F484383
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 877 | 474 | 1754 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100623260|Ga0068853_1006232601 |
| Length | 284 |
| Sequence | MAVHEEYAMLSKLQVVSTPSPSPAQVLQQPLLQVAGVTLQYKTAEYLVTATSQVTFDIHAGDRFVLLGPSGCGKSTLLKAIAGFIKPVEGKITLRDREIDAPGPDRMMVFQEFDQLLPWKTVRQNIELPLKLNKRADISRSASEIIERVGLTKFADSYPHMLSGGMKQRVAIARSMAMKPDVLLMDEPYAALDALTRRKMQQELLQLWDKTRFTLIFVTHSIEEAVLIGSRILVLSPHPGRVRAELNAHAFGPESLGGSEFQGLCKKINDMLFEHEATGKGTCA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 98 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 99 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 100 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 137 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 230 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 232 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 237 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 246 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 247 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 260 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 263 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 267 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 268 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 272 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 273 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 274 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 275 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 276 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 277 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 278 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 279 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 280 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 281 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 282 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 283 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 362 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 363 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 364 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 365 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 366 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 367 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 370 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 371 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 372 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 373 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 374 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 375 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 376 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 377 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 378 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 379 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 380 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 381 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 406 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 412 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 413 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 421 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 422 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 424 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 426 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 427 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 428 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 429 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 430 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 431 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 432 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 433 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 434 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 435 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 436 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 437 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 438 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 439 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 440 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 441 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 442 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 443 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 444 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 445 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 446 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 447 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 448 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 449 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 450 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 451 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 452 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 453 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 454 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 455 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 456 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 457 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 458 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 459 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 460 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 461 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 462 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 463 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 464 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 465 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 466 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 467 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 468 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 469 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 470 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 471 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 472 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 473 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 474 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.16 |
| Metatranscriptomes | 1.14 |
| Isolates | 5.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.9 |
| Nodule | 1.94 |
| Rhizoplane | 5.13 |
| Rhizosphere | 80.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068853_100623260 | 3300005539 | Bacteria | 1025 |
| 2 | JGI24743J22301_10005709 | 3300001991 | Bacteria | 2088 |
| 3 | JGI24034J26672_10009435 | 3300002239 | Bacteria | 1440 |
| 4 | JGI24742J22300_10006380 | 3300002244 | Bacteria | 1949 |
| 5 | JGI25155J39150_1000076 | 3300002704 | Bacteria | 59158 |
| 6 | JGI25155J39150_1000567 | 3300002704 | Bacteria | 8291 |
| 7 | JGI25156J39149_1000032 | 3300002705 | Bacteria | 118609 |
| 8 | JGI25156J39149_1002064 | 3300002705 | Bacteria | 7631 |
| 9 | JGI25156J39149_1003734 | 3300002705 | Bacteria | 4872 |
| 10 | JGI25162J39368_1004764 | 3300002737 | Bacteria | 2980 |
| 11 | JGI25154J39366_1000095 | 3300002738 | Bacteria | 79187 |
| 12 | JGI25154J39366_1000223 | 3300002738 | Bacteria | 38684 |
| 13 | JGI25157J39369_1000388 | 3300002741 | Bacteria | 30373 |
| 14 | JGI25159J45721_1004525 | 3300002987 | Bacteria | 4594 |
| 15 | JGI25151J46595_10000079 | 3300003187 | Bacteria | 132415 |
| 16 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 17 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 18 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 19 | Ga0055532_1000083 | 3300003758 | Bacteria | 118609 |
| 20 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 21 | Ga0055535_1012982 | 3300003761 | Bacteria | 1249 |
| 22 | Ga0055526_1000718 | 3300003771 | Bacteria | 25105 |
| 23 | Ga0055524_1000147 | 3300003775 | Bacteria | 83426 |
| 24 | Ga0055524_1005161 | 3300003775 | Bacteria | 5889 |
| 25 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 26 | Ga0065165_1000306 | 3300005262 | Bacteria | 81181 |
| 27 | Ga0065712_10086790 | 3300005290 | Bacteria | 2616 |
| 28 | Ga0070658_10018562 | 3300005327 | Bacteria | 5570 |
| 29 | Ga0070658_10034943 | 3300005327 | Bacteria | 4046 |
| 30 | Ga0070658_10112763 | 3300005327 | Bacteria | 2254 |
| 31 | Ga0070658_10250922 | 3300005327 | Bacteria | 1501 |
| 32 | Ga0070676_10031151 | 3300005328 | Bacteria | 3046 |
| 33 | Ga0070683_100352660 | 3300005329 | Bacteria | 1401 |
| 34 | Ga0070690_100020880 | 3300005330 | Bacteria | 3994 |
| 35 | Ga0070690_100082456 | 3300005330 | Bacteria | 2105 |
| 36 | Ga0070670_100012362 | 3300005331 | Bacteria | 7305 |
| 37 | Ga0070670_100069368 | 3300005331 | Bacteria | 3026 |
| 38 | Ga0070670_100201684 | 3300005331 | Bacteria | 1729 |
| 39 | Ga0070670_100264755 | 3300005331 | Bacteria | 1499 |
| 40 | Ga0068869_100071537 | 3300005334 | Bacteria | 2568 |
| 41 | Ga0068869_100076940 | 3300005334 | Bacteria | 2481 |
| 42 | Ga0068869_100089529 | 3300005334 | Bacteria | 2311 |
| 43 | Ga0070666_10055078 | 3300005335 | Bacteria | 2684 |
| 44 | Ga0070666_10209223 | 3300005335 | Bacteria | 1373 |
| 45 | Ga0070680_100001454 | 3300005336 | Bacteria | 17167 |
| 46 | Ga0070680_100002828 | 3300005336 | Bacteria | 12901 |
| 47 | Ga0070682_100037646 | 3300005337 | Bacteria | 2963 |
| 48 | Ga0068868_100043322 | 3300005338 | Bacteria | 3515 |
| 49 | Ga0070660_100000414 | 3300005339 | Bacteria | 28402 |
| 50 | Ga0070660_100007676 | 3300005339 | Bacteria | 7517 |
| 51 | Ga0070660_100025623 | 3300005339 | Bacteria | 4384 |
| 52 | Ga0070660_100029654 | 3300005339 | Bacteria | 4102 |
| 53 | Ga0070660_100043495 | 3300005339 | Bacteria | 3433 |
| 54 | Ga0070660_100084771 | 3300005339 | Bacteria | 2491 |
| 55 | Ga0070660_100108342 | 3300005339 | Bacteria | 2208 |
| 56 | Ga0070660_100293491 | 3300005339 | Bacteria | 1332 |
| 57 | Ga0070689_100019359 | 3300005340 | Bacteria | 5034 |
| 58 | Ga0070689_100126351 | 3300005340 | Bacteria | 2046 |
| 59 | Ga0070689_100219097 | 3300005340 | Bacteria | 1560 |
| 60 | Ga0070691_10002244 | 3300005341 | Bacteria | 8545 |
| 61 | Ga0070691_10042038 | 3300005341 | Bacteria | 2162 |
| 62 | Ga0070687_100121609 | 3300005343 | Bacteria | 1494 |
| 63 | Ga0070661_100001393 | 3300005344 | Bacteria | 16882 |
| 64 | Ga0070661_100228154 | 3300005344 | Bacteria | 1430 |
| 65 | Ga0070692_10033004 | 3300005345 | Bacteria | 2607 |
| 66 | Ga0070668_100399072 | 3300005347 | Bacteria | 1174 |
| 67 | Ga0070669_100013267 | 3300005353 | Bacteria | 5857 |
| 68 | Ga0070669_100277956 | 3300005353 | Bacteria | 1341 |
| 69 | Ga0070675_100000047 | 3300005354 | Bacteria | 76032 |
| 70 | Ga0070675_100003166 | 3300005354 | Bacteria | 12449 |
| 71 | Ga0070675_100003200 | 3300005354 | Bacteria | 12407 |
| 72 | Ga0070675_100016822 | 3300005354 | Bacteria | 5806 |
| 73 | Ga0070675_100039428 | 3300005354 | Bacteria | 3854 |
| 74 | Ga0070675_100221126 | 3300005354 | Bacteria | 1649 |
| 75 | Ga0070671_100003924 | 3300005355 | Bacteria | 11699 |
| 76 | Ga0070671_100028246 | 3300005355 | Bacteria | 4619 |
| 77 | Ga0070671_100060943 | 3300005355 | Bacteria | 3142 |
| 78 | Ga0070673_100002755 | 3300005364 | Bacteria | 10795 |
| 79 | Ga0070673_100009518 | 3300005364 | Bacteria | 6524 |
| 80 | Ga0070688_100008728 | 3300005365 | Bacteria | 5512 |
| 81 | Ga0070688_100283604 | 3300005365 | Bacteria | 1191 |
| 82 | Ga0070688_100284513 | 3300005365 | Bacteria | 1189 |
| 83 | Ga0070659_100000526 | 3300005366 | Bacteria | 27993 |
| 84 | Ga0070659_100018531 | 3300005366 | Bacteria | 5253 |
| 85 | Ga0070659_100041122 | 3300005366 | Bacteria | 3613 |
| 86 | Ga0070659_100109435 | 3300005366 | Bacteria | 2230 |
| 87 | Ga0070659_100117968 | 3300005366 | Bacteria | 2146 |
| 88 | Ga0070667_100123125 | 3300005367 | Bacteria | 2258 |
| 89 | Ga0070703_10002040 | 3300005406 | Bacteria | 5896 |
| 90 | Ga0070714_100011555 | 3300005435 | Bacteria | 7008 |
| 91 | Ga0070713_100006994 | 3300005436 | Bacteria | 7877 |
| 92 | Ga0070713_100197303 | 3300005436 | Bacteria | 1816 |
| 93 | Ga0070710_10152324 | 3300005437 | Bacteria | 1427 |
| 94 | Ga0070701_10002126 | 3300005438 | Bacteria | 7538 |
| 95 | Ga0070701_10071198 | 3300005438 | Bacteria | 1859 |
| 96 | Ga0070711_100113147 | 3300005439 | Bacteria | 1995 |
| 97 | Ga0070705_100000070 | 3300005440 | Bacteria | 54646 |
| 98 | Ga0070700_100001054 | 3300005441 | Bacteria | 13643 |
| 99 | Ga0070700_100033455 | 3300005441 | Bacteria | 3096 |
| 100 | Ga0070694_100001284 | 3300005444 | Bacteria | 14583 |
| 101 | Ga0070708_100211552 | 3300005445 | Bacteria | 1817 |
| 102 | Ga0070663_100002090 | 3300005455 | Bacteria | 11171 |
| 103 | Ga0070663_100003639 | 3300005455 | Bacteria | 8925 |
| 104 | Ga0070662_100000260 | 3300005457 | Bacteria | 31271 |
| 105 | Ga0070681_10005497 | 3300005458 | Bacteria | 12242 |
| 106 | Ga0070681_10092407 | 3300005458 | Bacteria | 2975 |
| 107 | Ga0070681_10287940 | 3300005458 | Bacteria | 1553 |
| 108 | Ga0068867_100045778 | 3300005459 | Bacteria | 3210 |
| 109 | Ga0068867_100528315 | 3300005459 | Bacteria | 1018 |
| 110 | Ga0070698_100174104 | 3300005471 | Bacteria | 2092 |
| 111 | Ga0070699_100002047 | 3300005518 | Bacteria | 18227 |
| 112 | Ga0070679_100011047 | 3300005530 | Bacteria | 8589 |
| 113 | Ga0070679_100025904 | 3300005530 | Bacteria | 5755 |
| 114 | Ga0070679_100057189 | 3300005530 | Bacteria | 3887 |
| 115 | Ga0070679_100062826 | 3300005530 | Bacteria | 3702 |
| 116 | Ga0070679_100096263 | 3300005530 | Bacteria | 2948 |
| 117 | Ga0070679_100421749 | 3300005530 | Bacteria | 1280 |
| 118 | Ga0070684_100088797 | 3300005535 | Bacteria | 2746 |
| 119 | Ga0070684_100156418 | 3300005535 | Bacteria | 2067 |
| 120 | Ga0068853_100001673 | 3300005539 | Bacteria | 16221 |
| 121 | Ga0068853_100055480 | 3300005539 | Bacteria | 3415 |
| 122 | Ga0068853_100071638 | 3300005539 | Bacteria | 3019 |
| 123 | Ga0068853_100211279 | 3300005539 | Bacteria | 1769 |
| 124 | Ga0070672_100016809 | 3300005543 | Bacteria | 5248 |
| 125 | Ga0070672_100038229 | 3300005543 | Bacteria | 3666 |
| 126 | Ga0070686_100032215 | 3300005544 | Bacteria | 3212 |
| 127 | Ga0070686_100051768 | 3300005544 | Bacteria | 2615 |
| 128 | Ga0070686_100142483 | 3300005544 | Bacteria | 1670 |
| 129 | Ga0070695_100000961 | 3300005545 | Bacteria | 15654 |
| 130 | Ga0070695_100245482 | 3300005545 | Bacteria | 1301 |
| 131 | Ga0070696_100000787 | 3300005546 | Bacteria | 20400 |
| 132 | Ga0070696_100003444 | 3300005546 | Bacteria | 10532 |
| 133 | Ga0070693_100150948 | 3300005547 | Bacteria | 1472 |
| 134 | Ga0070665_100077618 | 3300005548 | Bacteria | 3328 |
| 135 | Ga0070665_100125115 | 3300005548 | Bacteria | 2573 |
| 136 | Ga0070665_100173026 | 3300005548 | Bacteria | 2160 |
| 137 | Ga0070704_100001472 | 3300005549 | Bacteria | 12642 |
| 138 | Ga0070704_100019492 | 3300005549 | Bacteria | 4358 |
| 139 | Ga0070704_100120867 | 3300005549 | Bacteria | 2012 |
| 140 | Ga0068855_100000055 | 3300005563 | Bacteria | 136099 |
| 141 | Ga0068855_100000110 | 3300005563 | Bacteria | 102379 |
| 142 | Ga0068855_100007699 | 3300005563 | Bacteria | 13008 |
| 143 | Ga0068855_100025547 | 3300005563 | Bacteria | 7065 |
| 144 | Ga0068855_100093172 | 3300005563 | Bacteria | 3474 |
| 145 | Ga0068855_100149825 | 3300005563 | Bacteria | 2653 |
| 146 | Ga0068855_100190252 | 3300005563 | Bacteria | 2315 |
| 147 | Ga0068855_100260802 | 3300005563 | Bacteria | 1930 |
| 148 | Ga0068855_100316770 | 3300005563 | Bacteria | 1725 |
| 149 | Ga0068855_100411777 | 3300005563 | Bacteria | 1480 |
| 150 | Ga0070664_100000378 | 3300005564 | Bacteria | 33105 |
| 151 | Ga0070664_100010769 | 3300005564 | Bacteria | 7415 |
| 152 | Ga0070664_100055996 | 3300005564 | Bacteria | 3350 |
| 153 | Ga0070664_100077109 | 3300005564 | Bacteria | 2865 |
| 154 | Ga0070664_100210121 | 3300005564 | Bacteria | 1739 |
| 155 | Ga0070664_100243081 | 3300005564 | Bacteria | 1616 |
| 156 | Ga0070664_100268732 | 3300005564 | Bacteria | 1535 |
| 157 | Ga0068857_100040684 | 3300005577 | Bacteria | 4122 |
| 158 | Ga0068857_100140746 | 3300005577 | Bacteria | 2181 |
| 159 | Ga0068857_100244042 | 3300005577 | Bacteria | 1645 |
| 160 | Ga0068857_100402341 | 3300005577 | Bacteria | 1274 |
| 161 | Ga0068854_100008843 | 3300005578 | Bacteria | 6481 |
| 162 | Ga0068854_100017510 | 3300005578 | Bacteria | 4794 |
| 163 | Ga0068854_100129464 | 3300005578 | Bacteria | 1925 |
| 164 | Ga0068856_100000111 | 3300005614 | Bacteria | 81104 |
| 165 | Ga0068856_100014426 | 3300005614 | Bacteria | 7633 |
| 166 | Ga0068856_100028653 | 3300005614 | Bacteria | 5440 |
| 167 | Ga0068856_100651604 | 3300005614 | Bacteria | 1074 |
| 168 | Ga0070702_100111537 | 3300005615 | Bacteria | 1696 |
| 169 | Ga0068852_100003379 | 3300005616 | Bacteria | 11139 |
| 170 | Ga0068852_100349420 | 3300005616 | Bacteria | 1443 |
| 171 | Ga0068852_100424630 | 3300005616 | Bacteria | 1312 |
| 172 | Ga0068859_100000540 | 3300005617 | Bacteria | 37486 |
| 173 | Ga0068859_100006985 | 3300005617 | Bacteria | 11463 |
| 174 | Ga0068859_100020770 | 3300005617 | Bacteria | 6591 |
| 175 | Ga0068859_100090120 | 3300005617 | Bacteria | 3117 |
| 176 | Ga0068864_100094812 | 3300005618 | Bacteria | 2638 |
| 177 | Ga0068851_10072499 | 3300005834 | Bacteria | 1784 |
| 178 | Ga0068851_10168028 | 3300005834 | Bacteria | 1209 |
| 179 | Ga0068851_10233951 | 3300005834 | Bacteria | 1037 |
| 180 | Ga0068870_10016704 | 3300005840 | Bacteria | 3513 |
| 181 | Ga0068863_100000482 | 3300005841 | Bacteria | 40772 |
| 182 | Ga0068863_100046317 | 3300005841 | Bacteria | 4127 |
| 183 | Ga0068863_100143017 | 3300005841 | Bacteria | 2287 |
| 184 | Ga0068858_100072148 | 3300005842 | Bacteria | 3203 |
| 185 | Ga0068858_100585377 | 3300005842 | Bacteria | 1082 |
| 186 | Ga0068860_100002026 | 3300005843 | Bacteria | 21380 |
| 187 | Ga0068860_100004449 | 3300005843 | Bacteria | 14300 |
| 188 | Ga0068860_100104218 | 3300005843 | Bacteria | 2708 |
| 189 | Ga0068862_100001012 | 3300005844 | Bacteria | 26997 |
| 190 | Ga0081455_10115957 | 3300005937 | Bacteria | 2119 |
| 191 | Ga0081539_10019491 | 3300005985 | Bacteria | 4638 |
| 192 | Ga0075365_10007935 | 3300006038 | Bacteria | 5984 |
| 193 | Ga0075365_10094270 | 3300006038 | Bacteria | 2043 |
| 194 | Ga0075363_100097150 | 3300006048 | Bacteria | 1627 |
| 195 | Ga0075367_10146917 | 3300006178 | Bacteria | 1462 |
| 196 | Ga0075369_10007679 | 3300006186 | Bacteria | 4121 |
| 197 | Ga0097621_100001740 | 3300006237 | Bacteria | 14908 |
| 198 | Ga0097621_100122580 | 3300006237 | Bacteria | 2206 |
| 199 | Ga0068871_100036976 | 3300006358 | Bacteria | 3891 |
| 200 | Ga0068871_100070256 | 3300006358 | Bacteria | 2878 |
| 201 | Ga0075434_100087811 | 3300006871 | Bacteria | 3111 |
| 202 | Ga0075434_100191262 | 3300006871 | Bacteria | 2067 |
| 203 | Ga0097620_100000540 | 3300006931 | Bacteria | 37486 |
| 204 | Ga0097620_100006985 | 3300006931 | Bacteria | 11463 |
| 205 | Ga0097620_100020770 | 3300006931 | Bacteria | 6591 |
| 206 | Ga0097620_100090121 | 3300006931 | Bacteria | 3117 |
| 207 | Ga0099825_1042400 | 3300006941 | Bacteria | 1261 |
| 208 | Ga0099824_1018508 | 3300006942 | Bacteria | 5700 |
| 209 | Ga0099822_1006503 | 3300006943 | Bacteria | 15212 |
| 210 | Ga0079104_1004906 | 3300006946 | Bacteria | 5526 |
| 211 | Ga0075435_100025364 | 3300007076 | Bacteria | 4615 |
| 212 | Ga0105251_10083050 | 3300009011 | Bacteria | 1479 |
| 213 | Ga0105240_10007018 | 3300009093 | Bacteria | 16438 |
| 214 | Ga0105240_10007251 | 3300009093 | Bacteria | 16141 |
| 215 | Ga0105240_10008689 | 3300009093 | Bacteria | 14492 |
| 216 | Ga0105240_10014573 | 3300009093 | Bacteria | 10727 |
| 217 | Ga0105240_10027626 | 3300009093 | Bacteria | 7428 |
| 218 | Ga0105240_10192764 | 3300009093 | Bacteria | 2395 |
| 219 | Ga0105240_10365685 | 3300009093 | Bacteria | 1633 |
| 220 | Ga0105240_10483225 | 3300009093 | Bacteria | 1380 |
| 221 | Ga0111539_10011976 | 3300009094 | Bacteria | 10874 |
| 222 | Ga0111539_10022710 | 3300009094 | Bacteria | 7705 |
| 223 | Ga0111539_10128782 | 3300009094 | Bacteria | 2965 |
| 224 | Ga0111539_10144393 | 3300009094 | Bacteria | 2786 |
| 225 | Ga0105245_10335375 | 3300009098 | Bacteria | 1494 |
| 226 | Ga0105247_10087642 | 3300009101 | Bacteria | 1972 |
| 227 | Ga0114129_10205160 | 3300009147 | Bacteria | 2667 |
| 228 | Ga0114129_10391670 | 3300009147 | Bacteria | 1832 |
| 229 | Ga0105243_10019973 | 3300009148 | Bacteria | 5080 |
| 230 | Ga0105241_10005236 | 3300009174 | Bacteria | 9579 |
| 231 | Ga0105242_10037406 | 3300009176 | Bacteria | 3898 |
| 232 | Ga0105242_10417449 | 3300009176 | Bacteria | 1256 |
| 233 | Ga0105248_10028635 | 3300009177 | Bacteria | 6207 |
| 234 | Ga0105248_10123691 | 3300009177 | Bacteria | 2918 |
| 235 | Ga0105248_10135888 | 3300009177 | Bacteria | 2774 |
| 236 | Ga0105248_10145682 | 3300009177 | Bacteria | 2672 |
| 237 | Ga0105248_10161752 | 3300009177 | Bacteria | 2525 |
| 238 | Ga0105248_10255890 | 3300009177 | Bacteria | 1971 |
| 239 | Ga0105248_10549831 | 3300009177 | Bacteria | 1302 |
| 240 | Ga0105237_10051247 | 3300009545 | Bacteria | 4145 |
| 241 | Ga0105237_10102457 | 3300009545 | Bacteria | 2854 |
| 242 | Ga0105237_10281050 | 3300009545 | Bacteria | 1667 |
| 243 | Ga0105237_10289384 | 3300009545 | Bacteria | 1641 |
| 244 | Ga0105238_10001827 | 3300009551 | Bacteria | 21335 |
| 245 | Ga0105238_10044711 | 3300009551 | Bacteria | 4476 |
| 246 | Ga0105238_10070544 | 3300009551 | Bacteria | 3493 |
| 247 | Ga0105249_10150379 | 3300009553 | Bacteria | 2241 |
| 248 | Ga0105239_10163183 | 3300010375 | Bacteria | 2490 |
| 249 | Ga0105239_10259904 | 3300010375 | Bacteria | 1951 |
| 250 | Ga0105246_10067320 | 3300011119 | Bacteria | 2509 |
| 251 | Ga0157371_10000248 | 3300013102 | Bacteria | 76451 |
| 252 | Ga0157371_10226485 | 3300013102 | Bacteria | 1343 |
| 253 | Ga0157370_10004460 | 3300013104 | Bacteria | 16037 |
| 254 | Ga0157370_10006449 | 3300013104 | Bacteria | 12944 |
| 255 | Ga0157370_10011079 | 3300013104 | Bacteria | 9452 |
| 256 | Ga0157370_10046276 | 3300013104 | Bacteria | 4171 |
| 257 | Ga0157370_10056647 | 3300013104 | Bacteria | 3730 |
| 258 | Ga0157370_10065888 | 3300013104 | Bacteria | 3426 |
| 259 | Ga0157370_10087663 | 3300013104 | Bacteria | 2924 |
| 260 | Ga0157370_10103781 | 3300013104 | Bacteria | 2661 |
| 261 | Ga0157370_10301095 | 3300013104 | Bacteria | 1480 |
| 262 | Ga0157369_10002981 | 3300013105 | Bacteria | 20257 |
| 263 | Ga0157369_10009381 | 3300013105 | Bacteria | 11188 |
| 264 | Ga0157369_10526916 | 3300013105 | Bacteria | 1222 |
| 265 | Ga0157369_10582756 | 3300013105 | Bacteria | 1155 |
| 266 | Ga0171462_1033 | 3300013250 | Bacteria | 90238 |
| 267 | Ga0157374_10079283 | 3300013296 | Bacteria | 3112 |
| 268 | Ga0157374_10114698 | 3300013296 | Bacteria | 2594 |
| 269 | Ga0157378_10254433 | 3300013297 | Bacteria | 1683 |
| 270 | Ga0163162_10003469 | 3300013306 | Bacteria | 15064 |
| 271 | Ga0157372_10000468 | 3300013307 | Bacteria | 44530 |
| 272 | Ga0157372_10072433 | 3300013307 | Bacteria | 3883 |
| 273 | Ga0157372_10081535 | 3300013307 | Bacteria | 3662 |
| 274 | Ga0157372_10164788 | 3300013307 | Bacteria | 2563 |
| 275 | Ga0157372_10250568 | 3300013307 | Bacteria | 2055 |
| 276 | Ga0157372_10342671 | 3300013307 | Bacteria | 1741 |
| 277 | Ga0157372_10426810 | 3300013307 | Bacteria | 1545 |
| 278 | Ga0157372_10539410 | 3300013307 | Bacteria | 1360 |
| 279 | Ga0157375_10001118 | 3300013308 | Bacteria | 23248 |
| 280 | Ga0157375_10058966 | 3300013308 | Bacteria | 3800 |
| 281 | Ga0163163_10006158 | 3300014325 | Bacteria | 10456 |
| 282 | Ga0163163_10134066 | 3300014325 | Bacteria | 2517 |
| 283 | Ga0163163_10292736 | 3300014325 | Bacteria | 1680 |
| 284 | Ga0163163_10294975 | 3300014325 | Bacteria | 1674 |
| 285 | Ga0163163_10311496 | 3300014325 | Bacteria | 1627 |
| 286 | Ga0157380_10053274 | 3300014326 | Bacteria | 3207 |
| 287 | Ga0157377_10025992 | 3300014745 | Bacteria | 3128 |
| 288 | Ga0157377_10316143 | 3300014745 | Bacteria | 1036 |
| 289 | Ga0157379_10000226 | 3300014968 | Bacteria | 44189 |
| 290 | Ga0157379_10143572 | 3300014968 | Bacteria | 2152 |
| 291 | Ga0182006_1000685 | 3300015261 | Bacteria | 23686 |
| 292 | Ga0182007_10038195 | 3300015262 | Bacteria | 1611 |
| 293 | Ga0163161_10036130 | 3300017792 | Bacteria | 3538 |
| 294 | Ga0163161_10069471 | 3300017792 | Bacteria | 2575 |
| 295 | Ga0206353_10103469 | 3300020082 | Bacteria | 1917 |
| 296 | Ga0213872_10005720 | 3300021361 | Bacteria | 6332 |
| 297 | Ga0213876_10046609 | 3300021384 | Bacteria | 2292 |
| 298 | Ga0213875_10016710 | 3300021388 | Bacteria | 3555 |
| 299 | Ga0213875_10082261 | 3300021388 | Bacteria | 1502 |
| 300 | Ga0213875_10096126 | 3300021388 | Bacteria | 1382 |
| 301 | Ga0213875_10100885 | 3300021388 | Bacteria | 1347 |
| 302 | Ga0209435_100013 | 3300025206 | Bacteria | 366789 |
| 303 | Ga0209435_100379 | 3300025206 | Bacteria | 9907 |
| 304 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 305 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 306 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 307 | Ga0209147_100030 | 3300025229 | Bacteria | 366789 |
| 308 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 309 | Ga0209437_100419 | 3300025233 | Bacteria | 38515 |
| 310 | Ga0209258_100433 | 3300025242 | Bacteria | 48200 |
| 311 | Ga0209646_1000021 | 3300025246 | Bacteria | 461083 |
| 312 | Ga0209646_1000034 | 3300025246 | Bacteria | 366789 |
| 313 | Ga0209026_1000022 | 3300025250 | Bacteria | 366789 |
| 314 | Ga0209026_1001565 | 3300025250 | Bacteria | 9869 |
| 315 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 316 | Ga0209759_1000018 | 3300025256 | Bacteria | 366789 |
| 317 | Ga0209759_1000100 | 3300025256 | Bacteria | 156294 |
| 318 | Ga0209233_1034338 | 3300025261 | Bacteria | 1156 |
| 319 | Ga0209673_1017561 | 3300025273 | Bacteria | 2635 |
| 320 | Ga0209130_1000111 | 3300025284 | Bacteria | 131855 |
| 321 | Ga0207673_1000127 | 3300025290 | Bacteria | 7181 |
| 322 | Ga0209675_1001117 | 3300025291 | Bacteria | 16355 |
| 323 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 324 | Ga0209025_1001499 | 3300025294 | Bacteria | 30164 |
| 325 | Ga0209564_1000179 | 3300025295 | Bacteria | 151032 |
| 326 | Ga0209256_1000055 | 3300025299 | Bacteria | 295530 |
| 327 | Ga0209256_1000102 | 3300025299 | Bacteria | 199097 |
| 328 | Ga0209256_1033389 | 3300025299 | Bacteria | 1385 |
| 329 | Ga0207697_10017438 | 3300025315 | Bacteria | 2951 |
| 330 | Ga0207656_10026268 | 3300025321 | Bacteria | 2372 |
| 331 | Ga0207656_10026269 | 3300025321 | Bacteria | 2372 |
| 332 | Ga0207656_10111912 | 3300025321 | Bacteria | 1262 |
| 333 | Ga0207682_10009230 | 3300025893 | Bacteria | 3897 |
| 334 | Ga0207692_10251953 | 3300025898 | Bacteria | 1058 |
| 335 | Ga0207710_10048570 | 3300025900 | Bacteria | 1900 |
| 336 | Ga0207688_10002018 | 3300025901 | Bacteria | 10890 |
| 337 | Ga0207680_10044443 | 3300025903 | Bacteria | 2612 |
| 338 | Ga0207647_10018756 | 3300025904 | Bacteria | 4669 |
| 339 | Ga0207647_10021879 | 3300025904 | Bacteria | 4258 |
| 340 | Ga0207647_10093776 | 3300025904 | Bacteria | 1789 |
| 341 | Ga0207647_10179160 | 3300025904 | Bacteria | 1232 |
| 342 | Ga0207699_10168463 | 3300025906 | Bacteria | 1464 |
| 343 | Ga0207645_10014390 | 3300025907 | Bacteria | 5293 |
| 344 | Ga0207645_10080323 | 3300025907 | Bacteria | 2091 |
| 345 | Ga0207643_10005305 | 3300025908 | Bacteria | 6900 |
| 346 | Ga0207705_10007617 | 3300025909 | Bacteria | 7962 |
| 347 | Ga0207705_10037355 | 3300025909 | Bacteria | 3476 |
| 348 | Ga0207705_10067806 | 3300025909 | Bacteria | 2582 |
| 349 | Ga0207705_10192267 | 3300025909 | Bacteria | 1544 |
| 350 | Ga0207654_10004070 | 3300025911 | Bacteria | 7364 |
| 351 | Ga0207654_10026836 | 3300025911 | Bacteria | 3124 |
| 352 | Ga0207707_10030136 | 3300025912 | Bacteria | 4744 |
| 353 | Ga0207707_10077177 | 3300025912 | Bacteria | 2908 |
| 354 | Ga0207707_10084215 | 3300025912 | Bacteria | 2777 |
| 355 | Ga0207707_10176638 | 3300025912 | Bacteria | 1866 |
| 356 | Ga0207695_10000896 | 3300025913 | Bacteria | 53929 |
| 357 | Ga0207695_10009589 | 3300025913 | Bacteria | 11960 |
| 358 | Ga0207695_10029551 | 3300025913 | Bacteria | 6051 |
| 359 | Ga0207695_10055460 | 3300025913 | Bacteria | 4129 |
| 360 | Ga0207695_10105955 | 3300025913 | Bacteria | 2798 |
| 361 | Ga0207695_10171105 | 3300025913 | Bacteria | 2098 |
| 362 | Ga0207695_10308035 | 3300025913 | Bacteria | 1474 |
| 363 | Ga0207671_10215167 | 3300025914 | Bacteria | 1504 |
| 364 | Ga0207671_10313599 | 3300025914 | Bacteria | 1240 |
| 365 | Ga0207660_10025362 | 3300025917 | Bacteria | 4023 |
| 366 | Ga0207660_10025923 | 3300025917 | Bacteria | 3986 |
| 367 | Ga0207660_10083052 | 3300025917 | Bacteria | 2358 |
| 368 | Ga0207660_10133347 | 3300025917 | Bacteria | 1893 |
| 369 | Ga0207662_10076289 | 3300025918 | Bacteria | 2037 |
| 370 | Ga0207657_10000894 | 3300025919 | Bacteria | 31534 |
| 371 | Ga0207657_10000910 | 3300025919 | Bacteria | 31264 |
| 372 | Ga0207657_10010420 | 3300025919 | Bacteria | 9279 |
| 373 | Ga0207657_10012583 | 3300025919 | Bacteria | 8341 |
| 374 | Ga0207657_10032705 | 3300025919 | Bacteria | 4696 |
| 375 | Ga0207657_10094060 | 3300025919 | Bacteria | 2496 |
| 376 | Ga0207657_10104907 | 3300025919 | Bacteria | 2341 |
| 377 | Ga0207657_10147206 | 3300025919 | Bacteria | 1920 |
| 378 | Ga0207649_10008175 | 3300025920 | Bacteria | 5696 |
| 379 | Ga0207649_10015173 | 3300025920 | Bacteria | 4326 |
| 380 | Ga0207649_10217186 | 3300025920 | Bacteria | 1360 |
| 381 | Ga0207652_10007193 | 3300025921 | Bacteria | 8982 |
| 382 | Ga0207652_10028301 | 3300025921 | Bacteria | 4675 |
| 383 | Ga0207652_10048462 | 3300025921 | Bacteria | 3632 |
| 384 | Ga0207652_10051659 | 3300025921 | Bacteria | 3525 |
| 385 | Ga0207652_10244174 | 3300025921 | Bacteria | 1619 |
| 386 | Ga0207681_10169790 | 3300025923 | Bacteria | 1652 |
| 387 | Ga0207694_10003746 | 3300025924 | Bacteria | 12049 |
| 388 | Ga0207694_10100452 | 3300025924 | Bacteria | 2292 |
| 389 | Ga0207694_10153090 | 3300025924 | Bacteria | 1858 |
| 390 | Ga0207694_10320744 | 3300025924 | Bacteria | 1278 |
| 391 | Ga0207650_10004859 | 3300025925 | Bacteria | 9179 |
| 392 | Ga0207650_10007669 | 3300025925 | Bacteria | 7350 |
| 393 | Ga0207650_10050178 | 3300025925 | Bacteria | 3085 |
| 394 | Ga0207659_10014380 | 3300025926 | Bacteria | 5102 |
| 395 | Ga0207659_10014390 | 3300025926 | Bacteria | 5101 |
| 396 | Ga0207659_10026030 | 3300025926 | Bacteria | 3942 |
| 397 | Ga0207659_10027271 | 3300025926 | Bacteria | 3865 |
| 398 | Ga0207659_10106897 | 3300025926 | Bacteria | 2119 |
| 399 | Ga0207659_10159237 | 3300025926 | Bacteria | 1771 |
| 400 | Ga0207700_10035789 | 3300025928 | Bacteria | 3579 |
| 401 | Ga0207700_10170377 | 3300025928 | Bacteria | 1816 |
| 402 | Ga0207664_10006045 | 3300025929 | Bacteria | 8289 |
| 403 | Ga0207644_10019042 | 3300025931 | Bacteria | 4653 |
| 404 | Ga0207690_10000194 | 3300025932 | Bacteria | 47161 |
| 405 | Ga0207690_10063622 | 3300025932 | Bacteria | 2516 |
| 406 | Ga0207690_10151633 | 3300025932 | Bacteria | 1719 |
| 407 | Ga0207690_10224436 | 3300025932 | Bacteria | 1439 |
| 408 | Ga0207706_10000008 | 3300025933 | Bacteria | 201940 |
| 409 | Ga0207706_10002914 | 3300025933 | Bacteria | 16537 |
| 410 | Ga0207686_10038644 | 3300025934 | Bacteria | 2890 |
| 411 | Ga0207686_10478190 | 3300025934 | Bacteria | 963 |
| 412 | Ga0207709_10042244 | 3300025935 | Bacteria | 2741 |
| 413 | Ga0207670_10039589 | 3300025936 | Bacteria | 3088 |
| 414 | Ga0207670_10100957 | 3300025936 | Bacteria | 2061 |
| 415 | Ga0207669_10077183 | 3300025937 | Bacteria | 2117 |
| 416 | Ga0207669_10212045 | 3300025937 | Bacteria | 1414 |
| 417 | Ga0207691_10016366 | 3300025940 | Bacteria | 7039 |
| 418 | Ga0207691_10033742 | 3300025940 | Bacteria | 4765 |
| 419 | Ga0207691_10061595 | 3300025940 | Bacteria | 3408 |
| 420 | Ga0207711_10003837 | 3300025941 | Bacteria | 12927 |
| 421 | Ga0207711_10083534 | 3300025941 | Bacteria | 2794 |
| 422 | Ga0207711_10224911 | 3300025941 | Bacteria | 1717 |
| 423 | Ga0207689_10028886 | 3300025942 | Bacteria | 4637 |
| 424 | Ga0207689_10250682 | 3300025942 | Bacteria | 1464 |
| 425 | Ga0207661_10026953 | 3300025944 | Bacteria | 4385 |
| 426 | Ga0207679_10000934 | 3300025945 | Bacteria | 18670 |
| 427 | Ga0207679_10027208 | 3300025945 | Bacteria | 3953 |
| 428 | Ga0207679_10040686 | 3300025945 | Bacteria | 3329 |
| 429 | Ga0207679_10133355 | 3300025945 | Bacteria | 1996 |
| 430 | Ga0207679_10179854 | 3300025945 | Bacteria | 1749 |
| 431 | Ga0207679_10183517 | 3300025945 | Bacteria | 1733 |
| 432 | Ga0207667_10000032 | 3300025949 | Bacteria | 322253 |
| 433 | Ga0207667_10001326 | 3300025949 | Bacteria | 31063 |
| 434 | Ga0207667_10008233 | 3300025949 | Bacteria | 12408 |
| 435 | Ga0207667_10013259 | 3300025949 | Bacteria | 9446 |
| 436 | Ga0207667_10025214 | 3300025949 | Bacteria | 6512 |
| 437 | Ga0207667_10033295 | 3300025949 | Bacteria | 5543 |
| 438 | Ga0207667_10068397 | 3300025949 | Bacteria | 3698 |
| 439 | Ga0207667_10273652 | 3300025949 | Bacteria | 1726 |
| 440 | Ga0207667_10310771 | 3300025949 | Bacteria | 1610 |
| 441 | Ga0207667_10554070 | 3300025949 | Bacteria | 1163 |
| 442 | Ga0207651_10003519 | 3300025960 | Bacteria | 7699 |
| 443 | Ga0207651_10021459 | 3300025960 | Bacteria | 3926 |
| 444 | Ga0207651_10056016 | 3300025960 | Bacteria | 2711 |
| 445 | Ga0207651_10381021 | 3300025960 | Bacteria | 1195 |
| 446 | Ga0207712_10014486 | 3300025961 | Bacteria | 5075 |
| 447 | Ga0207712_10313431 | 3300025961 | Bacteria | 1292 |
| 448 | Ga0207712_10471852 | 3300025961 | Bacteria | 1068 |
| 449 | Ga0207640_10004677 | 3300025981 | Bacteria | 7429 |
| 450 | Ga0207640_10012816 | 3300025981 | Bacteria | 4789 |
| 451 | Ga0207640_10140103 | 3300025981 | Bacteria | 1762 |
| 452 | Ga0207640_10363612 | 3300025981 | Bacteria | 1167 |
| 453 | Ga0207658_10054168 | 3300025986 | Bacteria | 2967 |
| 454 | Ga0207658_10056134 | 3300025986 | Bacteria | 2921 |
| 455 | Ga0207677_10335920 | 3300026023 | Bacteria | 1261 |
| 456 | Ga0207703_10061310 | 3300026035 | Bacteria | 3079 |
| 457 | Ga0207639_10002823 | 3300026041 | Bacteria | 11653 |
| 458 | Ga0207639_10041392 | 3300026041 | Bacteria | 3446 |
| 459 | Ga0207639_10043729 | 3300026041 | Bacteria | 3364 |
| 460 | Ga0207639_10144336 | 3300026041 | Bacteria | 1987 |
| 461 | Ga0207639_10399999 | 3300026041 | Bacteria | 1237 |
| 462 | Ga0207678_10008479 | 3300026067 | Bacteria | 9064 |
| 463 | Ga0207678_10009793 | 3300026067 | Bacteria | 8428 |
| 464 | Ga0207678_10013310 | 3300026067 | Bacteria | 7219 |
| 465 | Ga0207678_10603928 | 3300026067 | Bacteria | 962 |
| 466 | Ga0207708_10000440 | 3300026075 | Bacteria | 32431 |
| 467 | Ga0207708_10046499 | 3300026075 | Bacteria | 3305 |
| 468 | Ga0207708_10302454 | 3300026075 | Bacteria | 1301 |
| 469 | Ga0207702_10000510 | 3300026078 | Bacteria | 43837 |
| 470 | Ga0207702_10034707 | 3300026078 | Bacteria | 4218 |
| 471 | Ga0207641_10002558 | 3300026088 | Bacteria | 16737 |
| 472 | Ga0207641_10417469 | 3300026088 | Bacteria | 1291 |
| 473 | Ga0207648_10016548 | 3300026089 | Bacteria | 6735 |
| 474 | Ga0207648_10127558 | 3300026089 | Bacteria | 2238 |
| 475 | Ga0207676_10050123 | 3300026095 | Bacteria | 3253 |
| 476 | Ga0207676_10057721 | 3300026095 | Bacteria | 3058 |
| 477 | Ga0207674_10000709 | 3300026116 | Bacteria | 43489 |
| 478 | Ga0207674_10031602 | 3300026116 | Bacteria | 5559 |
| 479 | Ga0207674_10037960 | 3300026116 | Bacteria | 5003 |
| 480 | Ga0207674_10124228 | 3300026116 | Bacteria | 2547 |
| 481 | Ga0207674_10128967 | 3300026116 | Bacteria | 2493 |
| 482 | Ga0207674_10366378 | 3300026116 | Bacteria | 1393 |
| 483 | Ga0207674_10473279 | 3300026116 | Bacteria | 1211 |
| 484 | Ga0207675_100011223 | 3300026118 | Bacteria | 8390 |
| 485 | Ga0207675_100059656 | 3300026118 | Bacteria | 3560 |
| 486 | Ga0207683_10211816 | 3300026121 | Bacteria | 1764 |
| 487 | Ga0207698_10017290 | 3300026142 | Bacteria | 4889 |
| 488 | Ga0209589_1000276 | 3300027357 | Bacteria | 65299 |
| 489 | Ga0209489_100714 | 3300027361 | Bacteria | 65299 |
| 490 | Ga0209700_100732 | 3300027363 | Bacteria | 65299 |
| 491 | Ga0209983_1010276 | 3300027665 | Bacteria | 1912 |
| 492 | Ga0209971_1004023 | 3300027682 | Bacteria | 3476 |
| 493 | Ga0209971_1014099 | 3300027682 | Bacteria | 1894 |
| 494 | Ga0209974_10000194 | 3300027876 | Bacteria | 19284 |
| 495 | Ga0209974_10001758 | 3300027876 | Bacteria | 7890 |
| 496 | Ga0207428_10060550 | 3300027907 | Bacteria | 2999 |
| 497 | Ga0207428_10189003 | 3300027907 | Bacteria | 1553 |
| 498 | Ga0268266_10127191 | 3300028379 | Bacteria | 2275 |
| 499 | Ga0268266_10571213 | 3300028379 | Bacteria | 1085 |
| 500 | Ga0268265_10014552 | 3300028380 | Bacteria | 5362 |
| 501 | Ga0268265_10443594 | 3300028380 | Bacteria | 1210 |
| 502 | Ga0268264_10002236 | 3300028381 | Bacteria | 17157 |
| 503 | Ga0268264_10019143 | 3300028381 | Bacteria | 5596 |
| 504 | Ga0268264_10025590 | 3300028381 | Bacteria | 4821 |
| 505 | Ga0268264_10511906 | 3300028381 | Bacteria | 1172 |
| 506 | Ga0265337_1016644 | 3300028556 | Bacteria | 2371 |
| 507 | Ga0265760_10050084 | 3300031090 | Bacteria | 1257 |
| 508 | Ga0265330_10070485 | 3300031235 | Bacteria | 1512 |
| 509 | Ga0265332_10001524 | 3300031238 | Bacteria | 12848 |
| 510 | Ga0265328_10004422 | 3300031239 | Bacteria | 6104 |
| 511 | Ga0265325_10000406 | 3300031241 | Bacteria | 30585 |
| 512 | Ga0265329_10008728 | 3300031242 | Bacteria | 3825 |
| 513 | Ga0265340_10003673 | 3300031247 | Bacteria | 8638 |
| 514 | Ga0265339_10020973 | 3300031249 | Bacteria | 3811 |
| 515 | Ga0265327_10026872 | 3300031251 | Bacteria | 3325 |
| 516 | Ga0265316_10014787 | 3300031344 | Bacteria | 6851 |
| 517 | Ga0265316_10081573 | 3300031344 | Bacteria | 2479 |
| 518 | Ga0307513_10129248 | 3300031456 | Bacteria | 2475 |
| 519 | Ga0307408_100068146 | 3300031548 | Bacteria | 2619 |
| 520 | Ga0307408_100427436 | 3300031548 | Bacteria | 1144 |
| 521 | Ga0265313_10001452 | 3300031595 | Bacteria | 22114 |
| 522 | Ga0265314_10000523 | 3300031711 | Bacteria | 49565 |
| 523 | Ga0307405_10043573 | 3300031731 | Bacteria | 2739 |
| 524 | Ga0307405_10092697 | 3300031731 | Bacteria | 2005 |
| 525 | Ga0307410_10005780 | 3300031852 | Bacteria | 6595 |
| 526 | Ga0307406_10203757 | 3300031901 | Bacteria | 1458 |
| 527 | Ga0307407_10006689 | 3300031903 | Bacteria | 5154 |
| 528 | Ga0307409_100176336 | 3300031995 | Bacteria | 1887 |
| 529 | Ga0307416_100018117 | 3300032002 | Bacteria | 4951 |
| 530 | Ga0307416_100399303 | 3300032002 | Bacteria | 1412 |
| 531 | Ga0307415_100022830 | 3300032126 | Bacteria | 3871 |
| 532 | Ga0373926_0007792 | 3300035083 | Bacteria | 3567 |
| 533 | Ga0373944_0004353 | 3300035089 | Bacteria | 3684 |
| 534 | Ga0373923_0064730 | 3300035111 | Bacteria | 1560 |
| 535 | Ga0373936_0029866 | 3300035113 | Bacteria | 2148 |
| 536 | Ga0373945_0061322 | 3300035116 | Bacteria | 1404 |
| 537 | Ga0373953_0030840 | 3300035117 | Bacteria | 2082 |
| 538 | Ga0373953_0129156 | 3300035117 | Bacteria | 1077 |
| 539 | Ga0373943_0034956 | 3300035170 | Bacteria | 2399 |
| 540 | Ga0373943_0136844 | 3300035170 | Bacteria | 1316 |
| 541 | Ga0373946_0030549 | 3300035171 | Bacteria | 2151 |
| 542 | Ga0373946_0072146 | 3300035171 | Bacteria | 1494 |
| 543 | Ga0373946_0182228 | 3300035171 | Bacteria | 997 |
| 544 | Ga0373955_0080851 | 3300035172 | Bacteria | 1836 |
| 545 | Ga0373955_0298499 | 3300035172 | Bacteria | 971 |
| 546 | Ga0373924_0132299 | 3300035410 | Bacteria | 1086 |
| 547 | Ga0373931_0163058 | 3300035691 | Bacteria | 1308 |
| 548 | Ga0373935_0149940 | 3300035692 | Bacteria | 1582 |
| 549 | Ga0373935_0205045 | 3300035692 | Bacteria | 1364 |
| 550 | Ga0373927_0113068 | 3300035695 | Bacteria | 1769 |
| 551 | Ga0373927_0178399 | 3300035695 | Bacteria | 1393 |
| 552 | Ga0373947_0018501 | 3300035725 | Bacteria | 4011 |
| 553 | Ga0373947_0062207 | 3300035725 | Bacteria | 2271 |
| 554 | Ga0373947_0143388 | 3300035725 | Bacteria | 1534 |
| 555 | Ga0373937_0061179 | 3300036401 | Bacteria | 3461 |
| 556 | Ga0373937_0100529 | 3300036401 | Bacteria | 2684 |
| 557 | Ga0373937_0111265 | 3300036401 | Bacteria | 2547 |
| 558 | Ga0373925_0178582 | 3300037068 | Bacteria | 1679 |
| 559 | Ga0373925_0565691 | 3300037068 | Bacteria | 935 |
| 560 | Ga0395899_0005348 | 3300037312 | Bacteria | 9973 |
| 561 | Ga0395899_0028642 | 3300037312 | Bacteria | 4193 |
| 562 | Ga0395900_0028376 | 3300037418 | Bacteria | 5732 |
| 563 | Ga0395900_0163032 | 3300037418 | Bacteria | 2273 |
| 564 | Ga0395898_0078503 | 3300037466 | Bacteria | 3185 |
| 565 | Ga0395898_0094384 | 3300037466 | Bacteria | 2875 |
| 566 | Ga0395905_0000772 | 3300037471 | Bacteria | 42135 |
| 567 | Ga0395905_0008320 | 3300037471 | Bacteria | 10234 |
| 568 | Ga0395905_0038129 | 3300037471 | Bacteria | 4508 |
| 569 | Ga0395905_0125531 | 3300037471 | Bacteria | 2413 |
| 570 | Ga0395905_0143222 | 3300037471 | Bacteria | 2249 |
| 571 | Ga0395905_0155175 | 3300037471 | Bacteria | 2153 |
| 572 | Ga0436364_0687681 | 3300037853 | Bacteria | 1734 |
| 573 | Ga0436364_0920462 | 3300037853 | Bacteria | 2561 |
| 574 | Ga0436364_1333790 | 3300037853 | Bacteria | 4413 |
| 575 | Ga0436364_1400673 | 3300037853 | Bacteria | 3728 |
| 576 | Ga0436364_1422510 | 3300037853 | Bacteria | 10335 |
| 577 | Ga0395901_0294571 | 3300038443 | Bacteria | 1683 |
| 578 | Ga0395901_0544803 | 3300038443 | Bacteria | 1176 |
| 579 | Ga0237816_00954 | 3300039145 | Bacteria | 2373 |
| 580 | Ga0436365_0849376 | 3300039437 | Bacteria | 1030 |
| 581 | Ga0436361_0564858 | 3300039447 | Bacteria | 17666 |
| 582 | Ga0436362_0744013 | 3300039453 | Bacteria | 1835 |
| 583 | Ga0451577_0040855 | 3300042876 | Bacteria | 4164 |
| 584 | Ga0451577_0064559 | 3300042876 | Bacteria | 3265 |
| 585 | Ga0451577_0205723 | 3300042876 | Bacteria | 1777 |
| 586 | Ga0466977_0000316 | 3300044666 | Bacteria | 14397 |
| 587 | Ga0453683_0000320 | 3300044673 | Bacteria | 59650 |
| 588 | Ga0453683_0002549 | 3300044673 | Bacteria | 14049 |
| 589 | Ga0466965_0152188 | 3300044683 | Bacteria | 1209 |
| 590 | Ga0466966_0070088 | 3300044684 | Bacteria | 2198 |
| 591 | Ga0466961_0023848 | 3300044693 | Bacteria | 3937 |
| 592 | Ga0466963_0057383 | 3300044694 | Bacteria | 2593 |
| 593 | Ga0466971_0034830 | 3300044719 | Bacteria | 2257 |
| 594 | Ga0466968_0005636 | 3300044735 | Bacteria | 4690 |
| 595 | Ga0466957_0047812 | 3300044842 | Bacteria | 2600 |
| 596 | Ga0466957_0299248 | 3300044842 | Bacteria | 1081 |
| 597 | Ga0466960_0052819 | 3300044901 | Bacteria | 1967 |
| 598 | Ga0466959_0032646 | 3300045049 | Bacteria | 3853 |
| 599 | Ga0451576_0039095 | 3300045051 | Bacteria | 5022 |
| 600 | Ga0451576_0233031 | 3300045051 | Bacteria | 1923 |
| 601 | Ga0466958_0117689 | 3300045836 | Bacteria | 1662 |
| 602 | Ga0466958_0236603 | 3300045836 | Bacteria | 1167 |
| 603 | Ga0466967_0012482 | 3300045976 | Bacteria | 6502 |
| 604 | Ga0495617_047571 | 3300046452 | Bacteria | 1428 |
| 605 | Ga0495592_0034788 | 3300046454 | Bacteria | 3796 |
| 606 | Ga0495603_0050030 | 3300046455 | Bacteria | 2486 |
| 607 | Ga0495591_074153 | 3300046458 | Bacteria | 878 |
| 608 | Ga0495629_0024397 | 3300046459 | Bacteria | 4306 |
| 609 | Ga0495641_0082890 | 3300046461 | Bacteria | 1436 |
| 610 | Ga0495651_0002400 | 3300046462 | Bacteria | 14464 |
| 611 | Ga0495651_0039803 | 3300046462 | Bacteria | 3657 |
| 612 | Ga0495653_0000318 | 3300046463 | Bacteria | 39300 |
| 613 | Ga0495653_0046673 | 3300046463 | Bacteria | 3353 |
| 614 | Ga0495580_0041235 | 3300046472 | Bacteria | 3292 |
| 615 | Ga0495582_0011135 | 3300046473 | Bacteria | 4953 |
| 616 | Ga0495582_0011243 | 3300046473 | Bacteria | 4931 |
| 617 | Ga0495582_0027403 | 3300046473 | Bacteria | 3123 |
| 618 | Ga0495605_0055602 | 3300046474 | Bacteria | 1911 |
| 619 | Ga0495639_0055112 | 3300046475 | Bacteria | 1813 |
| 620 | Ga0495662_0004187 | 3300046476 | Bacteria | 7268 |
| 621 | Ga0495584_0149039 | 3300046491 | Bacteria | 1188 |
| 622 | Ga0495585_0020745 | 3300046492 | Bacteria | 3777 |
| 623 | Ga0495585_0065485 | 3300046492 | Bacteria | 1990 |
| 624 | Ga0495594_0006629 | 3300046499 | Bacteria | 5958 |
| 625 | Ga0495594_0164357 | 3300046499 | Bacteria | 1262 |
| 626 | Ga0495596_0001312 | 3300046500 | Bacteria | 14347 |
| 627 | Ga0495596_0031197 | 3300046500 | Bacteria | 2130 |
| 628 | Ga0495607_0039727 | 3300046501 | Bacteria | 2808 |
| 629 | Ga0495607_0052553 | 3300046501 | Bacteria | 2360 |
| 630 | Ga0495606_0000901 | 3300046507 | Bacteria | 44189 |
| 631 | Ga0495608_0001403 | 3300046511 | Bacteria | 17129 |
| 632 | Ga0495608_0030373 | 3300046511 | Bacteria | 3658 |
| 633 | Ga0495610_0016384 | 3300046512 | Bacteria | 4268 |
| 634 | Ga0495616_0008842 | 3300046513 | Bacteria | 5925 |
| 635 | Ga0495618_0005557 | 3300046514 | Bacteria | 7672 |
| 636 | Ga0495628_0000474 | 3300046516 | Bacteria | 36662 |
| 637 | Ga0495630_0009413 | 3300046517 | Bacteria | 7022 |
| 638 | Ga0495631_0048057 | 3300046518 | Bacteria | 1871 |
| 639 | Ga0495637_0151124 | 3300046520 | Bacteria | 876 |
| 640 | Ga0495643_0127745 | 3300046522 | Bacteria | 1279 |
| 641 | Ga0495644_0006387 | 3300046523 | Bacteria | 4572 |
| 642 | Ga0495644_0032391 | 3300046523 | Bacteria | 1975 |
| 643 | Ga0495663_0082322 | 3300046525 | Bacteria | 1038 |
| 644 | Ga0495666_0000159 | 3300046526 | Bacteria | 28594 |
| 645 | Ga0495666_0009188 | 3300046526 | Bacteria | 4944 |
| 646 | Ga0495666_0084806 | 3300046526 | Bacteria | 1496 |
| 647 | Ga0495642_0021852 | 3300046528 | Bacteria | 2518 |
| 648 | Ga0495642_0086357 | 3300046528 | Bacteria | 1325 |
| 649 | Ga0495652_0002709 | 3300046529 | Bacteria | 17989 |
| 650 | Ga0495665_0019002 | 3300046531 | Bacteria | 3693 |
| 651 | Ga0495665_0037286 | 3300046531 | Bacteria | 2595 |
| 652 | Ga0495665_0080813 | 3300046531 | Bacteria | 1709 |
| 653 | Ga0495640_0020019 | 3300046533 | Bacteria | 4932 |
| 654 | Ga0495640_0162456 | 3300046533 | Bacteria | 1430 |
| 655 | Ga0495586_0026784 | 3300046535 | Bacteria | 3085 |
| 656 | Ga0495587_0043831 | 3300046536 | Bacteria | 2662 |
| 657 | Ga0495587_0059704 | 3300046536 | Bacteria | 2237 |
| 658 | Ga0495598_0028709 | 3300046537 | Bacteria | 1545 |
| 659 | Ga0495609_0001971 | 3300046538 | Bacteria | 13011 |
| 660 | Ga0495609_0105115 | 3300046538 | Bacteria | 1221 |
| 661 | Ga0495621_0054078 | 3300046539 | Bacteria | 1442 |
| 662 | Ga0495633_0006686 | 3300046558 | Bacteria | 6790 |
| 663 | Ga0495633_0017678 | 3300046558 | Bacteria | 3638 |
| 664 | Ga0495633_0098736 | 3300046558 | Bacteria | 1356 |
| 665 | Ga0495656_0008886 | 3300046615 | Bacteria | 3604 |
| 666 | Ga0495668_0115968 | 3300046616 | Bacteria | 1465 |
| 667 | Ga0495634_0316048 | 3300046642 | Bacteria | 941 |
| 668 | Ga0495611_0140401 | 3300046648 | Bacteria | 1128 |
| 669 | Ga0495625_0013761 | 3300046660 | Bacteria | 6486 |
| 670 | Ga0495635_0029874 | 3300046663 | Bacteria | 3789 |
| 671 | Ga0495635_0274260 | 3300046663 | Bacteria | 1134 |
| 672 | Ga0495661_0004493 | 3300046665 | Bacteria | 10061 |
| 673 | Ga0495588_0000933 | 3300046674 | Bacteria | 12731 |
| 674 | Ga0495588_0046361 | 3300046674 | Bacteria | 2229 |
| 675 | Ga0495588_0205825 | 3300046674 | Bacteria | 1039 |
| 676 | Ga0495623_0003295 | 3300046679 | Bacteria | 10663 |
| 677 | Ga0495646_0227526 | 3300046680 | Bacteria | 1006 |
| 678 | Ga0495647_0149815 | 3300046681 | Bacteria | 999 |
| 679 | Ga0495658_0058013 | 3300046683 | Bacteria | 2213 |
| 680 | Ga0495669_0000018 | 3300046684 | Bacteria | 127866 |
| 681 | Ga0495669_0069607 | 3300046684 | Bacteria | 1602 |
| 682 | Ga0495613_0060530 | 3300046689 | Bacteria | 2773 |
| 683 | Ga0495670_0023688 | 3300046691 | Bacteria | 3031 |
| 684 | Ga0495671_0036034 | 3300046692 | Bacteria | 2509 |
| 685 | Ga0495671_0093075 | 3300046692 | Bacteria | 1475 |
| 686 | Ga0495671_0168151 | 3300046692 | Bacteria | 1066 |
| 687 | Ga0495649_0193717 | 3300046694 | Bacteria | 1057 |
| 688 | Ga0495589_0007201 | 3300046794 | Bacteria | 5826 |
| 689 | Ga0495581_0048068 | 3300047315 | Bacteria | 2464 |
| 690 | Ga0495581_0162002 | 3300047315 | Bacteria | 1308 |
| 691 | Ga0495604_0031555 | 3300047317 | Bacteria | 4201 |
| 692 | Ga0495604_0066625 | 3300047317 | Bacteria | 2738 |
| 693 | Ga0495674_0519816 | 3300047319 | Bacteria | 950 |
| 694 | Ga0495672_0007678 | 3300047320 | Bacteria | 8085 |
| 695 | Ga0495676_0000030 | 3300047321 | Bacteria | 133637 |
| 696 | Ga0495676_0000067 | 3300047321 | Bacteria | 80084 |
| 697 | Ga0495676_0076806 | 3300047321 | Bacteria | 2549 |
| 698 | Ga0495676_0087580 | 3300047321 | Bacteria | 2339 |
| 699 | Ga0495676_0092315 | 3300047321 | Bacteria | 2260 |
| 700 | Ga0495680_0064426 | 3300047322 | Bacteria | 2810 |
| 701 | Ga0495675_0003662 | 3300047444 | Bacteria | 9287 |
| 702 | Ga0495677_0074325 | 3300047445 | Bacteria | 1268 |
| 703 | Ga0495679_003833 | 3300047446 | Bacteria | 7116 |
| 704 | Ga0495673_0011511 | 3300047469 | Bacteria | 4752 |
| 705 | Ga0495673_0033095 | 3300047469 | Bacteria | 2403 |
| 706 | Ga0495684_0159062 | 3300047471 | Bacteria | 1686 |
| 707 | Ga0495593_0008063 | 3300047673 | Bacteria | 6126 |
| 708 | Ga0495602_0052501 | 3300048088 | Bacteria | 3620 |
| 709 | Ga0495614_0003665 | 3300048089 | Bacteria | 6890 |
| 710 | Ga0496101_0064373 | 3300048904 | Bacteria | 2670 |
| 711 | Ga0496101_0148668 | 3300048904 | Bacteria | 1790 |
| 712 | Ga0496102_0003048 | 3300048905 | Bacteria | 14194 |
| 713 | Ga0496102_0043842 | 3300048905 | Bacteria | 4057 |
| 714 | Ga0496102_0056580 | 3300048905 | Bacteria | 3578 |
| 715 | Ga0496103_0032512 | 3300048906 | Bacteria | 3184 |
| 716 | Ga0496103_0150428 | 3300048906 | Bacteria | 1491 |
| 717 | Ga0496104_0000455 | 3300048907 | Bacteria | 35340 |
| 718 | Ga0496104_0003616 | 3300048907 | Bacteria | 13355 |
| 719 | Ga0496104_0004195 | 3300048907 | Bacteria | 12515 |
| 720 | Ga0496104_0006892 | 3300048907 | Bacteria | 10020 |
| 721 | Ga0496104_0012202 | 3300048907 | Bacteria | 7720 |
| 722 | Ga0496104_0104808 | 3300048907 | Bacteria | 2710 |
| 723 | Ga0496104_0473765 | 3300048907 | Bacteria | 1163 |
| 724 | Ga0496105_0000139 | 3300048908 | Bacteria | 48427 |
| 725 | Ga0496105_0015534 | 3300048908 | Bacteria | 6069 |
| 726 | Ga0496105_0023268 | 3300048908 | Bacteria | 5023 |
| 727 | Ga0496105_0048578 | 3300048908 | Bacteria | 3503 |
| 728 | Ga0496106_0001067 | 3300048909 | Bacteria | 20209 |
| 729 | Ga0496106_0002328 | 3300048909 | Bacteria | 14165 |
| 730 | Ga0496106_0026340 | 3300048909 | Bacteria | 4329 |
| 731 | Ga0496107_0006188 | 3300048910 | Bacteria | 8223 |
| 732 | Ga0496107_0132216 | 3300048910 | Bacteria | 1842 |
| 733 | Ga0496108_0001155 | 3300048911 | Bacteria | 20587 |
| 734 | Ga0496108_0015292 | 3300048911 | Bacteria | 6261 |
| 735 | Ga0496108_0198231 | 3300048911 | Bacteria | 1742 |
| 736 | Ga0496109_0003275 | 3300048912 | Bacteria | 13514 |
| 737 | Ga0496109_0036119 | 3300048912 | Bacteria | 4459 |
| 738 | Ga0496109_0089378 | 3300048912 | Bacteria | 2847 |
| 739 | Ga0496110_0008762 | 3300048913 | Bacteria | 8150 |
| 740 | Ga0496110_0013586 | 3300048913 | Bacteria | 6739 |
| 741 | Ga0496110_0683774 | 3300048913 | Bacteria | 927 |
| 742 | Ga0496111_0001646 | 3300048914 | Bacteria | 12960 |
| 743 | Ga0496111_0019436 | 3300048914 | Bacteria | 4718 |
| 744 | Ga0496112_0001735 | 3300048915 | Bacteria | 17067 |
| 745 | Ga0496112_0011228 | 3300048915 | Bacteria | 8170 |
| 746 | Ga0496113_0000957 | 3300048916 | Bacteria | 15360 |
| 747 | Ga0496113_0001913 | 3300048916 | Bacteria | 11892 |
| 748 | Ga0496113_0037725 | 3300048916 | Bacteria | 3548 |
| 749 | Ga0496114_0223059 | 3300048917 | Bacteria | 1655 |
| 750 | Ga0496114_0370064 | 3300048917 | Bacteria | 1268 |
| 751 | Ga0496115_0010390 | 3300048918 | Bacteria | 6954 |
| 752 | Ga0496115_0041924 | 3300048918 | Bacteria | 3645 |
| 753 | Ga0496115_0090521 | 3300048918 | Bacteria | 2499 |
| 754 | Ga0496117_0003342 | 3300048920 | Bacteria | 18731 |
| 755 | Ga0496118_0000401 | 3300048921 | Bacteria | 73186 |
| 756 | Ga0496121_0000473 | 3300048924 | Bacteria | 78228 |
| 757 | Ga0496121_0003466 | 3300048924 | Bacteria | 22480 |
| 758 | Ga0496121_0041790 | 3300048924 | Bacteria | 4001 |
| 759 | Ga0496122_0000134 | 3300048925 | Bacteria | 171080 |
| 760 | Ga0496122_0144164 | 3300048925 | Bacteria | 1483 |
| 761 | Ga0496123_0023694 | 3300048926 | Bacteria | 4691 |
| 762 | Ga0496123_0271138 | 3300048926 | Bacteria | 825 |
| 763 | Ga0496125_0000433 | 3300048928 | Bacteria | 76686 |
| 764 | Ga0501306_018758 | 3300049127 | Bacteria | 949 |
| 765 | Ga0501310_004570 | 3300049130 | Bacteria | 1394 |
| 766 | Ga0501305_013311 | 3300049161 | Bacteria | 1136 |
| 767 | Ga0501312_018699 | 3300049528 | Bacteria | 1011 |
| 768 | Ga0501314_002536 | 3300049530 | Bacteria | 1418 |
| 769 | Ga0501317_003764 | 3300049533 | Bacteria | 1536 |
| 770 | Ga0501318_002010 | 3300049534 | Bacteria | 1703 |
| 771 | Ga0501321_001406 | 3300049537 | Bacteria | 1902 |
| 772 | Ga0501032_0000026 | 3300049569 | Bacteria | 136472 |
| 773 | Ga0501033_0000243 | 3300049570 | Bacteria | 52328 |
| 774 | Ga0501033_0055773 | 3300049570 | Bacteria | 2921 |
| 775 | Ga0501034_0000054 | 3300049571 | Bacteria | 206373 |
| 776 | Ga0501034_0063114 | 3300049571 | Bacteria | 3718 |
| 777 | Ga0501034_0532804 | 3300049571 | Bacteria | 1085 |
| 778 | Ga0501036_0000082 | 3300049572 | Bacteria | 58711 |
| 779 | Ga0501037_0000032 | 3300049573 | Bacteria | 132863 |
| 780 | Ga0501038_0000018 | 3300049574 | Bacteria | 155191 |
| 781 | Ga0501038_0446241 | 3300049574 | Bacteria | 995 |
| 782 | Ga0501039_0000018 | 3300049575 | Bacteria | 176187 |
| 783 | Ga0501043_0000014 | 3300049579 | Bacteria | 184687 |
| 784 | Ga0501047_0004660 | 3300049581 | Bacteria | 12902 |
| 785 | Ga0501047_0249453 | 3300049581 | Bacteria | 1624 |
| 786 | Ga0501047_0294645 | 3300049581 | Bacteria | 1466 |
| 787 | Ga0501067_0084440 | 3300049583 | Bacteria | 1761 |
| 788 | Ga0501067_0100581 | 3300049583 | Bacteria | 1606 |
| 789 | Ga0501068_0146286 | 3300049584 | Bacteria | 1483 |
| 790 | Ga0501069_0057827 | 3300049585 | Bacteria | 2162 |
| 791 | Ga0501070_0006142 | 3300049586 | Bacteria | 10241 |
| 792 | Ga0501070_0048560 | 3300049586 | Bacteria | 3525 |
| 793 | Ga0501073_0000067 | 3300049589 | Bacteria | 64981 |
| 794 | Ga0501074_0013085 | 3300049590 | Bacteria | 6031 |
| 795 | Ga0501076_0435709 | 3300049592 | Bacteria | 1079 |
| 796 | Ga0501202_095239 | 3300049652 | Bacteria | 718 |
| 797 | Ga0501079_0063334 | 3300049741 | Bacteria | 2853 |
| 798 | Ga0501080_0016551 | 3300049742 | Bacteria | 6812 |
| 799 | Ga0501080_0146178 | 3300049742 | Bacteria | 2185 |
| 800 | Ga0501080_0166555 | 3300049742 | Bacteria | 2033 |
| 801 | Ga0501035_0000019 | 3300049822 | Bacteria | 241152 |
| 802 | Ga0501044_0000969 | 3300049823 | Bacteria | 34557 |
| 803 | Ga0501044_0083555 | 3300049823 | Bacteria | 3229 |
| 804 | Ga0501044_0086056 | 3300049823 | Bacteria | 3176 |
| 805 | Ga0501044_0099629 | 3300049823 | Bacteria | 2924 |
| 806 | Ga0501044_0311371 | 3300049823 | Bacteria | 1501 |
| 807 | Ga0501044_0477679 | 3300049823 | Bacteria | 1150 |
| 808 | Ga0501045_0274181 | 3300049824 | Bacteria | 1256 |
| 809 | nmdc:mga0yw44_73973_c1 | 3300050492 | Bacteria | 2121 |
| 810 | nmdc:mga0k408_4176_c1 | 3300050493 | Bacteria | 7666 |
| 811 | nmdc:mga05p37_19291_c1 | 3300050507 | Bacteria | 8247 |
| 812 | nmdc:mga05p37_33296_c1 | 3300050507 | Bacteria | 6311 |
| 813 | nmdc:mga08y16_194610_c1 | 3300050511 | Bacteria | 2102 |
| 814 | nmdc:mga08y16_29822_c1 | 3300050511 | Bacteria | 5744 |
| 815 | nmdc:mga0n895_101235_c1 | 3300050512 | Bacteria | 2891 |
| 816 | nmdc:mga0n895_130655_c1 | 3300050512 | Bacteria | 2536 |
| 817 | nmdc:mga0n895_322418_c1 | 3300050512 | Bacteria | 1566 |
| 818 | nmdc:mga0a205_309367_c1 | 3300050515 | Bacteria | 1452 |
| 819 | Ga0495612_0030611 | 3300053078 | Bacteria | 2168 |
| 820 | Ga0495655_0023600 | 3300053083 | Bacteria | 1420 |
| 821 | Ga0495619_0284028 | 3300053085 | Bacteria | 1147 |
| 822 | Ga0500572_000274 | 3300053111 | Bacteria | 18700 |
| 823 | Ga0500559_0000053 | 3300053136 | Bacteria | 90779 |
| 824 | Ga0500568_0009740 | 3300053139 | Bacteria | 4548 |
| 825 | Ga0500611_002322 | 3300053727 | Bacteria | 2257 |
| 826 | Ga0501082_0017352 | 3300060353 | Bacteria | 6201 |
| 827 | Ga0466962_0001020 | 3300061719 | Bacteria | 12802 |
| 828 | 2511250682 | 2511231003 | Bacteria | 5606035 |
| 829 | 2511383288 | 2511231026 | Bacteria | 5225445 |
| 830 | 2515689302 | 2515154123 | Bacteria | 6387382 |
| 831 | 2521558520 | 2521172590 | Bacteria | 5047645 |
| 832 | 2524438228 | 2524023205 | Bacteria | 8918781 |
| 833 | 2550694049 | 2548876994 | Bacteria | 4904866 |
| 834 | 2553004147 | 2551306416 | Bacteria | 6152985 |
| 835 | 2596375629 | 2595698237 | Bacteria | 6712432 |
| 836 | 2599446307 | 2599185178 | Bacteria | 5365746 |
| 837 | 2643754563 | 2643221547 | Bacteria | 4740017 |
| 838 | 2723875956 | 2721755763 | Bacteria | 4464185 |
| 839 | 2728751850 | 2728368998 | Bacteria | 8720350 |
| 840 | 2765569625 | 2765235838 | Bacteria | 5445269 |
| 841 | 2793062817 | 2791355196 | Bacteria | 7323613 |
| 842 | 2808981982 | 2808606386 | Bacteria | 4471946 |
| 843 | 2809131605 | 2808606415 | Bacteria | 4576710 |
| 844 | 2809151227 | 2808606419 | Bacteria | 4576925 |
| 845 | 2819591843 | 2818991445 | Bacteria | 4955017 |
| 846 | 2819614258 | 2818991449 | Bacteria | 5518009 |
| 847 | 2819718076 | 2818991467 | Bacteria | 5893227 |
| 848 | 2839097456 | 2839094727 | Bacteria | 5534556 |
| 849 | 2842340282 | 2842333319 | Bacteria | 8899485 |
| 850 | 2852622491 | 2852618963 | Bacteria | 4577824 |
| 851 | 2854684968 | 2854681122 | Bacteria | 4548679 |
| 852 | 2854896847 | 2854896431 | Bacteria | 5869725 |
| 853 | 2884816766 | 2884811622 | Bacteria | 5552861 |
| 854 | 2884837649 | 2884836552 | Bacteria | 5219991 |
| 855 | 2884853940 | 2884852848 | Bacteria | 5221161 |
| 856 | 2889307414 | 2889306138 | Bacteria | 6358934 |
| 857 | 2889309490 | 2889306138 | Bacteria | 6358934 |
| 858 | 2894235853 | 2894232714 | Bacteria | 8834183 |
| 859 | 2896154943 | 2896154374 | Bacteria | 5221518 |
| 860 | 2902332679 | 2902330777 | Bacteria | 6395352 |
| 861 | 2902408737 | 2902405164 | Bacteria | 6784948 |
| 862 | 2904429901 | 2904424332 | Bacteria | 7633521 |
| 863 | 2904445196 | 2904439833 | Bacteria | 5931679 |
| 864 | 2904534218 | 2904530477 | Bacteria | 5876334 |
| 865 | 2904588941 | 2904584206 | Bacteria | 6028872 |
| 866 | 2904590578 | 2904589729 | Bacteria | 6113573 |
| 867 | 2904603552 | 2904601388 | Bacteria | 5884906 |
| 868 | 2917700468 | 2917699015 | Bacteria | 7043791 |
| 869 | 2919046945 | 2919046199 | Bacteria | 5567169 |
| 870 | 2919080440 | 2919079590 | Bacteria | 5946433 |
| 871 | 2923511984 | 2923510766 | Bacteria | 5926163 |
| 872 | 2928130179 | 2928125067 | Bacteria | 5937560 |
| 873 | 2928131705 | 2928130867 | Bacteria | 5467269 |
| 874 | 643597835 | 643348564 | Bacteria | 8839022 |
| 875 | 8045864746 | 8045864390 | Bacteria | 5043873 |
| 876 | 8054566056 | 8054563764 | Bacteria | 5592885 |
| 877 | 8055228679 | 8055225921 | Bacteria | 3341787 |
| 878 | Ga0068853_100623260 | |||
| 879 | JGI24743J22301_10005709 | |||
| 880 | JGI24034J26672_10009435 | |||
| 881 | JGI24742J22300_10006380 | |||
| 882 | JGI25155J39150_1000076 | |||
| 883 | JGI25155J39150_1000567 | |||
| 884 | JGI25156J39149_1000032 | |||
| 885 | JGI25156J39149_1002064 | |||
| 886 | JGI25156J39149_1003734 | |||
| 887 | JGI25162J39368_1004764 | |||
| 888 | JGI25154J39366_1000095 | |||
| 889 | JGI25154J39366_1000223 | |||
| 890 | JGI25157J39369_1000388 | |||
| 891 | JGI25159J45721_1004525 | |||
| 892 | JGI25151J46595_10000079 | |||
| 893 | Ga0055538_1000002 | |||
| 894 | Ga0055539_1000002 | |||
| 895 | Ga0055533_1000004 | |||
| 896 | Ga0055532_1000083 | |||
| 897 | Ga0055525_1000002 | |||
| 898 | Ga0055535_1012982 | |||
| 899 | Ga0055526_1000718 | |||
| 900 | Ga0055524_1000147 | |||
| 901 | Ga0055524_1005161 | |||
| 902 | Ga0055541_1000002 | |||
| 903 | Ga0065165_1000306 | |||
| 904 | Ga0065712_10086790 | |||
| 905 | Ga0070658_10018562 | |||
| 906 | Ga0070658_10034943 | |||
| 907 | Ga0070658_10112763 | |||
| 908 | Ga0070658_10250922 | |||
| 909 | Ga0070676_10031151 | |||
| 910 | Ga0070683_100352660 | |||
| 911 | Ga0070690_100020880 | |||
| 912 | Ga0070690_100082456 | |||
| 913 | Ga0070670_100012362 | |||
| 914 | Ga0070670_100069368 | |||
| 915 | Ga0070670_100201684 | |||
| 916 | Ga0070670_100264755 | |||
| 917 | Ga0068869_100071537 | |||
| 918 | Ga0068869_100076940 | |||
| 919 | Ga0068869_100089529 | |||
| 920 | Ga0070666_10055078 | |||
| 921 | Ga0070666_10209223 | |||
| 922 | Ga0070680_100001454 | |||
| 923 | Ga0070680_100002828 | |||
| 924 | Ga0070682_100037646 | |||
| 925 | Ga0068868_100043322 | |||
| 926 | Ga0070660_100000414 | |||
| 927 | Ga0070660_100007676 | |||
| 928 | Ga0070660_100025623 | |||
| 929 | Ga0070660_100029654 | |||
| 930 | Ga0070660_100043495 | |||
| 931 | Ga0070660_100084771 | |||
| 932 | Ga0070660_100108342 | |||
| 933 | Ga0070660_100293491 | |||
| 934 | Ga0070689_100019359 | |||
| 935 | Ga0070689_100126351 | |||
| 936 | Ga0070689_100219097 | |||
| 937 | Ga0070691_10002244 | |||
| 938 | Ga0070691_10042038 | |||
| 939 | Ga0070687_100121609 | |||
| 940 | Ga0070661_100001393 | |||
| 941 | Ga0070661_100228154 | |||
| 942 | Ga0070692_10033004 | |||
| 943 | Ga0070668_100399072 | |||
| 944 | Ga0070669_100013267 | |||
| 945 | Ga0070669_100277956 | |||
| 946 | Ga0070675_100000047 | |||
| 947 | Ga0070675_100003166 | |||
| 948 | Ga0070675_100003200 | |||
| 949 | Ga0070675_100016822 | |||
| 950 | Ga0070675_100039428 | |||
| 951 | Ga0070675_100221126 | |||
| 952 | Ga0070671_100003924 | |||
| 953 | Ga0070671_100028246 | |||
| 954 | Ga0070671_100060943 | |||
| 955 | Ga0070673_100002755 | |||
| 956 | Ga0070673_100009518 | |||
| 957 | Ga0070688_100008728 | |||
| 958 | Ga0070688_100283604 | |||
| 959 | Ga0070688_100284513 | |||
| 960 | Ga0070659_100000526 | |||
| 961 | Ga0070659_100018531 | |||
| 962 | Ga0070659_100041122 | |||
| 963 | Ga0070659_100109435 | |||
| 964 | Ga0070659_100117968 | |||
| 965 | Ga0070667_100123125 | |||
| 966 | Ga0070703_10002040 | |||
| 967 | Ga0070714_100011555 | |||
| 968 | Ga0070713_100006994 | |||
| 969 | Ga0070713_100197303 | |||
| 970 | Ga0070710_10152324 | |||
| 971 | Ga0070701_10002126 | |||
| 972 | Ga0070701_10071198 | |||
| 973 | Ga0070711_100113147 | |||
| 974 | Ga0070705_100000070 | |||
| 975 | Ga0070700_100001054 | |||
| 976 | Ga0070700_100033455 | |||
| 977 | Ga0070694_100001284 | |||
| 978 | Ga0070708_100211552 | |||
| 979 | Ga0070663_100002090 | |||
| 980 | Ga0070663_100003639 | |||
| 981 | Ga0070662_100000260 | |||
| 982 | Ga0070681_10005497 | |||
| 983 | Ga0070681_10092407 | |||
| 984 | Ga0070681_10287940 | |||
| 985 | Ga0068867_100045778 | |||
| 986 | Ga0068867_100528315 | |||
| 987 | Ga0070698_100174104 | |||
| 988 | Ga0070699_100002047 | |||
| 989 | Ga0070679_100011047 | |||
| 990 | Ga0070679_100025904 | |||
| 991 | Ga0070679_100057189 | |||
| 992 | Ga0070679_100062826 | |||
| 993 | Ga0070679_100096263 | |||
| 994 | Ga0070679_100421749 | |||
| 995 | Ga0070684_100088797 | |||
| 996 | Ga0070684_100156418 | |||
| 997 | Ga0068853_100001673 | |||
| 998 | Ga0068853_100055480 | |||
| 999 | Ga0068853_100071638 | |||
| 1000 | Ga0068853_100211279 | |||
| 1001 | Ga0070672_100016809 | |||
| 1002 | Ga0070672_100038229 | |||
| 1003 | Ga0070686_100032215 | |||
| 1004 | Ga0070686_100051768 | |||
| 1005 | Ga0070686_100142483 | |||
| 1006 | Ga0070695_100000961 | |||
| 1007 | Ga0070695_100245482 | |||
| 1008 | Ga0070696_100000787 | |||
| 1009 | Ga0070696_100003444 | |||
| 1010 | Ga0070693_100150948 | |||
| 1011 | Ga0070665_100077618 | |||
| 1012 | Ga0070665_100125115 | |||
| 1013 | Ga0070665_100173026 | |||
| 1014 | Ga0070704_100001472 | |||
| 1015 | Ga0070704_100019492 | |||
| 1016 | Ga0070704_100120867 | |||
| 1017 | Ga0068855_100000055 | |||
| 1018 | Ga0068855_100000110 | |||
| 1019 | Ga0068855_100007699 | |||
| 1020 | Ga0068855_100025547 | |||
| 1021 | Ga0068855_100093172 | |||
| 1022 | Ga0068855_100149825 | |||
| 1023 | Ga0068855_100190252 | |||
| 1024 | Ga0068855_100260802 | |||
| 1025 | Ga0068855_100316770 | |||
| 1026 | Ga0068855_100411777 | |||
| 1027 | Ga0070664_100000378 | |||
| 1028 | Ga0070664_100010769 | |||
| 1029 | Ga0070664_100055996 | |||
| 1030 | Ga0070664_100077109 | |||
| 1031 | Ga0070664_100210121 | |||
| 1032 | Ga0070664_100243081 | |||
| 1033 | Ga0070664_100268732 | |||
| 1034 | Ga0068857_100040684 | |||
| 1035 | Ga0068857_100140746 | |||
| 1036 | Ga0068857_100244042 | |||
| 1037 | Ga0068857_100402341 | |||
| 1038 | Ga0068854_100008843 | |||
| 1039 | Ga0068854_100017510 | |||
| 1040 | Ga0068854_100129464 | |||
| 1041 | Ga0068856_100000111 | |||
| 1042 | Ga0068856_100014426 | |||
| 1043 | Ga0068856_100028653 | |||
| 1044 | Ga0068856_100651604 | |||
| 1045 | Ga0070702_100111537 | |||
| 1046 | Ga0068852_100003379 | |||
| 1047 | Ga0068852_100349420 | |||
| 1048 | Ga0068852_100424630 | |||
| 1049 | Ga0068859_100000540 | |||
| 1050 | Ga0068859_100006985 | |||
| 1051 | Ga0068859_100020770 | |||
| 1052 | Ga0068859_100090120 | |||
| 1053 | Ga0068864_100094812 | |||
| 1054 | Ga0068851_10072499 | |||
| 1055 | Ga0068851_10168028 | |||
| 1056 | Ga0068851_10233951 | |||
| 1057 | Ga0068870_10016704 | |||
| 1058 | Ga0068863_100000482 | |||
| 1059 | Ga0068863_100046317 | |||
| 1060 | Ga0068863_100143017 | |||
| 1061 | Ga0068858_100072148 | |||
| 1062 | Ga0068858_100585377 | |||
| 1063 | Ga0068860_100002026 | |||
| 1064 | Ga0068860_100004449 | |||
| 1065 | Ga0068860_100104218 | |||
| 1066 | Ga0068862_100001012 | |||
| 1067 | Ga0081455_10115957 | |||
| 1068 | Ga0081539_10019491 | |||
| 1069 | Ga0075365_10007935 | |||
| 1070 | Ga0075365_10094270 | |||
| 1071 | Ga0075363_100097150 | |||
| 1072 | Ga0075367_10146917 | |||
| 1073 | Ga0075369_10007679 | |||
| 1074 | Ga0097621_100001740 | |||
| 1075 | Ga0097621_100122580 | |||
| 1076 | Ga0068871_100036976 | |||
| 1077 | Ga0068871_100070256 | |||
| 1078 | Ga0075434_100087811 | |||
| 1079 | Ga0075434_100191262 | |||
| 1080 | Ga0097620_100000540 | |||
| 1081 | Ga0097620_100006985 | |||
| 1082 | Ga0097620_100020770 | |||
| 1083 | Ga0097620_100090121 | |||
| 1084 | Ga0099825_1042400 | |||
| 1085 | Ga0099824_1018508 | |||
| 1086 | Ga0099822_1006503 | |||
| 1087 | Ga0079104_1004906 | |||
| 1088 | Ga0075435_100025364 | |||
| 1089 | Ga0105251_10083050 | |||
| 1090 | Ga0105240_10007018 | |||
| 1091 | Ga0105240_10007251 | |||
| 1092 | Ga0105240_10008689 | |||
| 1093 | Ga0105240_10014573 | |||
| 1094 | Ga0105240_10027626 | |||
| 1095 | Ga0105240_10192764 | |||
| 1096 | Ga0105240_10365685 | |||
| 1097 | Ga0105240_10483225 | |||
| 1098 | Ga0111539_10011976 | |||
| 1099 | Ga0111539_10022710 | |||
| 1100 | Ga0111539_10128782 | |||
| 1101 | Ga0111539_10144393 | |||
| 1102 | Ga0105245_10335375 | |||
| 1103 | Ga0105247_10087642 | |||
| 1104 | Ga0114129_10205160 | |||
| 1105 | Ga0114129_10391670 | |||
| 1106 | Ga0105243_10019973 | |||
| 1107 | Ga0105241_10005236 | |||
| 1108 | Ga0105242_10037406 | |||
| 1109 | Ga0105242_10417449 | |||
| 1110 | Ga0105248_10028635 | |||
| 1111 | Ga0105248_10123691 | |||
| 1112 | Ga0105248_10135888 | |||
| 1113 | Ga0105248_10145682 | |||
| 1114 | Ga0105248_10161752 | |||
| 1115 | Ga0105248_10255890 | |||
| 1116 | Ga0105248_10549831 | |||
| 1117 | Ga0105237_10051247 | |||
| 1118 | Ga0105237_10102457 | |||
| 1119 | Ga0105237_10281050 | |||
| 1120 | Ga0105237_10289384 | |||
| 1121 | Ga0105238_10001827 | |||
| 1122 | Ga0105238_10044711 | |||
| 1123 | Ga0105238_10070544 | |||
| 1124 | Ga0105249_10150379 | |||
| 1125 | Ga0105239_10163183 | |||
| 1126 | Ga0105239_10259904 | |||
| 1127 | Ga0105246_10067320 | |||
| 1128 | Ga0157371_10000248 | |||
| 1129 | Ga0157371_10226485 | |||
| 1130 | Ga0157370_10004460 | |||
| 1131 | Ga0157370_10006449 | |||
| 1132 | Ga0157370_10011079 | |||
| 1133 | Ga0157370_10046276 | |||
| 1134 | Ga0157370_10056647 | |||
| 1135 | Ga0157370_10065888 | |||
| 1136 | Ga0157370_10087663 | |||
| 1137 | Ga0157370_10103781 | |||
| 1138 | Ga0157370_10301095 | |||
| 1139 | Ga0157369_10002981 | |||
| 1140 | Ga0157369_10009381 | |||
| 1141 | Ga0157369_10526916 | |||
| 1142 | Ga0157369_10582756 | |||
| 1143 | Ga0171462_1033 | |||
| 1144 | Ga0157374_10079283 | |||
| 1145 | Ga0157374_10114698 | |||
| 1146 | Ga0157378_10254433 | |||
| 1147 | Ga0163162_10003469 | |||
| 1148 | Ga0157372_10000468 | |||
| 1149 | Ga0157372_10072433 | |||
| 1150 | Ga0157372_10081535 | |||
| 1151 | Ga0157372_10164788 | |||
| 1152 | Ga0157372_10250568 | |||
| 1153 | Ga0157372_10342671 | |||
| 1154 | Ga0157372_10426810 | |||
| 1155 | Ga0157372_10539410 | |||
| 1156 | Ga0157375_10001118 | |||
| 1157 | Ga0157375_10058966 | |||
| 1158 | Ga0163163_10006158 | |||
| 1159 | Ga0163163_10134066 | |||
| 1160 | Ga0163163_10292736 | |||
| 1161 | Ga0163163_10294975 | |||
| 1162 | Ga0163163_10311496 | |||
| 1163 | Ga0157380_10053274 | |||
| 1164 | Ga0157377_10025992 | |||
| 1165 | Ga0157377_10316143 | |||
| 1166 | Ga0157379_10000226 | |||
| 1167 | Ga0157379_10143572 | |||
| 1168 | Ga0182006_1000685 | |||
| 1169 | Ga0182007_10038195 | |||
| 1170 | Ga0163161_10036130 | |||
| 1171 | Ga0163161_10069471 | |||
| 1172 | Ga0206353_10103469 | |||
| 1173 | Ga0213872_10005720 | |||
| 1174 | Ga0213876_10046609 | |||
| 1175 | Ga0213875_10016710 | |||
| 1176 | Ga0213875_10082261 | |||
| 1177 | Ga0213875_10096126 | |||
| 1178 | Ga0213875_10100885 | |||
| 1179 | Ga0209435_100013 | |||
| 1180 | Ga0209435_100379 | |||
| 1181 | Ga0209784_100002 | |||
| 1182 | Ga0209566_100003 | |||
| 1183 | Ga0209674_100004 | |||
| 1184 | Ga0209147_100030 | |||
| 1185 | Ga0209563_100006 | |||
| 1186 | Ga0209437_100419 | |||
| 1187 | Ga0209258_100433 | |||
| 1188 | Ga0209646_1000021 | |||
| 1189 | Ga0209646_1000034 | |||
| 1190 | Ga0209026_1000022 | |||
| 1191 | Ga0209026_1001565 | |||
| 1192 | Ga0209677_100003 | |||
| 1193 | Ga0209759_1000018 | |||
| 1194 | Ga0209759_1000100 | |||
| 1195 | Ga0209233_1034338 | |||
| 1196 | Ga0209673_1017561 | |||
| 1197 | Ga0209130_1000111 | |||
| 1198 | Ga0207673_1000127 | |||
| 1199 | Ga0209675_1001117 | |||
| 1200 | Ga0209025_1000014 | |||
| 1201 | Ga0209025_1001499 | |||
| 1202 | Ga0209564_1000179 | |||
| 1203 | Ga0209256_1000055 | |||
| 1204 | Ga0209256_1000102 | |||
| 1205 | Ga0209256_1033389 | |||
| 1206 | Ga0207697_10017438 | |||
| 1207 | Ga0207656_10026268 | |||
| 1208 | Ga0207656_10026269 | |||
| 1209 | Ga0207656_10111912 | |||
| 1210 | Ga0207682_10009230 | |||
| 1211 | Ga0207692_10251953 | |||
| 1212 | Ga0207710_10048570 | |||
| 1213 | Ga0207688_10002018 | |||
| 1214 | Ga0207680_10044443 | |||
| 1215 | Ga0207647_10018756 | |||
| 1216 | Ga0207647_10021879 | |||
| 1217 | Ga0207647_10093776 | |||
| 1218 | Ga0207647_10179160 | |||
| 1219 | Ga0207699_10168463 | |||
| 1220 | Ga0207645_10014390 | |||
| 1221 | Ga0207645_10080323 | |||
| 1222 | Ga0207643_10005305 | |||
| 1223 | Ga0207705_10007617 | |||
| 1224 | Ga0207705_10037355 | |||
| 1225 | Ga0207705_10067806 | |||
| 1226 | Ga0207705_10192267 | |||
| 1227 | Ga0207654_10004070 | |||
| 1228 | Ga0207654_10026836 | |||
| 1229 | Ga0207707_10030136 | |||
| 1230 | Ga0207707_10077177 | |||
| 1231 | Ga0207707_10084215 | |||
| 1232 | Ga0207707_10176638 | |||
| 1233 | Ga0207695_10000896 | |||
| 1234 | Ga0207695_10009589 | |||
| 1235 | Ga0207695_10029551 | |||
| 1236 | Ga0207695_10055460 | |||
| 1237 | Ga0207695_10105955 | |||
| 1238 | Ga0207695_10171105 | |||
| 1239 | Ga0207695_10308035 | |||
| 1240 | Ga0207671_10215167 | |||
| 1241 | Ga0207671_10313599 | |||
| 1242 | Ga0207660_10025362 | |||
| 1243 | Ga0207660_10025923 | |||
| 1244 | Ga0207660_10083052 | |||
| 1245 | Ga0207660_10133347 | |||
| 1246 | Ga0207662_10076289 | |||
| 1247 | Ga0207657_10000894 | |||
| 1248 | Ga0207657_10000910 | |||
| 1249 | Ga0207657_10010420 | |||
| 1250 | Ga0207657_10012583 | |||
| 1251 | Ga0207657_10032705 | |||
| 1252 | Ga0207657_10094060 | |||
| 1253 | Ga0207657_10104907 | |||
| 1254 | Ga0207657_10147206 | |||
| 1255 | Ga0207649_10008175 | |||
| 1256 | Ga0207649_10015173 | |||
| 1257 | Ga0207649_10217186 | |||
| 1258 | Ga0207652_10007193 | |||
| 1259 | Ga0207652_10028301 | |||
| 1260 | Ga0207652_10048462 | |||
| 1261 | Ga0207652_10051659 | |||
| 1262 | Ga0207652_10244174 | |||
| 1263 | Ga0207681_10169790 | |||
| 1264 | Ga0207694_10003746 | |||
| 1265 | Ga0207694_10100452 | |||
| 1266 | Ga0207694_10153090 | |||
| 1267 | Ga0207694_10320744 | |||
| 1268 | Ga0207650_10004859 | |||
| 1269 | Ga0207650_10007669 | |||
| 1270 | Ga0207650_10050178 | |||
| 1271 | Ga0207659_10014380 | |||
| 1272 | Ga0207659_10014390 | |||
| 1273 | Ga0207659_10026030 | |||
| 1274 | Ga0207659_10027271 | |||
| 1275 | Ga0207659_10106897 | |||
| 1276 | Ga0207659_10159237 | |||
| 1277 | Ga0207700_10035789 | |||
| 1278 | Ga0207700_10170377 | |||
| 1279 | Ga0207664_10006045 | |||
| 1280 | Ga0207644_10019042 | |||
| 1281 | Ga0207690_10000194 | |||
| 1282 | Ga0207690_10063622 | |||
| 1283 | Ga0207690_10151633 | |||
| 1284 | Ga0207690_10224436 | |||
| 1285 | Ga0207706_10000008 | |||
| 1286 | Ga0207706_10002914 | |||
| 1287 | Ga0207686_10038644 | |||
| 1288 | Ga0207686_10478190 | |||
| 1289 | Ga0207709_10042244 | |||
| 1290 | Ga0207670_10039589 | |||
| 1291 | Ga0207670_10100957 | |||
| 1292 | Ga0207669_10077183 | |||
| 1293 | Ga0207669_10212045 | |||
| 1294 | Ga0207691_10016366 | |||
| 1295 | Ga0207691_10033742 | |||
| 1296 | Ga0207691_10061595 | |||
| 1297 | Ga0207711_10003837 | |||
| 1298 | Ga0207711_10083534 | |||
| 1299 | Ga0207711_10224911 | |||
| 1300 | Ga0207689_10028886 | |||
| 1301 | Ga0207689_10250682 | |||
| 1302 | Ga0207661_10026953 | |||
| 1303 | Ga0207679_10000934 | |||
| 1304 | Ga0207679_10027208 | |||
| 1305 | Ga0207679_10040686 | |||
| 1306 | Ga0207679_10133355 | |||
| 1307 | Ga0207679_10179854 | |||
| 1308 | Ga0207679_10183517 | |||
| 1309 | Ga0207667_10000032 | |||
| 1310 | Ga0207667_10001326 | |||
| 1311 | Ga0207667_10008233 | |||
| 1312 | Ga0207667_10013259 | |||
| 1313 | Ga0207667_10025214 | |||
| 1314 | Ga0207667_10033295 | |||
| 1315 | Ga0207667_10068397 | |||
| 1316 | Ga0207667_10273652 | |||
| 1317 | Ga0207667_10310771 | |||
| 1318 | Ga0207667_10554070 | |||
| 1319 | Ga0207651_10003519 | |||
| 1320 | Ga0207651_10021459 | |||
| 1321 | Ga0207651_10056016 | |||
| 1322 | Ga0207651_10381021 | |||
| 1323 | Ga0207712_10014486 | |||
| 1324 | Ga0207712_10313431 | |||
| 1325 | Ga0207712_10471852 | |||
| 1326 | Ga0207640_10004677 | |||
| 1327 | Ga0207640_10012816 | |||
| 1328 | Ga0207640_10140103 | |||
| 1329 | Ga0207640_10363612 | |||
| 1330 | Ga0207658_10054168 | |||
| 1331 | Ga0207658_10056134 | |||
| 1332 | Ga0207677_10335920 | |||
| 1333 | Ga0207703_10061310 | |||
| 1334 | Ga0207639_10002823 | |||
| 1335 | Ga0207639_10041392 | |||
| 1336 | Ga0207639_10043729 | |||
| 1337 | Ga0207639_10144336 | |||
| 1338 | Ga0207639_10399999 | |||
| 1339 | Ga0207678_10008479 | |||
| 1340 | Ga0207678_10009793 | |||
| 1341 | Ga0207678_10013310 | |||
| 1342 | Ga0207678_10603928 | |||
| 1343 | Ga0207708_10000440 | |||
| 1344 | Ga0207708_10046499 | |||
| 1345 | Ga0207708_10302454 | |||
| 1346 | Ga0207702_10000510 | |||
| 1347 | Ga0207702_10034707 | |||
| 1348 | Ga0207641_10002558 | |||
| 1349 | Ga0207641_10417469 | |||
| 1350 | Ga0207648_10016548 | |||
| 1351 | Ga0207648_10127558 | |||
| 1352 | Ga0207676_10050123 | |||
| 1353 | Ga0207676_10057721 | |||
| 1354 | Ga0207674_10000709 | |||
| 1355 | Ga0207674_10031602 | |||
| 1356 | Ga0207674_10037960 | |||
| 1357 | Ga0207674_10124228 | |||
| 1358 | Ga0207674_10128967 | |||
| 1359 | Ga0207674_10366378 | |||
| 1360 | Ga0207674_10473279 | |||
| 1361 | Ga0207675_100011223 | |||
| 1362 | Ga0207675_100059656 | |||
| 1363 | Ga0207683_10211816 | |||
| 1364 | Ga0207698_10017290 | |||
| 1365 | Ga0209589_1000276 | |||
| 1366 | Ga0209489_100714 | |||
| 1367 | Ga0209700_100732 | |||
| 1368 | Ga0209983_1010276 | |||
| 1369 | Ga0209971_1004023 | |||
| 1370 | Ga0209971_1014099 | |||
| 1371 | Ga0209974_10000194 | |||
| 1372 | Ga0209974_10001758 | |||
| 1373 | Ga0207428_10060550 | |||
| 1374 | Ga0207428_10189003 | |||
| 1375 | Ga0268266_10127191 | |||
| 1376 | Ga0268266_10571213 | |||
| 1377 | Ga0268265_10014552 | |||
| 1378 | Ga0268265_10443594 | |||
| 1379 | Ga0268264_10002236 | |||
| 1380 | Ga0268264_10019143 | |||
| 1381 | Ga0268264_10025590 | |||
| 1382 | Ga0268264_10511906 | |||
| 1383 | Ga0265337_1016644 | |||
| 1384 | Ga0265760_10050084 | |||
| 1385 | Ga0265330_10070485 | |||
| 1386 | Ga0265332_10001524 | |||
| 1387 | Ga0265328_10004422 | |||
| 1388 | Ga0265325_10000406 | |||
| 1389 | Ga0265329_10008728 | |||
| 1390 | Ga0265340_10003673 | |||
| 1391 | Ga0265339_10020973 | |||
| 1392 | Ga0265327_10026872 | |||
| 1393 | Ga0265316_10014787 | |||
| 1394 | Ga0265316_10081573 | |||
| 1395 | Ga0307513_10129248 | |||
| 1396 | Ga0307408_100068146 | |||
| 1397 | Ga0307408_100427436 | |||
| 1398 | Ga0265313_10001452 | |||
| 1399 | Ga0265314_10000523 | |||
| 1400 | Ga0307405_10043573 | |||
| 1401 | Ga0307405_10092697 | |||
| 1402 | Ga0307410_10005780 | |||
| 1403 | Ga0307406_10203757 | |||
| 1404 | Ga0307407_10006689 | |||
| 1405 | Ga0307409_100176336 | |||
| 1406 | Ga0307416_100018117 | |||
| 1407 | Ga0307416_100399303 | |||
| 1408 | Ga0307415_100022830 | |||
| 1409 | Ga0373926_0007792 | |||
| 1410 | Ga0373944_0004353 | |||
| 1411 | Ga0373923_0064730 | |||
| 1412 | Ga0373936_0029866 | |||
| 1413 | Ga0373945_0061322 | |||
| 1414 | Ga0373953_0030840 | |||
| 1415 | Ga0373953_0129156 | |||
| 1416 | Ga0373943_0034956 | |||
| 1417 | Ga0373943_0136844 | |||
| 1418 | Ga0373946_0030549 | |||
| 1419 | Ga0373946_0072146 | |||
| 1420 | Ga0373946_0182228 | |||
| 1421 | Ga0373955_0080851 | |||
| 1422 | Ga0373955_0298499 | |||
| 1423 | Ga0373924_0132299 | |||
| 1424 | Ga0373931_0163058 | |||
| 1425 | Ga0373935_0149940 | |||
| 1426 | Ga0373935_0205045 | |||
| 1427 | Ga0373927_0113068 | |||
| 1428 | Ga0373927_0178399 | |||
| 1429 | Ga0373947_0018501 | |||
| 1430 | Ga0373947_0062207 | |||
| 1431 | Ga0373947_0143388 | |||
| 1432 | Ga0373937_0061179 | |||
| 1433 | Ga0373937_0100529 | |||
| 1434 | Ga0373937_0111265 | |||
| 1435 | Ga0373925_0178582 | |||
| 1436 | Ga0373925_0565691 | |||
| 1437 | Ga0395899_0005348 | |||
| 1438 | Ga0395899_0028642 | |||
| 1439 | Ga0395900_0028376 | |||
| 1440 | Ga0395900_0163032 | |||
| 1441 | Ga0395898_0078503 | |||
| 1442 | Ga0395898_0094384 | |||
| 1443 | Ga0395905_0000772 | |||
| 1444 | Ga0395905_0008320 | |||
| 1445 | Ga0395905_0038129 | |||
| 1446 | Ga0395905_0125531 | |||
| 1447 | Ga0395905_0143222 | |||
| 1448 | Ga0395905_0155175 | |||
| 1449 | Ga0436364_0687681 | |||
| 1450 | Ga0436364_0920462 | |||
| 1451 | Ga0436364_1333790 | |||
| 1452 | Ga0436364_1400673 | |||
| 1453 | Ga0436364_1422510 | |||
| 1454 | Ga0395901_0294571 | |||
| 1455 | Ga0395901_0544803 | |||
| 1456 | Ga0237816_00954 | |||
| 1457 | Ga0436365_0849376 | |||
| 1458 | Ga0436361_0564858 | |||
| 1459 | Ga0436362_0744013 | |||
| 1460 | Ga0451577_0040855 | |||
| 1461 | Ga0451577_0064559 | |||
| 1462 | Ga0451577_0205723 | |||
| 1463 | Ga0466977_0000316 | |||
| 1464 | Ga0453683_0000320 | |||
| 1465 | Ga0453683_0002549 | |||
| 1466 | Ga0466965_0152188 | |||
| 1467 | Ga0466966_0070088 | |||
| 1468 | Ga0466961_0023848 | |||
| 1469 | Ga0466963_0057383 | |||
| 1470 | Ga0466971_0034830 | |||
| 1471 | Ga0466968_0005636 | |||
| 1472 | Ga0466957_0047812 | |||
| 1473 | Ga0466957_0299248 | |||
| 1474 | Ga0466960_0052819 | |||
| 1475 | Ga0466959_0032646 | |||
| 1476 | Ga0451576_0039095 | |||
| 1477 | Ga0451576_0233031 | |||
| 1478 | Ga0466958_0117689 | |||
| 1479 | Ga0466958_0236603 | |||
| 1480 | Ga0466967_0012482 | |||
| 1481 | Ga0495617_047571 | |||
| 1482 | Ga0495592_0034788 | |||
| 1483 | Ga0495603_0050030 | |||
| 1484 | Ga0495591_074153 | |||
| 1485 | Ga0495629_0024397 | |||
| 1486 | Ga0495641_0082890 | |||
| 1487 | Ga0495651_0002400 | |||
| 1488 | Ga0495651_0039803 | |||
| 1489 | Ga0495653_0000318 | |||
| 1490 | Ga0495653_0046673 | |||
| 1491 | Ga0495580_0041235 | |||
| 1492 | Ga0495582_0011135 | |||
| 1493 | Ga0495582_0011243 | |||
| 1494 | Ga0495582_0027403 | |||
| 1495 | Ga0495605_0055602 | |||
| 1496 | Ga0495639_0055112 | |||
| 1497 | Ga0495662_0004187 | |||
| 1498 | Ga0495584_0149039 | |||
| 1499 | Ga0495585_0020745 | |||
| 1500 | Ga0495585_0065485 | |||
| 1501 | Ga0495594_0006629 | |||
| 1502 | Ga0495594_0164357 | |||
| 1503 | Ga0495596_0001312 | |||
| 1504 | Ga0495596_0031197 | |||
| 1505 | Ga0495607_0039727 | |||
| 1506 | Ga0495607_0052553 | |||
| 1507 | Ga0495606_0000901 | |||
| 1508 | Ga0495608_0001403 | |||
| 1509 | Ga0495608_0030373 | |||
| 1510 | Ga0495610_0016384 | |||
| 1511 | Ga0495616_0008842 | |||
| 1512 | Ga0495618_0005557 | |||
| 1513 | Ga0495628_0000474 | |||
| 1514 | Ga0495630_0009413 | |||
| 1515 | Ga0495631_0048057 | |||
| 1516 | Ga0495637_0151124 | |||
| 1517 | Ga0495643_0127745 | |||
| 1518 | Ga0495644_0006387 | |||
| 1519 | Ga0495644_0032391 | |||
| 1520 | Ga0495663_0082322 | |||
| 1521 | Ga0495666_0000159 | |||
| 1522 | Ga0495666_0009188 | |||
| 1523 | Ga0495666_0084806 | |||
| 1524 | Ga0495642_0021852 | |||
| 1525 | Ga0495642_0086357 | |||
| 1526 | Ga0495652_0002709 | |||
| 1527 | Ga0495665_0019002 | |||
| 1528 | Ga0495665_0037286 | |||
| 1529 | Ga0495665_0080813 | |||
| 1530 | Ga0495640_0020019 | |||
| 1531 | Ga0495640_0162456 | |||
| 1532 | Ga0495586_0026784 | |||
| 1533 | Ga0495587_0043831 | |||
| 1534 | Ga0495587_0059704 | |||
| 1535 | Ga0495598_0028709 | |||
| 1536 | Ga0495609_0001971 | |||
| 1537 | Ga0495609_0105115 | |||
| 1538 | Ga0495621_0054078 | |||
| 1539 | Ga0495633_0006686 | |||
| 1540 | Ga0495633_0017678 | |||
| 1541 | Ga0495633_0098736 | |||
| 1542 | Ga0495656_0008886 | |||
| 1543 | Ga0495668_0115968 | |||
| 1544 | Ga0495634_0316048 | |||
| 1545 | Ga0495611_0140401 | |||
| 1546 | Ga0495625_0013761 | |||
| 1547 | Ga0495635_0029874 | |||
| 1548 | Ga0495635_0274260 | |||
| 1549 | Ga0495661_0004493 | |||
| 1550 | Ga0495588_0000933 | |||
| 1551 | Ga0495588_0046361 | |||
| 1552 | Ga0495588_0205825 | |||
| 1553 | Ga0495623_0003295 | |||
| 1554 | Ga0495646_0227526 | |||
| 1555 | Ga0495647_0149815 | |||
| 1556 | Ga0495658_0058013 | |||
| 1557 | Ga0495669_0000018 | |||
| 1558 | Ga0495669_0069607 | |||
| 1559 | Ga0495613_0060530 | |||
| 1560 | Ga0495670_0023688 | |||
| 1561 | Ga0495671_0036034 | |||
| 1562 | Ga0495671_0093075 | |||
| 1563 | Ga0495671_0168151 | |||
| 1564 | Ga0495649_0193717 | |||
| 1565 | Ga0495589_0007201 | |||
| 1566 | Ga0495581_0048068 | |||
| 1567 | Ga0495581_0162002 | |||
| 1568 | Ga0495604_0031555 | |||
| 1569 | Ga0495604_0066625 | |||
| 1570 | Ga0495674_0519816 | |||
| 1571 | Ga0495672_0007678 | |||
| 1572 | Ga0495676_0000030 | |||
| 1573 | Ga0495676_0000067 | |||
| 1574 | Ga0495676_0076806 | |||
| 1575 | Ga0495676_0087580 | |||
| 1576 | Ga0495676_0092315 | |||
| 1577 | Ga0495680_0064426 | |||
| 1578 | Ga0495675_0003662 | |||
| 1579 | Ga0495677_0074325 | |||
| 1580 | Ga0495679_003833 | |||
| 1581 | Ga0495673_0011511 | |||
| 1582 | Ga0495673_0033095 | |||
| 1583 | Ga0495684_0159062 | |||
| 1584 | Ga0495593_0008063 | |||
| 1585 | Ga0495602_0052501 | |||
| 1586 | Ga0495614_0003665 | |||
| 1587 | Ga0496101_0064373 | |||
| 1588 | Ga0496101_0148668 | |||
| 1589 | Ga0496102_0003048 | |||
| 1590 | Ga0496102_0043842 | |||
| 1591 | Ga0496102_0056580 | |||
| 1592 | Ga0496103_0032512 | |||
| 1593 | Ga0496103_0150428 | |||
| 1594 | Ga0496104_0000455 | |||
| 1595 | Ga0496104_0003616 | |||
| 1596 | Ga0496104_0004195 | |||
| 1597 | Ga0496104_0006892 | |||
| 1598 | Ga0496104_0012202 | |||
| 1599 | Ga0496104_0104808 | |||
| 1600 | Ga0496104_0473765 | |||
| 1601 | Ga0496105_0000139 | |||
| 1602 | Ga0496105_0015534 | |||
| 1603 | Ga0496105_0023268 | |||
| 1604 | Ga0496105_0048578 | |||
| 1605 | Ga0496106_0001067 | |||
| 1606 | Ga0496106_0002328 | |||
| 1607 | Ga0496106_0026340 | |||
| 1608 | Ga0496107_0006188 | |||
| 1609 | Ga0496107_0132216 | |||
| 1610 | Ga0496108_0001155 | |||
| 1611 | Ga0496108_0015292 | |||
| 1612 | Ga0496108_0198231 | |||
| 1613 | Ga0496109_0003275 | |||
| 1614 | Ga0496109_0036119 | |||
| 1615 | Ga0496109_0089378 | |||
| 1616 | Ga0496110_0008762 | |||
| 1617 | Ga0496110_0013586 | |||
| 1618 | Ga0496110_0683774 | |||
| 1619 | Ga0496111_0001646 | |||
| 1620 | Ga0496111_0019436 | |||
| 1621 | Ga0496112_0001735 | |||
| 1622 | Ga0496112_0011228 | |||
| 1623 | Ga0496113_0000957 | |||
| 1624 | Ga0496113_0001913 | |||
| 1625 | Ga0496113_0037725 | |||
| 1626 | Ga0496114_0223059 | |||
| 1627 | Ga0496114_0370064 | |||
| 1628 | Ga0496115_0010390 | |||
| 1629 | Ga0496115_0041924 | |||
| 1630 | Ga0496115_0090521 | |||
| 1631 | Ga0496117_0003342 | |||
| 1632 | Ga0496118_0000401 | |||
| 1633 | Ga0496121_0000473 | |||
| 1634 | Ga0496121_0003466 | |||
| 1635 | Ga0496121_0041790 | |||
| 1636 | Ga0496122_0000134 | |||
| 1637 | Ga0496122_0144164 | |||
| 1638 | Ga0496123_0023694 | |||
| 1639 | Ga0496123_0271138 | |||
| 1640 | Ga0496125_0000433 | |||
| 1641 | Ga0501306_018758 | |||
| 1642 | Ga0501310_004570 | |||
| 1643 | Ga0501305_013311 | |||
| 1644 | Ga0501312_018699 | |||
| 1645 | Ga0501314_002536 | |||
| 1646 | Ga0501317_003764 | |||
| 1647 | Ga0501318_002010 | |||
| 1648 | Ga0501321_001406 | |||
| 1649 | Ga0501032_0000026 | |||
| 1650 | Ga0501033_0000243 | |||
| 1651 | Ga0501033_0055773 | |||
| 1652 | Ga0501034_0000054 | |||
| 1653 | Ga0501034_0063114 | |||
| 1654 | Ga0501034_0532804 | |||
| 1655 | Ga0501036_0000082 | |||
| 1656 | Ga0501037_0000032 | |||
| 1657 | Ga0501038_0000018 | |||
| 1658 | Ga0501038_0446241 | |||
| 1659 | Ga0501039_0000018 | |||
| 1660 | Ga0501043_0000014 | |||
| 1661 | Ga0501047_0004660 | |||
| 1662 | Ga0501047_0249453 | |||
| 1663 | Ga0501047_0294645 | |||
| 1664 | Ga0501067_0084440 | |||
| 1665 | Ga0501067_0100581 | |||
| 1666 | Ga0501068_0146286 | |||
| 1667 | Ga0501069_0057827 | |||
| 1668 | Ga0501070_0006142 | |||
| 1669 | Ga0501070_0048560 | |||
| 1670 | Ga0501073_0000067 | |||
| 1671 | Ga0501074_0013085 | |||
| 1672 | Ga0501076_0435709 | |||
| 1673 | Ga0501202_095239 | |||
| 1674 | Ga0501079_0063334 | |||
| 1675 | Ga0501080_0016551 | |||
| 1676 | Ga0501080_0146178 | |||
| 1677 | Ga0501080_0166555 | |||
| 1678 | Ga0501035_0000019 | |||
| 1679 | Ga0501044_0000969 | |||
| 1680 | Ga0501044_0083555 | |||
| 1681 | Ga0501044_0086056 | |||
| 1682 | Ga0501044_0099629 | |||
| 1683 | Ga0501044_0311371 | |||
| 1684 | Ga0501044_0477679 | |||
| 1685 | Ga0501045_0274181 | |||
| 1686 | nmdc:mga0yw44_73973_c1 | |||
| 1687 | nmdc:mga0k408_4176_c1 | |||
| 1688 | nmdc:mga05p37_19291_c1 | |||
| 1689 | nmdc:mga05p37_33296_c1 | |||
| 1690 | nmdc:mga08y16_194610_c1 | |||
| 1691 | nmdc:mga08y16_29822_c1 | |||
| 1692 | nmdc:mga0n895_101235_c1 | |||
| 1693 | nmdc:mga0n895_130655_c1 | |||
| 1694 | nmdc:mga0n895_322418_c1 | |||
| 1695 | nmdc:mga0a205_309367_c1 | |||
| 1696 | Ga0495612_0030611 | |||
| 1697 | Ga0495655_0023600 | |||
| 1698 | Ga0495619_0284028 | |||
| 1699 | Ga0500572_000274 | |||
| 1700 | Ga0500559_0000053 | |||
| 1701 | Ga0500568_0009740 | |||
| 1702 | Ga0500611_002322 | |||
| 1703 | Ga0501082_0017352 | |||
| 1704 | Ga0466962_0001020 | |||
| 1705 | 2511250682 | |||
| 1706 | 2511383288 | |||
| 1707 | 2515689302 | |||
| 1708 | 2521558520 | |||
| 1709 | 2524438228 | |||
| 1710 | 2550694049 | |||
| 1711 | 2553004147 | |||
| 1712 | 2596375629 | |||
| 1713 | 2599446307 | |||
| 1714 | 2643754563 | |||
| 1715 | 2723875956 | |||
| 1716 | 2728751850 | |||
| 1717 | 2765569625 | |||
| 1718 | 2793062817 | |||
| 1719 | 2808981982 | |||
| 1720 | 2809131605 | |||
| 1721 | 2809151227 | |||
| 1722 | 2819591843 | |||
| 1723 | 2819614258 | |||
| 1724 | 2819718076 | |||
| 1725 | 2839097456 | |||
| 1726 | 2842340282 | |||
| 1727 | 2852622491 | |||
| 1728 | 2854684968 | |||
| 1729 | 2854896847 | |||
| 1730 | 2884816766 | |||
| 1731 | 2884837649 | |||
| 1732 | 2884853940 | |||
| 1733 | 2889307414 | |||
| 1734 | 2889309490 | |||
| 1735 | 2894235853 | |||
| 1736 | 2896154943 | |||
| 1737 | 2902332679 | |||
| 1738 | 2902408737 | |||
| 1739 | 2904429901 | |||
| 1740 | 2904445196 | |||
| 1741 | 2904534218 | |||
| 1742 | 2904588941 | |||
| 1743 | 2904590578 | |||
| 1744 | 2904603552 | |||
| 1745 | 2917700468 | |||
| 1746 | 2919046945 | |||
| 1747 | 2919080440 | |||
| 1748 | 2923511984 | |||
| 1749 | 2928130179 | |||
| 1750 | 2928131705 | |||
| 1751 | 643597835 | |||
| 1752 | 8045864746 | |||
| 1753 | 8054566056 | |||
| 1754 | 8055228679 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.933 | 11 | 229 |
| 4jbw-assembly1.cif.gz_A | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.9164 | 11 | 229 |
| 1z47-assembly1.cif.gz_B-2 | structure of the atpase subunit cysa of the putative sulfate atp-binding cassette (abc) transporter from alicyclobacillus acidocaldarius | 0.916 | 11 | 230 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9157 | 11 | 229 |
| 7caf-assembly1.cif.gz_C | mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state | 0.9152 | 11 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q47538_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9693 | 11 | 232 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9359 | 9 | 229 | 3.40.50.300 |
| af_P77737_9_333_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9283 | 8 | 216 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9235 | 9 | 229 | 3.40.50.300 |
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9197 | 10 | 254 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7UW92-F1-model_v4 | ABC transporter ATP-binding protein | 0.9655 | 8 | 211 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A7C0XLY7-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.9645 | 85 | 229 |
GO:0005524
GO:0016887 GO:0022857 GO:0043190 |
| AF-A0A7C7UW92-F1-model_v4 | ABC transporter ATP-binding protein | 0.9609 | 8 | 211 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A7W0CI05-F1-model_v4 | ABC-type nitrate/sulfonate/bicarbonate transport system ATPase subunit | 0.9536 | 7 | 254 |
GO:0005524
GO:0016887 |
| AF-A0A2S5T3T1-F1-model_v4 | NitT/TauT family transport system ATP-binding protein (Sulfonate ABC transporter ATP-binding protein) | 0.9452 | 1 | 253 |
GO:0005524
GO:0005886 GO:0016887 |