127 | 3300031247 | Unclassified | 997 |
| 331 | Ga0265339_10011424 | 3300031249 | Bacteria | 5465 |
| 332 | Ga0265339_10150598 | 3300031249 | Bacteria | 1177 |
| 333 | Ga0265331_10061744 | 3300031250 | Bacteria | 1768 |
| 334 | Ga0265331_10095560 | 3300031250 | Unclassified | 1371 |
| 335 | Ga0265327_10025194 | 3300031251 | Bacteria | 3474 |
| 336 | Ga0265327_10124888 | 3300031251 | Bacteria | 1216 |
| 337 | Ga0265327_10135228 | 3300031251 | Unclassified | 1156 |
| 338 | Ga0265316_10021633 | 3300031344 | Bacteria | 5441 |
| 339 | Ga0265313_10006148 | 3300031595 | Bacteria | 8619 |
| 340 | Ga0265313_10090527 | 3300031595 | Bacteria | 1374 |
| 341 | Ga0265314_10003427 | 3300031711 | Bacteria | 15325 |
| 342 | Ga0265342_10038790 | 3300031712 | Bacteria | 2899 |
| 343 | Ga0316583_10014535 | 3300032133 | Bacteria | 2837 |
| 344 | Ga0316583_10038708 | 3300032133 | Bacteria | 1690 |
| 345 | Ga0316583_10039538 | 3300032133 | Bacteria | 1670 |
| 346 | Ga0373934_0037792 | 3300035086 | Bacteria | 1901 |
| 347 | Ga0373923_0254471 | 3300035111 | Bacteria | 823 |
| 348 | Ga0373936_0176263 | 3300035113 | Bacteria | 936 |
| 349 | Ga0373941_0254590 | 3300035115 | Bacteria | 687 |
| 350 | Ga0373945_0005783 | 3300035116 | Bacteria | 3968 |
| 351 | Ga0373945_0209764 | 3300035116 | Bacteria | 811 |
| 352 | Ga0373954_0155027 | 3300035118 | Unclassified | 1120 |
| 353 | Ga0373956_0042005 | 3300035119 | Bacteria | 2032 |
| 354 | Ga0373956_0372871 | 3300035119 | Bacteria | 681 |
| 355 | Ga0373957_0090977 | 3300035120 | Bacteria | 1213 |
| 356 | Ga0373960_0120036 | 3300035121 | Bacteria | 872 |
| 357 | Ga0373943_0002704 | 3300035170 | Bacteria | 8056 |
| 358 | Ga0373943_0365015 | 3300035170 | Bacteria | 829 |
| 359 | Ga0373946_0021452 | 3300035171 | Bacteria | 2505 |
| 360 | Ga0373955_0016364 | 3300035172 | Bacteria | 3649 |
| 361 | Ga0373955_0159308 | 3300035172 | Bacteria | 1331 |
| 362 | Ga0373955_0309974 | 3300035172 | Bacteria | 953 |
| 363 | Ga0373955_0340373 | 3300035172 | Unclassified | 908 |
| 364 | Ga0373924_0049640 | 3300035410 | Bacteria | 1737 |
| 365 | Ga0373924_0089194 | 3300035410 | Bacteria | 1318 |
| 366 | Ga0373924_0179913 | 3300035410 | Bacteria | 930 |
| 367 | Ga0373931_0180163 | 3300035691 | Bacteria | 1251 |
| 368 | Ga0373931_0259568 | 3300035691 | Bacteria | 1060 |
| 369 | Ga0373933_0156210 | 3300035724 | Bacteria | 1447 |
| 370 | Ga0373947_0556874 | 3300035725 | Bacteria | 781 |
| 371 | Ga0373937_0003562 | 3300036401 | Bacteria | 13119 |
| 372 | Ga0373937_1031926 | 3300036401 | Bacteria | 771 |
| 373 | Ga0373925_0001320 | 3300037068 | Bacteria | 21707 |
| 374 | Ga0373925_0484484 | 3300037068 | Bacteria | 1015 |
| 375 | Ga0395899_0161575 | 3300037312 | Bacteria | 1582 |
| 376 | Ga0395899_0167975 | 3300037312 | Bacteria | 1546 |
| 377 | Ga0395900_0101231 | 3300037418 | Bacteria | 2959 |
| 378 | Ga0395900_0153540 | 3300037418 | Bacteria | 2352 |
| 379 | Ga0395900_0160762 | 3300037418 | Bacteria | 2291 |
| 380 | Ga0395900_0222339 | 3300037418 | Bacteria | 1902 |
| 381 | Ga0395900_0229986 | 3300037418 | Bacteria | 1865 |
| 382 | Ga0395900_0673417 | 3300037418 | Bacteria | 970 |
| 383 | Ga0395900_0804888 | 3300037418 | Bacteria | 867 |
| 384 | Ga0395900_0902665 | 3300037418 | Bacteria | 807 |
| 385 | Ga0395900_0994576 | 3300037418 | Unclassified | 759 |
| 386 | Ga0395900_1428488 | 3300037418 | Bacteria | 605 |
| 387 | Ga0395900_1470170 | 3300037418 | Bacteria | 594 |
| 388 | Ga0395898_0018968 | 3300037466 | Bacteria | 7008 |
| 389 | Ga0395898_0067856 | 3300037466 | Bacteria | 3452 |
| 390 | Ga0395898_0088361 | 3300037466 | Bacteria | 2983 |
| 391 | Ga0395898_0114073 | 3300037466 | Bacteria | 2589 |
| 392 | Ga0395898_1105813 | 3300037466 | Bacteria | 726 |
| 393 | Ga0395898_1819768 | 3300037466 | Bacteria | 530 |
| 394 | Ga0395905_0000386 | 3300037471 | Bacteria | 62786 |
| 395 | Ga0395905_0114323 | 3300037471 | Bacteria | 2536 |
| 396 | Ga0395905_0121213 | 3300037471 | Bacteria | 2458 |
| 397 | Ga0395905_0131737 | 3300037471 | Bacteria | 2351 |
| 398 | Ga0395905_0501725 | 3300037471 | Unclassified | 1114 |
| 399 | Ga0395905_0973689 | 3300037471 | Bacteria | 751 |
| 400 | Ga0395901_0054876 | 3300038443 | Bacteria | 4142 |
| 401 | Ga0395901_0124900 | 3300038443 | Bacteria | 2704 |
| 402 | Ga0395901_0130218 | 3300038443 | Bacteria | 2643 |
| 403 | Ga0395901_0147806 | 3300038443 | Bacteria | 2470 |
| 404 | Ga0395901_0603215 | 3300038443 | Bacteria | 1107 |
| 405 | Ga0242420_054419 | 3300038996 | Bacteria | 788 |
| 406 | Ga0436365_0252739 | 3300039437 | Bacteria | 707 |
| 407 | Ga0436360_0556007 | 3300039438 | Bacteria | 1634 |
| 408 | Ga0436363_1430576 | 3300039450 | Unclassified | 603 |
| 409 | Ga0436363_1463861 | 3300039450 | Bacteria | 976 |
| 410 | Ga0451853_1828558 | 3300041512 | Bacteria | 1124 |
| 411 | Ga0451853_3430042 | 3300041512 | Bacteria | 780 |
| 412 | Ga0466969_0032043 | 3300044656 | Bacteria | 2673 |
| 413 | Ga0466965_0011754 | 3300044683 | Bacteria | 4108 |
| 414 | Ga0466965_0056962 | 3300044683 | Bacteria | 1947 |
| 415 | Ga0466966_0003176 | 3300044684 | Bacteria | 10817 |
| 416 | Ga0466966_0040188 | 3300044684 | Bacteria | 3010 |
| 417 | Ga0466966_0243719 | 3300044684 | Bacteria | 1083 |
| 418 | Ga0466966_0572357 | 3300044684 | Bacteria | 680 |
| 419 | Ga0466966_0903747 | 3300044684 | Bacteria | 532 |
| 420 | Ga0466961_0012817 | 3300044693 | Bacteria | 5366 |
| 421 | Ga0466961_0022246 | 3300044693 | Bacteria | 4079 |
| 422 | Ga0466961_0129285 | 3300044693 | Bacteria | 1583 |
| 423 | Ga0466961_0245992 | 3300044693 | Bacteria | 1099 |
| 424 | Ga0466961_0732636 | 3300044693 | Bacteria | 591 |
| 425 | Ga0466961_0747228 | 3300044693 | Bacteria | 585 |
| 426 | Ga0466961_0803150 | 3300044693 | Unclassified | 561 |
| 427 | Ga0466963_0001433 | 3300044694 | Bacteria | 12841 |
| 428 | Ga0466963_0002189 | 3300044694 | Bacteria | 10808 |
| 429 | Ga0466963_0003641 | 3300044694 | Bacteria | 8854 |
| 430 | Ga0466963_0006990 | 3300044694 | Bacteria | 6716 |
| 431 | Ga0466963_0007093 | 3300044694 | Bacteria | 6673 |
| 432 | Ga0466963_0008418 | 3300044694 | Bacteria | 6181 |
| 433 | Ga0466963_0010262 | 3300044694 | Bacteria | 5667 |
| 434 | Ga0466963_0013063 | 3300044694 | Bacteria | 5092 |
| 435 | Ga0466963_0016356 | 3300044694 | Bacteria | 4612 |
| 436 | Ga0466963_0021819 | 3300044694 | Bacteria | 4045 |
| 437 | Ga0466963_0043897 | 3300044694 | Bacteria | 2941 |
| 438 | Ga0466963_0097428 | 3300044694 | Bacteria | 2009 |
| 439 | Ga0466963_0103608 | 3300044694 | Bacteria | 1949 |
| 440 | Ga0466963_0213516 | 3300044694 | Bacteria | 1351 |
| 441 | Ga0466963_0424630 | 3300044694 | Bacteria | 937 |
| 442 | Ga0466963_0959202 | 3300044694 | Unclassified | 602 |
| 443 | Ga0466963_1023291 | 3300044694 | Bacteria | 581 |
| 444 | Ga0466964_0016378 | 3300044706 | Bacteria | 2830 |
| 445 | Ga0466964_0019203 | 3300044706 | Bacteria | 2626 |
| 446 | Ga0466964_0038264 | 3300044706 | Bacteria | 1928 |
| 447 | Ga0466964_0044192 | 3300044706 | Bacteria | 1809 |
| 448 | Ga0466964_0063715 | 3300044706 | Bacteria | 1540 |
| 449 | Ga0466964_0072368 | 3300044706 | Bacteria | 1461 |
| 450 | Ga0466964_0077099 | 3300044706 | Bacteria | 1422 |
| 451 | Ga0466964_0078199 | 3300044706 | Bacteria | 1414 |
| 452 | Ga0466964_0114655 | 3300044706 | Bacteria | 1206 |
| 453 | Ga0466964_0345219 | 3300044706 | Bacteria | 763 |
| 454 | Ga0466964_0378874 | 3300044706 | Bacteria | 734 |
| 455 | Ga0453684_0644134 | 3300044712 | Bacteria | 1157 |
| 456 | Ga0466971_0000170 | 3300044719 | Bacteria | 24398 |
| 457 | Ga0466971_0007771 | 3300044719 | Bacteria | 4674 |
| 458 | Ga0466971_0027006 | 3300044719 | Bacteria | 2569 |
| 459 | Ga0466971_0034096 | 3300044719 | Bacteria | 2281 |
| 460 | Ga0466971_0654262 | 3300044719 | Unclassified | 526 |
| 461 | Ga0466968_0001006 | 3300044735 | Bacteria | 9928 |
| 462 | Ga0466968_0019982 | 3300044735 | Bacteria | 2700 |
| 463 | Ga0466968_0021702 | 3300044735 | Bacteria | 2602 |
| 464 | Ga0466968_0046529 | 3300044735 | Bacteria | 1843 |
| 465 | Ga0466968_0127171 | 3300044735 | Bacteria | 1157 |
| 466 | Ga0466968_0132526 | 3300044735 | Bacteria | 1135 |
| 467 | Ga0466968_0198853 | 3300044735 | Bacteria | 938 |
| 468 | Ga0466968_0212394 | 3300044735 | Bacteria | 909 |
| 469 | Ga0466968_0313522 | 3300044735 | Bacteria | 756 |
| 470 | Ga0466970_0000806 | 3300044765 | Bacteria | 15112 |
| 471 | Ga0466970_0015951 | 3300044765 | Bacteria | 3868 |
| 472 | Ga0466970_0020042 | 3300044765 | Bacteria | 3471 |
| 473 | Ga0466957_0000671 | 3300044842 | Bacteria | 17426 |
| 474 | Ga0466957_0003280 | 3300044842 | Bacteria | 8862 |
| 475 | Ga0466957_0004865 | 3300044842 | Bacteria | 7519 |
| 476 | Ga0466957_0009740 | 3300044842 | Bacteria | 5488 |
| 477 | Ga0466957_0011646 | 3300044842 | Bacteria | 5082 |
| 478 | Ga0466957_0030148 | 3300044842 | Bacteria | 3238 |
| 479 | Ga0466957_0031191 | 3300044842 | Bacteria | 3184 |
| 480 | Ga0466957_0045424 | 3300044842 | Bacteria | 2664 |
| 481 | Ga0466957_0063127 | 3300044842 | Bacteria | 2276 |
| 482 | Ga0466957_0075551 | 3300044842 | Bacteria | 2091 |
| 483 | Ga0466957_0139000 | 3300044842 | Bacteria | 1563 |
| 484 | Ga0466957_0188090 | 3300044842 | Bacteria | 1351 |
| 485 | Ga0466957_0205312 | 3300044842 | Bacteria | 1296 |
| 486 | Ga0466957_0211372 | 3300044842 | Bacteria | 1277 |
| 487 | Ga0466957_0318204 | 3300044842 | Bacteria | 1049 |
| 488 | Ga0466957_0329970 | 3300044842 | Bacteria | 1031 |
| 489 | Ga0466960_0031765 | 3300044901 | Bacteria | 2438 |
| 490 | Ga0466960_0146023 | 3300044901 | Bacteria | 1260 |
| 491 | Ga0466959_0000274 | 3300045049 | Bacteria | 31486 |
| 492 | Ga0466959_0003637 | 3300045049 | Bacteria | 10171 |
| 493 | Ga0466959_0005938 | 3300045049 | Bacteria | 8416 |
| 494 | Ga0466959_0028480 | 3300045049 | Bacteria | 4142 |
| 495 | Ga0466959_0066806 | 3300045049 | Bacteria | 2608 |
| 496 | Ga0466959_0111214 | 3300045049 | Bacteria | 1954 |
| 497 | Ga0466959_0181500 | 3300045049 | Unclassified | 1472 |
| 498 | Ga0466959_0236750 | 3300045049 | Unclassified | 1262 |
| 499 | Ga0466959_0458591 | 3300045049 | Bacteria | 864 |
| 500 | Ga0466959_0965759 | 3300045049 | Bacteria | 568 |
| 501 | Ga0466958_0000300 | 3300045836 | Bacteria | 19385 |
| 502 | Ga0466958_0001062 | 3300045836 | Bacteria | 12591 |
| 503 | Ga0466958_0006904 | 3300045836 | Bacteria | 6208 |
| 504 | Ga0466958_0017529 | 3300045836 | Bacteria | 4143 |
| 505 | Ga0466958_0021115 | 3300045836 | Bacteria | 3801 |
| 506 | Ga0466958_0022617 | 3300045836 | Bacteria | 3684 |
| 507 | Ga0466958_0040385 | 3300045836 | Bacteria | 2804 |
| 508 | Ga0466958_0068946 | 3300045836 | Bacteria | 2162 |
| 509 | Ga0466958_0116018 | 3300045836 | Bacteria | 1673 |
| 510 | Ga0466958_0120128 | 3300045836 | Bacteria | 1645 |
| 511 | Ga0466958_0350377 | 3300045836 | Bacteria | 950 |
| 512 | Ga0466958_0424269 | 3300045836 | Bacteria | 860 |
| 513 | Ga0466967_0000828 | 3300045976 | Bacteria | 16293 |
| 514 | Ga0466967_0002114 | 3300045976 | Bacteria | 12193 |
| 515 | Ga0466967_0002908 | 3300045976 | Bacteria | 10915 |
| 516 | Ga0466967_0003311 | 3300045976 | Bacteria | 10465 |
| 517 | Ga0466967_0009149 | 3300045976 | Bacteria | 7328 |
| 518 | Ga0466967_0010698 | 3300045976 | Bacteria | 6897 |
| 519 | Ga0466967_0012395 | 3300045976 | Bacteria | 6517 |
| 520 | Ga0466967_0023141 | 3300045976 | Bacteria | 5087 |
| 521 | Ga0466967_0027027 | 3300045976 | Bacteria | 4766 |
| 522 | Ga0466967_0029636 | 3300045976 | Bacteria | 4583 |
| 523 | Ga0466967_0033811 | 3300045976 | Bacteria | 4332 |
| 524 | Ga0466967_0034791 | 3300045976 | Bacteria | 4280 |
| 525 | Ga0466967_0042827 | 3300045976 | Bacteria | 3915 |
| 526 | Ga0466967_0067487 | 3300045976 | Bacteria | 3190 |
| 527 | Ga0466967_0072640 | 3300045976 | Unclassified | 3084 |
| 528 | Ga0466967_0081515 | 3300045976 | Bacteria | 2922 |
| 529 | Ga0466967_0098579 | 3300045976 | Bacteria | 2668 |
| 530 | Ga0466967_0105618 | 3300045976 | Bacteria | 2580 |
| 531 | Ga0466967_0107460 | 3300045976 | Bacteria | 2559 |
| 532 | Ga0466967_0117557 | 3300045976 | Bacteria | 2451 |
| 533 | Ga0466967_0169647 | 3300045976 | Bacteria | 2052 |
| 534 | Ga0466967_0184316 | 3300045976 | Bacteria | 1970 |
| 535 | Ga0466967_0204330 | 3300045976 | Bacteria | 1872 |
| 536 | Ga0466967_0207943 | 3300045976 | Bacteria | 1855 |
| 537 | Ga0466967_0211135 | 3300045976 | Bacteria | 1841 |
| 538 | Ga0466967_0236924 | 3300045976 | Bacteria | 1739 |
| 539 | Ga0466967_0255654 | 3300045976 | Bacteria | 1675 |
| 540 | Ga0466967_0323107 | 3300045976 | Bacteria | 1488 |
| 541 | Ga0466967_0479525 | 3300045976 | Bacteria | 1218 |
| 542 | Ga0466967_0716912 | 3300045976 | Bacteria | 991 |
| 543 | Ga0466967_1430949 | 3300045976 | Bacteria | 688 |
| 544 | Ga0466967_1519522 | 3300045976 | Bacteria | 667 |
| 545 | Ga0495592_0014141 | 3300046454 | Bacteria | 6063 |
| 546 | Ga0495592_0038050 | 3300046454 | Bacteria | 3620 |
| 547 | Ga0495592_0185722 | 3300046454 | Bacteria | 1412 |
| 548 | Ga0495592_0223762 | 3300046454 | Bacteria | 1257 |
| 549 | Ga0495603_0053526 | 3300046455 | Bacteria | 2394 |
| 550 | Ga0495603_0520239 | 3300046455 | Bacteria | 681 |
| 551 | Ga0495603_0604889 | 3300046455 | Bacteria | 628 |
| 552 | Ga0495590_0095049 | 3300046457 | Bacteria | 1056 |
| 553 | Ga0495629_0001816 | 3300046459 | Bacteria | 16725 |
| 554 | Ga0495629_0320029 | 3300046459 | Bacteria | 1060 |
| 555 | Ga0495629_0567865 | 3300046459 | Bacteria | 760 |
| 556 | Ga0495641_0007480 | 3300046461 | Bacteria | 6809 |
| 557 | Ga0495641_0142465 | 3300046461 | Bacteria | 1071 |
| 558 | Ga0495641_0184946 | 3300046461 | Bacteria | 933 |
| 559 | Ga0495651_0000028 | 3300046462 | Bacteria | 105473 |
| 560 | Ga0495651_0111389 | 3300046462 | Bacteria | 2023 |
| 561 | Ga0495653_0000965 | 3300046463 | Bacteria | 22058 |
| 562 | Ga0495653_0019134 | 3300046463 | Bacteria | 5556 |
| 563 | Ga0495653_0023889 | 3300046463 | Bacteria | 4933 |
| 564 | Ga0495653_0061020 | 3300046463 | Bacteria | 2854 |
| 565 | Ga0495653_0081081 | 3300046463 | Bacteria | 2398 |
| 566 | Ga0495653_0185791 | 3300046463 | Bacteria | 1422 |
| 567 | Ga0495580_0042963 | 3300046472 | Bacteria | 3217 |
| 568 | Ga0495582_0012985 | 3300046473 | Bacteria | 4588 |
| 569 | Ga0495582_0016268 | 3300046473 | Bacteria | 4074 |
| 570 | Ga0495582_0031507 | 3300046473 | Bacteria | 2914 |
| 571 | Ga0495639_0000630 | 3300046475 | Bacteria | 16276 |
| 572 | Ga0495662_0001339 | 3300046476 | Bacteria | 12171 |
| 573 | Ga0495662_0024242 | 3300046476 | Bacteria | 2928 |
| 574 | Ga0495664_0032023 | 3300046477 | Bacteria | 3083 |
| 575 | Ga0495664_0082635 | 3300046477 | Bacteria | 1926 |
| 576 | Ga0495664_0105740 | 3300046477 | Bacteria | 1697 |
| 577 | Ga0495664_0117867 | 3300046477 | Bacteria | 1605 |
| 578 | Ga0495664_0162973 | 3300046477 | Bacteria | 1353 |
| 579 | Ga0495584_0051193 | 3300046491 | Bacteria | 2080 |
| 580 | Ga0495584_0713903 | 3300046491 | Bacteria | 511 |
| 581 | Ga0495607_0081915 | 3300046501 | Bacteria | 1772 |
| 582 | Ga0495608_0008137 | 3300046511 | Bacteria | 7364 |
| 583 | Ga0495608_0008892 | 3300046511 | Bacteria | 7021 |
| 584 | Ga0495608_0100374 | 3300046511 | Bacteria | 1866 |
| 585 | Ga0495608_0228967 | 3300046511 | Bacteria | 1164 |
| 586 | Ga0495608_0259131 | 3300046511 | Unclassified | 1083 |
| 587 | Ga0495608_0339532 | 3300046511 | Unclassified | 926 |
| 588 | Ga0495618_0012985 | 3300046514 | Bacteria | 5063 |
| 589 | Ga0495618_0052048 | 3300046514 | Bacteria | 2587 |
| 590 | Ga0495618_0113992 | 3300046514 | Bacteria | 1731 |
| 591 | Ga0495618_0331322 | 3300046514 | Bacteria | 941 |
| 592 | Ga0495618_0491674 | 3300046514 | Bacteria | 741 |
| 593 | Ga0495618_0560170 | 3300046514 | Bacteria | 683 |
| 594 | Ga0495628_0000069 | 3300046516 | Bacteria | 82366 |
| 595 | Ga0495628_0041826 | 3300046516 | Bacteria | 3657 |
| 596 | Ga0495628_0052488 | 3300046516 | Bacteria | 3220 |
| 597 | Ga0495628_0084398 | 3300046516 | Bacteria | 2464 |
| 598 | Ga0495628_0656994 | 3300046516 | Bacteria | 744 |
| 599 | Ga0495628_0952469 | 3300046516 | Bacteria | 593 |
| 600 | Ga0495630_0005233 | 3300046517 | Bacteria | 9144 |
| 601 | Ga0495630_0015336 | 3300046517 | Bacteria | 5595 |
| 602 | Ga0495630_0033318 | 3300046517 | Bacteria | 3841 |
| 603 | Ga0495630_0052803 | 3300046517 | Bacteria | 3043 |
| 604 | Ga0495630_0232839 | 3300046517 | Bacteria | 1407 |
| 605 | Ga0495630_0284413 | 3300046517 | Bacteria | 1263 |
| 606 | Ga0495630_0300788 | 3300046517 | Bacteria | 1226 |
| 607 | Ga0495630_0536166 | 3300046517 | Bacteria | 897 |
| 608 | Ga0495630_0651016 | 3300046517 | Unclassified | 807 |
| 609 | Ga0495643_0042252 | 3300046522 | Bacteria | 2484 |
| 610 | Ga0495644_0010118 | 3300046523 | Bacteria | 3634 |
| 611 | Ga0495666_0000145 | 3300046526 | Bacteria | 29818 |
| 612 | Ga0495642_0054501 | 3300046528 | Bacteria | 1649 |
| 613 | Ga0495652_0010813 | 3300046529 | Bacteria | 8270 |
| 614 | Ga0495652_0011205 | 3300046529 | Bacteria | 8119 |
| 615 | Ga0495652_0040217 | 3300046529 | Bacteria | 4041 |
| 616 | Ga0495652_0130565 | 3300046529 | Bacteria | 1989 |
| 617 | Ga0495665_0005590 | 3300046531 | Bacteria | 6775 |
| 618 | Ga0495665_0086666 | 3300046531 | Bacteria | 1646 |
| 619 | Ga0495640_0017850 | 3300046533 | Bacteria | 5277 |
| 620 | Ga0495640_0128572 | 3300046533 | Bacteria | 1641 |
| 621 | Ga0495640_0164965 | 3300046533 | Bacteria | 1417 |
| 622 | Ga0495586_0101960 | 3300046535 | Bacteria | 1593 |
| 623 | Ga0495586_0202814 | 3300046535 | Bacteria | 1124 |
| 624 | Ga0495586_0515229 | 3300046535 | Bacteria | 690 |
| 625 | Ga0495586_0871299 | 3300046535 | Unclassified | 519 |
| 626 | Ga0495587_0000062 | 3300046536 | Bacteria | 91862 |
| 627 | Ga0495587_0029172 | 3300046536 | Bacteria | 3351 |
| 628 | Ga0495587_0104275 | 3300046536 | Bacteria | 1632 |
| 629 | Ga0495609_0027478 | 3300046538 | Bacteria | 2600 |
| 630 | Ga0495645_0000418 | 3300046543 | Bacteria | 29334 |
| 631 | Ga0495645_0108936 | 3300046543 | Bacteria | 1961 |
| 632 | Ga0495645_0265141 | 3300046543 | Bacteria | 1135 |
| 633 | Ga0495645_0426764 | 3300046543 | Bacteria | 840 |
| 634 | Ga0495622_0469107 | 3300046557 | Bacteria | 539 |
| 635 | Ga0495667_0006358 | 3300046559 | Bacteria | 8013 |
| 636 | Ga0495667_0123792 | 3300046559 | Bacteria | 1669 |
| 637 | Ga0495667_0133183 | 3300046559 | Bacteria | 1603 |
| 638 | Ga0495667_0138025 | 3300046559 | Bacteria | 1572 |
| 639 | Ga0495656_0005449 | 3300046615 | Bacteria | 4394 |
| 640 | Ga0495668_0715484 | 3300046616 | Bacteria | 554 |
| 641 | Ga0495634_0169783 | 3300046642 | Bacteria | 1371 |
| 642 | Ga0495625_0194649 | 3300046660 | Bacteria | 1341 |
| 643 | Ga0495635_0009289 | 3300046663 | Bacteria | 6870 |
| 644 | Ga0495635_0029747 | 3300046663 | Bacteria | 3799 |
| 645 | Ga0495635_0040696 | 3300046663 | Bacteria | 3211 |
| 646 | Ga0495635_0045955 | 3300046663 | Bacteria | 3012 |
| 647 | Ga0495635_0060045 | 3300046663 | Bacteria | 2614 |
| 648 | Ga0495635_0063064 | 3300046663 | Bacteria | 2545 |
| 649 | Ga0495659_0017863 | 3300046664 | Bacteria | 2357 |
| 650 | Ga0495588_0257393 | 3300046674 | Bacteria | 920 |
| 651 | Ga0495657_0020111 | 3300046675 | Bacteria | 4803 |
| 652 | Ga0495657_0045579 | 3300046675 | Bacteria | 2975 |
| 653 | Ga0495657_0081438 | 3300046675 | Bacteria | 2093 |
| 654 | Ga0495657_0131452 | 3300046675 | Bacteria | 1568 |
| 655 | Ga0495599_0000542 | 3300046678 | Bacteria | 21674 |
| 656 | Ga0495599_0009394 | 3300046678 | Bacteria | 5975 |
| 657 | Ga0495599_0146908 | 3300046678 | Bacteria | 1461 |
| 658 | Ga0495599_0447111 | 3300046678 | Bacteria | 765 |
| 659 | Ga0495623_0000435 | 3300046679 | Bacteria | 27481 |
| 660 | Ga0495623_0041600 | 3300046679 | Bacteria | 2930 |
| 661 | Ga0495623_0168006 | 3300046679 | Bacteria | 1284 |
| 662 | Ga0495646_0007673 | 3300046680 | Bacteria | 6857 |
| 663 | Ga0495646_0023000 | 3300046680 | Bacteria | 3925 |
| 664 | Ga0495646_0031340 | 3300046680 | Bacteria | 3314 |
| 665 | Ga0495647_0000560 | 3300046681 | Bacteria | 10950 |
| 666 | Ga0495647_0026163 | 3300046681 | Bacteria | 2135 |
| 667 | Ga0495647_0044993 | 3300046681 | Bacteria | 1694 |
| 668 | Ga0495647_0340079 | 3300046681 | Bacteria | 682 |
| 669 | Ga0495658_0001373 | 3300046683 | Bacteria | 12760 |
| 670 | Ga0495658_0336681 | 3300046683 | Bacteria | 958 |
| 671 | Ga0495613_0024193 | 3300046689 | Bacteria | 4525 |
| 672 | Ga0495613_0129368 | 3300046689 | Bacteria | 1809 |
| 673 | Ga0495624_0000753 | 3300046690 | Bacteria | 25488 |
| 674 | Ga0495624_0028902 | 3300046690 | Bacteria | 3618 |
| 675 | Ga0495624_0211407 | 3300046690 | Bacteria | 1177 |
| 676 | Ga0495670_0627108 | 3300046691 | Bacteria | 586 |
| 677 | Ga0495589_0139208 | 3300046794 | Bacteria | 1163 |
| 678 | Ga0495600_0023999 | 3300046809 | Bacteria | 3926 |
| 679 | Ga0495600_0031656 | 3300046809 | Bacteria | 3428 |
| 680 | Ga0495600_0172723 | 3300046809 | Bacteria | 1395 |
| 681 | Ga0495600_0328107 | 3300046809 | Bacteria | 961 |
| 682 | Ga0495581_0000407 | 3300047315 | Bacteria | 21707 |
| 683 | Ga0495581_0302065 | 3300047315 | Unclassified | 935 |
| 684 | Ga0495581_0785678 | 3300047315 | Bacteria | 547 |
| 685 | Ga0495604_0009317 | 3300047317 | Bacteria | 7773 |
| 686 | Ga0495604_0052634 | 3300047317 | Bacteria | 3151 |
| 687 | Ga0495604_0054650 | 3300047317 | Bacteria | 3081 |
| 688 | Ga0495604_0192278 | 3300047317 | Bacteria | 1421 |
| 689 | Ga0495636_0191294 | 3300047318 | Bacteria | 932 |
| 690 | Ga0495674_0031730 | 3300047319 | Bacteria | 4796 |
| 691 | Ga0495674_0041557 | 3300047319 | Bacteria | 4106 |
| 692 | Ga0495674_0997152 | 3300047319 | Bacteria | 642 |
| 693 | Ga0495676_0002534 | 3300047321 | Bacteria | 16250 |
| 694 | Ga0495676_0233414 | 3300047321 | Bacteria | 1263 |
| 695 | Ga0495680_0009043 | 3300047322 | Bacteria | 8999 |
| 696 | Ga0495680_0032626 | 3300047322 | Bacteria | 4224 |
| 697 | Ga0495680_0115359 | 3300047322 | Bacteria | 1987 |
| 698 | Ga0495680_0182791 | 3300047322 | Bacteria | 1512 |
| 699 | Ga0495680_0227464 | 3300047322 | Bacteria | 1329 |
| 700 | Ga0495680_0312242 | 3300047322 | Unclassified | 1102 |
| 701 | Ga0495680_0479211 | 3300047322 | Bacteria | 847 |
| 702 | Ga0495683_0299687 | 3300047323 | Bacteria | 691 |
| 703 | Ga0495675_0004323 | 3300047444 | Bacteria | 8594 |
| 704 | Ga0495677_0078693 | 3300047445 | Bacteria | 1234 |
| 705 | Ga0495679_061237 | 3300047446 | Bacteria | 1103 |
| 706 | Ga0495685_058678 | 3300047447 | Bacteria | 1299 |
| 707 | Ga0495684_0005543 | 3300047471 | Bacteria | 9838 |
| 708 | Ga0495684_0012597 | 3300047471 | Bacteria | 6522 |
| 709 | Ga0495684_0042031 | 3300047471 | Bacteria | 3502 |
| 710 | Ga0495684_0087933 | 3300047471 | Bacteria | 2355 |
| 711 | Ga0495684_0199122 | 3300047471 | Bacteria | 1477 |
| 712 | Ga0495684_0488488 | 3300047471 | Unclassified | 849 |
| 713 | Ga0495684_0612038 | 3300047471 | Bacteria | 733 |
| 714 | Ga0495593_0000807 | 3300047673 | Bacteria | 18118 |
| 715 | Ga0495593_0327020 | 3300047673 | Bacteria | 766 |
| 716 | Ga0495602_0005881 | 3300048088 | Bacteria | 12881 |
| 717 | Ga0495602_0035846 | 3300048088 | Bacteria | 4622 |
| 718 | Ga0495614_0487952 | 3300048089 | Unclassified | 585 |
| 719 | Ga0496100_0129890 | 3300048903 | Bacteria | 1773 |
| 720 | Ga0496100_0164748 | 3300048903 | Bacteria | 1591 |
| 721 | Ga0496100_0373763 | 3300048903 | Bacteria | 1081 |
| 722 | Ga0496100_0474291 | 3300048903 | Bacteria | 962 |
| 723 | Ga0496100_0625398 | 3300048903 | Bacteria | 837 |
| 724 | Ga0496101_0034217 | 3300048904 | Bacteria | 3587 |
| 725 | Ga0496101_0183464 | 3300048904 | Bacteria | 1612 |
| 726 | Ga0496102_0008078 | 3300048905 | Bacteria | 9002 |
| 727 | Ga0496102_0141612 | 3300048905 | Bacteria | 2255 |
| 728 | Ga0496102_0156809 | 3300048905 | Bacteria | 2140 |
| 729 | Ga0496102_0349065 | 3300048905 | Bacteria | 1393 |
| 730 | Ga0496102_0542661 | 3300048905 | Bacteria | 1085 |
| 731 | Ga0496103_0006222 | 3300048906 | Bacteria | 7132 |
| 732 | Ga0496103_0066505 | 3300048906 | Bacteria | 2250 |
| 733 | Ga0496103_0147329 | 3300048906 | Bacteria | 1507 |
| 734 | Ga0496103_0896542 | 3300048906 | Bacteria | 556 |
| 735 | Ga0496104_0002502 | 3300048907 | Bacteria | 15814 |
| 736 | Ga0496104_0014077 | 3300048907 | Bacteria | 7220 |
| 737 | Ga0496104_0032821 | 3300048907 | Bacteria | 4832 |
| 738 | Ga0496104_0175680 | 3300048907 | Bacteria | 2052 |
| 739 | Ga0496104_0189567 | 3300048907 | Bacteria | 1967 |
| 740 | Ga0496104_1560155 | 3300048907 | Unclassified | 563 |
| 741 | Ga0496105_0025913 | 3300048908 | Bacteria | 4777 |
| 742 | Ga0496105_0185988 | 3300048908 | Bacteria | 1700 |
| 743 | Ga0496105_0243832 | 3300048908 | Bacteria | 1457 |
| 744 | Ga0496105_0363319 | 3300048908 | Bacteria | 1154 |
| 745 | Ga0496106_0012693 | 3300048909 | Bacteria | 6223 |
| 746 | Ga0496106_0925459 | 3300048909 | Bacteria | 688 |
| 747 | Ga0496107_0001925 | 3300048910 | Bacteria | 13179 |
| 748 | Ga0496107_0011878 | 3300048910 | Bacteria | 6083 |
| 749 | Ga0496107_0145920 | 3300048910 | Bacteria | 1750 |
| 750 | Ga0496107_0166116 | 3300048910 | Bacteria | 1636 |
| 751 | Ga0496107_0205978 | 3300048910 | Bacteria | 1462 |
| 752 | Ga0496107_0226044 | 3300048910 | Bacteria | 1392 |
| 753 | Ga0496108_0021721 | 3300048911 | Bacteria | 5277 |
| 754 | Ga0496108_0054644 | 3300048911 | Bacteria | 3351 |
| 755 | Ga0496108_0088376 | 3300048911 | Bacteria | 2633 |
| 756 | Ga0496108_0387977 | 3300048911 | Bacteria | 1219 |
| 757 | Ga0496108_1282525 | 3300048911 | Bacteria | 617 |
| 758 | Ga0496109_0012739 | 3300048912 | Bacteria | 7266 |
| 759 | Ga0496109_0049496 | 3300048912 | Bacteria | 3825 |
| 760 | Ga0496109_0051890 | 3300048912 | Bacteria | 3736 |
| 761 | Ga0496109_0068013 | 3300048912 | Bacteria | 3264 |
| 762 | Ga0496109_0335950 | 3300048912 | Bacteria | 1427 |
| 763 | Ga0496110_0014622 | 3300048913 | Bacteria | 6521 |
| 764 | Ga0496110_0021211 | 3300048913 | Bacteria | 5495 |
| 765 | Ga0496110_0249670 | 3300048913 | Bacteria | 1615 |
| 766 | Ga0496111_0011695 | 3300048914 | Bacteria | 5924 |
| 767 | Ga0496111_0302555 | 3300048914 | Bacteria | 1185 |
| 768 | Ga0496111_1053393 | 3300048914 | Bacteria | 581 |
| 769 | Ga0496112_0000598 | 3300048915 | Bacteria | 24854 |
| 770 | Ga0496112_0027644 | 3300048915 | Bacteria | 5470 |
| 771 | Ga0496112_0042134 | 3300048915 | Bacteria | 4467 |
| 772 | Ga0496112_0074888 | 3300048915 | Bacteria | 3348 |
| 773 | Ga0496112_0110368 | 3300048915 | Bacteria | 2721 |
| 774 | Ga0496112_0153892 | 3300048915 | Bacteria | 2267 |
| 775 | Ga0496112_0228515 | 3300048915 | Bacteria | 1815 |
| 776 | Ga0496112_0299204 | 3300048915 | Bacteria | 1554 |
| 777 | Ga0496112_0531464 | 3300048915 | Bacteria | 1110 |
| 778 | Ga0496112_0552184 | 3300048915 | Bacteria | 1085 |
| 779 | Ga0496112_0689560 | 3300048915 | Bacteria | 950 |
| 780 | Ga0496113_0014459 | 3300048916 | Bacteria | 5385 |
| 781 | Ga0496113_0121522 | 3300048916 | Bacteria | 2042 |
| 782 | Ga0496113_0342819 | 3300048916 | Bacteria | 1198 |
| 783 | Ga0496113_0417180 | 3300048916 | Bacteria | 1078 |
| 784 | Ga0496113_0671954 | 3300048916 | Bacteria | 828 |
| 785 | Ga0496113_0824065 | 3300048916 | Bacteria | 736 |
| 786 | Ga0496114_0008459 | 3300048917 | Bacteria | 8154 |
| 787 | Ga0496114_0015753 | 3300048917 | Bacteria | 6083 |
| 788 | Ga0496114_0268079 | 3300048917 | Bacteria | 1504 |
| 789 | Ga0496114_0376562 | 3300048917 | Bacteria | 1257 |
| 790 | Ga0496115_0025452 | 3300048918 | Bacteria | 4607 |
| 791 | Ga0496115_0040946 | 3300048918 | Bacteria | 3684 |
| 792 | Ga0496115_0075583 | 3300048918 | Bacteria | 2736 |
| 793 | Ga0496115_0081726 | 3300048918 | Bacteria | 2631 |
| 794 | Ga0496115_0090806 | 3300048918 | Bacteria | 2495 |
| 795 | Ga0496115_0123748 | 3300048918 | Bacteria | 2129 |
| 796 | Ga0496115_0818320 | 3300048918 | Bacteria | 724 |
| 797 | Ga0496121_0007276 | 3300048924 | Bacteria | 13395 |
| 798 | Ga0501032_0246372 | 3300049569 | Bacteria | 1160 |
| 799 | Ga0501033_0060902 | 3300049570 | Bacteria | 2783 |
| 800 | Ga0501034_0007715 | 3300049571 | Bacteria | 11447 |
| 801 | Ga0501034_0124122 | 3300049571 | Bacteria | 2567 |
| 802 | Ga0501036_0058299 | 3300049572 | Bacteria | 3271 |
| 803 | Ga0501038_0022061 | 3300049574 | Bacteria | 5710 |
| 804 | Ga0501039_0771570 | 3300049575 | Bacteria | 750 |
| 805 | Ga0501043_0028409 | 3300049579 | Bacteria | 4391 |
| 806 | Ga0501047_0056599 | 3300049581 | Bacteria | 3792 |
| 807 | Ga0501047_0951122 | 3300049581 | Unclassified | 672 |
| 808 | Ga0501047_1254183 | 3300049581 | Bacteria | 555 |
| 809 | Ga0501067_0028554 | 3300049583 | Bacteria | 3092 |
| 810 | Ga0501067_0227031 | 3300049583 | Bacteria | 1039 |
| 811 | Ga0501067_0594662 | 3300049583 | Unclassified | 620 |
| 812 | Ga0501068_0047842 | 3300049584 | Bacteria | 2581 |
| 813 | Ga0501069_0049386 | 3300049585 | Bacteria | 2338 |
| 814 | Ga0501069_0146152 | 3300049585 | Bacteria | 1357 |
| 815 | Ga0501069_0178115 | 3300049585 | Bacteria | 1228 |
| 816 | Ga0501070_0015295 | 3300049586 | Bacteria | 6457 |
| 817 | Ga0501070_0112052 | 3300049586 | Bacteria | 2255 |
| 818 | Ga0501070_0547174 | 3300049586 | Bacteria | 927 |
| 819 | Ga0501071_0010326 | 3300049587 | Bacteria | 6254 |
| 820 | Ga0501072_0005175 | 3300049588 | Bacteria | 9919 |
| 821 | Ga0501072_0015653 | 3300049588 | Bacteria | 5812 |
| 822 | Ga0501073_0022725 | 3300049589 | Bacteria | 4512 |
| 823 | Ga0501073_0051428 | 3300049589 | Bacteria | 2886 |
| 824 | Ga0501074_0023509 | 3300049590 | Bacteria | 4479 |
| 825 | Ga0501074_0261133 | 3300049590 | Bacteria | 1231 |
| 826 | Ga0501076_0029667 | 3300049592 | Bacteria | 4255 |
| 827 | Ga0501079_0010628 | 3300049741 | Bacteria | 7005 |
| 828 | Ga0501080_0002078 | 3300049742 | Bacteria | 17369 |
| 829 | Ga0501080_0079478 | 3300049742 | Bacteria | 3049 |
| 830 | Ga0501081_0322464 | 3300049743 | Bacteria | 1136 |
| 831 | Ga0501083_0010820 | 3300049744 | Bacteria | 6416 |
| 832 | Ga0501044_0029300 | 3300049823 | Bacteria | 5805 |
| 833 | nmdc:mga00v17_704_c2 | 3300050491 | Bacteria | 10003 |
| 834 | nmdc:mga06z11_269765_c1 | 3300050494 | Bacteria | 1006 |
| 835 | nmdc:mga06z11_38335_c1 | 3300050494 | Bacteria | 2379 |
| 836 | nmdc:mga0n895_469_c1 | 3300050512 | Bacteria | 27118 |
| 837 | nmdc:mga0n895_801181_c1 | 3300050512 | Bacteria | 932 |
| 838 | nmdc:mga0n895_98228_c1 | 3300050512 | Bacteria | 2935 |
| 839 | nmdc:mga0rr50_499690_c1 | 3300050513 | Bacteria | 1034 |
| 840 | nmdc:mga0rr50_85581_c1 | 3300050513 | Unclassified | 2443 |
| 841 | nmdc:mga0rr50_887505_c1 | 3300050513 | Bacteria | 760 |
| 842 | nmdc:mga08x19_14_c1 | 3300050514 | Bacteria | 365567 |
| 843 | nmdc:mga08x19_72638_c1 | 3300050514 | Bacteria | 2244 |
| 844 | Ga0495601_0004004 | 3300053077 | Bacteria | 8484 |
| 845 | Ga0495601_0027217 | 3300053077 | Bacteria | 3534 |
| 846 | Ga0495601_0034847 | 3300053077 | Bacteria | 3140 |
| 847 | Ga0495601_0070843 | 3300053077 | Bacteria | 2225 |
| 848 | Ga0495601_0747048 | 3300053077 | Bacteria | 623 |
| 849 | Ga0495612_0002367 | 3300053078 | Bacteria | 7771 |
| 850 | Ga0495612_0156875 | 3300053078 | Bacteria | 992 |
| 851 | Ga0495612_0251963 | 3300053078 | Bacteria | 785 |
| 852 | Ga0495595_0013724 | 3300053084 | Bacteria | 3426 |
| 853 | Ga0495595_0019382 | 3300053084 | Bacteria | 2951 |
| 854 | Ga0495595_0027118 | 3300053084 | Bacteria | 2550 |
| 855 | Ga0495595_0319667 | 3300053084 | Bacteria | 781 |
| 856 | Ga0495595_0483344 | 3300053084 | Bacteria | 630 |
| 857 | Ga0495619_0000123 | 3300053085 | Bacteria | 57052 |
| 858 | Ga0495619_0001783 | 3300053085 | Bacteria | 14316 |
| 859 | Ga0495619_0025730 | 3300053085 | Bacteria | 3782 |
| 860 | Ga0495619_0027860 | 3300053085 | Bacteria | 3643 |
| 861 | Ga0495619_0051013 | 3300053085 | Bacteria | 2733 |
| 862 | Ga0495619_0077113 | 3300053085 | Bacteria | 2238 |
| 863 | Ga0495619_0293391 | 3300053085 | Bacteria | 1126 |
| 864 | Ga0495619_0384735 | 3300053085 | Bacteria | 969 |
| 865 | Ga0495619_0587197 | 3300053085 | Bacteria | 763 |
| 866 | Ga0500616_0053634 | 3300053153 | Bacteria | 2115 |
| 867 | Ga0501084_0084482 | 3300054114 | Bacteria | 2664 |
| 868 | Ga0501084_0162537 | 3300054114 | Bacteria | 1884 |
| 869 | Ga0466962_0000436 | 3300061719 | Bacteria | 18149 |
| 870 | Ga0466962_0106140 | 3300061719 | Bacteria | 1350 |
| 871 | Ga0466962_0158131 | 3300061719 | Bacteria | 1101 |
| 872 | Ga0466962_0301241 | 3300061719 | Bacteria | 793 |
| 873 | Ga0466962_0686962 | 3300061719 | Bacteria | 525 |
| 874 | Ga0530510_0018159 | 3300061734 | Bacteria | 4987 |
| 875 | Ga0530510_0175883 | 3300061734 | Bacteria | 1586 |
| 876 | Ga0530510_0912664 | 3300061734 | Bacteria | 671 |
| 877 | 2561466289 | 2558860983 | Bacteria | 4133860 |
| 878 | Ga0157373_10260748 | |||
| 879 | Ga0070658_10077027 | |||
| 880 | Ga0070658_10119088 | |||
| 881 | Ga0070658_10240372 | |||
| 882 | Ga0070658_10286934 | |||
| 883 | Ga0070683_100098993 | |||
| 884 | Ga0070680_100046688 | |||
| 885 | Ga0070680_100148285 | |||
| 886 | Ga0070680_100340398 | |||
| 887 | Ga0070680_100696672 | |||
| 888 | Ga0070682_100000772 | |||
| 889 | Ga0070682_100235764 | |||
| 890 | Ga0070682_100591179 | |||
| 891 | Ga0068868_101152761 | |||
| 892 | Ga0070660_100025106 | |||
| 893 | Ga0070660_100062235 | |||
| 894 | Ga0070660_100085622 | |||
| 895 | Ga0070660_100138224 | |||
| 896 | Ga0070660_100397188 | |||
| 897 | Ga0070660_100691423 | |||
| 898 | Ga0070660_100779159 | |||
| 899 | Ga0070691_10134671 | |||
| 900 | Ga0070661_100313734 | |||
| 901 | Ga0070661_100982745 | |||
| 902 | Ga0070692_10551980 | |||
| 903 | Ga0070675_101010204 | |||
| 904 | Ga0070675_101194960 | |||
| 905 | Ga0070671_100298514 | |||
| 906 | Ga0070671_100520779 | |||
| 907 | Ga0070703_10073215 | |||
| 908 | Ga0070709_10069891 | |||
| 909 | Ga0070709_10277901 | |||
| 910 | Ga0070714_100001442 | |||
| 911 | Ga0070714_100001730 | |||
| 912 | Ga0070714_100008154 | |||
| 913 | Ga0070714_100028037 | |||
| 914 | Ga0070714_100120683 | |||
| 915 | Ga0070714_100137599 | |||
| 916 | Ga0070714_100316964 | |||
| 917 | Ga0070714_101084003 | |||
| 918 | Ga0070713_100027513 | |||
| 919 | Ga0070713_100029682 | |||
| 920 | Ga0070713_100097436 | |||
| 921 | Ga0070713_100214119 | |||
| 922 | Ga0070713_100813950 | |||
| 923 | Ga0070710_10004523 | |||
| 924 | Ga0070711_100032777 | |||
| 925 | Ga0070711_100088200 | |||
| 926 | Ga0070711_100194348 | |||
| 927 | Ga0070711_100284269 | |||
| 928 | Ga0070711_100596461 | |||
| 929 | Ga0070711_100968706 | |||
| 930 | Ga0070694_100043187 | |||
| 931 | Ga0070708_100140293 | |||
| 932 | Ga0070708_100263613 | |||
| 933 | Ga0070708_100897480 | |||
| 934 | Ga0070663_100676971 | |||
| 935 | Ga0070681_10027297 | |||
| 936 | Ga0070681_10036000 | |||
| 937 | Ga0070681_10051344 | |||
| 938 | Ga0070681_10057780 | |||
| 939 | Ga0070681_10262884 | |||
| 940 | Ga0070681_10555920 | |||
| 941 | Ga0070681_11071621 | |||
| 942 | Ga0070707_100001128 | |||
| 943 | Ga0070707_100097095 | |||
| 944 | Ga0070707_100139777 | |||
| 945 | Ga0070707_100229155 | |||
| 946 | Ga0070707_100344411 | |||
| 947 | Ga0070707_100426793 | |||
| 948 | Ga0070698_100023352 | |||
| 949 | Ga0070698_100066288 | |||
| 950 | Ga0070698_100096124 | |||
| 951 | Ga0070698_100375402 | |||
| 952 | Ga0070679_100051987 | |||
| 953 | Ga0070679_100065672 | |||
| 954 | Ga0070679_100080703 | |||
| 955 | Ga0070679_100321897 | |||
| 956 | Ga0070679_101215223 | |||
| 957 | Ga0070684_100230630 | |||
| 958 | Ga0070684_100518743 | |||
| 959 | Ga0070697_100037020 | |||
| 960 | Ga0070697_100718080 | |||
| 961 | Ga0070697_101063564 | |||
| 962 | Ga0068853_100362468 | |||
| 963 | Ga0070686_100113072 | |||
| 964 | Ga0070695_100000029 | |||
| 965 | Ga0070696_100367656 | |||
| 966 | Ga0070693_100182825 | |||
| 967 | Ga0070693_100947917 | |||
| 968 | Ga0070704_100669133 | |||
| 969 | Ga0068855_100044799 | |||
| 970 | Ga0068855_100070085 | |||
| 971 | Ga0068855_100980471 | |||
| 972 | Ga0068855_101612890 | |||
| 973 | Ga0070664_100088058 | |||
| 974 | Ga0068857_100103084 | |||
| 975 | Ga0068856_100098363 | |||
| 976 | Ga0068856_101264215 | |||
| 977 | Ga0068856_101584317 | |||
| 978 | Ga0070702_100284521 | |||
| 979 | Ga0068852_100316316 | |||
| 980 | Ga0068852_100834755 | |||
| 981 | Ga0068852_101648512 | |||
| 982 | Ga0068851_10586558 | |||
| 983 | Ga0068863_100191810 | |||
| 984 | Ga0081538_10033321 | |||
| 985 | Ga0070717_10016372 | |||
| 986 | Ga0070717_10029414 | |||
| 987 | Ga0070717_10031104 | |||
| 988 | Ga0070717_10080120 | |||
| 989 | Ga0070717_10145688 | |||
| 990 | Ga0070717_10158291 | |||
| 991 | Ga0070717_10860777 | |||
| 992 | Ga0075364_10003592 | |||
| 993 | Ga0070715_10250386 | |||
| 994 | Ga0070716_100041828 | |||
| 995 | Ga0070716_100471412 | |||
| 996 | Ga0070712_100052688 | |||
| 997 | Ga0070712_100087058 | |||
| 998 | Ga0070712_100210926 | |||
| 999 | Ga0070712_100513907 | |||
| 1000 | Ga0075367_10093994 | |||
| 1001 | Ga0075367_10146206 | |||
| 1002 | Ga0075433_10688127 | |||
| 1003 | Ga0075434_100002359 | |||
| 1004 | Ga0075434_100042304 | |||
| 1005 | Ga0075436_100003536 | |||
| 1006 | Ga0075436_100142117 | |||
| 1007 | Ga0075436_100287087 | |||
| 1008 | Ga0075436_100454671 | |||
| 1009 | Ga0075435_100112723 | |||
| 1010 | Ga0075435_100796061 | |||
| 1011 | Ga0105240_10010108 | |||
| 1012 | Ga0105240_10023072 | |||
| 1013 | Ga0105240_10036412 | |||
| 1014 | Ga0105240_10186268 | |||
| 1015 | Ga0105245_10730365 | |||
| 1016 | Ga0105241_10596901 | |||
| 1017 | Ga0105248_10246668 | |||
| 1018 | Ga0105237_10064368 | |||
| 1019 | Ga0105237_10413288 | |||
| 1020 | Ga0105237_11385020 | |||
| 1021 | Ga0105237_11918162 | |||
| 1022 | Ga0105238_10093907 | |||
| 1023 | Ga0105238_10457848 | |||
| 1024 | Ga0099796_10054239 | |||
| 1025 | Ga0105239_10058833 | |||
| 1026 | Ga0105239_11000878 | |||
| 1027 | Ga0157373_10043309 | |||
| 1028 | Ga0157373_10472871 | |||
| 1029 | Ga0157373_10553350 | |||
| 1030 | Ga0157373_11454715 | |||
| 1031 | Ga0157371_10636437 | |||
| 1032 | Ga0157370_10013425 | |||
| 1033 | Ga0157370_10088032 | |||
| 1034 | Ga0157370_10915501 | |||
| 1035 | Ga0157369_10013174 | |||
| 1036 | Ga0157369_10033465 | |||
| 1037 | Ga0157369_10283362 | |||
| 1038 | Ga0157369_10369988 | |||
| 1039 | Ga0157369_10402020 | |||
| 1040 | Ga0157369_10481476 | |||
| 1041 | Ga0157369_11260523 | |||
| 1042 | Ga0157374_10702232 | |||
| 1043 | Ga0157374_11850541 | |||
| 1044 | Ga0157378_10744068 | |||
| 1045 | Ga0163162_10154082 | |||
| 1046 | Ga0157372_10007615 | |||
| 1047 | Ga0157372_10353420 | |||
| 1048 | Ga0157372_10588257 | |||
| 1049 | Ga0157372_11080743 | |||
| 1050 | Ga0157375_12465529 | |||
| 1051 | Ga0163163_10571131 | |||
| 1052 | Ga0182008_10003425 | |||
| 1053 | Ga0182008_10025785 | |||
| 1054 | Ga0182008_10188646 | |||
| 1055 | Ga0157379_11785684 | |||
| 1056 | Ga0157376_10031446 | |||
| 1057 | Ga0182006_1013195 | |||
| 1058 | Ga0182007_10013137 | |||
| 1059 | Ga0182005_1139216 | |||
| 1060 | Ga0197907_11037992 | |||
| 1061 | Ga0206356_10027961 | |||
| 1062 | Ga0206356_11522396 | |||
| 1063 | Ga0206356_11548852 | |||
| 1064 | Ga0206354_10162523 | |||
| 1065 | Ga0206354_10280470 | |||
| 1066 | Ga0206354_10581218 | |||
| 1067 | Ga0206354_11352109 | |||
| 1068 | Ga0206354_11453059 | |||
| 1069 | Ga0206353_10217476 | |||
| 1070 | Ga0206353_10335970 | |||
| 1071 | Ga0206353_10928214 | |||
| 1072 | Ga0206353_11341242 | |||
| 1073 | Ga0206353_12063638 | |||
| 1074 | Ga0224712_10026165 | |||
| 1075 | Ga0207692_10047524 | |||
| 1076 | Ga0207692_10187343 | |||
| 1077 | Ga0207692_10476687 | |||
| 1078 | Ga0207685_10114734 | |||
| 1079 | Ga0207699_10005456 | |||
| 1080 | Ga0207699_10260711 | |||
| 1081 | Ga0207705_10009302 | |||
| 1082 | Ga0207705_10090975 | |||
| 1083 | Ga0207705_10107552 | |||
| 1084 | Ga0207705_10272643 | |||
| 1085 | Ga0207705_10342036 | |||
| 1086 | Ga0207705_11098974 | |||
| 1087 | Ga0207707_10013404 | |||
| 1088 | Ga0207707_10018329 | |||
| 1089 | Ga0207707_10073051 | |||
| 1090 | Ga0207707_10084670 | |||
| 1091 | Ga0207707_10183900 | |||
| 1092 | Ga0207707_10269275 | |||
| 1093 | Ga0207707_10927744 | |||
| 1094 | Ga0207695_10030376 | |||
| 1095 | Ga0207695_10654536 | |||
| 1096 | Ga0207695_11728477 | |||
| 1097 | Ga0207671_10375002 | |||
| 1098 | Ga0207693_10020457 | |||
| 1099 | Ga0207693_10052882 | |||
| 1100 | Ga0207693_10241259 | |||
| 1101 | Ga0207693_11286048 | |||
| 1102 | Ga0207663_10161964 | |||
| 1103 | Ga0207663_10183229 | |||
| 1104 | Ga0207663_10285313 | |||
| 1105 | Ga0207663_10515222 | |||
| 1106 | Ga0207663_10573485 | |||
| 1107 | Ga0207660_10098505 | |||
| 1108 | Ga0207660_10242086 | |||
| 1109 | Ga0207660_10311739 | |||
| 1110 | Ga0207660_10800396 | |||
| 1111 | Ga0207660_11104569 | |||
| 1112 | Ga0207657_10013743 | |||
| 1113 | Ga0207657_10028373 | |||
| 1114 | Ga0207657_10053710 | |||
| 1115 | Ga0207657_10061747 | |||
| 1116 | Ga0207657_10307677 | |||
| 1117 | Ga0207657_10320892 | |||
| 1118 | Ga0207649_10722288 | |||
| 1119 | Ga0207652_10114951 | |||
| 1120 | Ga0207652_10159422 | |||
| 1121 | Ga0207652_10262398 | |||
| 1122 | Ga0207652_10279447 | |||
| 1123 | Ga0207652_11015729 | |||
| 1124 | Ga0207652_11394116 | |||
| 1125 | Ga0207646_10003943 | |||
| 1126 | Ga0207646_10266726 | |||
| 1127 | Ga0207646_10289617 | |||
| 1128 | Ga0207646_10529585 | |||
| 1129 | Ga0207694_10139557 | |||
| 1130 | Ga0207687_10121658 | |||
| 1131 | Ga0207700_10154134 | |||
| 1132 | Ga0207700_10568213 | |||
| 1133 | Ga0207664_10007454 | |||
| 1134 | Ga0207664_10019236 | |||
| 1135 | Ga0207664_10025643 | |||
| 1136 | Ga0207664_10049060 | |||
| 1137 | Ga0207664_10059156 | |||
| 1138 | Ga0207664_10242555 | |||
| 1139 | Ga0207664_10251574 | |||
| 1140 | Ga0207664_10317572 | |||
| 1141 | Ga0207664_10317877 | |||
| 1142 | Ga0207664_10319332 | |||
| 1143 | Ga0207664_10555673 | |||
| 1144 | Ga0207644_10091555 | |||
| 1145 | Ga0207686_10810993 | |||
| 1146 | Ga0207665_10001348 | |||
| 1147 | Ga0207665_10102769 | |||
| 1148 | Ga0207665_10260740 | |||
| 1149 | Ga0207665_10310301 | |||
| 1150 | Ga0207665_10604255 | |||
| 1151 | Ga0207711_10517683 | |||
| 1152 | Ga0207661_10181222 | |||
| 1153 | Ga0207661_10244532 | |||
| 1154 | Ga0207661_11100131 | |||
| 1155 | Ga0207667_10186001 | |||
| 1156 | Ga0207667_10244522 | |||
| 1157 | Ga0207667_10258869 | |||
| 1158 | Ga0207667_10416902 | |||
| 1159 | Ga0207667_10683456 | |||
| 1160 | Ga0207667_10837863 | |||
| 1161 | Ga0207712_10178408 | |||
| 1162 | Ga0207640_10141303 | |||
| 1163 | Ga0207639_10558783 | |||
| 1164 | Ga0207639_11055357 | |||
| 1165 | Ga0207678_10417337 | |||
| 1166 | Ga0207702_10113980 | |||
| 1167 | Ga0207702_10148408 | |||
| 1168 | Ga0207702_10544779 | |||
| 1169 | Ga0207641_10039645 | |||
| 1170 | Ga0207698_10422343 | |||
| 1171 | Ga0207698_10447569 | |||
| 1172 | Ga0207698_10918802 | |||
| 1173 | Ga0209813_10258041 | |||
| 1174 | Ga0265326_10036019 | |||
| 1175 | Ga0265326_10128514 | |||
| 1176 | Ga0265319_1006111 | |||
| 1177 | Ga0265319_1039562 | |||
| 1178 | Ga0265334_10014826 | |||
| 1179 | Ga0265334_10020139 | |||
| 1180 | Ga0265318_10000691 | |||
| 1181 | Ga0265318_10100256 | |||
| 1182 | Ga0265323_10013669 | |||
| 1183 | Ga0265323_10079191 | |||
| 1184 | Ga0265322_10009294 | |||
| 1185 | Ga0265336_10019405 | |||
| 1186 | Ga0265338_10001048 | |||
| 1187 | Ga0265338_10003605 | |||
| 1188 | Ga0265338_10007115 | |||
| 1189 | Ga0265338_10022563 | |||
| 1190 | Ga0265338_10039236 | |||
| 1191 | Ga0265338_10102538 | |||
| 1192 | Ga0265338_10231610 | |||
| 1193 | Ga0265338_10478762 | |||
| 1194 | Ga0265324_10011053 | |||
| 1195 | Ga0265324_10060109 | |||
| 1196 | Ga0265330_10028366 | |||
| 1197 | Ga0265330_10063169 | |||
| 1198 | Ga0265330_10302547 | |||
| 1199 | Ga0265328_10019067 | |||
| 1200 | Ga0265320_10017612 | |||
| 1201 | Ga0265320_10030136 | |||
| 1202 | Ga0265325_10000102 | |||
| 1203 | Ga0265325_10203959 | |||
| 1204 | Ga0265325_10246858 | |||
| 1205 | Ga0265329_10086720 | |||
| 1206 | Ga0265340_10009900 | |||
| 1207 | Ga0265340_10167127 | |||
| 1208 | Ga0265339_10011424 | |||
| 1209 | Ga0265339_10150598 | |||
| 1210 | Ga0265331_10061744 | |||
| 1211 | Ga0265331_10095560 | |||
| 1212 | Ga0265327_10025194 | |||
| 1213 | Ga0265327_10124888 | |||
| 1214 | Ga0265327_10135228 | |||
| 1215 | Ga0265316_10021633 | |||
| 1216 | Ga0265313_10006148 | |||
| 1217 | Ga0265313_10090527 | |||
| 1218 | Ga0265314_10003427 | |||
| 1219 | Ga0265342_10038790 | |||
| 1220 | Ga0316583_10014535 | |||
| 1221 | Ga0316583_10038708 | |||
| 1222 | Ga0316583_10039538 | |||
| 1223 | Ga0373934_0037792 | |||
| 1224 | Ga0373923_0254471 | |||
| 1225 | Ga0373936_0176263 | |||
| 1226 | Ga0373941_0254590 | |||
| 1227 | Ga0373945_0005783 | |||
| 1228 | Ga0373945_0209764 | |||
| 1229 | Ga0373954_0155027 | |||
| 1230 | Ga0373956_0042005 | |||
| 1231 | Ga0373956_0372871 | |||
| 1232 | Ga0373957_0090977 | |||
| 1233 | Ga0373960_0120036 | |||
| 1234 | Ga0373943_0002704 | |||
| 1235 | Ga0373943_0365015 | |||
| 1236 | Ga0373946_0021452 | |||
| 1237 | Ga0373955_0016364 | |||
| 1238 | Ga0373955_0159308 | |||
| 1239 | Ga0373955_0309974 | |||
| 1240 | Ga0373955_0340373 | |||
| 1241 | Ga0373924_0049640 | |||
| 1242 | Ga0373924_0089194 | |||
| 1243 | Ga0373924_0179913 | |||
| 1244 | Ga0373931_0180163 | |||
| 1245 | Ga0373931_0259568 | |||
| 1246 | Ga0373933_0156210 | |||
| 1247 | Ga0373947_0556874 | |||
| 1248 | Ga0373937_0003562 | |||
| 1249 | Ga0373937_1031926 | |||
| 1250 | Ga0373925_0001320 | |||
| 1251 | Ga0373925_0484484 | |||
| 1252 | Ga0395899_0161575 | |||
| 1253 | Ga0395899_0167975 | |||
| 1254 | Ga0395900_0101231 | |||
| 1255 | Ga0395900_0153540 | |||
| 1256 | Ga0395900_0160762 | |||
| 1257 | Ga0395900_0222339 | |||
| 1258 | Ga0395900_0229986 | |||
| 1259 | Ga0395900_0673417 | |||
| 1260 | Ga0395900_0804888 | |||
| 1261 | Ga0395900_0902665 | |||
| 1262 | Ga0395900_0994576 | |||
| 1263 | Ga0395900_1428488 | |||
| 1264 | Ga0395900_1470170 | |||
| 1265 | Ga0395898_0018968 | |||
| 1266 | Ga0395898_0067856 | |||
| 1267 | Ga0395898_0088361 | |||
| 1268 | Ga0395898_0114073 | |||
| 1269 | Ga0395898_1105813 | |||
| 1270 | Ga0395898_1819768 | |||
| 1271 | Ga0395905_0000386 | |||
| 1272 | Ga0395905_0114323 | |||
| 1273 | Ga0395905_0121213 | |||
| 1274 | Ga0395905_0131737 | |||
| 1275 | Ga0395905_0501725 | |||
| 1276 | Ga0395905_0973689 | |||
| 1277 | Ga0395901_0054876 | |||
| 1278 | Ga0395901_0124900 | |||
| 1279 | Ga0395901_0130218 | |||
| 1280 | Ga0395901_0147806 | |||
| 1281 | Ga0395901_0603215 | |||
| 1282 | Ga0242420_054419 | |||
| 1283 | Ga0436365_0252739 | |||
| 1284 | Ga0436360_0556007 | |||
| 1285 | Ga0436363_1430576 | |||
| 1286 | Ga0436363_1463861 | |||
| 1287 | Ga0451853_1828558 | |||
| 1288 | Ga0451853_3430042 | |||
| 1289 | Ga0466969_0032043 | |||
| 1290 | Ga0466965_0011754 | |||
| 1291 | Ga0466965_0056962 | |||
| 1292 | Ga0466966_0003176 | |||
| 1293 | Ga0466966_0040188 | |||
| 1294 | Ga0466966_0243719 | |||
| 1295 | Ga0466966_0572357 | |||
| 1296 | Ga0466966_0903747 | |||
| 1297 | Ga0466961_0012817 | |||
| 1298 | Ga0466961_0022246 | |||
| 1299 | Ga0466961_0129285 | |||
| 1300 | Ga0466961_0245992 | |||
| 1301 | Ga0466961_0732636 | |||
| 1302 | Ga0466961_0747228 | |||
| 1303 | Ga0466961_0803150 | |||
| 1304 | Ga0466963_0001433 | |||
| 1305 | Ga0466963_0002189 | |||
| 1306 | Ga0466963_0003641 | |||
| 1307 | Ga0466963_0006990 | |||
| 1308 | Ga0466963_0007093 | |||
| 1309 | Ga0466963_0008418 | |||
| 1310 | Ga0466963_0010262 | |||
| 1311 | Ga0466963_0013063 | |||
| 1312 | Ga0466963_0016356 | |||
| 1313 | Ga0466963_0021819 | |||
| 1314 | Ga0466963_0043897 | |||
| 1315 | Ga0466963_0097428 | |||
| 1316 | Ga0466963_0103608 | |||
| 1317 | Ga0466963_0213516 | |||
| 1318 | Ga0466963_0424630 | |||
| 1319 | Ga0466963_0959202 | |||
| 1320 | Ga0466963_1023291 | |||
| 1321 | Ga0466964_0016378 | |||
| 1322 | Ga0466964_0019203 | |||
| 1323 | Ga0466964_0038264 | |||
| 1324 | Ga0466964_0044192 | |||
| 1325 | Ga0466964_0063715 | |||
| 1326 | Ga0466964_0072368 | |||
| 1327 | Ga0466964_0077099 | |||
| 1328 | Ga0466964_0078199 | |||
| 1329 | Ga0466964_0114655 | |||
| 1330 | Ga0466964_0345219 | |||
| 1331 | Ga0466964_0378874 | |||
| 1332 | Ga0453684_0644134 | |||
| 1333 | Ga0466971_0000170 | |||
| 1334 | Ga0466971_0007771 | |||
| 1335 | Ga0466971_0027006 | |||
| 1336 | Ga0466971_0034096 | |||
| 1337 | Ga0466971_0654262 | |||
| 1338 | Ga0466968_0001006 | |||
| 1339 | Ga0466968_0019982 | |||
| 1340 | Ga0466968_0021702 | |||
| 1341 | Ga0466968_0046529 | |||
| 1342 | Ga0466968_0127171 | |||
| 1343 | Ga0466968_0132526 | |||
| 1344 | Ga0466968_0198853 | |||
| 1345 | Ga0466968_0212394 | |||
| 1346 | Ga0466968_0313522 | |||
| 1347 | Ga0466970_0000806 | |||
| 1348 | Ga0466970_0015951 | |||
| 1349 | Ga0466970_0020042 | |||
| 1350 | Ga0466957_0000671 | |||
| 1351 | Ga0466957_0003280 | |||
| 1352 | Ga0466957_0004865 | |||
| 1353 | Ga0466957_0009740 | |||
| 1354 | Ga0466957_0011646 | |||
| 1355 | Ga0466957_0030148 | |||
| 1356 | Ga0466957_0031191 | |||
| 1357 | Ga0466957_0045424 | |||
| 1358 | Ga0466957_0063127 | |||
| 1359 | Ga0466957_0075551 | |||
| 1360 | Ga0466957_0139000 | |||
| 1361 | Ga0466957_0188090 | |||
| 1362 | Ga0466957_0205312 | |||
| 1363 | Ga0466957_0211372 | |||
| 1364 | Ga0466957_0318204 | |||
| 1365 | Ga0466957_0329970 | |||
| 1366 | Ga0466960_0031765 | |||
| 1367 | Ga0466960_0146023 | |||
| 1368 | Ga0466959_0000274 | |||
| 1369 | Ga0466959_0003637 | |||
| 1370 | Ga0466959_0005938 | |||
| 1371 | Ga0466959_0028480 | |||
| 1372 | Ga0466959_0066806 | |||
| 1373 | Ga0466959_0111214 | |||
| 1374 | Ga0466959_0181500 | |||
| 1375 | Ga0466959_0236750 | |||
| 1376 | Ga0466959_0458591 | |||
| 1377 | Ga0466959_0965759 | |||
| 1378 | Ga0466958_0000300 | |||
| 1379 | Ga0466958_0001062 | |||
| 1380 | Ga0466958_0006904 | |||
| 1381 | Ga0466958_0017529 | |||
| 1382 | Ga0466958_0021115 | |||
| 1383 | Ga0466958_0022617 | |||
| 1384 | Ga0466958_0040385 | |||
| 1385 | Ga0466958_0068946 | |||
| 1386 | Ga0466958_0116018 | |||
| 1387 | Ga0466958_0120128 | |||
| 1388 | Ga0466958_0350377 | |||
| 1389 | Ga0466958_0424269 | |||
| 1390 | Ga0466967_0000828 | |||
| 1391 | Ga0466967_0002114 | |||
| 1392 | Ga0466967_0002908 | |||
| 1393 | Ga0466967_0003311 | |||
| 1394 | Ga0466967_0009149 | |||
| 1395 | Ga0466967_0010698 | |||
| 1396 | Ga0466967_0012395 | |||
| 1397 | Ga0466967_0023141 | |||
| 1398 | Ga0466967_0027027 | |||
| 1399 | Ga0466967_0029636 | |||
| 1400 | Ga0466967_0033811 | |||
| 1401 | Ga0466967_0034791 | |||
| 1402 | Ga0466967_0042827 | |||
| 1403 | Ga0466967_0067487 | |||
| 1404 | Ga0466967_0072640 | |||
| 1405 | Ga0466967_0081515 | |||
| 1406 | Ga0466967_0098579 | |||
| 1407 | Ga0466967_0105618 | |||
| 1408 | Ga0466967_0107460 | |||
| 1409 | Ga0466967_0117557 | |||
| 1410 | Ga0466967_0169647 | |||
| 1411 | Ga0466967_0184316 | |||
| 1412 | Ga0466967_0204330 | |||
| 1413 | Ga0466967_0207943 | |||
| 1414 | Ga0466967_0211135 | |||
| 1415 | Ga0466967_0236924 | |||
| 1416 | Ga0466967_0255654 | |||
| 1417 | Ga0466967_0323107 | |||
| 1418 | Ga0466967_0479525 | |||
| 1419 | Ga0466967_0716912 | |||
| 1420 | Ga0466967_1430949 | |||
| 1421 | Ga0466967_1519522 | |||
| 1422 | Ga0495592_0014141 | |||
| 1423 | Ga0495592_0038050 | |||
| 1424 | Ga0495592_0185722 | |||
| 1425 | Ga0495592_0223762 | |||
| 1426 | Ga0495603_0053526 | |||
| 1427 | Ga0495603_0520239 | |||
| 1428 | Ga0495603_0604889 | |||
| 1429 | Ga0495590_0095049 | |||
| 1430 | Ga0495629_0001816 | |||
| 1431 | Ga0495629_0320029 | |||
| 1432 | Ga0495629_0567865 | |||
| 1433 | Ga0495641_0007480 | |||
| 1434 | Ga0495641_0142465 | |||
| 1435 | Ga0495641_0184946 | |||
| 1436 | Ga0495651_0000028 | |||
| 1437 | Ga0495651_0111389 | |||
| 1438 | Ga0495653_0000965 | |||
| 1439 | Ga0495653_0019134 | |||
| 1440 | Ga0495653_0023889 | |||
| 1441 | Ga0495653_0061020 | |||
| 1442 | Ga0495653_0081081 | |||
| 1443 | Ga0495653_0185791 | |||
| 1444 | Ga0495580_0042963 | |||
| 1445 | Ga0495582_0012985 | |||
| 1446 | Ga0495582_0016268 | |||
| 1447 | Ga0495582_0031507 | |||
| 1448 | Ga0495639_0000630 | |||
| 1449 | Ga0495662_0001339 | |||
| 1450 | Ga0495662_0024242 | |||
| 1451 | Ga0495664_0032023 | |||
| 1452 | Ga0495664_0082635 | |||
| 1453 | Ga0495664_0105740 | |||
| 1454 | Ga0495664_0117867 | |||
| 1455 | Ga0495664_0162973 | |||
| 1456 | Ga0495584_0051193 | |||
| 1457 | Ga0495584_0713903 | |||
| 1458 | Ga0495607_0081915 | |||
| 1459 | Ga0495608_0008137 | |||
| 1460 | Ga0495608_0008892 | |||
| 1461 | Ga0495608_0100374 | |||
| 1462 | Ga0495608_0228967 | |||
| 1463 | Ga0495608_0259131 | |||
| 1464 | Ga0495608_0339532 | |||
| 1465 | Ga0495618_0012985 | |||
| 1466 | Ga0495618_0052048 | |||
| 1467 | Ga0495618_0113992 | |||
| 1468 | Ga0495618_0331322 | |||
| 1469 | Ga0495618_0491674 | |||
| 1470 | Ga0495618_0560170 | |||
| 1471 | Ga0495628_0000069 | |||
| 1472 | Ga0495628_0041826 | |||
| 1473 | Ga0495628_0052488 | |||
| 1474 | Ga0495628_0084398 | |||
| 1475 | Ga0495628_0656994 | |||
| 1476 | Ga0495628_0952469 | |||
| 1477 | Ga0495630_0005233 | |||
| 1478 | Ga0495630_0015336 | |||
| 1479 | Ga0495630_0033318 | |||
| 1480 | Ga0495630_0052803 | |||
| 1481 | Ga0495630_0232839 | |||
| 1482 | Ga0495630_0284413 | |||
| 1483 | Ga0495630_0300788 | |||
| 1484 | Ga0495630_0536166 | |||
| 1485 | Ga0495630_0651016 | |||
| 1486 | Ga0495643_0042252 | |||
| 1487 | Ga0495644_0010118 | |||
| 1488 | Ga0495666_0000145 | |||
| 1489 | Ga0495642_0054501 | |||
| 1490 | Ga0495652_0010813 | |||
| 1491 | Ga0495652_0011205 | |||
| 1492 | Ga0495652_0040217 | |||
| 1493 | Ga0495652_0130565 | |||
| 1494 | Ga0495665_0005590 | |||
| 1495 | Ga0495665_0086666 | |||
| 1496 | Ga0495640_0017850 | |||
| 1497 | Ga0495640_0128572 | |||
| 1498 | Ga0495640_0164965 | |||
| 1499 | Ga0495586_0101960 | |||
| 1500 | Ga0495586_0202814 | |||
| 1501 | Ga0495586_0515229 | |||
| 1502 | Ga0495586_0871299 | |||
| 1503 | Ga0495587_0000062 | |||
| 1504 | Ga0495587_0029172 | |||
| 1505 | Ga0495587_0104275 | |||
| 1506 | Ga0495609_0027478 | |||
| 1507 | Ga0495645_0000418 | |||
| 1508 | Ga0495645_0108936 | |||
| 1509 | Ga0495645_0265141 | |||
| 1510 | Ga0495645_0426764 | |||
| 1511 | Ga0495622_0469107 | |||
| 1512 | Ga0495667_0006358 | |||
| 1513 | Ga0495667_0123792 | |||
| 1514 | Ga0495667_0133183 | |||
| 1515 | Ga0495667_0138025 | |||
| 1516 | Ga0495656_0005449 | |||
| 1517 | Ga0495668_0715484 | |||
| 1518 | Ga0495634_0169783 | |||
| 1519 | Ga0495625_0194649 | |||
| 1520 | Ga0495635_0009289 | |||
| 1521 | Ga0495635_0029747 | |||
| 1522 | Ga0495635_0040696 | |||
| 1523 | Ga0495635_0045955 | |||
| 1524 | Ga0495635_0060045 | |||
| 1525 | Ga0495635_0063064 | |||
| 1526 | Ga0495659_0017863 | |||
| 1527 | Ga0495588_0257393 | |||
| 1528 | Ga0495657_0020111 | |||
| 1529 | Ga0495657_0045579 | |||
| 1530 | Ga0495657_0081438 | |||
| 1531 | Ga0495657_0131452 | |||
| 1532 | Ga0495599_0000542 | |||
| 1533 | Ga0495599_0009394 | |||
| 1534 | Ga0495599_0146908 | |||
| 1535 | Ga0495599_0447111 | |||
| 1536 | Ga0495623_0000435 | |||
| 1537 | Ga0495623_0041600 | |||
| 1538 | Ga0495623_0168006 | |||
| 1539 | Ga0495646_0007673 | |||
| 1540 | Ga0495646_0023000 | |||
| 1541 | Ga0495646_0031340 | |||
| 1542 | Ga0495647_0000560 | |||
| 1543 | Ga0495647_0026163 | |||
| 1544 | Ga0495647_0044993 | |||
| 1545 | Ga0495647_0340079 | |||
| 1546 | Ga0495658_0001373 | |||
| 1547 | Ga0495658_0336681 | |||
| 1548 | Ga0495613_0024193 | |||
| 1549 | Ga0495613_0129368 | |||
| 1550 | Ga0495624_0000753 | |||
| 1551 | Ga0495624_0028902 | |||
| 1552 | Ga0495624_0211407 | |||
| 1553 | Ga0495670_0627108 | |||
| 1554 | Ga0495589_0139208 | |||
| 1555 | Ga0495600_0023999 | |||
| 1556 | Ga0495600_0031656 | |||
| 1557 | Ga0495600_0172723 | |||
| 1558 | Ga0495600_0328107 | |||
| 1559 | Ga0495581_0000407 | |||
| 1560 | Ga0495581_0302065 | |||
| 1561 | Ga0495581_0785678 | |||
| 1562 | Ga0495604_0009317 | |||
| 1563 | Ga0495604_0052634 | |||
| 1564 | Ga0495604_0054650 | |||
| 1565 | Ga0495604_0192278 | |||
| 1566 | Ga0495636_0191294 | |||
| 1567 | Ga0495674_0031730 | |||
| 1568 | Ga0495674_0041557 | |||
| 1569 | Ga0495674_0997152 | |||
| 1570 | Ga0495676_0002534 | |||
| 1571 | Ga0495676_0233414 | |||
| 1572 | Ga0495680_0009043 | |||
| 1573 | Ga0495680_0032626 | |||
| 1574 | Ga0495680_0115359 | |||
| 1575 | Ga0495680_0182791 | |||
| 1576 | Ga0495680_0227464 | |||
| 1577 | Ga0495680_0312242 | |||
| 1578 | Ga0495680_0479211 | |||
| 1579 | Ga0495683_0299687 | |||
| 1580 | Ga0495675_0004323 | |||
| 1581 | Ga0495677_0078693 | |||
| 1582 | Ga0495679_061237 | |||
| 1583 | Ga0495685_058678 | |||
| 1584 | Ga0495684_0005543 | |||
| 1585 | Ga0495684_0012597 | |||
| 1586 | Ga0495684_0042031 | |||
| 1587 | Ga0495684_0087933 | |||
| 1588 | Ga0495684_0199122 | |||
| 1589 | Ga0495684_0488488 | |||
| 1590 | Ga0495684_0612038 | |||
| 1591 | Ga0495593_0000807 | |||
| 1592 | Ga0495593_0327020 | |||
| 1593 | Ga0495602_0005881 | |||
| 1594 | Ga0495602_0035846 | |||
| 1595 | Ga0495614_0487952 | |||
| 1596 | Ga0496100_0129890 | |||
| 1597 | Ga0496100_0164748 | |||
| 1598 | Ga0496100_0373763 | |||
| 1599 | Ga0496100_0474291 | |||
| 1600 | Ga0496100_0625398 | |||
| 1601 | Ga0496101_0034217 | |||
| 1602 | Ga0496101_0183464 | |||
| 1603 | Ga0496102_0008078 | |||
| 1604 | Ga0496102_0141612 | |||
| 1605 | Ga0496102_0156809 | |||
| 1606 | Ga0496102_0349065 | |||
| 1607 | Ga0496102_0542661 | |||
| 1608 | Ga0496103_0006222 | |||
| 1609 | Ga0496103_0066505 | |||
| 1610 | Ga0496103_0147329 | |||
| 1611 | Ga0496103_0896542 | |||
| 1612 | Ga0496104_0002502 | |||
| 1613 | Ga0496104_0014077 | |||
| 1614 | Ga0496104_0032821 | |||
| 1615 | Ga0496104_0175680 | |||
| 1616 | Ga0496104_0189567 | |||
| 1617 | Ga0496104_1560155 | |||
| 1618 | Ga0496105_0025913 | |||
| 1619 | Ga0496105_0185988 | |||
| 1620 | Ga0496105_0243832 | |||
| 1621 | Ga0496105_0363319 | |||
| 1622 | Ga0496106_0012693 | |||
| 1623 | Ga0496106_0925459 | |||
| 1624 | Ga0496107_0001925 | |||
| 1625 | Ga0496107_0011878 | |||
| 1626 | Ga0496107_0145920 | |||
| 1627 | Ga0496107_0166116 | |||
| 1628 | Ga0496107_0205978 | |||
| 1629 | Ga0496107_0226044 | |||
| 1630 | Ga0496108_0021721 | |||
| 1631 | Ga0496108_0054644 | |||
| 1632 | Ga0496108_0088376 | |||
| 1633 | Ga0496108_0387977 | |||
| 1634 | Ga0496108_1282525 | |||
| 1635 | Ga0496109_0012739 | |||
| 1636 | Ga0496109_0049496 | |||
| 1637 | Ga0496109_0051890 | |||
| 1638 | Ga0496109_0068013 | |||
| 1639 | Ga0496109_0335950 | |||
| 1640 | Ga0496110_0014622 | |||
| 1641 | Ga0496110_0021211 | |||
| 1642 | Ga0496110_0249670 | |||
| 1643 | Ga0496111_0011695 | |||
| 1644 | Ga0496111_0302555 | |||
| 1645 | Ga0496111_1053393 | |||
| 1646 | Ga0496112_0000598 | |||
| 1647 | Ga0496112_0027644 | |||
| 1648 | Ga0496112_0042134 | |||
| 1649 | Ga0496112_0074888 | |||
| 1650 | Ga0496112_0110368 | |||
| 1651 | Ga0496112_0153892 | |||
| 1652 | Ga0496112_0228515 | |||
| 1653 | Ga0496112_0299204 | |||
| 1654 | Ga0496112_0531464 | |||
| 1655 | Ga0496112_0552184 | |||
| 1656 | Ga0496112_0689560 | |||
| 1657 | Ga0496113_0014459 | |||
| 1658 | Ga0496113_0121522 | |||
| 1659 | Ga0496113_0342819 | |||
| 1660 | Ga0496113_0417180 | |||
| 1661 | Ga0496113_0671954 | |||
| 1662 | Ga0496113_0824065 | |||
| 1663 | Ga0496114_0008459 | |||
| 1664 | Ga0496114_0015753 | |||
| 1665 | Ga0496114_0268079 | |||
| 1666 | Ga0496114_0376562 | |||
| 1667 | Ga0496115_0025452 | |||
| 1668 | Ga0496115_0040946 | |||
| 1669 | Ga0496115_0075583 | |||
| 1670 | Ga0496115_0081726 | |||
| 1671 | Ga0496115_0090806 | |||
| 1672 | Ga0496115_0123748 | |||
| 1673 | Ga0496115_0818320 | |||
| 1674 | Ga0496121_0007276 | |||
| 1675 | Ga0501032_0246372 | |||
| 1676 | Ga0501033_0060902 | |||
| 1677 | Ga0501034_0007715 | |||
| 1678 | Ga0501034_0124122 | |||
| 1679 | Ga0501036_0058299 | |||
| 1680 | Ga0501038_0022061 | |||
| 1681 | Ga0501039_0771570 | |||
| 1682 | Ga0501043_0028409 | |||
| 1683 | Ga0501047_0056599 | |||
| 1684 | Ga0501047_0951122 | |||
| 1685 | Ga0501047_1254183 | |||
| 1686 | Ga0501067_0028554 | |||
| 1687 | Ga0501067_0227031 | |||
| 1688 | Ga0501067_0594662 | |||
| 1689 | Ga0501068_0047842 | |||
| 1690 | Ga0501069_0049386 | |||
| 1691 | Ga0501069_0146152 | |||
| 1692 | Ga0501069_0178115 | |||
| 1693 | Ga0501070_0015295 | |||
| 1694 | Ga0501070_0112052 | |||
| 1695 | Ga0501070_0547174 | |||
| 1696 | Ga0501071_0010326 | |||
| 1697 | Ga0501072_0005175 | |||
| 1698 | Ga0501072_0015653 | |||
| 1699 | Ga0501073_0022725 | |||
| 1700 | Ga0501073_0051428 | |||
| 1701 | Ga0501074_0023509 | |||
| 1702 | Ga0501074_0261133 | |||
| 1703 | Ga0501076_0029667 | |||
| 1704 | Ga0501079_0010628 | |||
| 1705 | Ga0501080_0002078 | |||
| 1706 | Ga0501080_0079478 | |||
| 1707 | Ga0501081_0322464 | |||
| 1708 | Ga0501083_0010820 | |||
| 1709 | Ga0501044_0029300 | |||
| 1710 | nmdc:mga00v17_704_c2 | |||
| 1711 | nmdc:mga06z11_269765_c1 | |||
| 1712 | nmdc:mga06z11_38335_c1 | |||
| 1713 | nmdc:mga0n895_469_c1 | |||
| 1714 | nmdc:mga0n895_801181_c1 | |||
| 1715 | nmdc:mga0n895_98228_c1 | |||
| 1716 | nmdc:mga0rr50_499690_c1 | |||
| 1717 | nmdc:mga0rr50_85581_c1 | |||
| 1718 | nmdc:mga0rr50_887505_c1 | |||
| 1719 | nmdc:mga08x19_14_c1 | |||
| 1720 | nmdc:mga08x19_72638_c1 | |||
| 1721 | Ga0495601_0004004 | |||
| 1722 | Ga0495601_0027217 | |||
| 1723 | Ga0495601_0034847 | |||
| 1724 | Ga0495601_0070843 | |||
| 1725 | Ga0495601_0747048 | |||
| 1726 | Ga0495612_0002367 | |||
| 1727 | Ga0495612_0156875 | |||
| 1728 | Ga0495612_0251963 | |||
| 1729 | Ga0495595_0013724 | |||
| 1730 | Ga0495595_0019382 | |||
| 1731 | Ga0495595_0027118 | |||
| 1732 | Ga0495595_0319667 | |||
| 1733 | Ga0495595_0483344 | |||
| 1734 | Ga0495619_0000123 | |||
| 1735 | Ga0495619_0001783 | |||
| 1736 | Ga0495619_0025730 | |||
| 1737 | Ga0495619_0027860 | |||
| 1738 | Ga0495619_0051013 | |||
| 1739 | Ga0495619_0077113 | |||
| 1740 | Ga0495619_0293391 | |||
| 1741 | Ga0495619_0384735 | |||
| 1742 | Ga0495619_0587197 | |||
| 1743 | Ga0500616_0053634 | |||
| 1744 | Ga0501084_0084482 | |||
| 1745 | Ga0501084_0162537 | |||
| 1746 | Ga0466962_0000436 | |||
| 1747 | Ga0466962_0106140 | |||
| 1748 | Ga0466962_0158131 | |||
| 1749 | Ga0466962_0301241 | |||
| 1750 | Ga0466962_0686962 | |||
| 1751 | Ga0530510_0018159 | |||
| 1752 | Ga0530510_0175883 | |||
| 1753 | Ga0530510_0912664 | |||
| 1754 | 2561466289 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d6x-assembly1.cif.gz_D | crystal structure of campylobacter jejuni fabz | 0.9737 | 5 | 143 |
| 4h4g-assembly1.cif.gz_B | crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 | 0.9717 | 5 | 138 |
| 3d6x-assembly1.cif.gz_B | crystal structure of campylobacter jejuni fabz | 0.9716 | 5 | 144 |
| 3az8-assembly1.cif.gz_E | beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from plasmodium falciparum in complex with nas21 | 0.9644 | 4 | 140 |
| 1z6b-assembly4.cif.gz_B | crystal structure of plasmodium falciparum fabz at 2.1 a | 0.9638 | 3 | 141 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWF5_1_146_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9891 | 5 | 144 | 3.10.129.10 |
| 3d6xF00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9737 | 8 | 140 | 3.10.129.10 |
| 4h4gA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9615 | 5 | 144 | 3.10.129.10 |
| 5buyF00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9605 | 3 | 141 | 3.10.129.10 |
| af_Q2FWF5_1_146_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9553 | 5 | 144 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N6AMG0-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) | 0.9937 | 5 | 143 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-A0A354CN62-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.59) | 0.9922 | 5 | 143 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-C7G5K8-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.59) | 0.9917 | 5 | 143 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-A0A3D5R9H4-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) | 0.9912 | 5 | 143 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-A0A7V4X7V6-F1-model_v4 | Multifunctional fusion protein [Includes: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) (Beta-hydroxyacyl-ACP dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase); UDP-3-O-acyl-N-acetylglucosamine deacetylase (UDP-3-O-acyl-GlcNAc deacetylase) (EC 3.5.1.108) (UDP-3-O-[R-3-hydroxymyristoyl]-N-acetylglucosamine deacetylase)] | 0.9912 | 3 | 144 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0016836 GO:0046872 GO:0103117 |