F484383

General Info

Members Datasets Scaffolds Average Seq Length
877 474 1754 265

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100623260|Ga0068853_1006232601
Length 284
Sequence MAVHEEYAMLSKLQVVSTPSPSPAQVLQQPLLQVAGVTLQYKTAEYLVTATSQVTFDIHAGDRFVLLGPSGCGKSTLLKAIAGFIKPVEGKITLRDREIDAPGPDRMMVFQEFDQLLPWKTVRQNIELPLKLNKRADISRSASEIIERVGLTKFADSYPHMLSGGMKQRVAIARSMAMKPDVLLMDEPYAALDALTRRKMQQELLQLWDKTRFTLIFVTHSIEEAVLIGSRILVLSPHPGRVRAELNAHAFGPESLGGSEFQGLCKKINDMLFEHEATGKGTCA

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
98 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
99 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
100 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
138 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
146 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
147 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
149 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
215 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
216 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
217 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
225 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
230 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
231 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
232 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
248 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
254 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
255 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
267 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
268 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
274 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
275 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
276 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
277 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
278 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
283 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
288 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
293 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
294 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
295 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
296 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
297 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
301 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
302 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
303 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
304 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
307 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
308 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
309 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
313 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
314 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
315 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
316 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
317 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
318 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
321 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
322 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
323 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
324 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
325 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
326 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
327 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
330 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
331 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
332 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
333 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
334 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
337 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
338 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
344 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
345 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
349 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
350 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
351 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
352 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
353 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
354 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
355 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
358 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
359 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
360 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
361 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
362 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
363 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
364 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
365 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
366 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
367 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
368 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
369 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
370 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
371 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
372 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
373 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
374 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
375 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
376 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
379 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
380 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
381 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
399 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
400 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
401 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
402 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
403 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
404 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
405 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
406 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
407 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
408 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
411 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
412 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
413 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
414 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
415 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
418 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
419 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
420 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
421 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
422 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
423 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
424 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
425 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
426 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
427 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
428 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
429 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
430 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
431 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
432 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
433 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
434 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
435 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
436 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
437 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
438 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
439 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
440 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
441 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
442 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
443 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
444 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
445 2818991467 Bosea vestrisii 3192 Isolate Unclassified
446 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
447 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
448 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
449 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
450 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
451 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
452 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
453 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
454 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
455 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
456 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
457 2902330777 Methylobacterium sp. 2A Isolate Unclassified
458 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
459 2904424332 Duganella sp. 1411 Isolate Rhizosphere
460 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
461 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
462 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
463 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
464 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
465 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
466 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
467 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
468 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
469 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
470 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
471 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
472 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
473 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
474 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 1.14
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.9
Nodule 1.94
Rhizoplane 5.13
Rhizosphere 80.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100623260 3300005539 Bacteria 1025
2 JGI24743J22301_10005709 3300001991 Bacteria 2088
3 JGI24034J26672_10009435 3300002239 Bacteria 1440
4 JGI24742J22300_10006380 3300002244 Bacteria 1949
5 JGI25155J39150_1000076 3300002704 Bacteria 59158
6 JGI25155J39150_1000567 3300002704 Bacteria 8291
7 JGI25156J39149_1000032 3300002705 Bacteria 118609
8 JGI25156J39149_1002064 3300002705 Bacteria 7631
9 JGI25156J39149_1003734 3300002705 Bacteria 4872
10 JGI25162J39368_1004764 3300002737 Bacteria 2980
11 JGI25154J39366_1000095 3300002738 Bacteria 79187
12 JGI25154J39366_1000223 3300002738 Bacteria 38684
13 JGI25157J39369_1000388 3300002741 Bacteria 30373
14 JGI25159J45721_1004525 3300002987 Bacteria 4594
15 JGI25151J46595_10000079 3300003187 Bacteria 132415
16 Ga0055538_1000002 3300003751 Bacteria 999437
17 Ga0055539_1000002 3300003752 Bacteria 999437
18 Ga0055533_1000004 3300003756 Bacteria 999437
19 Ga0055532_1000083 3300003758 Bacteria 118609
20 Ga0055525_1000002 3300003759 Bacteria 999437
21 Ga0055535_1012982 3300003761 Bacteria 1249
22 Ga0055526_1000718 3300003771 Bacteria 25105
23 Ga0055524_1000147 3300003775 Bacteria 83426
24 Ga0055524_1005161 3300003775 Bacteria 5889
25 Ga0055541_1000002 3300003841 Bacteria 896405
26 Ga0065165_1000306 3300005262 Bacteria 81181
27 Ga0065712_10086790 3300005290 Bacteria 2616
28 Ga0070658_10018562 3300005327 Bacteria 5570
29 Ga0070658_10034943 3300005327 Bacteria 4046
30 Ga0070658_10112763 3300005327 Bacteria 2254
31 Ga0070658_10250922 3300005327 Bacteria 1501
32 Ga0070676_10031151 3300005328 Bacteria 3046
33 Ga0070683_100352660 3300005329 Bacteria 1401
34 Ga0070690_100020880 3300005330 Bacteria 3994
35 Ga0070690_100082456 3300005330 Bacteria 2105
36 Ga0070670_100012362 3300005331 Bacteria 7305
37 Ga0070670_100069368 3300005331 Bacteria 3026
38 Ga0070670_100201684 3300005331 Bacteria 1729
39 Ga0070670_100264755 3300005331 Bacteria 1499
40 Ga0068869_100071537 3300005334 Bacteria 2568
41 Ga0068869_100076940 3300005334 Bacteria 2481
42 Ga0068869_100089529 3300005334 Bacteria 2311
43 Ga0070666_10055078 3300005335 Bacteria 2684
44 Ga0070666_10209223 3300005335 Bacteria 1373
45 Ga0070680_100001454 3300005336 Bacteria 17167
46 Ga0070680_100002828 3300005336 Bacteria 12901
47 Ga0070682_100037646 3300005337 Bacteria 2963
48 Ga0068868_100043322 3300005338 Bacteria 3515
49 Ga0070660_100000414 3300005339 Bacteria 28402
50 Ga0070660_100007676 3300005339 Bacteria 7517
51 Ga0070660_100025623 3300005339 Bacteria 4384
52 Ga0070660_100029654 3300005339 Bacteria 4102
53 Ga0070660_100043495 3300005339 Bacteria 3433
54 Ga0070660_100084771 3300005339 Bacteria 2491
55 Ga0070660_100108342 3300005339 Bacteria 2208
56 Ga0070660_100293491 3300005339 Bacteria 1332
57 Ga0070689_100019359 3300005340 Bacteria 5034
58 Ga0070689_100126351 3300005340 Bacteria 2046
59 Ga0070689_100219097 3300005340 Bacteria 1560
60 Ga0070691_10002244 3300005341 Bacteria 8545
61 Ga0070691_10042038 3300005341 Bacteria 2162
62 Ga0070687_100121609 3300005343 Bacteria 1494
63 Ga0070661_100001393 3300005344 Bacteria 16882
64 Ga0070661_100228154 3300005344 Bacteria 1430
65 Ga0070692_10033004 3300005345 Bacteria 2607
66 Ga0070668_100399072 3300005347 Bacteria 1174
67 Ga0070669_100013267 3300005353 Bacteria 5857
68 Ga0070669_100277956 3300005353 Bacteria 1341
69 Ga0070675_100000047 3300005354 Bacteria 76032
70 Ga0070675_100003166 3300005354 Bacteria 12449
71 Ga0070675_100003200 3300005354 Bacteria 12407
72 Ga0070675_100016822 3300005354 Bacteria 5806
73 Ga0070675_100039428 3300005354 Bacteria 3854
74 Ga0070675_100221126 3300005354 Bacteria 1649
75 Ga0070671_100003924 3300005355 Bacteria 11699
76 Ga0070671_100028246 3300005355 Bacteria 4619
77 Ga0070671_100060943 3300005355 Bacteria 3142
78 Ga0070673_100002755 3300005364 Bacteria 10795
79 Ga0070673_100009518 3300005364 Bacteria 6524
80 Ga0070688_100008728 3300005365 Bacteria 5512
81 Ga0070688_100283604 3300005365 Bacteria 1191
82 Ga0070688_100284513 3300005365 Bacteria 1189
83 Ga0070659_100000526 3300005366 Bacteria 27993
84 Ga0070659_100018531 3300005366 Bacteria 5253
85 Ga0070659_100041122 3300005366 Bacteria 3613
86 Ga0070659_100109435 3300005366 Bacteria 2230
87 Ga0070659_100117968 3300005366 Bacteria 2146
88 Ga0070667_100123125 3300005367 Bacteria 2258
89 Ga0070703_10002040 3300005406 Bacteria 5896
90 Ga0070714_100011555 3300005435 Bacteria 7008
91 Ga0070713_100006994 3300005436 Bacteria 7877
92 Ga0070713_100197303 3300005436 Bacteria 1816
93 Ga0070710_10152324 3300005437 Bacteria 1427
94 Ga0070701_10002126 3300005438 Bacteria 7538
95 Ga0070701_10071198 3300005438 Bacteria 1859
96 Ga0070711_100113147 3300005439 Bacteria 1995
97 Ga0070705_100000070 3300005440 Bacteria 54646
98 Ga0070700_100001054 3300005441 Bacteria 13643
99 Ga0070700_100033455 3300005441 Bacteria 3096
100 Ga0070694_100001284 3300005444 Bacteria 14583
101 Ga0070708_100211552 3300005445 Bacteria 1817
102 Ga0070663_100002090 3300005455 Bacteria 11171
103 Ga0070663_100003639 3300005455 Bacteria 8925
104 Ga0070662_100000260 3300005457 Bacteria 31271
105 Ga0070681_10005497 3300005458 Bacteria 12242
106 Ga0070681_10092407 3300005458 Bacteria 2975
107 Ga0070681_10287940 3300005458 Bacteria 1553
108 Ga0068867_100045778 3300005459 Bacteria 3210
109 Ga0068867_100528315 3300005459 Bacteria 1018
110 Ga0070698_100174104 3300005471 Bacteria 2092
111 Ga0070699_100002047 3300005518 Bacteria 18227
112 Ga0070679_100011047 3300005530 Bacteria 8589
113 Ga0070679_100025904 3300005530 Bacteria 5755
114 Ga0070679_100057189 3300005530 Bacteria 3887
115 Ga0070679_100062826 3300005530 Bacteria 3702
116 Ga0070679_100096263 3300005530 Bacteria 2948
117 Ga0070679_100421749 3300005530 Bacteria 1280
118 Ga0070684_100088797 3300005535 Bacteria 2746
119 Ga0070684_100156418 3300005535 Bacteria 2067
120 Ga0068853_100001673 3300005539 Bacteria 16221
121 Ga0068853_100055480 3300005539 Bacteria 3415
122 Ga0068853_100071638 3300005539 Bacteria 3019
123 Ga0068853_100211279 3300005539 Bacteria 1769
124 Ga0070672_100016809 3300005543 Bacteria 5248
125 Ga0070672_100038229 3300005543 Bacteria 3666
126 Ga0070686_100032215 3300005544 Bacteria 3212
127 Ga0070686_100051768 3300005544 Bacteria 2615
128 Ga0070686_100142483 3300005544 Bacteria 1670
129 Ga0070695_100000961 3300005545 Bacteria 15654
130 Ga0070695_100245482 3300005545 Bacteria 1301
131 Ga0070696_100000787 3300005546 Bacteria 20400
132 Ga0070696_100003444 3300005546 Bacteria 10532
133 Ga0070693_100150948 3300005547 Bacteria 1472
134 Ga0070665_100077618 3300005548 Bacteria 3328
135 Ga0070665_100125115 3300005548 Bacteria 2573
136 Ga0070665_100173026 3300005548 Bacteria 2160
137 Ga0070704_100001472 3300005549 Bacteria 12642
138 Ga0070704_100019492 3300005549 Bacteria 4358
139 Ga0070704_100120867 3300005549 Bacteria 2012
140 Ga0068855_100000055 3300005563 Bacteria 136099
141 Ga0068855_100000110 3300005563 Bacteria 102379
142 Ga0068855_100007699 3300005563 Bacteria 13008
143 Ga0068855_100025547 3300005563 Bacteria 7065
144 Ga0068855_100093172 3300005563 Bacteria 3474
145 Ga0068855_100149825 3300005563 Bacteria 2653
146 Ga0068855_100190252 3300005563 Bacteria 2315
147 Ga0068855_100260802 3300005563 Bacteria 1930
148 Ga0068855_100316770 3300005563 Bacteria 1725
149 Ga0068855_100411777 3300005563 Bacteria 1480
150 Ga0070664_100000378 3300005564 Bacteria 33105
151 Ga0070664_100010769 3300005564 Bacteria 7415
152 Ga0070664_100055996 3300005564 Bacteria 3350
153 Ga0070664_100077109 3300005564 Bacteria 2865
154 Ga0070664_100210121 3300005564 Bacteria 1739
155 Ga0070664_100243081 3300005564 Bacteria 1616
156 Ga0070664_100268732 3300005564 Bacteria 1535
157 Ga0068857_100040684 3300005577 Bacteria 4122
158 Ga0068857_100140746 3300005577 Bacteria 2181
159 Ga0068857_100244042 3300005577 Bacteria 1645
160 Ga0068857_100402341 3300005577 Bacteria 1274
161 Ga0068854_100008843 3300005578 Bacteria 6481
162 Ga0068854_100017510 3300005578 Bacteria 4794
163 Ga0068854_100129464 3300005578 Bacteria 1925
164 Ga0068856_100000111 3300005614 Bacteria 81104
165 Ga0068856_100014426 3300005614 Bacteria 7633
166 Ga0068856_100028653 3300005614 Bacteria 5440
167 Ga0068856_100651604 3300005614 Bacteria 1074
168 Ga0070702_100111537 3300005615 Bacteria 1696
169 Ga0068852_100003379 3300005616 Bacteria 11139
170 Ga0068852_100349420 3300005616 Bacteria 1443
171 Ga0068852_100424630 3300005616 Bacteria 1312
172 Ga0068859_100000540 3300005617 Bacteria 37486
173 Ga0068859_100006985 3300005617 Bacteria 11463
174 Ga0068859_100020770 3300005617 Bacteria 6591
175 Ga0068859_100090120 3300005617 Bacteria 3117
176 Ga0068864_100094812 3300005618 Bacteria 2638
177 Ga0068851_10072499 3300005834 Bacteria 1784
178 Ga0068851_10168028 3300005834 Bacteria 1209
179 Ga0068851_10233951 3300005834 Bacteria 1037
180 Ga0068870_10016704 3300005840 Bacteria 3513
181 Ga0068863_100000482 3300005841 Bacteria 40772
182 Ga0068863_100046317 3300005841 Bacteria 4127
183 Ga0068863_100143017 3300005841 Bacteria 2287
184 Ga0068858_100072148 3300005842 Bacteria 3203
185 Ga0068858_100585377 3300005842 Bacteria 1082
186 Ga0068860_100002026 3300005843 Bacteria 21380
187 Ga0068860_100004449 3300005843 Bacteria 14300
188 Ga0068860_100104218 3300005843 Bacteria 2708
189 Ga0068862_100001012 3300005844 Bacteria 26997
190 Ga0081455_10115957 3300005937 Bacteria 2119
191 Ga0081539_10019491 3300005985 Bacteria 4638
192 Ga0075365_10007935 3300006038 Bacteria 5984
193 Ga0075365_10094270 3300006038 Bacteria 2043
194 Ga0075363_100097150 3300006048 Bacteria 1627
195 Ga0075367_10146917 3300006178 Bacteria 1462
196 Ga0075369_10007679 3300006186 Bacteria 4121
197 Ga0097621_100001740 3300006237 Bacteria 14908
198 Ga0097621_100122580 3300006237 Bacteria 2206
199 Ga0068871_100036976 3300006358 Bacteria 3891
200 Ga0068871_100070256 3300006358 Bacteria 2878
201 Ga0075434_100087811 3300006871 Bacteria 3111
202 Ga0075434_100191262 3300006871 Bacteria 2067
203 Ga0097620_100000540 3300006931 Bacteria 37486
204 Ga0097620_100006985 3300006931 Bacteria 11463
205 Ga0097620_100020770 3300006931 Bacteria 6591
206 Ga0097620_100090121 3300006931 Bacteria 3117
207 Ga0099825_1042400 3300006941 Bacteria 1261
208 Ga0099824_1018508 3300006942 Bacteria 5700
209 Ga0099822_1006503 3300006943 Bacteria 15212
210 Ga0079104_1004906 3300006946 Bacteria 5526
211 Ga0075435_100025364 3300007076 Bacteria 4615
212 Ga0105251_10083050 3300009011 Bacteria 1479
213 Ga0105240_10007018 3300009093 Bacteria 16438
214 Ga0105240_10007251 3300009093 Bacteria 16141
215 Ga0105240_10008689 3300009093 Bacteria 14492
216 Ga0105240_10014573 3300009093 Bacteria 10727
217 Ga0105240_10027626 3300009093 Bacteria 7428
218 Ga0105240_10192764 3300009093 Bacteria 2395
219 Ga0105240_10365685 3300009093 Bacteria 1633
220 Ga0105240_10483225 3300009093 Bacteria 1380
221 Ga0111539_10011976 3300009094 Bacteria 10874
222 Ga0111539_10022710 3300009094 Bacteria 7705
223 Ga0111539_10128782 3300009094 Bacteria 2965
224 Ga0111539_10144393 3300009094 Bacteria 2786
225 Ga0105245_10335375 3300009098 Bacteria 1494
226 Ga0105247_10087642 3300009101 Bacteria 1972
227 Ga0114129_10205160 3300009147 Bacteria 2667
228 Ga0114129_10391670 3300009147 Bacteria 1832
229 Ga0105243_10019973 3300009148 Bacteria 5080
230 Ga0105241_10005236 3300009174 Bacteria 9579
231 Ga0105242_10037406 3300009176 Bacteria 3898
232 Ga0105242_10417449 3300009176 Bacteria 1256
233 Ga0105248_10028635 3300009177 Bacteria 6207
234 Ga0105248_10123691 3300009177 Bacteria 2918
235 Ga0105248_10135888 3300009177 Bacteria 2774
236 Ga0105248_10145682 3300009177 Bacteria 2672
237 Ga0105248_10161752 3300009177 Bacteria 2525
238 Ga0105248_10255890 3300009177 Bacteria 1971
239 Ga0105248_10549831 3300009177 Bacteria 1302
240 Ga0105237_10051247 3300009545 Bacteria 4145
241 Ga0105237_10102457 3300009545 Bacteria 2854
242 Ga0105237_10281050 3300009545 Bacteria 1667
243 Ga0105237_10289384 3300009545 Bacteria 1641
244 Ga0105238_10001827 3300009551 Bacteria 21335
245 Ga0105238_10044711 3300009551 Bacteria 4476
246 Ga0105238_10070544 3300009551 Bacteria 3493
247 Ga0105249_10150379 3300009553 Bacteria 2241
248 Ga0105239_10163183 3300010375 Bacteria 2490
249 Ga0105239_10259904 3300010375 Bacteria 1951
250 Ga0105246_10067320 3300011119 Bacteria 2509
251 Ga0157371_10000248 3300013102 Bacteria 76451
252 Ga0157371_10226485 3300013102 Bacteria 1343
253 Ga0157370_10004460 3300013104 Bacteria 16037
254 Ga0157370_10006449 3300013104 Bacteria 12944
255 Ga0157370_10011079 3300013104 Bacteria 9452
256 Ga0157370_10046276 3300013104 Bacteria 4171
257 Ga0157370_10056647 3300013104 Bacteria 3730
258 Ga0157370_10065888 3300013104 Bacteria 3426
259 Ga0157370_10087663 3300013104 Bacteria 2924
260 Ga0157370_10103781 3300013104 Bacteria 2661
261 Ga0157370_10301095 3300013104 Bacteria 1480
262 Ga0157369_10002981 3300013105 Bacteria 20257
263 Ga0157369_10009381 3300013105 Bacteria 11188
264 Ga0157369_10526916 3300013105 Bacteria 1222
265 Ga0157369_10582756 3300013105 Bacteria 1155
266 Ga0171462_1033 3300013250 Bacteria 90238
267 Ga0157374_10079283 3300013296 Bacteria 3112
268 Ga0157374_10114698 3300013296 Bacteria 2594
269 Ga0157378_10254433 3300013297 Bacteria 1683
270 Ga0163162_10003469 3300013306 Bacteria 15064
271 Ga0157372_10000468 3300013307 Bacteria 44530
272 Ga0157372_10072433 3300013307 Bacteria 3883
273 Ga0157372_10081535 3300013307 Bacteria 3662
274 Ga0157372_10164788 3300013307 Bacteria 2563
275 Ga0157372_10250568 3300013307 Bacteria 2055
276 Ga0157372_10342671 3300013307 Bacteria 1741
277 Ga0157372_10426810 3300013307 Bacteria 1545
278 Ga0157372_10539410 3300013307 Bacteria 1360
279 Ga0157375_10001118 3300013308 Bacteria 23248
280 Ga0157375_10058966 3300013308 Bacteria 3800
281 Ga0163163_10006158 3300014325 Bacteria 10456
282 Ga0163163_10134066 3300014325 Bacteria 2517
283 Ga0163163_10292736 3300014325 Bacteria 1680
284 Ga0163163_10294975 3300014325 Bacteria 1674
285 Ga0163163_10311496 3300014325 Bacteria 1627
286 Ga0157380_10053274 3300014326 Bacteria 3207
287 Ga0157377_10025992 3300014745 Bacteria 3128
288 Ga0157377_10316143 3300014745 Bacteria 1036
289 Ga0157379_10000226 3300014968 Bacteria 44189
290 Ga0157379_10143572 3300014968 Bacteria 2152
291 Ga0182006_1000685 3300015261 Bacteria 23686
292 Ga0182007_10038195 3300015262 Bacteria 1611
293 Ga0163161_10036130 3300017792 Bacteria 3538
294 Ga0163161_10069471 3300017792 Bacteria 2575
295 Ga0206353_10103469 3300020082 Bacteria 1917
296 Ga0213872_10005720 3300021361 Bacteria 6332
297 Ga0213876_10046609 3300021384 Bacteria 2292
298 Ga0213875_10016710 3300021388 Bacteria 3555
299 Ga0213875_10082261 3300021388 Bacteria 1502
300 Ga0213875_10096126 3300021388 Bacteria 1382
301 Ga0213875_10100885 3300021388 Bacteria 1347
302 Ga0209435_100013 3300025206 Bacteria 366789
303 Ga0209435_100379 3300025206 Bacteria 9907
304 Ga0209784_100002 3300025224 Bacteria 1753105
305 Ga0209566_100003 3300025225 Bacteria 1753105
306 Ga0209674_100004 3300025226 Bacteria 1753105
307 Ga0209147_100030 3300025229 Bacteria 366789
308 Ga0209563_100006 3300025230 Bacteria 1753105
309 Ga0209437_100419 3300025233 Bacteria 38515
310 Ga0209258_100433 3300025242 Bacteria 48200
311 Ga0209646_1000021 3300025246 Bacteria 461083
312 Ga0209646_1000034 3300025246 Bacteria 366789
313 Ga0209026_1000022 3300025250 Bacteria 366789
314 Ga0209026_1001565 3300025250 Bacteria 9869
315 Ga0209677_100003 3300025253 Bacteria 1753105
316 Ga0209759_1000018 3300025256 Bacteria 366789
317 Ga0209759_1000100 3300025256 Bacteria 156294
318 Ga0209233_1034338 3300025261 Bacteria 1156
319 Ga0209673_1017561 3300025273 Bacteria 2635
320 Ga0209130_1000111 3300025284 Bacteria 131855
321 Ga0207673_1000127 3300025290 Bacteria 7181
322 Ga0209675_1001117 3300025291 Bacteria 16355
323 Ga0209025_1000014 3300025294 Bacteria 865448
324 Ga0209025_1001499 3300025294 Bacteria 30164
325 Ga0209564_1000179 3300025295 Bacteria 151032
326 Ga0209256_1000055 3300025299 Bacteria 295530
327 Ga0209256_1000102 3300025299 Bacteria 199097
328 Ga0209256_1033389 3300025299 Bacteria 1385
329 Ga0207697_10017438 3300025315 Bacteria 2951
330 Ga0207656_10026268 3300025321 Bacteria 2372
331 Ga0207656_10026269 3300025321 Bacteria 2372
332 Ga0207656_10111912 3300025321 Bacteria 1262
333 Ga0207682_10009230 3300025893 Bacteria 3897
334 Ga0207692_10251953 3300025898 Bacteria 1058
335 Ga0207710_10048570 3300025900 Bacteria 1900
336 Ga0207688_10002018 3300025901 Bacteria 10890
337 Ga0207680_10044443 3300025903 Bacteria 2612
338 Ga0207647_10018756 3300025904 Bacteria 4669
339 Ga0207647_10021879 3300025904 Bacteria 4258
340 Ga0207647_10093776 3300025904 Bacteria 1789
341 Ga0207647_10179160 3300025904 Bacteria 1232
342 Ga0207699_10168463 3300025906 Bacteria 1464
343 Ga0207645_10014390 3300025907 Bacteria 5293
344 Ga0207645_10080323 3300025907 Bacteria 2091
345 Ga0207643_10005305 3300025908 Bacteria 6900
346 Ga0207705_10007617 3300025909 Bacteria 7962
347 Ga0207705_10037355 3300025909 Bacteria 3476
348 Ga0207705_10067806 3300025909 Bacteria 2582
349 Ga0207705_10192267 3300025909 Bacteria 1544
350 Ga0207654_10004070 3300025911 Bacteria 7364
351 Ga0207654_10026836 3300025911 Bacteria 3124
352 Ga0207707_10030136 3300025912 Bacteria 4744
353 Ga0207707_10077177 3300025912 Bacteria 2908
354 Ga0207707_10084215 3300025912 Bacteria 2777
355 Ga0207707_10176638 3300025912 Bacteria 1866
356 Ga0207695_10000896 3300025913 Bacteria 53929
357 Ga0207695_10009589 3300025913 Bacteria 11960
358 Ga0207695_10029551 3300025913 Bacteria 6051
359 Ga0207695_10055460 3300025913 Bacteria 4129
360 Ga0207695_10105955 3300025913 Bacteria 2798
361 Ga0207695_10171105 3300025913 Bacteria 2098
362 Ga0207695_10308035 3300025913 Bacteria 1474
363 Ga0207671_10215167 3300025914 Bacteria 1504
364 Ga0207671_10313599 3300025914 Bacteria 1240
365 Ga0207660_10025362 3300025917 Bacteria 4023
366 Ga0207660_10025923 3300025917 Bacteria 3986
367 Ga0207660_10083052 3300025917 Bacteria 2358
368 Ga0207660_10133347 3300025917 Bacteria 1893
369 Ga0207662_10076289 3300025918 Bacteria 2037
370 Ga0207657_10000894 3300025919 Bacteria 31534
371 Ga0207657_10000910 3300025919 Bacteria 31264
372 Ga0207657_10010420 3300025919 Bacteria 9279
373 Ga0207657_10012583 3300025919 Bacteria 8341
374 Ga0207657_10032705 3300025919 Bacteria 4696
375 Ga0207657_10094060 3300025919 Bacteria 2496
376 Ga0207657_10104907 3300025919 Bacteria 2341
377 Ga0207657_10147206 3300025919 Bacteria 1920
378 Ga0207649_10008175 3300025920 Bacteria 5696
379 Ga0207649_10015173 3300025920 Bacteria 4326
380 Ga0207649_10217186 3300025920 Bacteria 1360
381 Ga0207652_10007193 3300025921 Bacteria 8982
382 Ga0207652_10028301 3300025921 Bacteria 4675
383 Ga0207652_10048462 3300025921 Bacteria 3632
384 Ga0207652_10051659 3300025921 Bacteria 3525
385 Ga0207652_10244174 3300025921 Bacteria 1619
386 Ga0207681_10169790 3300025923 Bacteria 1652
387 Ga0207694_10003746 3300025924 Bacteria 12049
388 Ga0207694_10100452 3300025924 Bacteria 2292
389 Ga0207694_10153090 3300025924 Bacteria 1858
390 Ga0207694_10320744 3300025924 Bacteria 1278
391 Ga0207650_10004859 3300025925 Bacteria 9179
392 Ga0207650_10007669 3300025925 Bacteria 7350
393 Ga0207650_10050178 3300025925 Bacteria 3085
394 Ga0207659_10014380 3300025926 Bacteria 5102
395 Ga0207659_10014390 3300025926 Bacteria 5101
396 Ga0207659_10026030 3300025926 Bacteria 3942
397 Ga0207659_10027271 3300025926 Bacteria 3865
398 Ga0207659_10106897 3300025926 Bacteria 2119
399 Ga0207659_10159237 3300025926 Bacteria 1771
400 Ga0207700_10035789 3300025928 Bacteria 3579
401 Ga0207700_10170377 3300025928 Bacteria 1816
402 Ga0207664_10006045 3300025929 Bacteria 8289
403 Ga0207644_10019042 3300025931 Bacteria 4653
404 Ga0207690_10000194 3300025932 Bacteria 47161
405 Ga0207690_10063622 3300025932 Bacteria 2516
406 Ga0207690_10151633 3300025932 Bacteria 1719
407 Ga0207690_10224436 3300025932 Bacteria 1439
408 Ga0207706_10000008 3300025933 Bacteria 201940
409 Ga0207706_10002914 3300025933 Bacteria 16537
410 Ga0207686_10038644 3300025934 Bacteria 2890
411 Ga0207686_10478190 3300025934 Bacteria 963
412 Ga0207709_10042244 3300025935 Bacteria 2741
413 Ga0207670_10039589 3300025936 Bacteria 3088
414 Ga0207670_10100957 3300025936 Bacteria 2061
415 Ga0207669_10077183 3300025937 Bacteria 2117
416 Ga0207669_10212045 3300025937 Bacteria 1414
417 Ga0207691_10016366 3300025940 Bacteria 7039
418 Ga0207691_10033742 3300025940 Bacteria 4765
419 Ga0207691_10061595 3300025940 Bacteria 3408
420 Ga0207711_10003837 3300025941 Bacteria 12927
421 Ga0207711_10083534 3300025941 Bacteria 2794
422 Ga0207711_10224911 3300025941 Bacteria 1717
423 Ga0207689_10028886 3300025942 Bacteria 4637
424 Ga0207689_10250682 3300025942 Bacteria 1464
425 Ga0207661_10026953 3300025944 Bacteria 4385
426 Ga0207679_10000934 3300025945 Bacteria 18670
427 Ga0207679_10027208 3300025945 Bacteria 3953
428 Ga0207679_10040686 3300025945 Bacteria 3329
429 Ga0207679_10133355 3300025945 Bacteria 1996
430 Ga0207679_10179854 3300025945 Bacteria 1749
431 Ga0207679_10183517 3300025945 Bacteria 1733
432 Ga0207667_10000032 3300025949 Bacteria 322253
433 Ga0207667_10001326 3300025949 Bacteria 31063
434 Ga0207667_10008233 3300025949 Bacteria 12408
435 Ga0207667_10013259 3300025949 Bacteria 9446
436 Ga0207667_10025214 3300025949 Bacteria 6512
437 Ga0207667_10033295 3300025949 Bacteria 5543
438 Ga0207667_10068397 3300025949 Bacteria 3698
439 Ga0207667_10273652 3300025949 Bacteria 1726
440 Ga0207667_10310771 3300025949 Bacteria 1610
441 Ga0207667_10554070 3300025949 Bacteria 1163
442 Ga0207651_10003519 3300025960 Bacteria 7699
443 Ga0207651_10021459 3300025960 Bacteria 3926
444 Ga0207651_10056016 3300025960 Bacteria 2711
445 Ga0207651_10381021 3300025960 Bacteria 1195
446 Ga0207712_10014486 3300025961 Bacteria 5075
447 Ga0207712_10313431 3300025961 Bacteria 1292
448 Ga0207712_10471852 3300025961 Bacteria 1068
449 Ga0207640_10004677 3300025981 Bacteria 7429
450 Ga0207640_10012816 3300025981 Bacteria 4789
451 Ga0207640_10140103 3300025981 Bacteria 1762
452 Ga0207640_10363612 3300025981 Bacteria 1167
453 Ga0207658_10054168 3300025986 Bacteria 2967
454 Ga0207658_10056134 3300025986 Bacteria 2921
455 Ga0207677_10335920 3300026023 Bacteria 1261
456 Ga0207703_10061310 3300026035 Bacteria 3079
457 Ga0207639_10002823 3300026041 Bacteria 11653
458 Ga0207639_10041392 3300026041 Bacteria 3446
459 Ga0207639_10043729 3300026041 Bacteria 3364
460 Ga0207639_10144336 3300026041 Bacteria 1987
461 Ga0207639_10399999 3300026041 Bacteria 1237
462 Ga0207678_10008479 3300026067 Bacteria 9064
463 Ga0207678_10009793 3300026067 Bacteria 8428
464 Ga0207678_10013310 3300026067 Bacteria 7219
465 Ga0207678_10603928 3300026067 Bacteria 962
466 Ga0207708_10000440 3300026075 Bacteria 32431
467 Ga0207708_10046499 3300026075 Bacteria 3305
468 Ga0207708_10302454 3300026075 Bacteria 1301
469 Ga0207702_10000510 3300026078 Bacteria 43837
470 Ga0207702_10034707 3300026078 Bacteria 4218
471 Ga0207641_10002558 3300026088 Bacteria 16737
472 Ga0207641_10417469 3300026088 Bacteria 1291
473 Ga0207648_10016548 3300026089 Bacteria 6735
474 Ga0207648_10127558 3300026089 Bacteria 2238
475 Ga0207676_10050123 3300026095 Bacteria 3253
476 Ga0207676_10057721 3300026095 Bacteria 3058
477 Ga0207674_10000709 3300026116 Bacteria 43489
478 Ga0207674_10031602 3300026116 Bacteria 5559
479 Ga0207674_10037960 3300026116 Bacteria 5003
480 Ga0207674_10124228 3300026116 Bacteria 2547
481 Ga0207674_10128967 3300026116 Bacteria 2493
482 Ga0207674_10366378 3300026116 Bacteria 1393
483 Ga0207674_10473279 3300026116 Bacteria 1211
484 Ga0207675_100011223 3300026118 Bacteria 8390
485 Ga0207675_100059656 3300026118 Bacteria 3560
486 Ga0207683_10211816 3300026121 Bacteria 1764
487 Ga0207698_10017290 3300026142 Bacteria 4889
488 Ga0209589_1000276 3300027357 Bacteria 65299
489 Ga0209489_100714 3300027361 Bacteria 65299
490 Ga0209700_100732 3300027363 Bacteria 65299
491 Ga0209983_1010276 3300027665 Bacteria 1912
492 Ga0209971_1004023 3300027682 Bacteria 3476
493 Ga0209971_1014099 3300027682 Bacteria 1894
494 Ga0209974_10000194 3300027876 Bacteria 19284
495 Ga0209974_10001758 3300027876 Bacteria 7890
496 Ga0207428_10060550 3300027907 Bacteria 2999
497 Ga0207428_10189003 3300027907 Bacteria 1553
498 Ga0268266_10127191 3300028379 Bacteria 2275
499 Ga0268266_10571213 3300028379 Bacteria 1085
500 Ga0268265_10014552 3300028380 Bacteria 5362
501 Ga0268265_10443594 3300028380 Bacteria 1210
502 Ga0268264_10002236 3300028381 Bacteria 17157
503 Ga0268264_10019143 3300028381 Bacteria 5596
504 Ga0268264_10025590 3300028381 Bacteria 4821
505 Ga0268264_10511906 3300028381 Bacteria 1172
506 Ga0265337_1016644 3300028556 Bacteria 2371
507 Ga0265760_10050084 3300031090 Bacteria 1257
508 Ga0265330_10070485 3300031235 Bacteria 1512
509 Ga0265332_10001524 3300031238 Bacteria 12848
510 Ga0265328_10004422 3300031239 Bacteria 6104
511 Ga0265325_10000406 3300031241 Bacteria 30585
512 Ga0265329_10008728 3300031242 Bacteria 3825
513 Ga0265340_10003673 3300031247 Bacteria 8638
514 Ga0265339_10020973 3300031249 Bacteria 3811
515 Ga0265327_10026872 3300031251 Bacteria 3325
516 Ga0265316_10014787 3300031344 Bacteria 6851
517 Ga0265316_10081573 3300031344 Bacteria 2479
518 Ga0307513_10129248 3300031456 Bacteria 2475
519 Ga0307408_100068146 3300031548 Bacteria 2619
520 Ga0307408_100427436 3300031548 Bacteria 1144
521 Ga0265313_10001452 3300031595 Bacteria 22114
522 Ga0265314_10000523 3300031711 Bacteria 49565
523 Ga0307405_10043573 3300031731 Bacteria 2739
524 Ga0307405_10092697 3300031731 Bacteria 2005
525 Ga0307410_10005780 3300031852 Bacteria 6595
526 Ga0307406_10203757 3300031901 Bacteria 1458
527 Ga0307407_10006689 3300031903 Bacteria 5154
528 Ga0307409_100176336 3300031995 Bacteria 1887
529 Ga0307416_100018117 3300032002 Bacteria 4951
530 Ga0307416_100399303 3300032002 Bacteria 1412
531 Ga0307415_100022830 3300032126 Bacteria 3871
532 Ga0373926_0007792 3300035083 Bacteria 3567
533 Ga0373944_0004353 3300035089 Bacteria 3684
534 Ga0373923_0064730 3300035111 Bacteria 1560
535 Ga0373936_0029866 3300035113 Bacteria 2148
536 Ga0373945_0061322 3300035116 Bacteria 1404
537 Ga0373953_0030840 3300035117 Bacteria 2082
538 Ga0373953_0129156 3300035117 Bacteria 1077
539 Ga0373943_0034956 3300035170 Bacteria 2399
540 Ga0373943_0136844 3300035170 Bacteria 1316
541 Ga0373946_0030549 3300035171 Bacteria 2151
542 Ga0373946_0072146 3300035171 Bacteria 1494
543 Ga0373946_0182228 3300035171 Bacteria 997
544 Ga0373955_0080851 3300035172 Bacteria 1836
545 Ga0373955_0298499 3300035172 Bacteria 971
546 Ga0373924_0132299 3300035410 Bacteria 1086
547 Ga0373931_0163058 3300035691 Bacteria 1308
548 Ga0373935_0149940 3300035692 Bacteria 1582
549 Ga0373935_0205045 3300035692 Bacteria 1364
550 Ga0373927_0113068 3300035695 Bacteria 1769
551 Ga0373927_0178399 3300035695 Bacteria 1393
552 Ga0373947_0018501 3300035725 Bacteria 4011
553 Ga0373947_0062207 3300035725 Bacteria 2271
554 Ga0373947_0143388 3300035725 Bacteria 1534
555 Ga0373937_0061179 3300036401 Bacteria 3461
556 Ga0373937_0100529 3300036401 Bacteria 2684
557 Ga0373937_0111265 3300036401 Bacteria 2547
558 Ga0373925_0178582 3300037068 Bacteria 1679
559 Ga0373925_0565691 3300037068 Bacteria 935
560 Ga0395899_0005348 3300037312 Bacteria 9973
561 Ga0395899_0028642 3300037312 Bacteria 4193
562 Ga0395900_0028376 3300037418 Bacteria 5732
563 Ga0395900_0163032 3300037418 Bacteria 2273
564 Ga0395898_0078503 3300037466 Bacteria 3185
565 Ga0395898_0094384 3300037466 Bacteria 2875
566 Ga0395905_0000772 3300037471 Bacteria 42135
567 Ga0395905_0008320 3300037471 Bacteria 10234
568 Ga0395905_0038129 3300037471 Bacteria 4508
569 Ga0395905_0125531 3300037471 Bacteria 2413
570 Ga0395905_0143222 3300037471 Bacteria 2249
571 Ga0395905_0155175 3300037471 Bacteria 2153
572 Ga0436364_0687681 3300037853 Bacteria 1734
573 Ga0436364_0920462 3300037853 Bacteria 2561
574 Ga0436364_1333790 3300037853 Bacteria 4413
575 Ga0436364_1400673 3300037853 Bacteria 3728
576 Ga0436364_1422510 3300037853 Bacteria 10335
577 Ga0395901_0294571 3300038443 Bacteria 1683
578 Ga0395901_0544803 3300038443 Bacteria 1176
579 Ga0237816_00954 3300039145 Bacteria 2373
580 Ga0436365_0849376 3300039437 Bacteria 1030
581 Ga0436361_0564858 3300039447 Bacteria 17666
582 Ga0436362_0744013 3300039453 Bacteria 1835
583 Ga0451577_0040855 3300042876 Bacteria 4164
584 Ga0451577_0064559 3300042876 Bacteria 3265
585 Ga0451577_0205723 3300042876 Bacteria 1777
586 Ga0466977_0000316 3300044666 Bacteria 14397
587 Ga0453683_0000320 3300044673 Bacteria 59650
588 Ga0453683_0002549 3300044673 Bacteria 14049
589 Ga0466965_0152188 3300044683 Bacteria 1209
590 Ga0466966_0070088 3300044684 Bacteria 2198
591 Ga0466961_0023848 3300044693 Bacteria 3937
592 Ga0466963_0057383 3300044694 Bacteria 2593
593 Ga0466971_0034830 3300044719 Bacteria 2257
594 Ga0466968_0005636 3300044735 Bacteria 4690
595 Ga0466957_0047812 3300044842 Bacteria 2600
596 Ga0466957_0299248 3300044842 Bacteria 1081
597 Ga0466960_0052819 3300044901 Bacteria 1967
598 Ga0466959_0032646 3300045049 Bacteria 3853
599 Ga0451576_0039095 3300045051 Bacteria 5022
600 Ga0451576_0233031 3300045051 Bacteria 1923
601 Ga0466958_0117689 3300045836 Bacteria 1662
602 Ga0466958_0236603 3300045836 Bacteria 1167
603 Ga0466967_0012482 3300045976 Bacteria 6502
604 Ga0495617_047571 3300046452 Bacteria 1428
605 Ga0495592_0034788 3300046454 Bacteria 3796
606 Ga0495603_0050030 3300046455 Bacteria 2486
607 Ga0495591_074153 3300046458 Bacteria 878
608 Ga0495629_0024397 3300046459 Bacteria 4306
609 Ga0495641_0082890 3300046461 Bacteria 1436
610 Ga0495651_0002400 3300046462 Bacteria 14464
611 Ga0495651_0039803 3300046462 Bacteria 3657
612 Ga0495653_0000318 3300046463 Bacteria 39300
613 Ga0495653_0046673 3300046463 Bacteria 3353
614 Ga0495580_0041235 3300046472 Bacteria 3292
615 Ga0495582_0011135 3300046473 Bacteria 4953
616 Ga0495582_0011243 3300046473 Bacteria 4931
617 Ga0495582_0027403 3300046473 Bacteria 3123
618 Ga0495605_0055602 3300046474 Bacteria 1911
619 Ga0495639_0055112 3300046475 Bacteria 1813
620 Ga0495662_0004187 3300046476 Bacteria 7268
621 Ga0495584_0149039 3300046491 Bacteria 1188
622 Ga0495585_0020745 3300046492 Bacteria 3777
623 Ga0495585_0065485 3300046492 Bacteria 1990
624 Ga0495594_0006629 3300046499 Bacteria 5958
625 Ga0495594_0164357 3300046499 Bacteria 1262
626 Ga0495596_0001312 3300046500 Bacteria 14347
627 Ga0495596_0031197 3300046500 Bacteria 2130
628 Ga0495607_0039727 3300046501 Bacteria 2808
629 Ga0495607_0052553 3300046501 Bacteria 2360
630 Ga0495606_0000901 3300046507 Bacteria 44189
631 Ga0495608_0001403 3300046511 Bacteria 17129
632 Ga0495608_0030373 3300046511 Bacteria 3658
633 Ga0495610_0016384 3300046512 Bacteria 4268
634 Ga0495616_0008842 3300046513 Bacteria 5925
635 Ga0495618_0005557 3300046514 Bacteria 7672
636 Ga0495628_0000474 3300046516 Bacteria 36662
637 Ga0495630_0009413 3300046517 Bacteria 7022
638 Ga0495631_0048057 3300046518 Bacteria 1871
639 Ga0495637_0151124 3300046520 Bacteria 876
640 Ga0495643_0127745 3300046522 Bacteria 1279
641 Ga0495644_0006387 3300046523 Bacteria 4572
642 Ga0495644_0032391 3300046523 Bacteria 1975
643 Ga0495663_0082322 3300046525 Bacteria 1038
644 Ga0495666_0000159 3300046526 Bacteria 28594
645 Ga0495666_0009188 3300046526 Bacteria 4944
646 Ga0495666_0084806 3300046526 Bacteria 1496
647 Ga0495642_0021852 3300046528 Bacteria 2518
648 Ga0495642_0086357 3300046528 Bacteria 1325
649 Ga0495652_0002709 3300046529 Bacteria 17989
650 Ga0495665_0019002 3300046531 Bacteria 3693
651 Ga0495665_0037286 3300046531 Bacteria 2595
652 Ga0495665_0080813 3300046531 Bacteria 1709
653 Ga0495640_0020019 3300046533 Bacteria 4932
654 Ga0495640_0162456 3300046533 Bacteria 1430
655 Ga0495586_0026784 3300046535 Bacteria 3085
656 Ga0495587_0043831 3300046536 Bacteria 2662
657 Ga0495587_0059704 3300046536 Bacteria 2237
658 Ga0495598_0028709 3300046537 Bacteria 1545
659 Ga0495609_0001971 3300046538 Bacteria 13011
660 Ga0495609_0105115 3300046538 Bacteria 1221
661 Ga0495621_0054078 3300046539 Bacteria 1442
662 Ga0495633_0006686 3300046558 Bacteria 6790
663 Ga0495633_0017678 3300046558 Bacteria 3638
664 Ga0495633_0098736 3300046558 Bacteria 1356
665 Ga0495656_0008886 3300046615 Bacteria 3604
666 Ga0495668_0115968 3300046616 Bacteria 1465
667 Ga0495634_0316048 3300046642 Bacteria 941
668 Ga0495611_0140401 3300046648 Bacteria 1128
669 Ga0495625_0013761 3300046660 Bacteria 6486
670 Ga0495635_0029874 3300046663 Bacteria 3789
671 Ga0495635_0274260 3300046663 Bacteria 1134
672 Ga0495661_0004493 3300046665 Bacteria 10061
673 Ga0495588_0000933 3300046674 Bacteria 12731
674 Ga0495588_0046361 3300046674 Bacteria 2229
675 Ga0495588_0205825 3300046674 Bacteria 1039
676 Ga0495623_0003295 3300046679 Bacteria 10663
677 Ga0495646_0227526 3300046680 Bacteria 1006
678 Ga0495647_0149815 3300046681 Bacteria 999
679 Ga0495658_0058013 3300046683 Bacteria 2213
680 Ga0495669_0000018 3300046684 Bacteria 127866
681 Ga0495669_0069607 3300046684 Bacteria 1602
682 Ga0495613_0060530 3300046689 Bacteria 2773
683 Ga0495670_0023688 3300046691 Bacteria 3031
684 Ga0495671_0036034 3300046692 Bacteria 2509
685 Ga0495671_0093075 3300046692 Bacteria 1475
686 Ga0495671_0168151 3300046692 Bacteria 1066
687 Ga0495649_0193717 3300046694 Bacteria 1057
688 Ga0495589_0007201 3300046794 Bacteria 5826
689 Ga0495581_0048068 3300047315 Bacteria 2464
690 Ga0495581_0162002 3300047315 Bacteria 1308
691 Ga0495604_0031555 3300047317 Bacteria 4201
692 Ga0495604_0066625 3300047317 Bacteria 2738
693 Ga0495674_0519816 3300047319 Bacteria 950
694 Ga0495672_0007678 3300047320 Bacteria 8085
695 Ga0495676_0000030 3300047321 Bacteria 133637
696 Ga0495676_0000067 3300047321 Bacteria 80084
697 Ga0495676_0076806 3300047321 Bacteria 2549
698 Ga0495676_0087580 3300047321 Bacteria 2339
699 Ga0495676_0092315 3300047321 Bacteria 2260
700 Ga0495680_0064426 3300047322 Bacteria 2810
701 Ga0495675_0003662 3300047444 Bacteria 9287
702 Ga0495677_0074325 3300047445 Bacteria 1268
703 Ga0495679_003833 3300047446 Bacteria 7116
704 Ga0495673_0011511 3300047469 Bacteria 4752
705 Ga0495673_0033095 3300047469 Bacteria 2403
706 Ga0495684_0159062 3300047471 Bacteria 1686
707 Ga0495593_0008063 3300047673 Bacteria 6126
708 Ga0495602_0052501 3300048088 Bacteria 3620
709 Ga0495614_0003665 3300048089 Bacteria 6890
710 Ga0496101_0064373 3300048904 Bacteria 2670
711 Ga0496101_0148668 3300048904 Bacteria 1790
712 Ga0496102_0003048 3300048905 Bacteria 14194
713 Ga0496102_0043842 3300048905 Bacteria 4057
714 Ga0496102_0056580 3300048905 Bacteria 3578
715 Ga0496103_0032512 3300048906 Bacteria 3184
716 Ga0496103_0150428 3300048906 Bacteria 1491
717 Ga0496104_0000455 3300048907 Bacteria 35340
718 Ga0496104_0003616 3300048907 Bacteria 13355
719 Ga0496104_0004195 3300048907 Bacteria 12515
720 Ga0496104_0006892 3300048907 Bacteria 10020
721 Ga0496104_0012202 3300048907 Bacteria 7720
722 Ga0496104_0104808 3300048907 Bacteria 2710
723 Ga0496104_0473765 3300048907 Bacteria 1163
724 Ga0496105_0000139 3300048908 Bacteria 48427
725 Ga0496105_0015534 3300048908 Bacteria 6069
726 Ga0496105_0023268 3300048908 Bacteria 5023
727 Ga0496105_0048578 3300048908 Bacteria 3503
728 Ga0496106_0001067 3300048909 Bacteria 20209
729 Ga0496106_0002328 3300048909 Bacteria 14165
730 Ga0496106_0026340 3300048909 Bacteria 4329
731 Ga0496107_0006188 3300048910 Bacteria 8223
732 Ga0496107_0132216 3300048910 Bacteria 1842
733 Ga0496108_0001155 3300048911 Bacteria 20587
734 Ga0496108_0015292 3300048911 Bacteria 6261
735 Ga0496108_0198231 3300048911 Bacteria 1742
736 Ga0496109_0003275 3300048912 Bacteria 13514
737 Ga0496109_0036119 3300048912 Bacteria 4459
738 Ga0496109_0089378 3300048912 Bacteria 2847
739 Ga0496110_0008762 3300048913 Bacteria 8150
740 Ga0496110_0013586 3300048913 Bacteria 6739
741 Ga0496110_0683774 3300048913 Bacteria 927
742 Ga0496111_0001646 3300048914 Bacteria 12960
743 Ga0496111_0019436 3300048914 Bacteria 4718
744 Ga0496112_0001735 3300048915 Bacteria 17067
745 Ga0496112_0011228 3300048915 Bacteria 8170
746 Ga0496113_0000957 3300048916 Bacteria 15360
747 Ga0496113_0001913 3300048916 Bacteria 11892
748 Ga0496113_0037725 3300048916 Bacteria 3548
749 Ga0496114_0223059 3300048917 Bacteria 1655
750 Ga0496114_0370064 3300048917 Bacteria 1268
751 Ga0496115_0010390 3300048918 Bacteria 6954
752 Ga0496115_0041924 3300048918 Bacteria 3645
753 Ga0496115_0090521 3300048918 Bacteria 2499
754 Ga0496117_0003342 3300048920 Bacteria 18731
755 Ga0496118_0000401 3300048921 Bacteria 73186
756 Ga0496121_0000473 3300048924 Bacteria 78228
757 Ga0496121_0003466 3300048924 Bacteria 22480
758 Ga0496121_0041790 3300048924 Bacteria 4001
759 Ga0496122_0000134 3300048925 Bacteria 171080
760 Ga0496122_0144164 3300048925 Bacteria 1483
761 Ga0496123_0023694 3300048926 Bacteria 4691
762 Ga0496123_0271138 3300048926 Bacteria 825
763 Ga0496125_0000433 3300048928 Bacteria 76686
764 Ga0501306_018758 3300049127 Bacteria 949
765 Ga0501310_004570 3300049130 Bacteria 1394
766 Ga0501305_013311 3300049161 Bacteria 1136
767 Ga0501312_018699 3300049528 Bacteria 1011
768 Ga0501314_002536 3300049530 Bacteria 1418
769 Ga0501317_003764 3300049533 Bacteria 1536
770 Ga0501318_002010 3300049534 Bacteria 1703
771 Ga0501321_001406 3300049537 Bacteria 1902
772 Ga0501032_0000026 3300049569 Bacteria 136472
773 Ga0501033_0000243 3300049570 Bacteria 52328
774 Ga0501033_0055773 3300049570 Bacteria 2921
775 Ga0501034_0000054 3300049571 Bacteria 206373
776 Ga0501034_0063114 3300049571 Bacteria 3718
777 Ga0501034_0532804 3300049571 Bacteria 1085
778 Ga0501036_0000082 3300049572 Bacteria 58711
779 Ga0501037_0000032 3300049573 Bacteria 132863
780 Ga0501038_0000018 3300049574 Bacteria 155191
781 Ga0501038_0446241 3300049574 Bacteria 995
782 Ga0501039_0000018 3300049575 Bacteria 176187
783 Ga0501043_0000014 3300049579 Bacteria 184687
784 Ga0501047_0004660 3300049581 Bacteria 12902
785 Ga0501047_0249453 3300049581 Bacteria 1624
786 Ga0501047_0294645 3300049581 Bacteria 1466
787 Ga0501067_0084440 3300049583 Bacteria 1761
788 Ga0501067_0100581 3300049583 Bacteria 1606
789 Ga0501068_0146286 3300049584 Bacteria 1483
790 Ga0501069_0057827 3300049585 Bacteria 2162
791 Ga0501070_0006142 3300049586 Bacteria 10241
792 Ga0501070_0048560 3300049586 Bacteria 3525
793 Ga0501073_0000067 3300049589 Bacteria 64981
794 Ga0501074_0013085 3300049590 Bacteria 6031
795 Ga0501076_0435709 3300049592 Bacteria 1079
796 Ga0501202_095239 3300049652 Bacteria 718
797 Ga0501079_0063334 3300049741 Bacteria 2853
798 Ga0501080_0016551 3300049742 Bacteria 6812
799 Ga0501080_0146178 3300049742 Bacteria 2185
800 Ga0501080_0166555 3300049742 Bacteria 2033
801 Ga0501035_0000019 3300049822 Bacteria 241152
802 Ga0501044_0000969 3300049823 Bacteria 34557
803 Ga0501044_0083555 3300049823 Bacteria 3229
804 Ga0501044_0086056 3300049823 Bacteria 3176
805 Ga0501044_0099629 3300049823 Bacteria 2924
806 Ga0501044_0311371 3300049823 Bacteria 1501
807 Ga0501044_0477679 3300049823 Bacteria 1150
808 Ga0501045_0274181 3300049824 Bacteria 1256
809 nmdc:mga0yw44_73973_c1 3300050492 Bacteria 2121
810 nmdc:mga0k408_4176_c1 3300050493 Bacteria 7666
811 nmdc:mga05p37_19291_c1 3300050507 Bacteria 8247
812 nmdc:mga05p37_33296_c1 3300050507 Bacteria 6311
813 nmdc:mga08y16_194610_c1 3300050511 Bacteria 2102
814 nmdc:mga08y16_29822_c1 3300050511 Bacteria 5744
815 nmdc:mga0n895_101235_c1 3300050512 Bacteria 2891
816 nmdc:mga0n895_130655_c1 3300050512 Bacteria 2536
817 nmdc:mga0n895_322418_c1 3300050512 Bacteria 1566
818 nmdc:mga0a205_309367_c1 3300050515 Bacteria 1452
819 Ga0495612_0030611 3300053078 Bacteria 2168
820 Ga0495655_0023600 3300053083 Bacteria 1420
821 Ga0495619_0284028 3300053085 Bacteria 1147
822 Ga0500572_000274 3300053111 Bacteria 18700
823 Ga0500559_0000053 3300053136 Bacteria 90779
824 Ga0500568_0009740 3300053139 Bacteria 4548
825 Ga0500611_002322 3300053727 Bacteria 2257
826 Ga0501082_0017352 3300060353 Bacteria 6201
827 Ga0466962_0001020 3300061719 Bacteria 12802
828 2511250682 2511231003 Bacteria 5606035
829 2511383288 2511231026 Bacteria 5225445
830 2515689302 2515154123 Bacteria 6387382
831 2521558520 2521172590 Bacteria 5047645
832 2524438228 2524023205 Bacteria 8918781
833 2550694049 2548876994 Bacteria 4904866
834 2553004147 2551306416 Bacteria 6152985
835 2596375629 2595698237 Bacteria 6712432
836 2599446307 2599185178 Bacteria 5365746
837 2643754563 2643221547 Bacteria 4740017
838 2723875956 2721755763 Bacteria 4464185
839 2728751850 2728368998 Bacteria 8720350
840 2765569625 2765235838 Bacteria 5445269
841 2793062817 2791355196 Bacteria 7323613
842 2808981982 2808606386 Bacteria 4471946
843 2809131605 2808606415 Bacteria 4576710
844 2809151227 2808606419 Bacteria 4576925
845 2819591843 2818991445 Bacteria 4955017
846 2819614258 2818991449 Bacteria 5518009
847 2819718076 2818991467 Bacteria 5893227
848 2839097456 2839094727 Bacteria 5534556
849 2842340282 2842333319 Bacteria 8899485
850 2852622491 2852618963 Bacteria 4577824
851 2854684968 2854681122 Bacteria 4548679
852 2854896847 2854896431 Bacteria 5869725
853 2884816766 2884811622 Bacteria 5552861
854 2884837649 2884836552 Bacteria 5219991
855 2884853940 2884852848 Bacteria 5221161
856 2889307414 2889306138 Bacteria 6358934
857 2889309490 2889306138 Bacteria 6358934
858 2894235853 2894232714 Bacteria 8834183
859 2896154943 2896154374 Bacteria 5221518
860 2902332679 2902330777 Bacteria 6395352
861 2902408737 2902405164 Bacteria 6784948
862 2904429901 2904424332 Bacteria 7633521
863 2904445196 2904439833 Bacteria 5931679
864 2904534218 2904530477 Bacteria 5876334
865 2904588941 2904584206 Bacteria 6028872
866 2904590578 2904589729 Bacteria 6113573
867 2904603552 2904601388 Bacteria 5884906
868 2917700468 2917699015 Bacteria 7043791
869 2919046945 2919046199 Bacteria 5567169
870 2919080440 2919079590 Bacteria 5946433
871 2923511984 2923510766 Bacteria 5926163
872 2928130179 2928125067 Bacteria 5937560
873 2928131705 2928130867 Bacteria 5467269
874 643597835 643348564 Bacteria 8839022
875 8045864746 8045864390 Bacteria 5043873
876 8054566056 8054563764 Bacteria 5592885
877 8055228679 8055225921 Bacteria 3341787
878 Ga0068853_100623260
879 JGI24743J22301_10005709
880 JGI24034J26672_10009435
881 JGI24742J22300_10006380
882 JGI25155J39150_1000076
883 JGI25155J39150_1000567
884 JGI25156J39149_1000032
885 JGI25156J39149_1002064
886 JGI25156J39149_1003734
887 JGI25162J39368_1004764
888 JGI25154J39366_1000095
889 JGI25154J39366_1000223
890 JGI25157J39369_1000388
891 JGI25159J45721_1004525
892 JGI25151J46595_10000079
893 Ga0055538_1000002
894 Ga0055539_1000002
895 Ga0055533_1000004
896 Ga0055532_1000083
897 Ga0055525_1000002
898 Ga0055535_1012982
899 Ga0055526_1000718
900 Ga0055524_1000147
901 Ga0055524_1005161
902 Ga0055541_1000002
903 Ga0065165_1000306
904 Ga0065712_10086790
905 Ga0070658_10018562
906 Ga0070658_10034943
907 Ga0070658_10112763
908 Ga0070658_10250922
909 Ga0070676_10031151
910 Ga0070683_100352660
911 Ga0070690_100020880
912 Ga0070690_100082456
913 Ga0070670_100012362
914 Ga0070670_100069368
915 Ga0070670_100201684
916 Ga0070670_100264755
917 Ga0068869_100071537
918 Ga0068869_100076940
919 Ga0068869_100089529
920 Ga0070666_10055078
921 Ga0070666_10209223
922 Ga0070680_100001454
923 Ga0070680_100002828
924 Ga0070682_100037646
925 Ga0068868_100043322
926 Ga0070660_100000414
927 Ga0070660_100007676
928 Ga0070660_100025623
929 Ga0070660_100029654
930 Ga0070660_100043495
931 Ga0070660_100084771
932 Ga0070660_100108342
933 Ga0070660_100293491
934 Ga0070689_100019359
935 Ga0070689_100126351
936 Ga0070689_100219097
937 Ga0070691_10002244
938 Ga0070691_10042038
939 Ga0070687_100121609
940 Ga0070661_100001393
941 Ga0070661_100228154
942 Ga0070692_10033004
943 Ga0070668_100399072
944 Ga0070669_100013267
945 Ga0070669_100277956
946 Ga0070675_100000047
947 Ga0070675_100003166
948 Ga0070675_100003200
949 Ga0070675_100016822
950 Ga0070675_100039428
951 Ga0070675_100221126
952 Ga0070671_100003924
953 Ga0070671_100028246
954 Ga0070671_100060943
955 Ga0070673_100002755
956 Ga0070673_100009518
957 Ga0070688_100008728
958 Ga0070688_100283604
959 Ga0070688_100284513
960 Ga0070659_100000526
961 Ga0070659_100018531
962 Ga0070659_100041122
963 Ga0070659_100109435
964 Ga0070659_100117968
965 Ga0070667_100123125
966 Ga0070703_10002040
967 Ga0070714_100011555
968 Ga0070713_100006994
969 Ga0070713_100197303
970 Ga0070710_10152324
971 Ga0070701_10002126
972 Ga0070701_10071198
973 Ga0070711_100113147
974 Ga0070705_100000070
975 Ga0070700_100001054
976 Ga0070700_100033455
977 Ga0070694_100001284
978 Ga0070708_100211552
979 Ga0070663_100002090
980 Ga0070663_100003639
981 Ga0070662_100000260
982 Ga0070681_10005497
983 Ga0070681_10092407
984 Ga0070681_10287940
985 Ga0068867_100045778
986 Ga0068867_100528315
987 Ga0070698_100174104
988 Ga0070699_100002047
989 Ga0070679_100011047
990 Ga0070679_100025904
991 Ga0070679_100057189
992 Ga0070679_100062826
993 Ga0070679_100096263
994 Ga0070679_100421749
995 Ga0070684_100088797
996 Ga0070684_100156418
997 Ga0068853_100001673
998 Ga0068853_100055480
999 Ga0068853_100071638
1000 Ga0068853_100211279
1001 Ga0070672_100016809
1002 Ga0070672_100038229
1003 Ga0070686_100032215
1004 Ga0070686_100051768
1005 Ga0070686_100142483
1006 Ga0070695_100000961
1007 Ga0070695_100245482
1008 Ga0070696_100000787
1009 Ga0070696_100003444
1010 Ga0070693_100150948
1011 Ga0070665_100077618
1012 Ga0070665_100125115
1013 Ga0070665_100173026
1014 Ga0070704_100001472
1015 Ga0070704_100019492
1016 Ga0070704_100120867
1017 Ga0068855_100000055
1018 Ga0068855_100000110
1019 Ga0068855_100007699
1020 Ga0068855_100025547
1021 Ga0068855_100093172
1022 Ga0068855_100149825
1023 Ga0068855_100190252
1024 Ga0068855_100260802
1025 Ga0068855_100316770
1026 Ga0068855_100411777
1027 Ga0070664_100000378
1028 Ga0070664_100010769
1029 Ga0070664_100055996
1030 Ga0070664_100077109
1031 Ga0070664_100210121
1032 Ga0070664_100243081
1033 Ga0070664_100268732
1034 Ga0068857_100040684
1035 Ga0068857_100140746
1036 Ga0068857_100244042
1037 Ga0068857_100402341
1038 Ga0068854_100008843
1039 Ga0068854_100017510
1040 Ga0068854_100129464
1041 Ga0068856_100000111
1042 Ga0068856_100014426
1043 Ga0068856_100028653
1044 Ga0068856_100651604
1045 Ga0070702_100111537
1046 Ga0068852_100003379
1047 Ga0068852_100349420
1048 Ga0068852_100424630
1049 Ga0068859_100000540
1050 Ga0068859_100006985
1051 Ga0068859_100020770
1052 Ga0068859_100090120
1053 Ga0068864_100094812
1054 Ga0068851_10072499
1055 Ga0068851_10168028
1056 Ga0068851_10233951
1057 Ga0068870_10016704
1058 Ga0068863_100000482
1059 Ga0068863_100046317
1060 Ga0068863_100143017
1061 Ga0068858_100072148
1062 Ga0068858_100585377
1063 Ga0068860_100002026
1064 Ga0068860_100004449
1065 Ga0068860_100104218
1066 Ga0068862_100001012
1067 Ga0081455_10115957
1068 Ga0081539_10019491
1069 Ga0075365_10007935
1070 Ga0075365_10094270
1071 Ga0075363_100097150
1072 Ga0075367_10146917
1073 Ga0075369_10007679
1074 Ga0097621_100001740
1075 Ga0097621_100122580
1076 Ga0068871_100036976
1077 Ga0068871_100070256
1078 Ga0075434_100087811
1079 Ga0075434_100191262
1080 Ga0097620_100000540
1081 Ga0097620_100006985
1082 Ga0097620_100020770
1083 Ga0097620_100090121
1084 Ga0099825_1042400
1085 Ga0099824_1018508
1086 Ga0099822_1006503
1087 Ga0079104_1004906
1088 Ga0075435_100025364
1089 Ga0105251_10083050
1090 Ga0105240_10007018
1091 Ga0105240_10007251
1092 Ga0105240_10008689
1093 Ga0105240_10014573
1094 Ga0105240_10027626
1095 Ga0105240_10192764
1096 Ga0105240_10365685
1097 Ga0105240_10483225
1098 Ga0111539_10011976
1099 Ga0111539_10022710
1100 Ga0111539_10128782
1101 Ga0111539_10144393
1102 Ga0105245_10335375
1103 Ga0105247_10087642
1104 Ga0114129_10205160
1105 Ga0114129_10391670
1106 Ga0105243_10019973
1107 Ga0105241_10005236
1108 Ga0105242_10037406
1109 Ga0105242_10417449
1110 Ga0105248_10028635
1111 Ga0105248_10123691
1112 Ga0105248_10135888
1113 Ga0105248_10145682
1114 Ga0105248_10161752
1115 Ga0105248_10255890
1116 Ga0105248_10549831
1117 Ga0105237_10051247
1118 Ga0105237_10102457
1119 Ga0105237_10281050
1120 Ga0105237_10289384
1121 Ga0105238_10001827
1122 Ga0105238_10044711
1123 Ga0105238_10070544
1124 Ga0105249_10150379
1125 Ga0105239_10163183
1126 Ga0105239_10259904
1127 Ga0105246_10067320
1128 Ga0157371_10000248
1129 Ga0157371_10226485
1130 Ga0157370_10004460
1131 Ga0157370_10006449
1132 Ga0157370_10011079
1133 Ga0157370_10046276
1134 Ga0157370_10056647
1135 Ga0157370_10065888
1136 Ga0157370_10087663
1137 Ga0157370_10103781
1138 Ga0157370_10301095
1139 Ga0157369_10002981
1140 Ga0157369_10009381
1141 Ga0157369_10526916
1142 Ga0157369_10582756
1143 Ga0171462_1033
1144 Ga0157374_10079283
1145 Ga0157374_10114698
1146 Ga0157378_10254433
1147 Ga0163162_10003469
1148 Ga0157372_10000468
1149 Ga0157372_10072433
1150 Ga0157372_10081535
1151 Ga0157372_10164788
1152 Ga0157372_10250568
1153 Ga0157372_10342671
1154 Ga0157372_10426810
1155 Ga0157372_10539410
1156 Ga0157375_10001118
1157 Ga0157375_10058966
1158 Ga0163163_10006158
1159 Ga0163163_10134066
1160 Ga0163163_10292736
1161 Ga0163163_10294975
1162 Ga0163163_10311496
1163 Ga0157380_10053274
1164 Ga0157377_10025992
1165 Ga0157377_10316143
1166 Ga0157379_10000226
1167 Ga0157379_10143572
1168 Ga0182006_1000685
1169 Ga0182007_10038195
1170 Ga0163161_10036130
1171 Ga0163161_10069471
1172 Ga0206353_10103469
1173 Ga0213872_10005720
1174 Ga0213876_10046609
1175 Ga0213875_10016710
1176 Ga0213875_10082261
1177 Ga0213875_10096126
1178 Ga0213875_10100885
1179 Ga0209435_100013
1180 Ga0209435_100379
1181 Ga0209784_100002
1182 Ga0209566_100003
1183 Ga0209674_100004
1184 Ga0209147_100030
1185 Ga0209563_100006
1186 Ga0209437_100419
1187 Ga0209258_100433
1188 Ga0209646_1000021
1189 Ga0209646_1000034
1190 Ga0209026_1000022
1191 Ga0209026_1001565
1192 Ga0209677_100003
1193 Ga0209759_1000018
1194 Ga0209759_1000100
1195 Ga0209233_1034338
1196 Ga0209673_1017561
1197 Ga0209130_1000111
1198 Ga0207673_1000127
1199 Ga0209675_1001117
1200 Ga0209025_1000014
1201 Ga0209025_1001499
1202 Ga0209564_1000179
1203 Ga0209256_1000055
1204 Ga0209256_1000102
1205 Ga0209256_1033389
1206 Ga0207697_10017438
1207 Ga0207656_10026268
1208 Ga0207656_10026269
1209 Ga0207656_10111912
1210 Ga0207682_10009230
1211 Ga0207692_10251953
1212 Ga0207710_10048570
1213 Ga0207688_10002018
1214 Ga0207680_10044443
1215 Ga0207647_10018756
1216 Ga0207647_10021879
1217 Ga0207647_10093776
1218 Ga0207647_10179160
1219 Ga0207699_10168463
1220 Ga0207645_10014390
1221 Ga0207645_10080323
1222 Ga0207643_10005305
1223 Ga0207705_10007617
1224 Ga0207705_10037355
1225 Ga0207705_10067806
1226 Ga0207705_10192267
1227 Ga0207654_10004070
1228 Ga0207654_10026836
1229 Ga0207707_10030136
1230 Ga0207707_10077177
1231 Ga0207707_10084215
1232 Ga0207707_10176638
1233 Ga0207695_10000896
1234 Ga0207695_10009589
1235 Ga0207695_10029551
1236 Ga0207695_10055460
1237 Ga0207695_10105955
1238 Ga0207695_10171105
1239 Ga0207695_10308035
1240 Ga0207671_10215167
1241 Ga0207671_10313599
1242 Ga0207660_10025362
1243 Ga0207660_10025923
1244 Ga0207660_10083052
1245 Ga0207660_10133347
1246 Ga0207662_10076289
1247 Ga0207657_10000894
1248 Ga0207657_10000910
1249 Ga0207657_10010420
1250 Ga0207657_10012583
1251 Ga0207657_10032705
1252 Ga0207657_10094060
1253 Ga0207657_10104907
1254 Ga0207657_10147206
1255 Ga0207649_10008175
1256 Ga0207649_10015173
1257 Ga0207649_10217186
1258 Ga0207652_10007193
1259 Ga0207652_10028301
1260 Ga0207652_10048462
1261 Ga0207652_10051659
1262 Ga0207652_10244174
1263 Ga0207681_10169790
1264 Ga0207694_10003746
1265 Ga0207694_10100452
1266 Ga0207694_10153090
1267 Ga0207694_10320744
1268 Ga0207650_10004859
1269 Ga0207650_10007669
1270 Ga0207650_10050178
1271 Ga0207659_10014380
1272 Ga0207659_10014390
1273 Ga0207659_10026030
1274 Ga0207659_10027271
1275 Ga0207659_10106897
1276 Ga0207659_10159237
1277 Ga0207700_10035789
1278 Ga0207700_10170377
1279 Ga0207664_10006045
1280 Ga0207644_10019042
1281 Ga0207690_10000194
1282 Ga0207690_10063622
1283 Ga0207690_10151633
1284 Ga0207690_10224436
1285 Ga0207706_10000008
1286 Ga0207706_10002914
1287 Ga0207686_10038644
1288 Ga0207686_10478190
1289 Ga0207709_10042244
1290 Ga0207670_10039589
1291 Ga0207670_10100957
1292 Ga0207669_10077183
1293 Ga0207669_10212045
1294 Ga0207691_10016366
1295 Ga0207691_10033742
1296 Ga0207691_10061595
1297 Ga0207711_10003837
1298 Ga0207711_10083534
1299 Ga0207711_10224911
1300 Ga0207689_10028886
1301 Ga0207689_10250682
1302 Ga0207661_10026953
1303 Ga0207679_10000934
1304 Ga0207679_10027208
1305 Ga0207679_10040686
1306 Ga0207679_10133355
1307 Ga0207679_10179854
1308 Ga0207679_10183517
1309 Ga0207667_10000032
1310 Ga0207667_10001326
1311 Ga0207667_10008233
1312 Ga0207667_10013259
1313 Ga0207667_10025214
1314 Ga0207667_10033295
1315 Ga0207667_10068397
1316 Ga0207667_10273652
1317 Ga0207667_10310771
1318 Ga0207667_10554070
1319 Ga0207651_10003519
1320 Ga0207651_10021459
1321 Ga0207651_10056016
1322 Ga0207651_10381021
1323 Ga0207712_10014486
1324 Ga0207712_10313431
1325 Ga0207712_10471852
1326 Ga0207640_10004677
1327 Ga0207640_10012816
1328 Ga0207640_10140103
1329 Ga0207640_10363612
1330 Ga0207658_10054168
1331 Ga0207658_10056134
1332 Ga0207677_10335920
1333 Ga0207703_10061310
1334 Ga0207639_10002823
1335 Ga0207639_10041392
1336 Ga0207639_10043729
1337 Ga0207639_10144336
1338 Ga0207639_10399999
1339 Ga0207678_10008479
1340 Ga0207678_10009793
1341 Ga0207678_10013310
1342 Ga0207678_10603928
1343 Ga0207708_10000440
1344 Ga0207708_10046499
1345 Ga0207708_10302454
1346 Ga0207702_10000510
1347 Ga0207702_10034707
1348 Ga0207641_10002558
1349 Ga0207641_10417469
1350 Ga0207648_10016548
1351 Ga0207648_10127558
1352 Ga0207676_10050123
1353 Ga0207676_10057721
1354 Ga0207674_10000709
1355 Ga0207674_10031602
1356 Ga0207674_10037960
1357 Ga0207674_10124228
1358 Ga0207674_10128967
1359 Ga0207674_10366378
1360 Ga0207674_10473279
1361 Ga0207675_100011223
1362 Ga0207675_100059656
1363 Ga0207683_10211816
1364 Ga0207698_10017290
1365 Ga0209589_1000276
1366 Ga0209489_100714
1367 Ga0209700_100732
1368 Ga0209983_1010276
1369 Ga0209971_1004023
1370 Ga0209971_1014099
1371 Ga0209974_10000194
1372 Ga0209974_10001758
1373 Ga0207428_10060550
1374 Ga0207428_10189003
1375 Ga0268266_10127191
1376 Ga0268266_10571213
1377 Ga0268265_10014552
1378 Ga0268265_10443594
1379 Ga0268264_10002236
1380 Ga0268264_10019143
1381 Ga0268264_10025590
1382 Ga0268264_10511906
1383 Ga0265337_1016644
1384 Ga0265760_10050084
1385 Ga0265330_10070485
1386 Ga0265332_10001524
1387 Ga0265328_10004422
1388 Ga0265325_10000406
1389 Ga0265329_10008728
1390 Ga0265340_10003673
1391 Ga0265339_10020973
1392 Ga0265327_10026872
1393 Ga0265316_10014787
1394 Ga0265316_10081573
1395 Ga0307513_10129248
1396 Ga0307408_100068146
1397 Ga0307408_100427436
1398 Ga0265313_10001452
1399 Ga0265314_10000523
1400 Ga0307405_10043573
1401 Ga0307405_10092697
1402 Ga0307410_10005780
1403 Ga0307406_10203757
1404 Ga0307407_10006689
1405 Ga0307409_100176336
1406 Ga0307416_100018117
1407 Ga0307416_100399303
1408 Ga0307415_100022830
1409 Ga0373926_0007792
1410 Ga0373944_0004353
1411 Ga0373923_0064730
1412 Ga0373936_0029866
1413 Ga0373945_0061322
1414 Ga0373953_0030840
1415 Ga0373953_0129156
1416 Ga0373943_0034956
1417 Ga0373943_0136844
1418 Ga0373946_0030549
1419 Ga0373946_0072146
1420 Ga0373946_0182228
1421 Ga0373955_0080851
1422 Ga0373955_0298499
1423 Ga0373924_0132299
1424 Ga0373931_0163058
1425 Ga0373935_0149940
1426 Ga0373935_0205045
1427 Ga0373927_0113068
1428 Ga0373927_0178399
1429 Ga0373947_0018501
1430 Ga0373947_0062207
1431 Ga0373947_0143388
1432 Ga0373937_0061179
1433 Ga0373937_0100529
1434 Ga0373937_0111265
1435 Ga0373925_0178582
1436 Ga0373925_0565691
1437 Ga0395899_0005348
1438 Ga0395899_0028642
1439 Ga0395900_0028376
1440 Ga0395900_0163032
1441 Ga0395898_0078503
1442 Ga0395898_0094384
1443 Ga0395905_0000772
1444 Ga0395905_0008320
1445 Ga0395905_0038129
1446 Ga0395905_0125531
1447 Ga0395905_0143222
1448 Ga0395905_0155175
1449 Ga0436364_0687681
1450 Ga0436364_0920462
1451 Ga0436364_1333790
1452 Ga0436364_1400673
1453 Ga0436364_1422510
1454 Ga0395901_0294571
1455 Ga0395901_0544803
1456 Ga0237816_00954
1457 Ga0436365_0849376
1458 Ga0436361_0564858
1459 Ga0436362_0744013
1460 Ga0451577_0040855
1461 Ga0451577_0064559
1462 Ga0451577_0205723
1463 Ga0466977_0000316
1464 Ga0453683_0000320
1465 Ga0453683_0002549
1466 Ga0466965_0152188
1467 Ga0466966_0070088
1468 Ga0466961_0023848
1469 Ga0466963_0057383
1470 Ga0466971_0034830
1471 Ga0466968_0005636
1472 Ga0466957_0047812
1473 Ga0466957_0299248
1474 Ga0466960_0052819
1475 Ga0466959_0032646
1476 Ga0451576_0039095
1477 Ga0451576_0233031
1478 Ga0466958_0117689
1479 Ga0466958_0236603
1480 Ga0466967_0012482
1481 Ga0495617_047571
1482 Ga0495592_0034788
1483 Ga0495603_0050030
1484 Ga0495591_074153
1485 Ga0495629_0024397
1486 Ga0495641_0082890
1487 Ga0495651_0002400
1488 Ga0495651_0039803
1489 Ga0495653_0000318
1490 Ga0495653_0046673
1491 Ga0495580_0041235
1492 Ga0495582_0011135
1493 Ga0495582_0011243
1494 Ga0495582_0027403
1495 Ga0495605_0055602
1496 Ga0495639_0055112
1497 Ga0495662_0004187
1498 Ga0495584_0149039
1499 Ga0495585_0020745
1500 Ga0495585_0065485
1501 Ga0495594_0006629
1502 Ga0495594_0164357
1503 Ga0495596_0001312
1504 Ga0495596_0031197
1505 Ga0495607_0039727
1506 Ga0495607_0052553
1507 Ga0495606_0000901
1508 Ga0495608_0001403
1509 Ga0495608_0030373
1510 Ga0495610_0016384
1511 Ga0495616_0008842
1512 Ga0495618_0005557
1513 Ga0495628_0000474
1514 Ga0495630_0009413
1515 Ga0495631_0048057
1516 Ga0495637_0151124
1517 Ga0495643_0127745
1518 Ga0495644_0006387
1519 Ga0495644_0032391
1520 Ga0495663_0082322
1521 Ga0495666_0000159
1522 Ga0495666_0009188
1523 Ga0495666_0084806
1524 Ga0495642_0021852
1525 Ga0495642_0086357
1526 Ga0495652_0002709
1527 Ga0495665_0019002
1528 Ga0495665_0037286
1529 Ga0495665_0080813
1530 Ga0495640_0020019
1531 Ga0495640_0162456
1532 Ga0495586_0026784
1533 Ga0495587_0043831
1534 Ga0495587_0059704
1535 Ga0495598_0028709
1536 Ga0495609_0001971
1537 Ga0495609_0105115
1538 Ga0495621_0054078
1539 Ga0495633_0006686
1540 Ga0495633_0017678
1541 Ga0495633_0098736
1542 Ga0495656_0008886
1543 Ga0495668_0115968
1544 Ga0495634_0316048
1545 Ga0495611_0140401
1546 Ga0495625_0013761
1547 Ga0495635_0029874
1548 Ga0495635_0274260
1549 Ga0495661_0004493
1550 Ga0495588_0000933
1551 Ga0495588_0046361
1552 Ga0495588_0205825
1553 Ga0495623_0003295
1554 Ga0495646_0227526
1555 Ga0495647_0149815
1556 Ga0495658_0058013
1557 Ga0495669_0000018
1558 Ga0495669_0069607
1559 Ga0495613_0060530
1560 Ga0495670_0023688
1561 Ga0495671_0036034
1562 Ga0495671_0093075
1563 Ga0495671_0168151
1564 Ga0495649_0193717
1565 Ga0495589_0007201
1566 Ga0495581_0048068
1567 Ga0495581_0162002
1568 Ga0495604_0031555
1569 Ga0495604_0066625
1570 Ga0495674_0519816
1571 Ga0495672_0007678
1572 Ga0495676_0000030
1573 Ga0495676_0000067
1574 Ga0495676_0076806
1575 Ga0495676_0087580
1576 Ga0495676_0092315
1577 Ga0495680_0064426
1578 Ga0495675_0003662
1579 Ga0495677_0074325
1580 Ga0495679_003833
1581 Ga0495673_0011511
1582 Ga0495673_0033095
1583 Ga0495684_0159062
1584 Ga0495593_0008063
1585 Ga0495602_0052501
1586 Ga0495614_0003665
1587 Ga0496101_0064373
1588 Ga0496101_0148668
1589 Ga0496102_0003048
1590 Ga0496102_0043842
1591 Ga0496102_0056580
1592 Ga0496103_0032512
1593 Ga0496103_0150428
1594 Ga0496104_0000455
1595 Ga0496104_0003616
1596 Ga0496104_0004195
1597 Ga0496104_0006892
1598 Ga0496104_0012202
1599 Ga0496104_0104808
1600 Ga0496104_0473765
1601 Ga0496105_0000139
1602 Ga0496105_0015534
1603 Ga0496105_0023268
1604 Ga0496105_0048578
1605 Ga0496106_0001067
1606 Ga0496106_0002328
1607 Ga0496106_0026340
1608 Ga0496107_0006188
1609 Ga0496107_0132216
1610 Ga0496108_0001155
1611 Ga0496108_0015292
1612 Ga0496108_0198231
1613 Ga0496109_0003275
1614 Ga0496109_0036119
1615 Ga0496109_0089378
1616 Ga0496110_0008762
1617 Ga0496110_0013586
1618 Ga0496110_0683774
1619 Ga0496111_0001646
1620 Ga0496111_0019436
1621 Ga0496112_0001735
1622 Ga0496112_0011228
1623 Ga0496113_0000957
1624 Ga0496113_0001913
1625 Ga0496113_0037725
1626 Ga0496114_0223059
1627 Ga0496114_0370064
1628 Ga0496115_0010390
1629 Ga0496115_0041924
1630 Ga0496115_0090521
1631 Ga0496117_0003342
1632 Ga0496118_0000401
1633 Ga0496121_0000473
1634 Ga0496121_0003466
1635 Ga0496121_0041790
1636 Ga0496122_0000134
1637 Ga0496122_0144164
1638 Ga0496123_0023694
1639 Ga0496123_0271138
1640 Ga0496125_0000433
1641 Ga0501306_018758
1642 Ga0501310_004570
1643 Ga0501305_013311
1644 Ga0501312_018699
1645 Ga0501314_002536
1646 Ga0501317_003764
1647 Ga0501318_002010
1648 Ga0501321_001406
1649 Ga0501032_0000026
1650 Ga0501033_0000243
1651 Ga0501033_0055773
1652 Ga0501034_0000054
1653 Ga0501034_0063114
1654 Ga0501034_0532804
1655 Ga0501036_0000082
1656 Ga0501037_0000032
1657 Ga0501038_0000018
1658 Ga0501038_0446241
1659 Ga0501039_0000018
1660 Ga0501043_0000014
1661 Ga0501047_0004660
1662 Ga0501047_0249453
1663 Ga0501047_0294645
1664 Ga0501067_0084440
1665 Ga0501067_0100581
1666 Ga0501068_0146286
1667 Ga0501069_0057827
1668 Ga0501070_0006142
1669 Ga0501070_0048560
1670 Ga0501073_0000067
1671 Ga0501074_0013085
1672 Ga0501076_0435709
1673 Ga0501202_095239
1674 Ga0501079_0063334
1675 Ga0501080_0016551
1676 Ga0501080_0146178
1677 Ga0501080_0166555
1678 Ga0501035_0000019
1679 Ga0501044_0000969
1680 Ga0501044_0083555
1681 Ga0501044_0086056
1682 Ga0501044_0099629
1683 Ga0501044_0311371
1684 Ga0501044_0477679
1685 Ga0501045_0274181
1686 nmdc:mga0yw44_73973_c1
1687 nmdc:mga0k408_4176_c1
1688 nmdc:mga05p37_19291_c1
1689 nmdc:mga05p37_33296_c1
1690 nmdc:mga08y16_194610_c1
1691 nmdc:mga08y16_29822_c1
1692 nmdc:mga0n895_101235_c1
1693 nmdc:mga0n895_130655_c1
1694 nmdc:mga0n895_322418_c1
1695 nmdc:mga0a205_309367_c1
1696 Ga0495612_0030611
1697 Ga0495655_0023600
1698 Ga0495619_0284028
1699 Ga0500572_000274
1700 Ga0500559_0000053
1701 Ga0500568_0009740
1702 Ga0500611_002322
1703 Ga0501082_0017352
1704 Ga0466962_0001020
1705 2511250682
1706 2511383288
1707 2515689302
1708 2521558520
1709 2524438228
1710 2550694049
1711 2553004147
1712 2596375629
1713 2599446307
1714 2643754563
1715 2723875956
1716 2728751850
1717 2765569625
1718 2793062817
1719 2808981982
1720 2809131605
1721 2809151227
1722 2819591843
1723 2819614258
1724 2819718076
1725 2839097456
1726 2842340282
1727 2852622491
1728 2854684968
1729 2854896847
1730 2884816766
1731 2884837649
1732 2884853940
1733 2889307414
1734 2889309490
1735 2894235853
1736 2896154943
1737 2902332679
1738 2902408737
1739 2904429901
1740 2904445196
1741 2904534218
1742 2904588941
1743 2904590578
1744 2904603552
1745 2917700468
1746 2919046945
1747 2919080440
1748 2923511984
1749 2928130179
1750 2928131705
1751 643597835
1752 8045864746
1753 8054566056
1754 8055228679

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

51

190

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.933 11 229
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9164 11 229
1z47-assembly1.cif.gz_B-2 structure of the atpase subunit cysa of the putative sulfate atp-binding cassette (abc) transporter from alicyclobacillus acidocaldarius 0.916 11 230
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9157 11 229
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9152 11 238
ID Description Score Start End Superfamily
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9693 11 232 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9359 9 229 3.40.50.300
af_P77737_9_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9283 8 216 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9235 9 229 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9197 10 254 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7C7UW92-F1-model_v4 ABC transporter ATP-binding protein 0.9655 8 211 GO:0005524
GO:0005886
GO:0016887
AF-A0A7C0XLY7-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9645 85 229 GO:0005524
GO:0016887
GO:0022857
GO:0043190
AF-A0A7C7UW92-F1-model_v4 ABC transporter ATP-binding protein 0.9609 8 211 GO:0005524
GO:0005886
GO:0016887
AF-A0A7W0CI05-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system ATPase subunit 0.9536 7 254 GO:0005524
GO:0016887
AF-A0A2S5T3T1-F1-model_v4 NitT/TauT family transport system ATP-binding protein (Sulfonate ABC transporter ATP-binding protein) 0.9452 1 253 GO:0005524
GO:0005886
GO:0016887

Map