F484358

General Info

Members Datasets Scaffolds Average Seq Length
876 309 876 98

Family's Representative Sequence

Representative Sequence 3300031595|Ga0265313_10227376|Ga0265313_102273761
Length 115
Sequence MPRAIASDATRVHSMEVAERTSVDLPPHVPGDFQVFVNGVLQARGVDYEVVGRSLVFPRPIAQEGRLGFWRWLSMWLGIAGTYRRHETVDVVYESGGTRGVVTGLEPKPYEELEL

Samples

Sample ID Description Type Environment
1 2149837012 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
208 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
306 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 1.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.76
Rhizosphere 87.67
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 _F7QKVOU01CGDIP 2149837012 Unclassified 504
2 JGI24742J22300_10037227 3300002244 Unclassified 861
3 rootL2_10161100 3300003322 Bacteria 1328
4 Ga0070658_10024182 3300005327 Bacteria 4875
5 Ga0070658_10039434 3300005327 Bacteria 3810
6 Ga0070683_100029947 3300005329 Bacteria 4935
7 Ga0070683_100068886 3300005329 Bacteria 3297
8 Ga0070683_100419970 3300005329 Bacteria 1276
9 Ga0070683_101172969 3300005329 Bacteria 738
10 Ga0070683_101882290 3300005329 Bacteria 575
11 Ga0070683_101975090 3300005329 Bacteria 560
12 Ga0070690_100039369 3300005330 Bacteria 2987
13 Ga0070666_11059650 3300005335 Bacteria 602
14 Ga0070680_100129688 3300005336 Bacteria 2109
15 Ga0070680_100214185 3300005336 Bacteria 1625
16 Ga0070680_100857562 3300005336 Unclassified 783
17 Ga0070680_100866375 3300005336 Bacteria 779
18 Ga0070682_100069940 3300005337 Bacteria 2242
19 Ga0070682_100124742 3300005337 Bacteria 1734
20 Ga0070682_100619010 3300005337 Bacteria 857
21 Ga0070682_100845158 3300005337 Bacteria 747
22 Ga0070682_101640652 3300005337 Bacteria 557
23 Ga0068868_100057661 3300005338 Bacteria 3068
24 Ga0068868_100657715 3300005338 Bacteria 934
25 Ga0070660_100001894 3300005339 Bacteria 14408
26 Ga0070660_100032597 3300005339 Bacteria 3922
27 Ga0070660_100087839 3300005339 Bacteria 2447
28 Ga0070660_100124143 3300005339 Bacteria 2062
29 Ga0070660_100390291 3300005339 Bacteria 1150
30 Ga0070689_100989943 3300005340 Bacteria 747
31 Ga0070661_100002256 3300005344 Bacteria 13217
32 Ga0070668_100006039 3300005347 Bacteria 8982
33 Ga0070675_100545582 3300005354 Unclassified 1048
34 Ga0070671_100075864 3300005355 Bacteria 2809
35 Ga0070671_100235750 3300005355 Bacteria 1553
36 Ga0070674_101880383 3300005356 Unclassified 544
37 Ga0070673_100461553 3300005364 Bacteria 1144
38 Ga0070659_100069384 3300005366 Bacteria 2798
39 Ga0070659_100181629 3300005366 Bacteria 1727
40 Ga0070659_100943158 3300005366 Bacteria 756
41 Ga0070659_101830697 3300005366 Unclassified 544
42 Ga0070667_100934875 3300005367 Bacteria 808
43 Ga0070703_10461397 3300005406 Unclassified 565
44 Ga0070709_10023261 3300005434 Bacteria 3635
45 Ga0070709_10159763 3300005434 Bacteria 1566
46 Ga0070714_100007475 3300005435 Bacteria 8506
47 Ga0070714_100029145 3300005435 Bacteria 4587
48 Ga0070714_100047788 3300005435 Bacteria 3637
49 Ga0070714_100051138 3300005435 Bacteria 3522
50 Ga0070714_100160390 3300005435 Bacteria 2034
51 Ga0070714_100283219 3300005435 Unclassified 1541
52 Ga0070714_100384979 3300005435 Bacteria 1323
53 Ga0070714_100647102 3300005435 Bacteria 1017
54 Ga0070714_101121641 3300005435 Bacteria 767
55 Ga0070714_101174865 3300005435 Bacteria 748
56 Ga0070714_101918119 3300005435 Bacteria 578
57 Ga0070713_100022189 3300005436 Bacteria 4901
58 Ga0070713_100082041 3300005436 Bacteria 2753
59 Ga0070713_100350026 3300005436 Bacteria 1370
60 Ga0070713_101303645 3300005436 Bacteria 704
61 Ga0070710_10002341 3300005437 Bacteria 8966
62 Ga0070710_10020436 3300005437 Bacteria 3435
63 Ga0070710_11416750 3300005437 Unclassified 520
64 Ga0070711_100008253 3300005439 Bacteria 6371
65 Ga0070711_100028351 3300005439 Bacteria 3684
66 Ga0070711_100125191 3300005439 Bacteria 1907
67 Ga0070711_100212829 3300005439 Bacteria 1498
68 Ga0070711_100352477 3300005439 Bacteria 1184
69 Ga0070705_101272999 3300005440 Bacteria 609
70 Ga0070700_100000891 3300005441 Bacteria 14734
71 Ga0070694_100182245 3300005444 Bacteria 1554
72 Ga0070708_100160796 3300005445 Bacteria 2093
73 Ga0070663_100164084 3300005455 Bacteria 1712
74 Ga0070663_100926308 3300005455 Bacteria 754
75 Ga0070678_100243020 3300005456 Bacteria 1506
76 Ga0070678_100647592 3300005456 Bacteria 947
77 Ga0070681_10060719 3300005458 Bacteria 3756
78 Ga0070681_10097911 3300005458 Bacteria 2880
79 Ga0070681_10141560 3300005458 Bacteria 2335
80 Ga0070681_10273737 3300005458 Bacteria 1600
81 Ga0070681_11411912 3300005458 Bacteria 620
82 Ga0068867_100125084 3300005459 Bacteria 1991
83 Ga0070685_10141831 3300005466 Bacteria 1513
84 Ga0070706_100097485 3300005467 Bacteria 2731
85 Ga0070707_100003577 3300005468 Bacteria 14661
86 Ga0070707_100103581 3300005468 Bacteria 2758
87 Ga0070707_100190846 3300005468 Bacteria 1998
88 Ga0070707_100456273 3300005468 Bacteria 1239
89 Ga0070707_100532451 3300005468 Bacteria 1137
90 Ga0070698_100071346 3300005471 Bacteria 3483
91 Ga0070698_100219569 3300005471 Bacteria 1835
92 Ga0070698_100416571 3300005471 Bacteria 1277
93 Ga0070698_101194016 3300005471 Bacteria 710
94 Ga0070699_101114199 3300005518 Unclassified 724
95 Ga0070699_101214808 3300005518 Bacteria 691
96 Ga0070679_100089311 3300005530 Bacteria 3069
97 Ga0070679_100116757 3300005530 Bacteria 2653
98 Ga0070679_100219284 3300005530 Bacteria 1864
99 Ga0070679_100249696 3300005530 Bacteria 1731
100 Ga0070679_101295846 3300005530 Unclassified 674
101 Ga0070684_100150985 3300005535 Bacteria 2105
102 Ga0070684_100172478 3300005535 Bacteria 1965
103 Ga0070684_100396613 3300005535 Bacteria 1272
104 Ga0070684_100509356 3300005535 Bacteria 1115
105 Ga0070684_100659595 3300005535 Bacteria 974
106 Ga0070684_101301828 3300005535 Unclassified 684
107 Ga0070697_101904306 3300005536 Unclassified 532
108 Ga0068853_100816252 3300005539 Bacteria 893
109 Ga0068853_101208404 3300005539 Bacteria 730
110 Ga0070686_100479449 3300005544 Bacteria 961
111 Ga0070686_100826276 3300005544 Bacteria 749
112 Ga0070695_100000670 3300005545 Bacteria 18279
113 Ga0070695_100113305 3300005545 Unclassified 1844
114 Ga0070695_100853114 3300005545 Unclassified 733
115 Ga0070696_100184219 3300005546 Bacteria 1550
116 Ga0070693_100029063 3300005547 Bacteria 3011
117 Ga0070693_100105429 3300005547 Bacteria 1725
118 Ga0070693_100238725 3300005547 Bacteria 1199
119 Ga0070665_100579743 3300005548 Bacteria 1135
120 Ga0070665_101254305 3300005548 Bacteria 752
121 Ga0070704_100040941 3300005549 Bacteria 3194
122 Ga0068855_100051631 3300005563 Bacteria 4843
123 Ga0068855_100099345 3300005563 Bacteria 3352
124 Ga0068855_101169745 3300005563 Bacteria 801
125 Ga0068855_101312603 3300005563 Bacteria 748
126 Ga0068855_102212282 3300005563 Bacteria 552
127 Ga0068855_102567498 3300005563 Bacteria 506
128 Ga0070664_100261715 3300005564 Bacteria 1556
129 Ga0070664_100880022 3300005564 Bacteria 839
130 Ga0068854_101488408 3300005578 Bacteria 614
131 Ga0068856_100033197 3300005614 Bacteria 5054
132 Ga0068856_100195519 3300005614 Bacteria 2036
133 Ga0068856_100338351 3300005614 Bacteria 1523
134 Ga0068856_101749704 3300005614 Bacteria 634
135 Ga0068856_102369151 3300005614 Bacteria 538
136 Ga0068856_102450041 3300005614 Unclassified 529
137 Ga0070702_100193714 3300005615 Bacteria 1340
138 Ga0068852_100125695 3300005616 Bacteria 2355
139 Ga0068852_100183790 3300005616 Bacteria 1968
140 Ga0068852_101863981 3300005616 Unclassified 624
141 Ga0068864_100367993 3300005618 Bacteria 1360
142 Ga0068864_100579814 3300005618 Bacteria 1087
143 Ga0068864_100863295 3300005618 Bacteria 892
144 Ga0068866_10037942 3300005718 Bacteria 2369
145 Ga0068861_100034407 3300005719 Bacteria 3747
146 Ga0068863_100976453 3300005841 Bacteria 849
147 Ga0068858_100801980 3300005842 Bacteria 919
148 Ga0068858_100892333 3300005842 Bacteria 869
149 Ga0068860_102322432 3300005843 Bacteria 557
150 Ga0068862_100050448 3300005844 Bacteria 3557
151 Ga0081539_10010499 3300005985 Bacteria 7512
152 Ga0070717_10001487 3300006028 Bacteria 16225
153 Ga0070717_10026131 3300006028 Bacteria 4654
154 Ga0070717_10040736 3300006028 Bacteria 3785
155 Ga0070717_10279542 3300006028 Bacteria 1480
156 Ga0070717_10410781 3300006028 Bacteria 1217
157 Ga0070717_10663487 3300006028 Bacteria 947
158 Ga0070717_10707959 3300006028 Unclassified 915
159 Ga0070717_10882494 3300006028 Unclassified 814
160 Ga0070717_11099991 3300006028 Bacteria 724
161 Ga0070715_10082743 3300006163 Bacteria 1460
162 Ga0070715_10243114 3300006163 Bacteria 937
163 Ga0070716_100384148 3300006173 Bacteria 1004
164 Ga0070716_100718646 3300006173 Bacteria 765
165 Ga0070712_100096722 3300006175 Bacteria 2174
166 Ga0070712_100107235 3300006175 Bacteria 2078
167 Ga0070712_100168261 3300006175 Bacteria 1698
168 Ga0070712_100270609 3300006175 Bacteria 1365
169 Ga0070712_100940576 3300006175 Bacteria 746
170 Ga0097621_100205385 3300006237 Bacteria 1712
171 Ga0068871_100018881 3300006358 Bacteria 5253
172 Ga0075428_100824470 3300006844 Bacteria 985
173 Ga0075431_100020819 3300006847 Bacteria 6702
174 Ga0075433_10527011 3300006852 Bacteria 1039
175 Ga0075434_101055633 3300006871 Bacteria 826
176 Ga0075429_100002524 3300006880 Bacteria 15407
177 Ga0068865_100878083 3300006881 Bacteria 778
178 Ga0068865_100985894 3300006881 Unclassified 737
179 Ga0075435_100643019 3300007076 Bacteria 920
180 Ga0099795_10600980 3300007788 Unclassified 523
181 Ga0105240_10128695 3300009093 Bacteria 3040
182 Ga0105240_11941186 3300009093 Bacteria 612
183 Ga0105245_10016135 3300009098 Bacteria 6508
184 Ga0105245_10066687 3300009098 Bacteria 3258
185 Ga0105245_10443101 3300009098 Bacteria 1306
186 Ga0105245_11014151 3300009098 Unclassified 875
187 Ga0105245_12726390 3300009098 Bacteria 547
188 Ga0105247_10073977 3300009101 Bacteria 2136
189 Ga0105247_10557778 3300009101 Bacteria 843
190 Ga0105247_11276685 3300009101 Bacteria 588
191 Ga0114129_10120074 3300009147 Bacteria 3620
192 Ga0114129_10197834 3300009147 Bacteria 2724
193 Ga0114129_11560113 3300009147 Bacteria 810
194 Ga0105243_10154064 3300009148 Bacteria 1974
195 Ga0105243_12599260 3300009148 Unclassified 546
196 Ga0105243_12800367 3300009148 Bacteria 528
197 Ga0105241_10297035 3300009174 Bacteria 1385
198 Ga0105241_12087617 3300009174 Bacteria 560
199 Ga0105248_10025251 3300009177 Bacteria 6607
200 Ga0105248_10493547 3300009177 Archaea 1380
201 Ga0105248_10694609 3300009177 Bacteria 1148
202 Ga0105237_10056866 3300009545 Bacteria 3915
203 Ga0105237_10231304 3300009545 Bacteria 1849
204 Ga0105237_10666056 3300009545 Bacteria 1047
205 Ga0105237_10855280 3300009545 Bacteria 916
206 Ga0105238_10037789 3300009551 Bacteria 4906
207 Ga0105238_10167317 3300009551 Bacteria 2174
208 Ga0105238_10944528 3300009551 Bacteria 882
209 Ga0105238_11065158 3300009551 Bacteria 830
210 Ga0105249_10004496 3300009553 Bacteria 12054
211 Ga0099796_10100928 3300010159 Unclassified 1085
212 Ga0105239_10025569 3300010375 Bacteria 6499
213 Ga0105239_12892088 3300010375 Bacteria 560
214 Ga0105246_10130073 3300011119 Bacteria 1879
215 Ga0105246_10220770 3300011119 Bacteria 1486
216 Ga0157373_10066219 3300013100 Bacteria 2556
217 Ga0157373_10157682 3300013100 Bacteria 1596
218 Ga0157373_10186577 3300013100 Bacteria 1461
219 Ga0157373_10740147 3300013100 Bacteria 722
220 Ga0157371_10163186 3300013102 Bacteria 1591
221 Ga0157370_10012865 3300013104 Bacteria 8651
222 Ga0157370_10054012 3300013104 Bacteria 3830
223 Ga0157370_10067480 3300013104 Bacteria 3381
224 Ga0157370_10761466 3300013104 Bacteria 882
225 Ga0157369_10063544 3300013105 Bacteria 3977
226 Ga0157369_10116370 3300013105 Bacteria 2839
227 Ga0157369_10129273 3300013105 Bacteria 2677
228 Ga0157369_10157434 3300013105 Bacteria 2399
229 Ga0157369_10167975 3300013105 Bacteria 2313
230 Ga0157369_10359971 3300013105 Bacteria 1511
231 Ga0157369_12025189 3300013105 Unclassified 584
232 Ga0157369_12100024 3300013105 Bacteria 573
233 Ga0157374_10023216 3300013296 Bacteria 5544
234 Ga0157378_10010022 3300013297 Bacteria 8261
235 Ga0163162_10026703 3300013306 Bacteria 5709
236 Ga0163162_10407874 3300013306 Bacteria 1492
237 Ga0157372_10072409 3300013307 Bacteria 3884
238 Ga0157372_10140964 3300013307 Bacteria 2777
239 Ga0157372_11392438 3300013307 Bacteria 809
240 Ga0157372_12006164 3300013307 Bacteria 665
241 Ga0157375_13346932 3300013308 Bacteria 534
242 Ga0182008_10010399 3300014497 Bacteria 4981
243 Ga0182008_10028234 3300014497 Bacteria 2837
244 Ga0182008_10040828 3300014497 Bacteria 2315
245 Ga0182008_10138382 3300014497 Bacteria 1217
246 Ga0157377_10060167 3300014745 Bacteria 2168
247 Ga0157379_11715082 3300014968 Unclassified 616
248 Ga0157376_10054523 3300014969 Bacteria 3333
249 Ga0157376_10143874 3300014969 Bacteria 2142
250 Ga0182006_1014920 3300015261 Bacteria 3341
251 Ga0182006_1098267 3300015261 Bacteria 1043
252 Ga0182007_10012652 3300015262 Bacteria 3240
253 Ga0182007_10177883 3300015262 Unclassified 734
254 Ga0182007_10192700 3300015262 Bacteria 709
255 Ga0206356_10947349 3300020070 Bacteria 1743
256 Ga0206356_11446365 3300020070 Unclassified 538
257 Ga0206354_11484271 3300020081 Unclassified 794
258 Ga0206354_11532083 3300020081 Bacteria 595
259 Ga0206353_10033182 3300020082 Bacteria 537
260 Ga0206353_10146321 3300020082 Bacteria 1076
261 Ga0206353_10323144 3300020082 Bacteria 3568
262 Ga0206353_10826660 3300020082 Bacteria 1398
263 Ga0206353_11117289 3300020082 Bacteria 614
264 Ga0206353_11545420 3300020082 Bacteria 2381
265 Ga0213871_10116273 3300021441 Bacteria 794
266 Ga0207653_10064888 3300025885 Bacteria 1239
267 Ga0207692_10009923 3300025898 Bacteria 3992
268 Ga0207692_10052109 3300025898 Unclassified 2078
269 Ga0207692_10074635 3300025898 Bacteria 1797
270 Ga0207692_10343038 3300025898 Bacteria 919
271 Ga0207642_10046983 3300025899 Bacteria 1927
272 Ga0207710_10103688 3300025900 Bacteria 1344
273 Ga0207710_10297603 3300025900 Bacteria 815
274 Ga0207680_10117281 3300025903 Bacteria 1736
275 Ga0207647_10454309 3300025904 Bacteria 718
276 Ga0207685_10159924 3300025905 Bacteria 1027
277 Ga0207685_10861762 3300025905 Unclassified 502
278 Ga0207699_10018714 3300025906 Bacteria 3676
279 Ga0207699_10022093 3300025906 Bacteria 3442
280 Ga0207699_10031955 3300025906 Bacteria 2961
281 Ga0207699_10257999 3300025906 Bacteria 1204
282 Ga0207705_10048891 3300025909 Bacteria 3043
283 Ga0207705_10142189 3300025909 Bacteria 1792
284 Ga0207705_10304571 3300025909 Bacteria 1222
285 Ga0207705_10383635 3300025909 Unclassified 1085
286 Ga0207654_10193044 3300025911 Bacteria 1336
287 Ga0207707_10096086 3300025912 Bacteria 2589
288 Ga0207707_10171310 3300025912 Bacteria 1897
289 Ga0207707_10257291 3300025912 Bacteria 1516
290 Ga0207707_10643239 3300025912 Bacteria 894
291 Ga0207707_10951745 3300025912 Bacteria 707
292 Ga0207707_10985834 3300025912 Bacteria 692
293 Ga0207707_11194301 3300025912 Bacteria 616
294 Ga0207695_10015652 3300025913 Bacteria 8921
295 Ga0207695_10136893 3300025913 Bacteria 2402
296 Ga0207695_10227844 3300025913 Bacteria 1769
297 Ga0207695_11136087 3300025913 Bacteria 661
298 Ga0207671_10095099 3300025914 Bacteria 2249
299 Ga0207671_10656715 3300025914 Bacteria 835
300 Ga0207693_10000745 3300025915 Bacteria 29290
301 Ga0207693_10001551 3300025915 Bacteria 20284
302 Ga0207693_10036544 3300025915 Bacteria 3872
303 Ga0207693_10039934 3300025915 Bacteria 3695
304 Ga0207693_10418274 3300025915 Unclassified 1048
305 Ga0207663_10006473 3300025916 Bacteria 5994
306 Ga0207663_10325736 3300025916 Unclassified 1156
307 Ga0207663_11623886 3300025916 Bacteria 520
308 Ga0207660_10036675 3300025917 Bacteria 3410
309 Ga0207660_10040765 3300025917 Bacteria 3252
310 Ga0207660_10487091 3300025917 Bacteria 1000
311 Ga0207660_10590811 3300025917 Bacteria 904
312 Ga0207660_10777763 3300025917 Bacteria 781
313 Ga0207660_10911638 3300025917 Bacteria 717
314 Ga0207660_11646691 3300025917 Unclassified 517
315 Ga0207657_10002003 3300025919 Bacteria 22017
316 Ga0207657_10009290 3300025919 Bacteria 9904
317 Ga0207657_10052187 3300025919 Bacteria 3550
318 Ga0207657_10363015 3300025919 Bacteria 1141
319 Ga0207649_10073776 3300025920 Bacteria 2187
320 Ga0207649_10760129 3300025920 Bacteria 755
321 Ga0207649_11586852 3300025920 Bacteria 518
322 Ga0207652_10020844 3300025921 Bacteria 5403
323 Ga0207652_10044647 3300025921 Bacteria 3776
324 Ga0207652_10101900 3300025921 Bacteria 2536
325 Ga0207652_10317093 3300025921 Bacteria 1407
326 Ga0207652_10341511 3300025921 Bacteria 1352
327 Ga0207652_10812611 3300025921 Bacteria 830
328 Ga0207652_10919708 3300025921 Bacteria 772
329 Ga0207652_11060257 3300025921 Bacteria 710
330 Ga0207646_10000785 3300025922 Bacteria 41163
331 Ga0207646_10027291 3300025922 Bacteria 5207
332 Ga0207646_10151621 3300025922 Bacteria 2091
333 Ga0207646_10392196 3300025922 Bacteria 1254
334 Ga0207646_10651246 3300025922 Bacteria 944
335 Ga0207646_11150282 3300025922 Bacteria 682
336 Ga0207694_10018445 3300025924 Bacteria 5274
337 Ga0207694_10494739 3300025924 Bacteria 1023
338 Ga0207694_10592951 3300025924 Bacteria 932
339 Ga0207694_10883620 3300025924 Bacteria 756
340 Ga0207687_10048591 3300025927 Bacteria 2947
341 Ga0207687_10381626 3300025927 Bacteria 1155
342 Ga0207700_10002676 3300025928 Bacteria 10263
343 Ga0207700_10124498 3300025928 Bacteria 2095
344 Ga0207700_10226240 3300025928 Bacteria 1588
345 Ga0207700_10706538 3300025928 Bacteria 900
346 Ga0207700_10808487 3300025928 Bacteria 839
347 Ga0207664_10003292 3300025929 Bacteria 10740
348 Ga0207664_10006985 3300025929 Bacteria 7812
349 Ga0207664_10033341 3300025929 Bacteria 3955
350 Ga0207664_10065601 3300025929 Bacteria 2907
351 Ga0207664_10076263 3300025929 Bacteria 2713
352 Ga0207664_10084568 3300025929 Bacteria 2588
353 Ga0207664_10134686 3300025929 Bacteria 2083
354 Ga0207664_10170719 3300025929 Bacteria 1861
355 Ga0207664_10221472 3300025929 Bacteria 1641
356 Ga0207664_10496766 3300025929 Bacteria 1092
357 Ga0207664_10809311 3300025929 Bacteria 843
358 Ga0207664_10999267 3300025929 Bacteria 750
359 Ga0207664_11357001 3300025929 Bacteria 631
360 Ga0207644_10545705 3300025931 Bacteria 959
361 Ga0207690_10351348 3300025932 Bacteria 1166
362 Ga0207690_10480839 3300025932 Bacteria 1002
363 Ga0207690_10755384 3300025932 Bacteria 802
364 Ga0207706_11476694 3300025933 Bacteria 555
365 Ga0207686_10008680 3300025934 Bacteria 5489
366 Ga0207709_10014134 3300025935 Bacteria 4407
367 Ga0207709_11542856 3300025935 Unclassified 551
368 Ga0207670_10347830 3300025936 Bacteria 1173
369 Ga0207670_10798730 3300025936 Bacteria 786
370 Ga0207669_10001097 3300025937 Bacteria 11569
371 Ga0207704_10352309 3300025938 Bacteria 1147
372 Ga0207665_10001126 3300025939 Bacteria 17976
373 Ga0207665_10060117 3300025939 Bacteria 2572
374 Ga0207665_10133428 3300025939 Bacteria 1765
375 Ga0207665_10433682 3300025939 Bacteria 1006
376 Ga0207665_10762583 3300025939 Bacteria 763
377 Ga0207691_10001540 3300025940 Bacteria 22940
378 Ga0207711_10564476 3300025941 Bacteria 1062
379 Ga0207711_10640649 3300025941 Bacteria 991
380 Ga0207711_11276860 3300025941 Bacteria 676
381 Ga0207711_11423029 3300025941 Bacteria 636
382 Ga0207661_10024274 3300025944 Bacteria 4593
383 Ga0207661_10151201 3300025944 Bacteria 2007
384 Ga0207661_10173632 3300025944 Bacteria 1878
385 Ga0207661_10190536 3300025944 Bacteria 1797
386 Ga0207661_10500862 3300025944 Bacteria 1110
387 Ga0207661_10515939 3300025944 Bacteria 1093
388 Ga0207661_10790317 3300025944 Bacteria 874
389 Ga0207661_11508377 3300025944 Bacteria 616
390 Ga0207667_10050633 3300025949 Bacteria 4381
391 Ga0207667_10669312 3300025949 Unclassified 1042
392 Ga0207667_12133208 3300025949 Bacteria 518
393 Ga0207651_10246216 3300025960 Bacteria 1460
394 Ga0207712_10122587 3300025961 Bacteria 1969
395 Ga0207640_11248861 3300025981 Bacteria 662
396 Ga0207677_10019621 3300026023 Bacteria 4088
397 Ga0207677_10617745 3300026023 Bacteria 953
398 Ga0207703_11584799 3300026035 Unclassified 630
399 Ga0207639_10766908 3300026041 Bacteria 897
400 Ga0207678_10055915 3300026067 Bacteria 3399
401 Ga0207708_10000757 3300026075 Bacteria 24232
402 Ga0207702_10408030 3300026078 Bacteria 1311
403 Ga0207702_10557829 3300026078 Bacteria 1121
404 Ga0207702_10743840 3300026078 Bacteria 968
405 Ga0207702_10948366 3300026078 Bacteria 853
406 Ga0207702_11120158 3300026078 Bacteria 781
407 Ga0207702_11127669 3300026078 Bacteria 778
408 Ga0207641_10805086 3300026088 Bacteria 930
409 Ga0207648_10002049 3300026089 Bacteria 21957
410 Ga0207676_10069200 3300026095 Bacteria 2826
411 Ga0207676_10724146 3300026095 Bacteria 966
412 Ga0207674_10599462 3300026116 Bacteria 1064
413 Ga0207675_100052929 3300026118 Bacteria 3788
414 Ga0207683_10004507 3300026121 Bacteria 12018
415 Ga0207698_10072099 3300026142 Bacteria 2744
416 Ga0207698_10222335 3300026142 Bacteria 1707
417 Ga0207698_10257251 3300026142 Bacteria 1602
418 Ga0207698_10663252 3300026142 Bacteria 1034
419 Ga0268266_12101662 3300028379 Unclassified 537
420 Ga0268265_10731126 3300028380 Bacteria 959
421 Ga0268264_10315359 3300028381 Bacteria 1477
422 Ga0265337_1139887 3300028556 Unclassified 655
423 Ga0265334_10004671 3300028573 Bacteria 6041
424 Ga0265318_10000633 3300028577 Bacteria 24181
425 Ga0265318_10089713 3300028577 Archaea 1132
426 Ga0265336_10016538 3300028666 Bacteria 2412
427 Ga0265336_10070919 3300028666 Unclassified 1041
428 Ga0265338_10017133 3300028800 Bacteria 7830
429 Ga0265338_10100854 3300028800 Bacteria 2352
430 Ga0265338_10111758 3300028800 Bacteria 2198
431 Ga0265324_10008957 3300029957 Bacteria 3937
432 Ga0265330_10002779 3300031235 Bacteria 9395
433 Ga0265332_10006125 3300031238 Bacteria 5490
434 Ga0265332_10028477 3300031238 Bacteria 2445
435 Ga0265328_10003728 3300031239 Bacteria 6719
436 Ga0265328_10211552 3300031239 Bacteria 737
437 Ga0265325_10008761 3300031241 Bacteria 5949
438 Ga0265325_10288001 3300031241 Bacteria 735
439 Ga0265329_10001093 3300031242 Bacteria 13312
440 Ga0265340_10003071 3300031247 Bacteria 9478
441 Ga0265339_10006107 3300031249 Bacteria 7947
442 Ga0265339_10019201 3300031249 Bacteria 4015
443 Ga0265331_10082825 3300031250 Bacteria 1488
444 Ga0265327_10018223 3300031251 Bacteria 4362
445 Ga0265327_10027814 3300031251 Bacteria 3247
446 Ga0265316_10013122 3300031344 Bacteria 7380
447 Ga0265316_10189063 3300031344 Unclassified 1530
448 Ga0265313_10010591 3300031595 Bacteria 5809
449 Ga0265313_10227376 3300031595 Unclassified 767
450 Ga0265314_10040948 3300031711 Bacteria 3320
451 Ga0265314_10052382 3300031711 Bacteria 2837
452 Ga0265314_10406622 3300031711 Bacteria 735
453 Ga0265342_10130223 3300031712 Unclassified 1410
454 Ga0265342_10385091 3300031712 Unclassified 726
455 Ga0373934_0100170 3300035086 Bacteria 1172
456 Ga0373940_0253938 3300035088 Unclassified 593
457 Ga0373936_0065168 3300035113 Unclassified 1494
458 Ga0373939_0221727 3300035114 Bacteria 724
459 Ga0373945_0228175 3300035116 Bacteria 781
460 Ga0373954_0071174 3300035118 Bacteria 1653
461 Ga0373954_0698962 3300035118 Unclassified 503
462 Ga0373957_0050881 3300035120 Unclassified 1584
463 Ga0373943_0046679 3300035170 Bacteria 2115
464 Ga0373955_0639572 3300035172 Unclassified 652
465 Ga0373924_0069746 3300035410 Unclassified 1481
466 Ga0373931_0310390 3300035691 Unclassified 977
467 Ga0373935_0379407 3300035692 Unclassified 1012
468 Ga0373933_0114976 3300035724 Unclassified 1681
469 Ga0373947_0853188 3300035725 Bacteria 622
470 Ga0373947_1037867 3300035725 Bacteria 559
471 Ga0373937_0102641 3300036401 Bacteria 2655
472 Ga0373937_0934924 3300036401 Bacteria 816
473 Ga0373925_0690175 3300037068 Bacteria 842
474 Ga0373925_1606894 3300037068 Bacteria 531
475 Ga0373925_1727097 3300037068 Bacteria 511
476 Ga0395899_0108998 3300037312 Bacteria 1993
477 Ga0395899_0456060 3300037312 Bacteria 836
478 Ga0395899_0469062 3300037312 Bacteria 821
479 Ga0395900_0035416 3300037418 Bacteria 5141
480 Ga0395900_0063432 3300037418 Bacteria 3798
481 Ga0395900_0157692 3300037418 Bacteria 2317
482 Ga0395900_0261141 3300037418 Bacteria 1730
483 Ga0395900_0292880 3300037418 Bacteria 1616
484 Ga0395900_0357144 3300037418 Bacteria 1433
485 Ga0395900_0394816 3300037418 Bacteria 1349
486 Ga0395900_0435836 3300037418 Bacteria 1269
487 Ga0395900_1039310 3300037418 Unclassified 738
488 Ga0395898_0005111 3300037466 Bacteria 14219
489 Ga0395898_0047265 3300037466 Bacteria 4224
490 Ga0395898_0144482 3300037466 Bacteria 2277
491 Ga0395898_0251952 3300037466 Bacteria 1684
492 Ga0395898_0365206 3300037466 Bacteria 1376
493 Ga0395898_0394630 3300037466 Bacteria 1319
494 Ga0395898_0696209 3300037466 Bacteria 958
495 Ga0395898_1180166 3300037466 Unclassified 697
496 Ga0395905_0090318 3300037471 Bacteria 2871
497 Ga0395905_0091689 3300037471 Bacteria 2849
498 Ga0395905_0259722 3300037471 Bacteria 1622
499 Ga0395905_0470046 3300037471 Bacteria 1156
500 Ga0395905_0848502 3300037471 Unclassified 816
501 Ga0395905_1350705 3300037471 Bacteria 617
502 Ga0395901_0062296 3300038443 Bacteria 3882
503 Ga0395901_0099199 3300038443 Bacteria 3054
504 Ga0395901_0132173 3300038443 Bacteria 2623
505 Ga0395901_0168960 3300038443 Bacteria 2295
506 Ga0395901_0322399 3300038443 Bacteria 1598
507 Ga0395901_0650965 3300038443 Bacteria 1057
508 Ga0395901_0836144 3300038443 Unclassified 907
509 Ga0436360_0731594 3300039438 Bacteria 15643
510 Ga0451839_1156050 3300041496 Bacteria 760
511 Ga0451849_0488422 3300041505 Unclassified 548
512 Ga0451853_0743404 3300041512 Bacteria 735
513 Ga0451853_2551273 3300041512 Bacteria 1210
514 Ga0439448_0065366 3300042005 Bacteria 1206
515 Ga0439458_0232219 3300042157 Unclassified 510
516 Ga0453683_0750435 3300044673 Unclassified 641
517 Ga0466965_0022433 3300044683 Bacteria 3043
518 Ga0466965_0098501 3300044683 Bacteria 1493
519 Ga0466965_0209800 3300044683 Bacteria 1035
520 Ga0466966_0056927 3300044684 Unclassified 2472
521 Ga0466961_0001489 3300044693 Bacteria 14537
522 Ga0466961_0028288 3300044693 Bacteria 3603
523 Ga0466961_0053749 3300044693 Bacteria 2569
524 Ga0466961_0414083 3300044693 Bacteria 817
525 Ga0466961_0585211 3300044693 Bacteria 671
526 Ga0466963_0000049 3300044694 Bacteria 39571
527 Ga0466963_0000702 3300044694 Bacteria 16334
528 Ga0466963_0006992 3300044694 Bacteria 6716
529 Ga0466963_0007471 3300044694 Bacteria 6520
530 Ga0466963_0008847 3300044694 Bacteria 6042
531 Ga0466963_0011460 3300044694 Bacteria 5400
532 Ga0466963_0011474 3300044694 Bacteria 5396
533 Ga0466963_0015847 3300044694 Bacteria 4678
534 Ga0466963_0026131 3300044694 Bacteria 3732
535 Ga0466963_0035227 3300044694 Bacteria 3260
536 Ga0466963_0042322 3300044694 Bacteria 2990
537 Ga0466963_0079951 3300044694 Bacteria 2212
538 Ga0466963_0084311 3300044694 Bacteria 2156
539 Ga0466963_0097741 3300044694 Bacteria 2006
540 Ga0466963_0120403 3300044694 Bacteria 1806
541 Ga0466963_0137765 3300044694 Bacteria 1689
542 Ga0466963_0205764 3300044694 Bacteria 1376
543 Ga0466963_0424176 3300044694 Unclassified 938
544 Ga0466963_0560735 3300044694 Bacteria 807
545 Ga0466963_0790512 3300044694 Bacteria 669
546 Ga0466964_0003456 3300044706 Bacteria 5764
547 Ga0466964_0005312 3300044706 Bacteria 4780
548 Ga0466964_0012506 3300044706 Bacteria 3212
549 Ga0466964_0018531 3300044706 Bacteria 2672
550 Ga0466964_0024447 3300044706 Bacteria 2354
551 Ga0466964_0053153 3300044706 Bacteria 1667
552 Ga0466964_0160607 3300044706 Unclassified 1050
553 Ga0466964_0176008 3300044706 Bacteria 1011
554 Ga0466964_0216770 3300044706 Bacteria 927
555 Ga0466964_0372864 3300044706 Bacteria 739
556 Ga0466964_0635252 3300044706 Bacteria 589
557 Ga0466964_0812087 3300044706 Bacteria 529
558 Ga0466971_0007230 3300044719 Bacteria 4835
559 Ga0466971_0010458 3300044719 Bacteria 4055
560 Ga0466971_0041173 3300044719 Bacteria 2074
561 Ga0466971_0056281 3300044719 Bacteria 1774
562 Ga0466971_0109453 3300044719 Unclassified 1274
563 Ga0466971_0221810 3300044719 Bacteria 896
564 Ga0466968_0003890 3300044735 Bacteria 5542
565 Ga0466968_0004685 3300044735 Bacteria 5125
566 Ga0466968_0021882 3300044735 Bacteria 2593
567 Ga0466968_0022276 3300044735 Bacteria 2574
568 Ga0466968_0034558 3300044735 Bacteria 2110
569 Ga0466968_0068973 3300044735 Bacteria 1536
570 Ga0466968_0437213 3300044735 Bacteria 645
571 Ga0466968_0446494 3300044735 Bacteria 639
572 Ga0466968_0516125 3300044735 Bacteria 597
573 Ga0466970_0312272 3300044765 Bacteria 888
574 Ga0466957_0002669 3300044842 Bacteria 9634
575 Ga0466957_0011273 3300044842 Bacteria 5150
576 Ga0466957_0041436 3300044842 Bacteria 2785
577 Ga0466957_0045546 3300044842 Bacteria 2660
578 Ga0466957_0075614 3300044842 Bacteria 2090
579 Ga0466957_0089568 3300044842 Bacteria 1926
580 Ga0466957_0099409 3300044842 Bacteria 1832
581 Ga0466957_0133631 3300044842 Bacteria 1592
582 Ga0466957_0244682 3300044842 Bacteria 1191
583 Ga0466957_0583596 3300044842 Unclassified 781
584 Ga0466957_0626997 3300044842 Bacteria 754
585 Ga0466960_0002510 3300044901 Bacteria 6901
586 Ga0466960_0050980 3300044901 Bacteria 1997
587 Ga0466960_0204995 3300044901 Bacteria 1079
588 Ga0466960_0205402 3300044901 Bacteria 1078
589 Ga0466960_0261752 3300044901 Bacteria 964
590 Ga0466960_0894601 3300044901 Unclassified 541
591 Ga0466959_0002913 3300045049 Bacteria 11034
592 Ga0466959_0050239 3300045049 Bacteria 3062
593 Ga0466959_0064340 3300045049 Bacteria 2662
594 Ga0466959_0560520 3300045049 Bacteria 770
595 Ga0466959_0969914 3300045049 Bacteria 566
596 Ga0466959_1011539 3300045049 Bacteria 553
597 Ga0466958_0002299 3300045836 Bacteria 9531
598 Ga0466958_0003313 3300045836 Bacteria 8340
599 Ga0466958_0003751 3300045836 Bacteria 7933
600 Ga0466958_0006335 3300045836 Bacteria 6432
601 Ga0466958_0016686 3300045836 Bacteria 4232
602 Ga0466958_0016982 3300045836 Bacteria 4198
603 Ga0466958_0057162 3300045836 Bacteria 2371
604 Ga0466958_0111884 3300045836 Unclassified 1705
605 Ga0466958_0545285 3300045836 Bacteria 753
606 Ga0466958_0667298 3300045836 Bacteria 677
607 Ga0466967_0003030 3300045976 Bacteria 10780
608 Ga0466967_0004223 3300045976 Bacteria 9637
609 Ga0466967_0004913 3300045976 Bacteria 9135
610 Ga0466967_0028212 3300045976 Bacteria 4683
611 Ga0466967_0028214 3300045976 Bacteria 4683
612 Ga0466967_0033554 3300045976 Bacteria 4346
613 Ga0466967_0034562 3300045976 Bacteria 4292
614 Ga0466967_0045393 3300045976 Bacteria 3817
615 Ga0466967_0066380 3300045976 Bacteria 3214
616 Ga0466967_0075464 3300045976 Bacteria 3030
617 Ga0466967_0081903 3300045976 Bacteria 2916
618 Ga0466967_0099687 3300045976 Bacteria 2653
619 Ga0466967_0105596 3300045976 Bacteria 2580
620 Ga0466967_0130980 3300045976 Bacteria 2328
621 Ga0466967_0134398 3300045976 Bacteria 2299
622 Ga0466967_0145122 3300045976 Bacteria 2213
623 Ga0466967_0160874 3300045976 Bacteria 2107
624 Ga0466967_0197590 3300045976 Unclassified 1903
625 Ga0466967_0224249 3300045976 Bacteria 1787
626 Ga0466967_0234016 3300045976 Bacteria 1750
627 Ga0466967_0237341 3300045976 Bacteria 1738
628 Ga0466967_0268088 3300045976 Bacteria 1635
629 Ga0466967_0286129 3300045976 Bacteria 1582
630 Ga0466967_0297852 3300045976 Bacteria 1551
631 Ga0466967_0303018 3300045976 Unclassified 1538
632 Ga0466967_0309017 3300045976 Bacteria 1522
633 Ga0466967_0353770 3300045976 Bacteria 1422
634 Ga0466967_0437022 3300045976 Bacteria 1277
635 Ga0466967_0552409 3300045976 Unclassified 1133
636 Ga0466967_0598937 3300045976 Bacteria 1087
637 Ga0466967_0616781 3300045976 Bacteria 1071
638 Ga0466967_1051176 3300045976 Bacteria 811
639 Ga0466967_1072300 3300045976 Unclassified 802
640 Ga0466967_1828382 3300045976 Bacteria 604
641 Ga0466967_2493273 3300045976 Bacteria 512
642 Ga0495592_0014667 3300046454 Bacteria 5949
643 Ga0495592_0701565 3300046454 Bacteria 609
644 Ga0495603_0212391 3300046455 Unclassified 1117
645 Ga0495629_0074600 3300046459 Bacteria 2368
646 Ga0495629_0107025 3300046459 Bacteria 1951
647 Ga0495629_0135661 3300046459 Bacteria 1713
648 Ga0495629_0296248 3300046459 Unclassified 1108
649 Ga0495641_0073273 3300046461 Bacteria 1536
650 Ga0495641_0098443 3300046461 Bacteria 1305
651 Ga0495641_0155142 3300046461 Unclassified 1024
652 Ga0495651_0087441 3300046462 Bacteria 2344
653 Ga0495651_0839351 3300046462 Bacteria 565
654 Ga0495653_0061173 3300046463 Bacteria 2850
655 Ga0495653_0066208 3300046463 Bacteria 2718
656 Ga0495653_0711506 3300046463 Bacteria 609
657 Ga0495582_0041166 3300046473 Bacteria 2546
658 Ga0495582_0412164 3300046473 Bacteria 779
659 Ga0495582_0528148 3300046473 Bacteria 682
660 Ga0495639_0349976 3300046475 Bacteria 742
661 Ga0495662_0027704 3300046476 Bacteria 2737
662 Ga0495594_0123403 3300046499 Bacteria 1465
663 Ga0495608_0043847 3300046511 Bacteria 2988
664 Ga0495608_0044061 3300046511 Bacteria 2979
665 Ga0495608_0048619 3300046511 Bacteria 2817
666 Ga0495618_0034726 3300046514 Bacteria 3164
667 Ga0495618_0037834 3300046514 Bacteria 3031
668 Ga0495628_0232139 3300046516 Bacteria 1383
669 Ga0495628_0421559 3300046516 Bacteria 973
670 Ga0495630_0078194 3300046517 Bacteria 2494
671 Ga0495630_0135047 3300046517 Bacteria 1875
672 Ga0495630_1432851 3300046517 Unclassified 519
673 Ga0495652_0358974 3300046529 Bacteria 1042
674 Ga0495652_0408293 3300046529 Bacteria 960
675 Ga0495665_0457190 3300046531 Bacteria 645
676 Ga0495640_0009269 3300046533 Bacteria 7673
677 Ga0495640_0171807 3300046533 Unclassified 1385
678 Ga0495587_0040939 3300046536 Bacteria 2766
679 Ga0495587_0817854 3300046536 Unclassified 508
680 Ga0495667_0023385 3300046559 Bacteria 4163
681 Ga0495667_0043603 3300046559 Bacteria 2972
682 Ga0495667_0094236 3300046559 Bacteria 1939
683 Ga0495634_0086551 3300046642 Unclassified 2041
684 Ga0495634_0202216 3300046642 Bacteria 1233
685 Ga0495635_0015823 3300046663 Bacteria 5269
686 Ga0495635_0047594 3300046663 Bacteria 2957
687 Ga0495588_0675617 3300046674 Bacteria 540
688 Ga0495657_0005251 3300046675 Bacteria 10253
689 Ga0495599_0487349 3300046678 Bacteria 727
690 Ga0495647_0087043 3300046681 Bacteria 1275
691 Ga0495658_0124455 3300046683 Bacteria 1563
692 Ga0495658_0132780 3300046683 Bacteria 1517
693 Ga0495613_0008298 3300046689 Bacteria 7711
694 Ga0495613_0178567 3300046689 Bacteria 1504
695 Ga0495613_0399049 3300046689 Unclassified 938
696 Ga0495624_0036445 3300046690 Bacteria 3171
697 Ga0495624_0397694 3300046690 Bacteria 827
698 Ga0495600_0165848 3300046809 Unclassified 1427
699 Ga0495600_0468870 3300046809 Bacteria 777
700 Ga0495581_0044857 3300047315 Bacteria 2556
701 Ga0495604_0222749 3300047317 Bacteria 1298
702 Ga0495604_0240503 3300047317 Bacteria 1238
703 Ga0495604_0377414 3300047317 Bacteria 937
704 Ga0495674_0365750 3300047319 Bacteria 1169
705 Ga0495674_0593249 3300047319 Unclassified 878
706 Ga0495676_0057156 3300047321 Bacteria 3080
707 Ga0495676_0074833 3300047321 Bacteria 2592
708 Ga0495676_0945797 3300047321 Unclassified 551
709 Ga0495680_0007127 3300047322 Bacteria 10296
710 Ga0495680_0011938 3300047322 Bacteria 7665
711 Ga0495680_0141654 3300047322 Bacteria 1759
712 Ga0495680_0671790 3300047322 Bacteria 687
713 Ga0495675_0085616 3300047444 Unclassified 1982
714 Ga0495675_0450094 3300047444 Bacteria 745
715 Ga0495684_0003752 3300047471 Bacteria 11850
716 Ga0495684_0070860 3300047471 Bacteria 2649
717 Ga0495684_0147308 3300047471 Bacteria 1762
718 Ga0495593_0381242 3300047673 Bacteria 705
719 Ga0495602_0258546 3300048088 Bacteria 1293
720 Ga0495602_0707905 3300048088 Unclassified 683
721 Ga0495614_0573887 3300048089 Unclassified 540
722 Ga0495614_0630409 3300048089 Unclassified 516
723 Ga0496100_0052986 3300048903 Bacteria 2640
724 Ga0496100_0061935 3300048903 Bacteria 2467
725 Ga0496100_0074430 3300048903 Bacteria 2276
726 Ga0496100_0109133 3300048903 Bacteria 1920
727 Ga0496100_0249336 3300048903 Bacteria 1313
728 Ga0496100_0330253 3300048903 Bacteria 1147
729 Ga0496100_0490090 3300048903 Bacteria 946
730 Ga0496100_0580047 3300048903 Bacteria 869
731 Ga0496101_0015173 3300048904 Bacteria 5186
732 Ga0496101_0037768 3300048904 Bacteria 3428
733 Ga0496101_0048534 3300048904 Bacteria 3051
734 Ga0496101_0054319 3300048904 Bacteria 2892
735 Ga0496101_0398214 3300048904 Bacteria 1084
736 Ga0496101_0544558 3300048904 Bacteria 917
737 Ga0496101_1034991 3300048904 Bacteria 645
738 Ga0496102_0028463 3300048905 Bacteria 4991
739 Ga0496102_0063204 3300048905 Bacteria 3389
740 Ga0496102_0114004 3300048905 Bacteria 2522
741 Ga0496102_0456170 3300048905 Bacteria 1199
742 Ga0496102_0780795 3300048905 Unclassified 878
743 Ga0496102_1420943 3300048905 Unclassified 613
744 Ga0496102_1615210 3300048905 Unclassified 566
745 Ga0496103_0117115 3300048906 Bacteria 1696
746 Ga0496103_0170535 3300048906 Bacteria 1397
747 Ga0496103_0302197 3300048906 Bacteria 1029
748 Ga0496103_0354990 3300048906 Bacteria 942
749 Ga0496103_0801636 3300048906 Bacteria 594
750 Ga0496104_0002863 3300048907 Bacteria 14870
751 Ga0496104_0051681 3300048907 Bacteria 3879
752 Ga0496104_0057294 3300048907 Bacteria 3686
753 Ga0496104_0287267 3300048907 Bacteria 1557
754 Ga0496104_0314253 3300048907 Bacteria 1479
755 Ga0496104_0456035 3300048907 Bacteria 1190
756 Ga0496104_0536355 3300048907 Bacteria 1081
757 Ga0496105_0001941 3300048908 Bacteria 14854
758 Ga0496105_0025023 3300048908 Bacteria 4853
759 Ga0496105_0069297 3300048908 Bacteria 2914
760 Ga0496105_0078234 3300048908 Bacteria 2731
761 Ga0496105_0108889 3300048908 Bacteria 2287
762 Ga0496105_0354046 3300048908 Bacteria 1172
763 Ga0496105_0580019 3300048908 Bacteria 872
764 Ga0496106_0000350 3300048909 Bacteria 32656
765 Ga0496106_0011764 3300048909 Bacteria 6459
766 Ga0496106_0034147 3300048909 Bacteria 3798
767 Ga0496106_0177432 3300048909 Archaea 1690
768 Ga0496106_1162939 3300048909 Bacteria 603
769 Ga0496106_1374721 3300048909 Unclassified 546
770 Ga0496107_0002689 3300048910 Bacteria 11655
771 Ga0496107_0003956 3300048910 Bacteria 9970
772 Ga0496107_0049688 3300048910 Bacteria 3023
773 Ga0496107_0056103 3300048910 Bacteria 2846
774 Ga0496107_0114583 3300048910 Bacteria 1983
775 Ga0496108_0004233 3300048911 Bacteria 11549
776 Ga0496108_0059812 3300048911 Bacteria 3204
777 Ga0496108_0095032 3300048911 Bacteria 2537
778 Ga0496108_0491770 3300048911 Bacteria 1071
779 Ga0496108_0617215 3300048911 Bacteria 944
780 Ga0496108_1756867 3300048911 Unclassified 509
781 Ga0496109_0012761 3300048912 Bacteria 7262
782 Ga0496109_0017047 3300048912 Bacteria 6357
783 Ga0496109_0020161 3300048912 Bacteria 5890
784 Ga0496109_0063148 3300048912 Bacteria 3387
785 Ga0496109_0063339 3300048912 Bacteria 3382
786 Ga0496109_0206683 3300048912 Bacteria 1846
787 Ga0496109_0878201 3300048912 Bacteria 835
788 Ga0496110_0003879 3300048913 Bacteria 11510
789 Ga0496110_0009448 3300048913 Bacteria 7897
790 Ga0496110_0242658 3300048913 Bacteria 1639
791 Ga0496110_0271349 3300048913 Bacteria 1544
792 Ga0496110_1818481 3300048913 Bacteria 519
793 Ga0496111_0000620 3300048914 Bacteria 18783
794 Ga0496111_0004132 3300048914 Bacteria 9121
795 Ga0496111_0016841 3300048914 Bacteria 5044
796 Ga0496111_0096277 3300048914 Bacteria 2172
797 Ga0496112_0024061 3300048915 Bacteria 5828
798 Ga0496112_0045242 3300048915 Bacteria 4315
799 Ga0496112_0088616 3300048915 Bacteria 3062
800 Ga0496112_0171765 3300048915 Bacteria 2133
801 Ga0496112_0702624 3300048915 Bacteria 939
802 Ga0496112_0789762 3300048915 Bacteria 874
803 Ga0496112_0830957 3300048915 Bacteria 848
804 Ga0496112_1643125 3300048915 Unclassified 555
805 Ga0496112_1723140 3300048915 Unclassified 539
806 Ga0496113_0064467 3300048916 Bacteria 2770
807 Ga0496113_0158276 3300048916 Bacteria 1790
808 Ga0496113_0202570 3300048916 Bacteria 1577
809 Ga0496113_0432005 3300048916 Bacteria 1058
810 Ga0496113_0977342 3300048916 Bacteria 667
811 Ga0496114_0007533 3300048917 Bacteria 8610
812 Ga0496114_0016919 3300048917 Bacteria 5881
813 Ga0496114_0021553 3300048917 Bacteria 5242
814 Ga0496114_0033748 3300048917 Bacteria 4218
815 Ga0496114_0039336 3300048917 Bacteria 3913
816 Ga0496114_0086686 3300048917 Bacteria 2654
817 Ga0496114_0194949 3300048917 Bacteria 1773
818 Ga0496114_1276512 3300048917 Bacteria 621
819 Ga0496115_0010734 3300048918 Bacteria 6850
820 Ga0496115_0032248 3300048918 Bacteria 4132
821 Ga0496115_0067550 3300048918 Bacteria 2892
822 Ga0496115_0077768 3300048918 Bacteria 2698
823 Ga0496115_0104862 3300048918 Bacteria 2320
824 Ga0496115_0130438 3300048918 Bacteria 2071
825 Ga0496115_0340317 3300048918 Bacteria 1224
826 Ga0501036_0174712 3300049572 Bacteria 1809
827 Ga0501040_0113875 3300049576 Bacteria 1893
828 Ga0501046_0703539 3300049580 Bacteria 712
829 Ga0501047_0633698 3300049581 Bacteria 889
830 Ga0501067_0008976 3300049583 Bacteria 5542
831 Ga0501067_0134848 3300049583 Bacteria 1374
832 Ga0501067_0181760 3300049583 Bacteria 1171
833 Ga0501067_0573557 3300049583 Bacteria 632
834 Ga0501069_0040908 3300049585 Bacteria 2561
835 Ga0501069_0090906 3300049585 Bacteria 1726
836 Ga0501069_0216522 3300049585 Bacteria 1112
837 Ga0501069_0517960 3300049585 Bacteria 712
838 Ga0501070_0042954 3300049586 Bacteria 3763
839 Ga0501070_1088434 3300049586 Bacteria 617
840 Ga0501071_0405440 3300049587 Bacteria 1041
841 Ga0501072_0005382 3300049588 Bacteria 9743
842 Ga0501073_0020331 3300049589 Bacteria 4790
843 Ga0501074_0083746 3300049590 Bacteria 2286
844 Ga0501079_0121210 3300049741 Bacteria 2034
845 Ga0501079_0383671 3300049741 Bacteria 1102
846 Ga0501080_0053575 3300049742 Bacteria 3756
847 Ga0501081_0516486 3300049743 Bacteria 891
848 Ga0501083_0000241 3300049744 Bacteria 35214
849 Ga0501045_0893361 3300049824 Bacteria 653
850 nmdc:mga05p37_210715_c1 3300050507 Bacteria 2349
851 nmdc:mga05p37_323100_c1 3300050507 Bacteria 1826
852 nmdc:mga09592_1402288_c1 3300050508 Bacteria 571
853 nmdc:mga09592_23722_c1 3300050508 Bacteria 5068
854 nmdc:mga0qj67_49810_c1 3300050509 Bacteria 3311
855 nmdc:mga06r32_81539_c1 3300050510 Bacteria 3151
856 nmdc:mga0n895_315514_c1 3300050512 Bacteria 1584
857 nmdc:mga0rr50_405383_c1 3300050513 Bacteria 1152
858 nmdc:mga0a205_381272_c1 3300050515 Bacteria 1275
859 nmdc:mga0a205_950269_c1 3300050515 Bacteria 706
860 Ga0495601_0089745 3300053077 Unclassified 1977
861 Ga0495601_0666822 3300053077 Bacteria 665
862 Ga0495655_0048250 3300053083 Bacteria 1117
863 Ga0495595_0005681 3300053084 Bacteria 5049
864 Ga0495595_0065863 3300053084 Bacteria 1704
865 Ga0495619_0047162 3300053085 Bacteria 2836
866 Ga0495619_0055558 3300053085 Bacteria 2622
867 Ga0495619_0067238 3300053085 Bacteria 2392
868 Ga0495619_0596108 3300053085 Unclassified 756
869 Ga0495619_0861131 3300053085 Bacteria 611
870 Ga0466962_0016648 3300061719 Bacteria 3545
871 Ga0466962_0037141 3300061719 Bacteria 2332
872 Ga0466962_0058691 3300061719 Bacteria 1836
873 Ga0466962_0075147 3300061719 Bacteria 1614
874 Ga0466962_0150496 3300061719 Unclassified 1129
875 Ga0466962_0377104 3300061719 Bacteria 708
876 Ga0530510_0593507 3300061734 Bacteria 842

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0435836 Ga0395900_0435836_752_1045 90
2 3300037466 Ga0395898_0696209 Ga0395898_0696209_152_445 90
3 3300037471 Ga0395905_0848502 Ga0395905_0848502_95_388 90
4 3300038443 Ga0395901_0099199 Ga0395901_0099199_245_538 90
5 3300005468 Ga0070707_100532451 Ga0070707_1005324512 91
6 3300005614 Ga0068856_101749704 Ga0068856_1017497042 91
7 3300005615 Ga0070702_100193714 Ga0070702_1001937142 91
8 3300013100 Ga0157373_10186577 Ga0157373_101865772 91
9 3300026078 Ga0207702_11120158 Ga0207702_111201582 91
10 3300048915 Ga0496112_0088616 Ga0496112_0088616_314_607 91
11 3300002244 JGI24742J22300_10037227 JGI24742J22300_100372272 92
12 3300005330 Ga0070690_100039369 Ga0070690_1000393693 92
13 3300005337 Ga0070682_100845158 Ga0070682_1008451582 92
14 3300005338 Ga0068868_100057661 Ga0068868_1000576615 92
15 3300005340 Ga0070689_100989943 Ga0070689_1009899432 92
16 3300005347 Ga0070668_100006039 Ga0070668_1000060392 92
17 3300005356 Ga0070674_101880383 Ga0070674_1018803832 92
18 3300005364 Ga0070673_100461553 Ga0070673_1004615532 92
19 3300005367 Ga0070667_100934875 Ga0070667_1009348751 92
20 3300005406 Ga0070703_10461397 Ga0070703_104613971 92
21 3300005434 Ga0070709_10023261 Ga0070709_100232615 92
22 3300005435 Ga0070714_101121641 Ga0070714_1011216411 92
23 3300005439 Ga0070711_100125191 Ga0070711_1001251912 92
24 3300005441 Ga0070700_100000891 Ga0070700_10000089111 92
25 3300005455 Ga0070663_100164084 Ga0070663_1001640842 92
26 3300005456 Ga0070678_100647592 Ga0070678_1006475922 92
27 3300005459 Ga0068867_100125084 Ga0068867_1001250842 92
28 3300005466 Ga0070685_10141831 Ga0070685_101418312 92
29 3300005468 Ga0070707_100103581 Ga0070707_1001035814 92
30 3300005530 Ga0070679_100219284 Ga0070679_1002192842 92
31 3300005539 Ga0068853_100816252 Ga0068853_1008162522 92
32 3300005544 Ga0070686_100479449 Ga0070686_1004794492 92
33 3300005545 Ga0070695_100853114 Ga0070695_1008531142 92
34 3300005546 Ga0070696_100184219 Ga0070696_1001842192 92
35 3300005547 Ga0070693_100029063 Ga0070693_1000290632 92
36 3300005548 Ga0070665_101254305 Ga0070665_1012543052 92
37 3300005563 Ga0068855_101312603 Ga0068855_1013126032 92
38 3300005564 Ga0070664_100880022 Ga0070664_1008800222 92
39 3300005614 Ga0068856_100033197 Ga0068856_1000331972 92
40 3300005616 Ga0068852_101863981 Ga0068852_1018639811 92
41 3300005618 Ga0068864_100863295 Ga0068864_1008632952 92
42 3300005718 Ga0068866_10037942 Ga0068866_100379423 92
43 3300005719 Ga0068861_100034407 Ga0068861_1000344074 92
44 3300005842 Ga0068858_100801980 Ga0068858_1008019802 92
45 3300005843 Ga0068860_102322432 Ga0068860_1023224322 92
46 3300005844 Ga0068862_100050448 Ga0068862_1000504482 92
47 3300006163 Ga0070715_10243114 Ga0070715_102431142 92
48 3300006175 Ga0070712_100096722 Ga0070712_1000967223 92
49 3300006358 Ga0068871_100018881 Ga0068871_1000188817 92
50 3300006881 Ga0068865_100878083 Ga0068865_1008780832 92
51 3300009098 Ga0105245_10016135 Ga0105245_100161352 92
52 3300009101 Ga0105247_10557778 Ga0105247_105577781 92
53 3300009148 Ga0105243_10154064 Ga0105243_101540643 92
54 3300009174 Ga0105241_10297035 Ga0105241_102970352 92
55 3300009177 Ga0105248_10694609 Ga0105248_106946092 92
56 3300009551 Ga0105238_10167317 Ga0105238_101673172 92
57 3300009553 Ga0105249_10004496 Ga0105249_100044964 92
58 3300010375 Ga0105239_10025569 Ga0105239_100255696 92
59 3300011119 Ga0105246_10130073 Ga0105246_101300733 92
60 3300013105 Ga0157369_10116370 Ga0157369_101163704 92
61 3300013297 Ga0157378_10010022 Ga0157378_100100226 92
62 3300013306 Ga0163162_10026703 Ga0163162_100267034 92
63 3300013307 Ga0157372_10140964 Ga0157372_101409642 92
64 3300014745 Ga0157377_10060167 Ga0157377_100601673 92
65 3300014969 Ga0157376_10054523 Ga0157376_100545232 92
66 3300025885 Ga0207653_10064888 Ga0207653_100648882 92
67 3300025898 Ga0207692_10074635 Ga0207692_100746353 92
68 3300025899 Ga0207642_10046983 Ga0207642_100469833 92
69 3300025900 Ga0207710_10297603 Ga0207710_102976031 92
70 3300025903 Ga0207680_10117281 Ga0207680_101172813 92
71 3300025904 Ga0207647_10454309 Ga0207647_104543092 92
72 3300025905 Ga0207685_10159924 Ga0207685_101599242 92
73 3300025906 Ga0207699_10031955 Ga0207699_100319552 92
74 3300025911 Ga0207654_10193044 Ga0207654_101930441 92
75 3300025915 Ga0207693_10001551 Ga0207693_1000155123 92
76 3300025917 Ga0207660_10777763 Ga0207660_107777632 92
77 3300025921 Ga0207652_10341511 Ga0207652_103415112 92
78 3300025922 Ga0207646_10027291 Ga0207646_100272917 92
79 3300025922 Ga0207646_11150282 Ga0207646_111502822 92
80 3300025924 Ga0207694_10018445 Ga0207694_100184454 92
81 3300025927 Ga0207687_10381626 Ga0207687_103816262 92
82 3300025929 Ga0207664_10999267 Ga0207664_109992672 92
83 3300025934 Ga0207686_10008680 Ga0207686_100086807 92
84 3300025935 Ga0207709_10014134 Ga0207709_100141342 92
85 3300025936 Ga0207670_10347830 Ga0207670_103478302 92
86 3300025937 Ga0207669_10001097 Ga0207669_100010975 92
87 3300025940 Ga0207691_10001540 Ga0207691_100015403 92
88 3300025941 Ga0207711_10564476 Ga0207711_105644762 92
89 3300025944 Ga0207661_11508377 Ga0207661_115083772 92
90 3300025960 Ga0207651_10246216 Ga0207651_102462162 92
91 3300025961 Ga0207712_10122587 Ga0207712_101225872 92
92 3300026023 Ga0207677_10019621 Ga0207677_100196213 92
93 3300026067 Ga0207678_10055915 Ga0207678_100559153 92
94 3300026075 Ga0207708_10000757 Ga0207708_100007578 92
95 3300026078 Ga0207702_10948366 Ga0207702_109483662 92
96 3300026089 Ga0207648_10002049 Ga0207648_100020499 92
97 3300026095 Ga0207676_10724146 Ga0207676_107241462 92
98 3300026118 Ga0207675_100052929 Ga0207675_1000529294 92
99 3300026121 Ga0207683_10004507 Ga0207683_100045077 92
100 3300026142 Ga0207698_10222335 Ga0207698_102223353 92
101 3300028379 Ga0268266_12101662 Ga0268266_121016622 92
102 3300028380 Ga0268265_10731126 Ga0268265_107311262 92
103 3300028381 Ga0268264_10315359 Ga0268264_103153592 92
104 3300037418 Ga0395900_0394816 Ga0395900_0394816_128_406 92
105 3300037466 Ga0395898_0005111 Ga0395898_0005111_11928_12206 92
106 3300048903 Ga0496100_0330253 Ga0496100_0330253_478_756 92
107 3300048904 Ga0496101_0015173 Ga0496101_0015173_4797_5075 92
108 3300048905 Ga0496102_1615210 Ga0496102_1615210_56_334 92
109 3300048906 Ga0496103_0354990 Ga0496103_0354990_512_790 92
110 3300048907 Ga0496104_0287267 Ga0496104_0287267_795_1073 92
111 3300048908 Ga0496105_0580019 Ga0496105_0580019_59_337 92
112 3300048909 Ga0496106_0034147 Ga0496106_0034147_421_699 92
113 3300048910 Ga0496107_0114583 Ga0496107_0114583_1169_1447 92
114 3300048911 Ga0496108_0617215 Ga0496108_0617215_533_811 92
115 3300048917 Ga0496114_0033748 Ga0496114_0033748_3131_3409 92
116 3300048918 Ga0496115_0032248 Ga0496115_0032248_242_520 92
117 3300006871 Ga0075434_101055633 Ga0075434_1010556332 93
118 3300007076 Ga0075435_100643019 Ga0075435_1006430192 93
119 3300037312 Ga0395899_0456060 Ga0395899_0456060_195_476 93
120 3300037418 Ga0395900_0292880 Ga0395900_0292880_456_737 93
121 3300037466 Ga0395898_0251952 Ga0395898_0251952_516_797 93
122 3300038443 Ga0395901_0132173 Ga0395901_0132173_351_632 93
123 3300045976 Ga0466967_0303018 Ga0466967_0303018_61_348 93
124 3300048911 Ga0496108_1756867 Ga0496108_1756867_174_461 93
125 3300048915 Ga0496112_0171765 Ga0496112_0171765_1539_1826 93
126 3300048916 Ga0496113_0158276 Ga0496113_0158276_49_336 93
127 3300050512 nmdc:mga0n895_315514_c1 nmdc:mga0n895_315514_c1_1187_1474 93
128 3300050513 nmdc:mga0rr50_405383_c1 nmdc:mga0rr50_405383_c1_307_594 93
129 3300050515 nmdc:mga0a205_381272_c1 nmdc:mga0a205_381272_c1_275_562 93
130 3300003322 rootL2_10161100 rootL2_101611002 94
131 3300005434 Ga0070709_10159763 Ga0070709_101597632 94
132 3300005435 Ga0070714_100160390 Ga0070714_1001603903 94
133 3300005435 Ga0070714_101918119 Ga0070714_1019181192 94
134 3300005436 Ga0070713_101303645 Ga0070713_1013036452 94
135 3300005985 Ga0081539_10010499 Ga0081539_100104995 94
136 3300006173 Ga0070716_100718646 Ga0070716_1007186461 94
137 3300006175 Ga0070712_100270609 Ga0070712_1002706092 94
138 3300006844 Ga0075428_100824470 Ga0075428_1008244702 94
139 3300007788 Ga0099795_10600980 Ga0099795_106009802 94
140 3300025906 Ga0207699_10257999 Ga0207699_102579992 94
141 3300025915 Ga0207693_10036544 Ga0207693_100365444 94
142 3300025928 Ga0207700_10706538 Ga0207700_107065382 94
143 3300025929 Ga0207664_10170719 Ga0207664_101707192 94
144 3300025939 Ga0207665_10060117 Ga0207665_100601173 94
145 3300025941 Ga0207711_11423029 Ga0207711_114230291 94
146 3300005337 Ga0070682_100069940 Ga0070682_1000699401 95
147 3300005339 Ga0070660_100032597 Ga0070660_1000325973 95
148 3300005366 Ga0070659_100069384 Ga0070659_1000693843 95
149 3300005471 Ga0070698_101194016 Ga0070698_1011940161 95
150 3300005535 Ga0070684_100509356 Ga0070684_1005093561 95
151 3300005616 Ga0068852_100125695 Ga0068852_1001256952 95
152 3300009551 Ga0105238_11065158 Ga0105238_110651581 95
153 3300020070 Ga0206356_11446365 Ga0206356_114463651 95
154 3300020082 Ga0206353_11117289 Ga0206353_111172891 95
155 3300020082 Ga0206353_11545420 Ga0206353_115454203 95
156 3300025913 Ga0207695_10227844 Ga0207695_102278442 95
157 3300025917 Ga0207660_10040765 Ga0207660_100407652 95
158 3300025917 Ga0207660_11646691 Ga0207660_116466911 95
159 3300025919 Ga0207657_10052187 Ga0207657_100521874 95
160 3300025921 Ga0207652_10044647 Ga0207652_100446473 95
161 3300025921 Ga0207652_10812611 Ga0207652_108126112 95
162 3300025924 Ga0207694_10883620 Ga0207694_108836202 95
163 3300025929 Ga0207664_10809311 Ga0207664_108093111 95
164 3300026142 Ga0207698_10257251 Ga0207698_102572511 95
165 3300028800 Ga0265338_10100854 Ga0265338_101008543 95
166 3300037418 Ga0395900_0063432 Ga0395900_0063432_3048_3335 95
167 3300037466 Ga0395898_0047265 Ga0395898_0047265_1269_1556 95
168 3300037471 Ga0395905_0259722 Ga0395905_0259722_872_1159 95
169 3300038443 Ga0395901_0168960 Ga0395901_0168960_1608_1895 95
170 3300044694 Ga0466963_0000049 Ga0466963_0000049_1990_2277 95
171 3300044694 Ga0466963_0042322 Ga0466963_0042322_2428_2730 95
172 3300044842 Ga0466957_0099409 Ga0466957_0099409_333_635 95
173 3300045836 Ga0466958_0003313 Ga0466958_0003313_1838_2125 95
174 3300045836 Ga0466958_0006335 Ga0466958_0006335_2646_2948 95
175 3300045976 Ga0466967_0003030 Ga0466967_0003030_6682_6969 95
176 3300045976 Ga0466967_0004913 Ga0466967_0004913_5078_5380 95
177 3300045976 Ga0466967_0197590 Ga0466967_0197590_402_689 95
178 3300045976 Ga0466967_0224249 Ga0466967_0224249_370_657 95
179 3300048905 Ga0496102_1420943 Ga0496102_1420943_299_586 95
180 3300049572 Ga0501036_0174712 Ga0501036_0174712_810_1106 95
181 3300049576 Ga0501040_0113875 Ga0501040_0113875_512_808 95
182 3300049585 Ga0501069_0517960 Ga0501069_0517960_14_310 95
183 3300049587 Ga0501071_0405440 Ga0501071_0405440_361_657 95
184 3300049741 Ga0501079_0383671 Ga0501079_0383671_61_357 95
185 3300049743 Ga0501081_0516486 Ga0501081_0516486_206_502 95
186 3300049824 Ga0501045_0893361 Ga0501045_0893361_20_316 95
187 3300005327 Ga0070658_10039434 Ga0070658_100394342 96
188 3300005329 Ga0070683_101172969 Ga0070683_1011729692 96
189 3300005329 Ga0070683_101882290 Ga0070683_1018822901 96
190 3300005339 Ga0070660_100001894 Ga0070660_1000018945 96
191 3300005344 Ga0070661_100002256 Ga0070661_1000022565 96
192 3300005354 Ga0070675_100545582 Ga0070675_1005455822 96
193 3300005435 Ga0070714_100007475 Ga0070714_1000074755 96
194 3300005458 Ga0070681_10141560 Ga0070681_101415603 96
195 3300005563 Ga0068855_100051631 Ga0068855_1000516312 96
196 3300005563 Ga0068855_101169745 Ga0068855_1011697452 96
197 3300005614 Ga0068856_100338351 Ga0068856_1003383512 96
198 3300005616 Ga0068852_100183790 Ga0068852_1001837902 96
199 3300005618 Ga0068864_100579814 Ga0068864_1005798143 96
200 3300006852 Ga0075433_10527011 Ga0075433_105270112 96
201 3300006881 Ga0068865_100985894 Ga0068865_1009858942 96
202 3300009093 Ga0105240_10128695 Ga0105240_101286953 96
203 3300009098 Ga0105245_11014151 Ga0105245_110141512 96
204 3300009147 Ga0114129_10197834 Ga0114129_101978342 96
205 3300009148 Ga0105243_12800367 Ga0105243_128003672 96
206 3300009174 Ga0105241_12087617 Ga0105241_120876172 96
207 3300009177 Ga0105248_10025251 Ga0105248_100252513 96
208 3300009545 Ga0105237_10231304 Ga0105237_102313043 96
209 3300013100 Ga0157373_10157682 Ga0157373_101576822 96
210 3300013102 Ga0157371_10163186 Ga0157371_101631861 96
211 3300013104 Ga0157370_10012865 Ga0157370_100128652 96
212 3300013104 Ga0157370_10067480 Ga0157370_100674802 96
213 3300013105 Ga0157369_10063544 Ga0157369_100635442 96
214 3300013105 Ga0157369_10359971 Ga0157369_103599712 96
215 3300013105 Ga0157369_12100024 Ga0157369_121000242 96
216 3300013308 Ga0157375_13346932 Ga0157375_133469322 96
217 3300020070 Ga0206356_10947349 Ga0206356_109473492 96
218 3300020081 Ga0206354_11532083 Ga0206354_115320832 96
219 3300020082 Ga0206353_10323144 Ga0206353_103231443 96
220 3300025909 Ga0207705_10304571 Ga0207705_103045712 96
221 3300025912 Ga0207707_10257291 Ga0207707_102572912 96
222 3300025913 Ga0207695_10136893 Ga0207695_101368932 96
223 3300025914 Ga0207671_10656715 Ga0207671_106567152 96
224 3300025917 Ga0207660_10590811 Ga0207660_105908112 96
225 3300025920 Ga0207649_10073776 Ga0207649_100737762 96
226 3300025921 Ga0207652_10020844 Ga0207652_100208444 96
227 3300025921 Ga0207652_10919708 Ga0207652_109197082 96
228 3300025929 Ga0207664_10065601 Ga0207664_100656013 96
229 3300025936 Ga0207670_10798730 Ga0207670_107987302 96
230 3300025941 Ga0207711_11276860 Ga0207711_112768602 96
231 3300025944 Ga0207661_10515939 Ga0207661_105159392 96
232 3300025944 Ga0207661_10790317 Ga0207661_107903172 96
233 3300025949 Ga0207667_10050633 Ga0207667_100506332 96
234 3300025949 Ga0207667_10669312 Ga0207667_106693122 96
235 3300026142 Ga0207698_10072099 Ga0207698_100720992 96
236 3300037312 Ga0395899_0108998 Ga0395899_0108998_822_1112 96
237 3300037312 Ga0395899_0469062 Ga0395899_0469062_455_745 96
238 3300037418 Ga0395900_0157692 Ga0395900_0157692_70_360 96
239 3300037418 Ga0395900_0261141 Ga0395900_0261141_119_409 96
240 3300037418 Ga0395900_0357144 Ga0395900_0357144_637_927 96
241 3300037466 Ga0395898_0144482 Ga0395898_0144482_502_792 96
242 3300037466 Ga0395898_0365206 Ga0395898_0365206_806_1096 96
243 3300037466 Ga0395898_0394630 Ga0395898_0394630_157_447 96
244 3300037466 Ga0395898_1180166 Ga0395898_1180166_359_658 96
245 3300037471 Ga0395905_0090318 Ga0395905_0090318_1778_2068 96
246 3300037471 Ga0395905_0470046 Ga0395905_0470046_787_1077 96
247 3300038443 Ga0395901_0322399 Ga0395901_0322399_687_977 96
248 3300044694 Ga0466963_0007471 Ga0466963_0007471_1856_2146 96
249 3300044694 Ga0466963_0120403 Ga0466963_0120403_1429_1719 96
250 3300046454 Ga0495592_0701565 Ga0495592_0701565_233_523 96
251 3300046514 Ga0495618_0037834 Ga0495618_0037834_1111_1401 96
252 3300046516 Ga0495628_0421559 Ga0495628_0421559_281_571 96
253 3300046517 Ga0495630_1432851 Ga0495630_1432851_129_419 96
254 3300046533 Ga0495640_0171807 Ga0495640_0171807_507_797 96
255 3300047322 Ga0495680_0141654 Ga0495680_0141654_448_738 96
256 3300047444 Ga0495675_0450094 Ga0495675_0450094_324_614 96
257 3300048088 Ga0495602_0707905 Ga0495602_0707905_60_350 96
258 3300050507 nmdc:mga05p37_323100_c1 nmdc:mga05p37_323100_c1_834_1124 96
259 3300050508 nmdc:mga09592_1402288_c1 nmdc:mga09592_1402288_c1_55_345 96
260 3300050515 nmdc:mga0a205_950269_c1 nmdc:mga0a205_950269_c1_353_643 96
261 3300053077 Ga0495601_0089745 Ga0495601_0089745_991_1281 96
262 3300053085 Ga0495619_0596108 Ga0495619_0596108_168_458 96
263 3300005327 Ga0070658_10024182 Ga0070658_100241823 97
264 3300005329 Ga0070683_100029947 Ga0070683_1000299475 97
265 3300005329 Ga0070683_100068886 Ga0070683_1000688866 97
266 3300005329 Ga0070683_101975090 Ga0070683_1019750901 97
267 3300005336 Ga0070680_100214185 Ga0070680_1002141852 97
268 3300005337 Ga0070682_100619010 Ga0070682_1006190102 97
269 3300005337 Ga0070682_101640652 Ga0070682_1016406522 97
270 3300005338 Ga0068868_100657715 Ga0068868_1006577151 97
271 3300005339 Ga0070660_100087839 Ga0070660_1000878393 97
272 3300005339 Ga0070660_100124143 Ga0070660_1001241431 97
273 3300005339 Ga0070660_100390291 Ga0070660_1003902912 97
274 3300005366 Ga0070659_100181629 Ga0070659_1001816292 97
275 3300005366 Ga0070659_100943158 Ga0070659_1009431582 97
276 3300005366 Ga0070659_101830697 Ga0070659_1018306971 97
277 3300005435 Ga0070714_100029145 Ga0070714_1000291453 97
278 3300005435 Ga0070714_100283219 Ga0070714_1002832192 97
279 3300005437 Ga0070710_11416750 Ga0070710_114167501 97
280 3300005445 Ga0070708_100160796 Ga0070708_1001607962 97
281 3300005455 Ga0070663_100926308 Ga0070663_1009263081 97
282 3300005458 Ga0070681_10060719 Ga0070681_100607196 97
283 3300005458 Ga0070681_10273737 Ga0070681_102737373 97
284 3300005530 Ga0070679_100116757 Ga0070679_1001167572 97
285 3300005530 Ga0070679_100249696 Ga0070679_1002496962 97
286 3300005535 Ga0070684_100659595 Ga0070684_1006595952 97
287 3300005539 Ga0068853_101208404 Ga0068853_1012084041 97
288 3300005547 Ga0070693_100238725 Ga0070693_1002387253 97
289 3300005563 Ga0068855_100099345 Ga0068855_1000993455 97
290 3300005564 Ga0070664_100261715 Ga0070664_1002617152 97
291 3300005614 Ga0068856_100195519 Ga0068856_1001955192 97
292 3300005614 Ga0068856_102450041 Ga0068856_1024500411 97
293 3300006028 Ga0070717_10882494 Ga0070717_108824942 97
294 3300006847 Ga0075431_100020819 Ga0075431_1000208192 97
295 3300006880 Ga0075429_100002524 Ga0075429_1000025249 97
296 3300009098 Ga0105245_12726390 Ga0105245_127263902 97
297 3300009147 Ga0114129_10120074 Ga0114129_101200744 97
298 3300009147 Ga0114129_11560113 Ga0114129_115601132 97
299 3300009545 Ga0105237_10666056 Ga0105237_106660562 97
300 3300009545 Ga0105237_10855280 Ga0105237_108552803 97
301 3300009551 Ga0105238_10037789 Ga0105238_100377893 97
302 3300010375 Ga0105239_12892088 Ga0105239_128920882 97
303 3300013100 Ga0157373_10740147 Ga0157373_107401472 97
304 3300013105 Ga0157369_12025189 Ga0157369_120251892 97
305 3300013307 Ga0157372_11392438 Ga0157372_113924382 97
306 3300014497 Ga0182008_10028234 Ga0182008_100282342 97
307 3300014497 Ga0182008_10040828 Ga0182008_100408283 97
308 3300014497 Ga0182008_10138382 Ga0182008_101383821 97
309 3300015261 Ga0182006_1014920 Ga0182006_10149202 97
310 3300015262 Ga0182007_10012652 Ga0182007_100126521 97
311 3300015262 Ga0182007_10177883 Ga0182007_101778832 97
312 3300015262 Ga0182007_10192700 Ga0182007_101927003 97
313 3300020082 Ga0206353_10033182 Ga0206353_100331822 97
314 3300020082 Ga0206353_10826660 Ga0206353_108266601 97
315 3300025898 Ga0207692_10343038 Ga0207692_103430381 97
316 3300025909 Ga0207705_10048891 Ga0207705_100488912 97
317 3300025909 Ga0207705_10142189 Ga0207705_101421892 97
318 3300025909 Ga0207705_10383635 Ga0207705_103836352 97
319 3300025912 Ga0207707_10171310 Ga0207707_101713103 97
320 3300025912 Ga0207707_10951745 Ga0207707_109517452 97
321 3300025912 Ga0207707_11194301 Ga0207707_111943011 97
322 3300025917 Ga0207660_10036675 Ga0207660_100366755 97
323 3300025919 Ga0207657_10002003 Ga0207657_100020032 97
324 3300025919 Ga0207657_10009290 Ga0207657_100092902 97
325 3300025919 Ga0207657_10363015 Ga0207657_103630152 97
326 3300025921 Ga0207652_10317093 Ga0207652_103170932 97
327 3300025921 Ga0207652_11060257 Ga0207652_110602572 97
328 3300025922 Ga0207646_10392196 Ga0207646_103921962 97
329 3300025924 Ga0207694_10494739 Ga0207694_104947392 97
330 3300025929 Ga0207664_10084568 Ga0207664_100845683 97
331 3300025929 Ga0207664_10134686 Ga0207664_101346862 97
332 3300025929 Ga0207664_11357001 Ga0207664_113570011 97
333 3300025932 Ga0207690_10351348 Ga0207690_103513482 97
334 3300025932 Ga0207690_10480839 Ga0207690_104808391 97
335 3300025932 Ga0207690_10755384 Ga0207690_107553842 97
336 3300025933 Ga0207706_11476694 Ga0207706_114766941 97
337 3300025944 Ga0207661_10024274 Ga0207661_100242745 97
338 3300025944 Ga0207661_10190536 Ga0207661_101905362 97
339 3300026023 Ga0207677_10617745 Ga0207677_106177451 97
340 3300026041 Ga0207639_10766908 Ga0207639_107669081 97
341 3300026078 Ga0207702_10408030 Ga0207702_104080302 97
342 3300026078 Ga0207702_11127669 Ga0207702_111276691 97
343 3300026116 Ga0207674_10599462 Ga0207674_105994622 97
344 3300026142 Ga0207698_10663252 Ga0207698_106632523 97
345 3300028573 Ga0265334_10004671 Ga0265334_100046716 97
346 3300028577 Ga0265318_10000633 Ga0265318_100006335 97
347 3300028666 Ga0265336_10070919 Ga0265336_100709192 97
348 3300028800 Ga0265338_10017133 Ga0265338_100171335 97
349 3300029957 Ga0265324_10008957 Ga0265324_100089573 97
350 3300031235 Ga0265330_10002779 Ga0265330_100027794 97
351 3300031238 Ga0265332_10006125 Ga0265332_100061256 97
352 3300031239 Ga0265328_10003728 Ga0265328_100037287 97
353 3300031241 Ga0265325_10008761 Ga0265325_100087612 97
354 3300031242 Ga0265329_10001093 Ga0265329_100010937 97
355 3300031247 Ga0265340_10003071 Ga0265340_100030717 97
356 3300031249 Ga0265339_10006107 Ga0265339_100061074 97
357 3300031251 Ga0265327_10018223 Ga0265327_100182232 97
358 3300031344 Ga0265316_10013122 Ga0265316_100131225 97
359 3300031595 Ga0265313_10010591 Ga0265313_100105916 97
360 3300031711 Ga0265314_10040948 Ga0265314_100409485 97
361 3300031712 Ga0265342_10130223 Ga0265342_101302232 97
362 3300031712 Ga0265342_10385091 Ga0265342_103850912 97
363 3300035086 Ga0373934_0100170 Ga0373934_0100170_379_672 97
364 3300035088 Ga0373940_0253938 Ga0373940_0253938_155_448 97
365 3300035118 Ga0373954_0071174 Ga0373954_0071174_10_303 97
366 3300035120 Ga0373957_0050881 Ga0373957_0050881_1255_1548 97
367 3300035410 Ga0373924_0069746 Ga0373924_0069746_897_1190 97
368 3300035724 Ga0373933_0114976 Ga0373933_0114976_520_813 97
369 3300036401 Ga0373937_0102641 Ga0373937_0102641_746_1039 97
370 3300037068 Ga0373925_0690175 Ga0373925_0690175_140_433 97
371 3300037418 Ga0395900_1039310 Ga0395900_1039310_180_473 97
372 3300038443 Ga0395901_0836144 Ga0395901_0836144_312_605 97
373 3300041505 Ga0451849_0488422 Ga0451849_0488422_206_499 97
374 3300041512 Ga0451853_0743404 Ga0451853_0743404_172_471 97
375 3300041512 Ga0451853_2551273 Ga0451853_2551273_182_475 97
376 3300042005 Ga0439448_0065366 Ga0439448_0065366_212_505 97
377 3300042157 Ga0439458_0232219 Ga0439458_0232219_116_409 97
378 3300044683 Ga0466965_0022433 Ga0466965_0022433_2592_2885 97
379 3300044683 Ga0466965_0098501 Ga0466965_0098501_757_1050 97
380 3300044684 Ga0466966_0056927 Ga0466966_0056927_1074_1376 97
381 3300044693 Ga0466961_0001489 Ga0466961_0001489_14073_14375 97
382 3300044693 Ga0466961_0028288 Ga0466961_0028288_100_420 97
383 3300044693 Ga0466961_0585211 Ga0466961_0585211_198_491 97
384 3300044694 Ga0466963_0006992 Ga0466963_0006992_2955_3248 97
385 3300044694 Ga0466963_0008847 Ga0466963_0008847_835_1128 97
386 3300044694 Ga0466963_0011474 Ga0466963_0011474_2012_2314 97
387 3300044694 Ga0466963_0026131 Ga0466963_0026131_1328_1630 97
388 3300044694 Ga0466963_0079951 Ga0466963_0079951_1568_1861 97
389 3300044694 Ga0466963_0097741 Ga0466963_0097741_58_351 97
390 3300044694 Ga0466963_0137765 Ga0466963_0137765_813_1106 97
391 3300044694 Ga0466963_0205764 Ga0466963_0205764_1021_1314 97
392 3300044694 Ga0466963_0424176 Ga0466963_0424176_388_681 97
393 3300044706 Ga0466964_0005312 Ga0466964_0005312_1565_1858 97
394 3300044706 Ga0466964_0018531 Ga0466964_0018531_1320_1622 97
395 3300044706 Ga0466964_0053153 Ga0466964_0053153_686_979 97
396 3300044706 Ga0466964_0160607 Ga0466964_0160607_585_878 97
397 3300044706 Ga0466964_0176008 Ga0466964_0176008_54_347 97
398 3300044706 Ga0466964_0372864 Ga0466964_0372864_421_714 97
399 3300044706 Ga0466964_0635252 Ga0466964_0635252_85_378 97
400 3300044706 Ga0466964_0812087 Ga0466964_0812087_89_382 97
401 3300044719 Ga0466971_0010458 Ga0466971_0010458_2938_3258 97
402 3300044719 Ga0466971_0041173 Ga0466971_0041173_1557_1850 97
403 3300044719 Ga0466971_0056281 Ga0466971_0056281_1189_1482 97
404 3300044735 Ga0466968_0004685 Ga0466968_0004685_1587_1880 97
405 3300044735 Ga0466968_0021882 Ga0466968_0021882_1850_2152 97
406 3300044735 Ga0466968_0034558 Ga0466968_0034558_59_352 97
407 3300044735 Ga0466968_0437213 Ga0466968_0437213_146_439 97
408 3300044765 Ga0466970_0312272 Ga0466970_0312272_424_717 97
409 3300044842 Ga0466957_0002669 Ga0466957_0002669_2510_2803 97
410 3300044842 Ga0466957_0041436 Ga0466957_0041436_1349_1651 97
411 3300044842 Ga0466957_0045546 Ga0466957_0045546_144_437 97
412 3300044842 Ga0466957_0075614 Ga0466957_0075614_42_344 97
413 3300044842 Ga0466957_0089568 Ga0466957_0089568_1486_1779 97
414 3300044842 Ga0466957_0133631 Ga0466957_0133631_824_1117 97
415 3300044842 Ga0466957_0244682 Ga0466957_0244682_374_667 97
416 3300044842 Ga0466957_0583596 Ga0466957_0583596_425_727 97
417 3300044901 Ga0466960_0261752 Ga0466960_0261752_432_728 97
418 3300044901 Ga0466960_0894601 Ga0466960_0894601_185_478 97
419 3300045049 Ga0466959_0002913 Ga0466959_0002913_9621_9923 97
420 3300045049 Ga0466959_0064340 Ga0466959_0064340_2243_2563 97
421 3300045049 Ga0466959_0560520 Ga0466959_0560520_219_512 97
422 3300045836 Ga0466958_0002299 Ga0466958_0002299_5356_5649 97
423 3300045836 Ga0466958_0003751 Ga0466958_0003751_3391_3693 97
424 3300045836 Ga0466958_0016982 Ga0466958_0016982_395_715 97
425 3300045836 Ga0466958_0057162 Ga0466958_0057162_349_642 97
426 3300045836 Ga0466958_0545285 Ga0466958_0545285_344_637 97
427 3300045836 Ga0466958_0667298 Ga0466958_0667298_235_537 97
428 3300045976 Ga0466967_0004223 Ga0466967_0004223_4097_4390 97
429 3300045976 Ga0466967_0028212 Ga0466967_0028212_1763_2056 97
430 3300045976 Ga0466967_0028214 Ga0466967_0028214_1227_1520 97
431 3300045976 Ga0466967_0033554 Ga0466967_0033554_1454_1747 97
432 3300045976 Ga0466967_0045393 Ga0466967_0045393_865_1158 97
433 3300045976 Ga0466967_0081903 Ga0466967_0081903_2138_2431 97
434 3300045976 Ga0466967_0099687 Ga0466967_0099687_1923_2216 97
435 3300045976 Ga0466967_0105596 Ga0466967_0105596_2098_2391 97
436 3300045976 Ga0466967_0134398 Ga0466967_0134398_564_857 97
437 3300045976 Ga0466967_0234016 Ga0466967_0234016_755_1048 97
438 3300045976 Ga0466967_0237341 Ga0466967_0237341_1229_1531 97
439 3300045976 Ga0466967_0268088 Ga0466967_0268088_1286_1585 97
440 3300045976 Ga0466967_0297852 Ga0466967_0297852_625_918 97
441 3300045976 Ga0466967_0309017 Ga0466967_0309017_289_591 97
442 3300045976 Ga0466967_0353770 Ga0466967_0353770_735_1028 97
443 3300045976 Ga0466967_0437022 Ga0466967_0437022_98_391 97
444 3300045976 Ga0466967_0552409 Ga0466967_0552409_800_1102 97
445 3300045976 Ga0466967_0616781 Ga0466967_0616781_753_1046 97
446 3300045976 Ga0466967_1051176 Ga0466967_1051176_353_646 97
447 3300045976 Ga0466967_1072300 Ga0466967_1072300_42_344 97
448 3300045976 Ga0466967_2493273 Ga0466967_2493273_207_500 97
449 3300046459 Ga0495629_0296248 Ga0495629_0296248_572_865 97
450 3300046462 Ga0495651_0087441 Ga0495651_0087441_1848_2141 97
451 3300046462 Ga0495651_0839351 Ga0495651_0839351_73_366 97
452 3300046463 Ga0495653_0061173 Ga0495653_0061173_343_636 97
453 3300046511 Ga0495608_0048619 Ga0495608_0048619_612_905 97
454 3300046517 Ga0495630_0135047 Ga0495630_0135047_98_391 97
455 3300046529 Ga0495652_0358974 Ga0495652_0358974_510_803 97
456 3300046536 Ga0495587_0040939 Ga0495587_0040939_2089_2382 97
457 3300046536 Ga0495587_0817854 Ga0495587_0817854_154_447 97
458 3300046559 Ga0495667_0043603 Ga0495667_0043603_1548_1841 97
459 3300046642 Ga0495634_0086551 Ga0495634_0086551_614_907 97
460 3300046663 Ga0495635_0047594 Ga0495635_0047594_2578_2871 97
461 3300046689 Ga0495613_0399049 Ga0495613_0399049_194_487 97
462 3300046809 Ga0495600_0165848 Ga0495600_0165848_643_936 97
463 3300047317 Ga0495604_0377414 Ga0495604_0377414_613_906 97
464 3300047319 Ga0495674_0365750 Ga0495674_0365750_224_517 97
465 3300047321 Ga0495676_0945797 Ga0495676_0945797_166_459 97
466 3300047322 Ga0495680_0007127 Ga0495680_0007127_1093_1386 97
467 3300047444 Ga0495675_0085616 Ga0495675_0085616_620_913 97
468 3300047471 Ga0495684_0070860 Ga0495684_0070860_771_1064 97
469 3300047471 Ga0495684_0147308 Ga0495684_0147308_393_686 97
470 3300048903 Ga0496100_0109133 Ga0496100_0109133_1343_1636 97
471 3300048903 Ga0496100_0249336 Ga0496100_0249336_804_1097 97
472 3300048904 Ga0496101_0054319 Ga0496101_0054319_2053_2346 97
473 3300048904 Ga0496101_0398214 Ga0496101_0398214_51_344 97
474 3300048906 Ga0496103_0801636 Ga0496103_0801636_189_482 97
475 3300048907 Ga0496104_0456035 Ga0496104_0456035_604_897 97
476 3300048908 Ga0496105_0354046 Ga0496105_0354046_520_813 97
477 3300048909 Ga0496106_1162939 Ga0496106_1162939_167_460 97
478 3300048909 Ga0496106_1374721 Ga0496106_1374721_218_511 97
479 3300048910 Ga0496107_0056103 Ga0496107_0056103_2008_2301 97
480 3300048912 Ga0496109_0020161 Ga0496109_0020161_3956_4249 97
481 3300048912 Ga0496109_0063148 Ga0496109_0063148_846_1139 97
482 3300048913 Ga0496110_0271349 Ga0496110_0271349_887_1180 97
483 3300048913 Ga0496110_1818481 Ga0496110_1818481_168_461 97
484 3300048914 Ga0496111_0096277 Ga0496111_0096277_901_1194 97
485 3300048915 Ga0496112_0024061 Ga0496112_0024061_604_897 97
486 3300048916 Ga0496113_0432005 Ga0496113_0432005_589_882 97
487 3300048917 Ga0496114_1276512 Ga0496114_1276512_251_544 97
488 3300049580 Ga0501046_0703539 Ga0501046_0703539_361_663 97
489 3300049581 Ga0501047_0633698 Ga0501047_0633698_46_348 97
490 3300049583 Ga0501067_0134848 Ga0501067_0134848_671_964 97
491 3300049585 Ga0501069_0040908 Ga0501069_0040908_1463_1756 97
492 3300049586 Ga0501070_0042954 Ga0501070_0042954_1871_2173 97
493 3300049586 Ga0501070_1088434 Ga0501070_1088434_300_593 97
494 3300049588 Ga0501072_0005382 Ga0501072_0005382_7350_7652 97
495 3300049589 Ga0501073_0020331 Ga0501073_0020331_2648_2950 97
496 3300049590 Ga0501074_0083746 Ga0501074_0083746_602_904 97
497 3300049741 Ga0501079_0121210 Ga0501079_0121210_705_1007 97
498 3300049742 Ga0501080_0053575 Ga0501080_0053575_3118_3420 97
499 3300049744 Ga0501083_0000241 Ga0501083_0000241_2897_3199 97
500 3300050507 nmdc:mga05p37_210715_c1 nmdc:mga05p37_210715_c1_739_1050 97
501 3300050508 nmdc:mga09592_23722_c1 nmdc:mga09592_23722_c1_3974_4285 97
502 3300050509 nmdc:mga0qj67_49810_c1 nmdc:mga0qj67_49810_c1_807_1118 97
503 3300050510 nmdc:mga06r32_81539_c1 nmdc:mga06r32_81539_c1_2194_2505 97
504 3300053084 Ga0495595_0005681 Ga0495595_0005681_3998_4291 97
505 3300053085 Ga0495619_0055558 Ga0495619_0055558_1576_1869 97
506 3300053085 Ga0495619_0861131 Ga0495619_0861131_286_579 97
507 3300061719 Ga0466962_0058691 Ga0466962_0058691_1233_1553 97
508 3300061719 Ga0466962_0075147 Ga0466962_0075147_811_1104 97
509 3300061719 Ga0466962_0377104 Ga0466962_0377104_202_495 97
510 3300061734 Ga0530510_0593507 Ga0530510_0593507_296_589 97
511 3300005335 Ga0070666_11059650 Ga0070666_110596501 98
512 3300005336 Ga0070680_100129688 Ga0070680_1001296882 98
513 3300005336 Ga0070680_100866375 Ga0070680_1008663752 98
514 3300005355 Ga0070671_100075864 Ga0070671_1000758642 98
515 3300005435 Ga0070714_100047788 Ga0070714_1000477882 98
516 3300005435 Ga0070714_100384979 Ga0070714_1003849792 98
517 3300005436 Ga0070713_100022189 Ga0070713_1000221894 98
518 3300005439 Ga0070711_100212829 Ga0070711_1002128292 98
519 3300005439 Ga0070711_100352477 Ga0070711_1003524772 98
520 3300005444 Ga0070694_100182245 Ga0070694_1001822452 98
521 3300005456 Ga0070678_100243020 Ga0070678_1002430203 98
522 3300005458 Ga0070681_10097911 Ga0070681_100979112 98
523 3300005458 Ga0070681_11411912 Ga0070681_114119121 98
524 3300005467 Ga0070706_100097485 Ga0070706_1000974853 98
525 3300005471 Ga0070698_100071346 Ga0070698_1000713462 98
526 3300005518 Ga0070699_101214808 Ga0070699_1012148081 98
527 3300005530 Ga0070679_100089311 Ga0070679_1000893112 98
528 3300005530 Ga0070679_101295846 Ga0070679_1012958461 98
529 3300005535 Ga0070684_101301828 Ga0070684_1013018282 98
530 3300005536 Ga0070697_101904306 Ga0070697_1019043061 98
531 3300005545 Ga0070695_100000670 Ga0070695_10000067011 98
532 3300005545 Ga0070695_100113305 Ga0070695_1001133053 98
533 3300005563 Ga0068855_102567498 Ga0068855_1025674981 98
534 3300005578 Ga0068854_101488408 Ga0068854_1014884082 98
535 3300006028 Ga0070717_10026131 Ga0070717_100261316 98
536 3300006175 Ga0070712_100940576 Ga0070712_1009405761 98
537 3300009093 Ga0105240_11941186 Ga0105240_119411862 98
538 3300009101 Ga0105247_11276685 Ga0105247_112766852 98
539 3300009177 Ga0105248_10493547 Ga0105248_104935472 98
540 3300009545 Ga0105237_10056866 Ga0105237_100568664 98
541 3300013100 Ga0157373_10066219 Ga0157373_100662192 98
542 3300013104 Ga0157370_10054012 Ga0157370_100540122 98
543 3300013104 Ga0157370_10761466 Ga0157370_107614662 98
544 3300013105 Ga0157369_10129273 Ga0157369_101292733 98
545 3300013105 Ga0157369_10157434 Ga0157369_101574343 98
546 3300013307 Ga0157372_10072409 Ga0157372_100724093 98
547 3300013307 Ga0157372_12006164 Ga0157372_120061642 98
548 3300014497 Ga0182008_10010399 Ga0182008_100103997 98
549 3300015261 Ga0182006_1098267 Ga0182006_10982672 98
550 3300020081 Ga0206354_11484271 Ga0206354_114842711 98
551 3300020082 Ga0206353_10146321 Ga0206353_101463212 98
552 3300021441 Ga0213871_10116273 Ga0213871_101162732 98
553 3300025912 Ga0207707_10096086 Ga0207707_100960864 98
554 3300025912 Ga0207707_10643239 Ga0207707_106432392 98
555 3300025913 Ga0207695_10015652 Ga0207695_100156527 98
556 3300025913 Ga0207695_11136087 Ga0207695_111360872 98
557 3300025914 Ga0207671_10095099 Ga0207671_100950993 98
558 3300025917 Ga0207660_10911638 Ga0207660_109116382 98
559 3300025920 Ga0207649_10760129 Ga0207649_107601292 98
560 3300025920 Ga0207649_11586852 Ga0207649_115868522 98
561 3300025921 Ga0207652_10101900 Ga0207652_101019003 98
562 3300025929 Ga0207664_10003292 Ga0207664_1000329211 98
563 3300025929 Ga0207664_10006985 Ga0207664_100069857 98
564 3300025929 Ga0207664_10076263 Ga0207664_100762634 98
565 3300025931 Ga0207644_10545705 Ga0207644_105457052 98
566 3300025939 Ga0207665_10433682 Ga0207665_104336822 98
567 3300025939 Ga0207665_10762583 Ga0207665_107625832 98
568 3300025941 Ga0207711_10640649 Ga0207711_106406492 98
569 3300025944 Ga0207661_10500862 Ga0207661_105008622 98
570 3300025981 Ga0207640_11248861 Ga0207640_112488611 98
571 3300026078 Ga0207702_10743840 Ga0207702_107438402 98
572 3300037471 Ga0395905_1350705 Ga0395905_1350705_92_388 98
573 3300039438 Ga0436360_0731594 Ga0436360_0731594_12377_12673 98
574 3300044673 Ga0453683_0750435 Ga0453683_0750435_224_520 98
575 3300044683 Ga0466965_0209800 Ga0466965_0209800_703_999 98
576 3300044693 Ga0466961_0053749 Ga0466961_0053749_1097_1393 98
577 3300044693 Ga0466961_0414083 Ga0466961_0414083_283_579 98
578 3300044694 Ga0466963_0000702 Ga0466963_0000702_15034_15330 98
579 3300044694 Ga0466963_0011460 Ga0466963_0011460_4420_4716 98
580 3300044694 Ga0466963_0035227 Ga0466963_0035227_1727_2023 98
581 3300044706 Ga0466964_0012506 Ga0466964_0012506_2163_2459 98
582 3300044706 Ga0466964_0024447 Ga0466964_0024447_1930_2226 98
583 3300044706 Ga0466964_0216770 Ga0466964_0216770_217_513 98
584 3300044719 Ga0466971_0007230 Ga0466971_0007230_1565_1861 98
585 3300044719 Ga0466971_0109453 Ga0466971_0109453_183_479 98
586 3300044719 Ga0466971_0221810 Ga0466971_0221810_75_371 98
587 3300044735 Ga0466968_0003890 Ga0466968_0003890_5111_5407 98
588 3300044735 Ga0466968_0068973 Ga0466968_0068973_965_1261 98
589 3300044735 Ga0466968_0446494 Ga0466968_0446494_103_399 98
590 3300044735 Ga0466968_0516125 Ga0466968_0516125_286_582 98
591 3300044842 Ga0466957_0011273 Ga0466957_0011273_3549_3845 98
592 3300044842 Ga0466957_0626997 Ga0466957_0626997_129_425 98
593 3300044901 Ga0466960_0205402 Ga0466960_0205402_173_469 98
594 3300045049 Ga0466959_0050239 Ga0466959_0050239_577_873 98
595 3300045836 Ga0466958_0016686 Ga0466958_0016686_1056_1352 98
596 3300045836 Ga0466958_0111884 Ga0466958_0111884_499_795 98
597 3300045976 Ga0466967_0130980 Ga0466967_0130980_1066_1362 98
598 3300045976 Ga0466967_0145122 Ga0466967_0145122_852_1148 98
599 3300045976 Ga0466967_0286129 Ga0466967_0286129_682_978 98
600 3300045976 Ga0466967_1828382 Ga0466967_1828382_199_495 98
601 3300047319 Ga0495674_0593249 Ga0495674_0593249_329_625 98
602 3300048903 Ga0496100_0061935 Ga0496100_0061935_1648_1962 98
603 3300048904 Ga0496101_0037768 Ga0496101_0037768_1828_2142 98
604 3300048905 Ga0496102_0028463 Ga0496102_0028463_3730_4026 98
605 3300048905 Ga0496102_0780795 Ga0496102_0780795_209_505 98
606 3300048906 Ga0496103_0117115 Ga0496103_0117115_350_664 98
607 3300048907 Ga0496104_0051681 Ga0496104_0051681_2118_2432 98
608 3300048908 Ga0496105_0108889 Ga0496105_0108889_308_622 98
609 3300048909 Ga0496106_0177432 Ga0496106_0177432_938_1252 98
610 3300048911 Ga0496108_0004233 Ga0496108_0004233_5887_6201 98
611 3300048912 Ga0496109_0012761 Ga0496109_0012761_20_334 98
612 3300048913 Ga0496110_0003879 Ga0496110_0003879_1854_2168 98
613 3300048914 Ga0496111_0000620 Ga0496111_0000620_9021_9335 98
614 3300048915 Ga0496112_0045242 Ga0496112_0045242_1284_1598 98
615 3300048915 Ga0496112_1643125 Ga0496112_1643125_56_352 98
616 3300048916 Ga0496113_0064467 Ga0496113_0064467_1499_1813 98
617 3300048917 Ga0496114_0007533 Ga0496114_0007533_289_603 98
618 3300048918 Ga0496115_0067550 Ga0496115_0067550_225_539 98
619 3300049583 Ga0501067_0008976 Ga0501067_0008976_4053_4349 98
620 3300049583 Ga0501067_0573557 Ga0501067_0573557_111_407 98
621 3300049585 Ga0501069_0090906 Ga0501069_0090906_1180_1476 98
622 3300061719 Ga0466962_0016648 Ga0466962_0016648_3220_3516 98
623 3300061719 Ga0466962_0150496 Ga0466962_0150496_406_702 98
624 2149837012 _F7QKVOU01CGDIP LJQ_0002.00000100 99
625 3300005329 Ga0070683_100419970 Ga0070683_1004199702 99
626 3300005336 Ga0070680_100857562 Ga0070680_1008575622 99
627 3300005337 Ga0070682_100124742 Ga0070682_1001247421 99
628 3300005355 Ga0070671_100235750 Ga0070671_1002357502 99
629 3300005435 Ga0070714_100051138 Ga0070714_1000511382 99
630 3300005435 Ga0070714_100647102 Ga0070714_1006471022 99
631 3300005435 Ga0070714_101174865 Ga0070714_1011748652 99
632 3300005436 Ga0070713_100082041 Ga0070713_1000820411 99
633 3300005436 Ga0070713_100350026 Ga0070713_1003500262 99
634 3300005437 Ga0070710_10002341 Ga0070710_100023417 99
635 3300005437 Ga0070710_10020436 Ga0070710_100204362 99
636 3300005439 Ga0070711_100008253 Ga0070711_1000082535 99
637 3300005439 Ga0070711_100028351 Ga0070711_1000283514 99
638 3300005440 Ga0070705_101272999 Ga0070705_1012729992 99
639 3300005468 Ga0070707_100003577 Ga0070707_1000035776 99
640 3300005468 Ga0070707_100190846 Ga0070707_1001908462 99
641 3300005468 Ga0070707_100456273 Ga0070707_1004562732 99
642 3300005471 Ga0070698_100219569 Ga0070698_1002195691 99
643 3300005471 Ga0070698_100416571 Ga0070698_1004165712 99
644 3300005518 Ga0070699_101114199 Ga0070699_1011141992 99
645 3300005535 Ga0070684_100150985 Ga0070684_1001509852 99
646 3300005535 Ga0070684_100172478 Ga0070684_1001724782 99
647 3300005535 Ga0070684_100396613 Ga0070684_1003966132 99
648 3300005544 Ga0070686_100826276 Ga0070686_1008262762 99
649 3300005547 Ga0070693_100105429 Ga0070693_1001054291 99
650 3300005548 Ga0070665_100579743 Ga0070665_1005797432 99
651 3300005549 Ga0070704_100040941 Ga0070704_1000409414 99
652 3300005563 Ga0068855_102212282 Ga0068855_1022122822 99
653 3300005614 Ga0068856_102369151 Ga0068856_1023691511 99
654 3300005618 Ga0068864_100367993 Ga0068864_1003679932 99
655 3300005841 Ga0068863_100976453 Ga0068863_1009764532 99
656 3300005842 Ga0068858_100892333 Ga0068858_1008923332 99
657 3300006028 Ga0070717_10001487 Ga0070717_1000148712 99
658 3300006028 Ga0070717_10040736 Ga0070717_100407365 99
659 3300006028 Ga0070717_10279542 Ga0070717_102795423 99
660 3300006028 Ga0070717_10410781 Ga0070717_104107812 99
661 3300006028 Ga0070717_10663487 Ga0070717_106634872 99
662 3300006028 Ga0070717_10707959 Ga0070717_107079592 99
663 3300006028 Ga0070717_11099991 Ga0070717_110999911 99
664 3300006163 Ga0070715_10082743 Ga0070715_100827432 99
665 3300006173 Ga0070716_100384148 Ga0070716_1003841482 99
666 3300006175 Ga0070712_100107235 Ga0070712_1001072353 99
667 3300006175 Ga0070712_100168261 Ga0070712_1001682613 99
668 3300006237 Ga0097621_100205385 Ga0097621_1002053853 99
669 3300009098 Ga0105245_10066687 Ga0105245_100666872 99
670 3300009098 Ga0105245_10443101 Ga0105245_104431012 99
671 3300009101 Ga0105247_10073977 Ga0105247_100739772 99
672 3300009148 Ga0105243_12599260 Ga0105243_125992602 99
673 3300009551 Ga0105238_10944528 Ga0105238_109445282 99
674 3300010159 Ga0099796_10100928 Ga0099796_101009282 99
675 3300011119 Ga0105246_10220770 Ga0105246_102207701 99
676 3300013105 Ga0157369_10167975 Ga0157369_101679752 99
677 3300013296 Ga0157374_10023216 Ga0157374_100232162 99
678 3300013306 Ga0163162_10407874 Ga0163162_104078742 99
679 3300014968 Ga0157379_11715082 Ga0157379_117150822 99
680 3300014969 Ga0157376_10143874 Ga0157376_101438743 99
681 3300025898 Ga0207692_10009923 Ga0207692_100099233 99
682 3300025898 Ga0207692_10052109 Ga0207692_100521092 99
683 3300025900 Ga0207710_10103688 Ga0207710_101036882 99
684 3300025905 Ga0207685_10861762 Ga0207685_108617621 99
685 3300025906 Ga0207699_10018714 Ga0207699_100187142 99
686 3300025906 Ga0207699_10022093 Ga0207699_100220934 99
687 3300025912 Ga0207707_10985834 Ga0207707_109858342 99
688 3300025915 Ga0207693_10000745 Ga0207693_1000074516 99
689 3300025915 Ga0207693_10039934 Ga0207693_100399342 99
690 3300025915 Ga0207693_10418274 Ga0207693_104182742 99
691 3300025916 Ga0207663_10006473 Ga0207663_100064735 99
692 3300025916 Ga0207663_10325736 Ga0207663_103257362 99
693 3300025916 Ga0207663_11623886 Ga0207663_116238862 99
694 3300025917 Ga0207660_10487091 Ga0207660_104870912 99
695 3300025922 Ga0207646_10000785 Ga0207646_1000078534 99
696 3300025922 Ga0207646_10151621 Ga0207646_101516212 99
697 3300025922 Ga0207646_10651246 Ga0207646_106512462 99
698 3300025924 Ga0207694_10592951 Ga0207694_105929512 99
699 3300025927 Ga0207687_10048591 Ga0207687_100485914 99
700 3300025928 Ga0207700_10002676 Ga0207700_100026768 99
701 3300025928 Ga0207700_10124498 Ga0207700_101244983 99
702 3300025928 Ga0207700_10226240 Ga0207700_102262402 99
703 3300025928 Ga0207700_10808487 Ga0207700_108084872 99
704 3300025929 Ga0207664_10033341 Ga0207664_100333413 99
705 3300025929 Ga0207664_10221472 Ga0207664_102214721 99
706 3300025929 Ga0207664_10496766 Ga0207664_104967662 99
707 3300025935 Ga0207709_11542856 Ga0207709_115428561 99
708 3300025938 Ga0207704_10352309 Ga0207704_103523092 99
709 3300025939 Ga0207665_10001126 Ga0207665_1000112613 99
710 3300025939 Ga0207665_10133428 Ga0207665_101334282 99
711 3300025944 Ga0207661_10151201 Ga0207661_101512012 99
712 3300025944 Ga0207661_10173632 Ga0207661_101736322 99
713 3300025949 Ga0207667_12133208 Ga0207667_121332082 99
714 3300026035 Ga0207703_11584799 Ga0207703_115847992 99
715 3300026078 Ga0207702_10557829 Ga0207702_105578292 99
716 3300026088 Ga0207641_10805086 Ga0207641_108050862 99
717 3300026095 Ga0207676_10069200 Ga0207676_100692003 99
718 3300028556 Ga0265337_1139887 Ga0265337_11398872 99
719 3300028577 Ga0265318_10089713 Ga0265318_100897132 99
720 3300028666 Ga0265336_10016538 Ga0265336_100165382 99
721 3300028800 Ga0265338_10111758 Ga0265338_101117583 99
722 3300031238 Ga0265332_10028477 Ga0265332_100284774 99
723 3300031239 Ga0265328_10211552 Ga0265328_102115522 99
724 3300031241 Ga0265325_10288001 Ga0265325_102880012 99
725 3300031249 Ga0265339_10019201 Ga0265339_100192014 99
726 3300031250 Ga0265331_10082825 Ga0265331_100828252 99
727 3300031251 Ga0265327_10027814 Ga0265327_100278143 99
728 3300031344 Ga0265316_10189063 Ga0265316_101890632 99
729 3300031595 Ga0265313_10227376 Ga0265313_102273761 99
730 3300031711 Ga0265314_10052382 Ga0265314_100523823 99
731 3300031711 Ga0265314_10406622 Ga0265314_104066222 99
732 3300035113 Ga0373936_0065168 Ga0373936_0065168_715_1020 99
733 3300035114 Ga0373939_0221727 Ga0373939_0221727_343_651 99
734 3300035116 Ga0373945_0228175 Ga0373945_0228175_439_738 99
735 3300035118 Ga0373954_0698962 Ga0373954_0698962_119_418 99
736 3300035170 Ga0373943_0046679 Ga0373943_0046679_724_1023 99
737 3300035172 Ga0373955_0639572 Ga0373955_0639572_298_597 99
738 3300035691 Ga0373931_0310390 Ga0373931_0310390_305_604 99
739 3300035692 Ga0373935_0379407 Ga0373935_0379407_568_873 99
740 3300035725 Ga0373947_0853188 Ga0373947_0853188_22_321 99
741 3300035725 Ga0373947_1037867 Ga0373947_1037867_12_311 99
742 3300036401 Ga0373937_0934924 Ga0373937_0934924_475_774 99
743 3300037068 Ga0373925_1606894 Ga0373925_1606894_19_318 99
744 3300037068 Ga0373925_1727097 Ga0373925_1727097_40_345 99
745 3300037418 Ga0395900_0035416 Ga0395900_0035416_4622_4921 99
746 3300037471 Ga0395905_0091689 Ga0395905_0091689_2176_2475 99
747 3300038443 Ga0395901_0062296 Ga0395901_0062296_1080_1379 99
748 3300038443 Ga0395901_0650965 Ga0395901_0650965_389_688 99
749 3300041496 Ga0451839_1156050 Ga0451839_1156050_57_356 99
750 3300044694 Ga0466963_0015847 Ga0466963_0015847_495_794 99
751 3300044694 Ga0466963_0084311 Ga0466963_0084311_1662_1961 99
752 3300044694 Ga0466963_0560735 Ga0466963_0560735_377_676 99
753 3300044694 Ga0466963_0790512 Ga0466963_0790512_112_411 99
754 3300044706 Ga0466964_0003456 Ga0466964_0003456_1148_1456 99
755 3300044735 Ga0466968_0022276 Ga0466968_0022276_2184_2483 99
756 3300044901 Ga0466960_0002510 Ga0466960_0002510_448_747 99
757 3300044901 Ga0466960_0050980 Ga0466960_0050980_592_891 99
758 3300044901 Ga0466960_0204995 Ga0466960_0204995_631_930 99
759 3300045049 Ga0466959_0969914 Ga0466959_0969914_12_311 99
760 3300045049 Ga0466959_1011539 Ga0466959_1011539_114_413 99
761 3300045976 Ga0466967_0034562 Ga0466967_0034562_1453_1752 99
762 3300045976 Ga0466967_0066380 Ga0466967_0066380_2387_2686 99
763 3300045976 Ga0466967_0075464 Ga0466967_0075464_2378_2677 99
764 3300045976 Ga0466967_0160874 Ga0466967_0160874_1386_1685 99
765 3300045976 Ga0466967_0598937 Ga0466967_0598937_251_559 99
766 3300046454 Ga0495592_0014667 Ga0495592_0014667_2191_2490 99
767 3300046455 Ga0495603_0212391 Ga0495603_0212391_507_806 99
768 3300046459 Ga0495629_0074600 Ga0495629_0074600_422_721 99
769 3300046459 Ga0495629_0107025 Ga0495629_0107025_492_791 99
770 3300046459 Ga0495629_0135661 Ga0495629_0135661_401_700 99
771 3300046461 Ga0495641_0073273 Ga0495641_0073273_402_701 99
772 3300046461 Ga0495641_0098443 Ga0495641_0098443_657_956 99
773 3300046461 Ga0495641_0155142 Ga0495641_0155142_388_687 99
774 3300046463 Ga0495653_0066208 Ga0495653_0066208_1593_1892 99
775 3300046463 Ga0495653_0711506 Ga0495653_0711506_171_470 99
776 3300046473 Ga0495582_0041166 Ga0495582_0041166_2188_2487 99
777 3300046473 Ga0495582_0412164 Ga0495582_0412164_380_679 99
778 3300046473 Ga0495582_0528148 Ga0495582_0528148_52_351 99
779 3300046475 Ga0495639_0349976 Ga0495639_0349976_211_510 99
780 3300046476 Ga0495662_0027704 Ga0495662_0027704_2164_2463 99
781 3300046499 Ga0495594_0123403 Ga0495594_0123403_89_388 99
782 3300046511 Ga0495608_0043847 Ga0495608_0043847_180_479 99
783 3300046511 Ga0495608_0044061 Ga0495608_0044061_841_1140 99
784 3300046514 Ga0495618_0034726 Ga0495618_0034726_2496_2795 99
785 3300046516 Ga0495628_0232139 Ga0495628_0232139_878_1177 99
786 3300046517 Ga0495630_0078194 Ga0495630_0078194_1668_1967 99
787 3300046529 Ga0495652_0408293 Ga0495652_0408293_22_321 99
788 3300046531 Ga0495665_0457190 Ga0495665_0457190_132_431 99
789 3300046533 Ga0495640_0009269 Ga0495640_0009269_1111_1410 99
790 3300046559 Ga0495667_0023385 Ga0495667_0023385_3426_3725 99
791 3300046559 Ga0495667_0094236 Ga0495667_0094236_1063_1362 99
792 3300046642 Ga0495634_0202216 Ga0495634_0202216_528_827 99
793 3300046663 Ga0495635_0015823 Ga0495635_0015823_2120_2419 99
794 3300046674 Ga0495588_0675617 Ga0495588_0675617_83_382 99
795 3300046675 Ga0495657_0005251 Ga0495657_0005251_6762_7061 99
796 3300046678 Ga0495599_0487349 Ga0495599_0487349_283_582 99
797 3300046681 Ga0495647_0087043 Ga0495647_0087043_304_603 99
798 3300046683 Ga0495658_0124455 Ga0495658_0124455_677_976 99
799 3300046683 Ga0495658_0132780 Ga0495658_0132780_384_683 99
800 3300046689 Ga0495613_0008298 Ga0495613_0008298_6486_6785 99
801 3300046689 Ga0495613_0178567 Ga0495613_0178567_316_615 99
802 3300046690 Ga0495624_0036445 Ga0495624_0036445_2043_2342 99
803 3300046690 Ga0495624_0397694 Ga0495624_0397694_209_508 99
804 3300046809 Ga0495600_0468870 Ga0495600_0468870_457_756 99
805 3300047315 Ga0495581_0044857 Ga0495581_0044857_504_803 99
806 3300047317 Ga0495604_0222749 Ga0495604_0222749_869_1168 99
807 3300047317 Ga0495604_0240503 Ga0495604_0240503_318_617 99
808 3300047321 Ga0495676_0057156 Ga0495676_0057156_510_809 99
809 3300047321 Ga0495676_0074833 Ga0495676_0074833_1432_1731 99
810 3300047322 Ga0495680_0011938 Ga0495680_0011938_6798_7097 99
811 3300047322 Ga0495680_0671790 Ga0495680_0671790_147_446 99
812 3300047471 Ga0495684_0003752 Ga0495684_0003752_926_1225 99
813 3300047673 Ga0495593_0381242 Ga0495593_0381242_255_554 99
814 3300048088 Ga0495602_0258546 Ga0495602_0258546_349_648 99
815 3300048089 Ga0495614_0573887 Ga0495614_0573887_20_319 99
816 3300048089 Ga0495614_0630409 Ga0495614_0630409_121_420 99
817 3300048903 Ga0496100_0052986 Ga0496100_0052986_900_1208 99
818 3300048903 Ga0496100_0074430 Ga0496100_0074430_317_616 99
819 3300048903 Ga0496100_0490090 Ga0496100_0490090_14_316 99
820 3300048903 Ga0496100_0580047 Ga0496100_0580047_236_535 99
821 3300048904 Ga0496101_0048534 Ga0496101_0048534_2473_2772 99
822 3300048904 Ga0496101_0544558 Ga0496101_0544558_342_641 99
823 3300048904 Ga0496101_1034991 Ga0496101_1034991_299_598 99
824 3300048905 Ga0496102_0063204 Ga0496102_0063204_991_1299 99
825 3300048905 Ga0496102_0114004 Ga0496102_0114004_1134_1433 99
826 3300048905 Ga0496102_0456170 Ga0496102_0456170_525_833 99
827 3300048906 Ga0496103_0170535 Ga0496103_0170535_788_1090 99
828 3300048906 Ga0496103_0302197 Ga0496103_0302197_647_955 99
829 3300048907 Ga0496104_0002863 Ga0496104_0002863_14184_14483 99
830 3300048907 Ga0496104_0057294 Ga0496104_0057294_1724_2023 99
831 3300048907 Ga0496104_0314253 Ga0496104_0314253_1060_1368 99
832 3300048907 Ga0496104_0536355 Ga0496104_0536355_693_992 99
833 3300048908 Ga0496105_0001941 Ga0496105_0001941_377_676 99
834 3300048908 Ga0496105_0025023 Ga0496105_0025023_1870_2169 99
835 3300048908 Ga0496105_0069297 Ga0496105_0069297_1521_1829 99
836 3300048908 Ga0496105_0078234 Ga0496105_0078234_1765_2064 99
837 3300048909 Ga0496106_0000350 Ga0496106_0000350_31221_31523 99
838 3300048909 Ga0496106_0011764 Ga0496106_0011764_5551_5859 99
839 3300048910 Ga0496107_0002689 Ga0496107_0002689_7282_7590 99
840 3300048910 Ga0496107_0003956 Ga0496107_0003956_8351_8653 99
841 3300048910 Ga0496107_0049688 Ga0496107_0049688_939_1238 99
842 3300048911 Ga0496108_0059812 Ga0496108_0059812_1862_2161 99
843 3300048911 Ga0496108_0095032 Ga0496108_0095032_900_1208 99
844 3300048911 Ga0496108_0491770 Ga0496108_0491770_541_840 99
845 3300048912 Ga0496109_0017047 Ga0496109_0017047_707_1006 99
846 3300048912 Ga0496109_0063339 Ga0496109_0063339_400_708 99
847 3300048912 Ga0496109_0206683 Ga0496109_0206683_303_605 99
848 3300048912 Ga0496109_0878201 Ga0496109_0878201_381_680 99
849 3300048913 Ga0496110_0009448 Ga0496110_0009448_661_969 99
850 3300048913 Ga0496110_0242658 Ga0496110_0242658_410_709 99
851 3300048914 Ga0496111_0004132 Ga0496111_0004132_5475_5783 99
852 3300048914 Ga0496111_0016841 Ga0496111_0016841_1279_1578 99
853 3300048915 Ga0496112_0702624 Ga0496112_0702624_579_881 99
854 3300048915 Ga0496112_0789762 Ga0496112_0789762_455_763 99
855 3300048915 Ga0496112_0830957 Ga0496112_0830957_194_493 99
856 3300048915 Ga0496112_1723140 Ga0496112_1723140_210_509 99
857 3300048916 Ga0496113_0202570 Ga0496113_0202570_1120_1428 99
858 3300048916 Ga0496113_0977342 Ga0496113_0977342_295_594 99
859 3300048917 Ga0496114_0016919 Ga0496114_0016919_3668_3967 99
860 3300048917 Ga0496114_0021553 Ga0496114_0021553_777_1076 99
861 3300048917 Ga0496114_0039336 Ga0496114_0039336_3531_3839 99
862 3300048917 Ga0496114_0086686 Ga0496114_0086686_1700_1999 99
863 3300048917 Ga0496114_0194949 Ga0496114_0194949_234_533 99
864 3300048918 Ga0496115_0010734 Ga0496115_0010734_2942_3241 99
865 3300048918 Ga0496115_0077768 Ga0496115_0077768_1449_1748 99
866 3300048918 Ga0496115_0104862 Ga0496115_0104862_739_1047 99
867 3300048918 Ga0496115_0130438 Ga0496115_0130438_1076_1375 99
868 3300048918 Ga0496115_0340317 Ga0496115_0340317_408_707 99
869 3300049583 Ga0501067_0181760 Ga0501067_0181760_599_898 99
870 3300049585 Ga0501069_0216522 Ga0501069_0216522_328_627 99
871 3300053077 Ga0495601_0666822 Ga0495601_0666822_68_367 99
872 3300053083 Ga0495655_0048250 Ga0495655_0048250_507_806 99
873 3300053084 Ga0495595_0065863 Ga0495595_0065863_579_878 99
874 3300053085 Ga0495619_0047162 Ga0495619_0047162_2200_2499 99
875 3300053085 Ga0495619_0067238 Ga0495619_0067238_479_778 99
876 3300061719 Ga0466962_0037141 Ga0466962_0037141_1200_1499 99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j9r-assembly1.cif.gz_C structure of penicillin v acylase from agrobacterium tumefaciens 0.8104 74 90
4j3b-assembly1.cif.gz_A a naturally variable residue in the s1 subsite of m1-family aminopeptidases modulates catalytic properties and promotes functional specialization 0.7296 2 43
5y1h-assembly1.cif.gz_A crystal structure of plasmodium falciparum aminopeptidase n in complex with (s)-2-(3-(2,4-difluorobenzyl)ureido)-n-hydroxy-4-methylpentanamide 0.7237 2 43
4p04-assembly1.cif.gz_B apo form of bacterial arylsulfate sulfotransferase (asst) h436n mutant with mpo in the active site 0.6581 74 93
5osi-assembly3.cif.gz_G structure of retromer vps29-vps35c subunits complexed with ridl harpin loop (163-176) 0.6555 74 95
ID Description Score Start End Superfamily
5j9rA00 Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A;Penicillin V Acylase; Chain A 0.8229 74 90 3.60.60.10
af_F8Y416_51_178_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.8208 74 89 3.80.10.10
3ebgA01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.7286 2 43 2.60.40.1730
1vraA00 Alpha Beta;4-Layer Sandwich;L-amino peptidase D-ALA esterase/amidase;L-amino peptidase D-ALA esterase/amidase 0.7089 74 92 3.60.70.12
af_Q21182_133_330_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.6917 74 91 2.110.10.10
ID Description Score Start End GO Terms
AF-A0A368WEF9-F1-model_v4 deleted 0.821 7 43
AF-A0A538HR50-F1-model_v4 Uncharacterized protein 0.786 10 95
AF-A0A7M2Z1L9-F1-model_v4 Uncharacterized protein 0.7848 3 95
AF-A0A7W0SGR1-F1-model_v4 Uncharacterized protein 0.7817 2 78
AF-A0A7W0PLV8-F1-model_v4 Uncharacterized protein 0.7802 1 95

Feature Viewer

pLDDT pTM Quality
69.74 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map