F484358
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 876 | 309 | 876 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300031595|Ga0265313_10227376|Ga0265313_102273761 |
| Length | 115 |
| Sequence | MPRAIASDATRVHSMEVAERTSVDLPPHVPGDFQVFVNGVLQARGVDYEVVGRSLVFPRPIAQEGRLGFWRWLSMWLGIAGTYRRHETVDVVYESGGTRGVVTGLEPKPYEELEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2149837012 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 176 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 208 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 209 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 210 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 211 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 212 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 218 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 219 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 220 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 309 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.86 |
| Metatranscriptomes | 1.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.76 |
| Rhizosphere | 87.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | _F7QKVOU01CGDIP | 2149837012 | Unclassified | 504 |
| 2 | JGI24742J22300_10037227 | 3300002244 | Unclassified | 861 |
| 3 | rootL2_10161100 | 3300003322 | Bacteria | 1328 |
| 4 | Ga0070658_10024182 | 3300005327 | Bacteria | 4875 |
| 5 | Ga0070658_10039434 | 3300005327 | Bacteria | 3810 |
| 6 | Ga0070683_100029947 | 3300005329 | Bacteria | 4935 |
| 7 | Ga0070683_100068886 | 3300005329 | Bacteria | 3297 |
| 8 | Ga0070683_100419970 | 3300005329 | Bacteria | 1276 |
| 9 | Ga0070683_101172969 | 3300005329 | Bacteria | 738 |
| 10 | Ga0070683_101882290 | 3300005329 | Bacteria | 575 |
| 11 | Ga0070683_101975090 | 3300005329 | Bacteria | 560 |
| 12 | Ga0070690_100039369 | 3300005330 | Bacteria | 2987 |
| 13 | Ga0070666_11059650 | 3300005335 | Bacteria | 602 |
| 14 | Ga0070680_100129688 | 3300005336 | Bacteria | 2109 |
| 15 | Ga0070680_100214185 | 3300005336 | Bacteria | 1625 |
| 16 | Ga0070680_100857562 | 3300005336 | Unclassified | 783 |
| 17 | Ga0070680_100866375 | 3300005336 | Bacteria | 779 |
| 18 | Ga0070682_100069940 | 3300005337 | Bacteria | 2242 |
| 19 | Ga0070682_100124742 | 3300005337 | Bacteria | 1734 |
| 20 | Ga0070682_100619010 | 3300005337 | Bacteria | 857 |
| 21 | Ga0070682_100845158 | 3300005337 | Bacteria | 747 |
| 22 | Ga0070682_101640652 | 3300005337 | Bacteria | 557 |
| 23 | Ga0068868_100057661 | 3300005338 | Bacteria | 3068 |
| 24 | Ga0068868_100657715 | 3300005338 | Bacteria | 934 |
| 25 | Ga0070660_100001894 | 3300005339 | Bacteria | 14408 |
| 26 | Ga0070660_100032597 | 3300005339 | Bacteria | 3922 |
| 27 | Ga0070660_100087839 | 3300005339 | Bacteria | 2447 |
| 28 | Ga0070660_100124143 | 3300005339 | Bacteria | 2062 |
| 29 | Ga0070660_100390291 | 3300005339 | Bacteria | 1150 |
| 30 | Ga0070689_100989943 | 3300005340 | Bacteria | 747 |
| 31 | Ga0070661_100002256 | 3300005344 | Bacteria | 13217 |
| 32 | Ga0070668_100006039 | 3300005347 | Bacteria | 8982 |
| 33 | Ga0070675_100545582 | 3300005354 | Unclassified | 1048 |
| 34 | Ga0070671_100075864 | 3300005355 | Bacteria | 2809 |
| 35 | Ga0070671_100235750 | 3300005355 | Bacteria | 1553 |
| 36 | Ga0070674_101880383 | 3300005356 | Unclassified | 544 |
| 37 | Ga0070673_100461553 | 3300005364 | Bacteria | 1144 |
| 38 | Ga0070659_100069384 | 3300005366 | Bacteria | 2798 |
| 39 | Ga0070659_100181629 | 3300005366 | Bacteria | 1727 |
| 40 | Ga0070659_100943158 | 3300005366 | Bacteria | 756 |
| 41 | Ga0070659_101830697 | 3300005366 | Unclassified | 544 |
| 42 | Ga0070667_100934875 | 3300005367 | Bacteria | 808 |
| 43 | Ga0070703_10461397 | 3300005406 | Unclassified | 565 |
| 44 | Ga0070709_10023261 | 3300005434 | Bacteria | 3635 |
| 45 | Ga0070709_10159763 | 3300005434 | Bacteria | 1566 |
| 46 | Ga0070714_100007475 | 3300005435 | Bacteria | 8506 |
| 47 | Ga0070714_100029145 | 3300005435 | Bacteria | 4587 |
| 48 | Ga0070714_100047788 | 3300005435 | Bacteria | 3637 |
| 49 | Ga0070714_100051138 | 3300005435 | Bacteria | 3522 |
| 50 | Ga0070714_100160390 | 3300005435 | Bacteria | 2034 |
| 51 | Ga0070714_100283219 | 3300005435 | Unclassified | 1541 |
| 52 | Ga0070714_100384979 | 3300005435 | Bacteria | 1323 |
| 53 | Ga0070714_100647102 | 3300005435 | Bacteria | 1017 |
| 54 | Ga0070714_101121641 | 3300005435 | Bacteria | 767 |
| 55 | Ga0070714_101174865 | 3300005435 | Bacteria | 748 |
| 56 | Ga0070714_101918119 | 3300005435 | Bacteria | 578 |
| 57 | Ga0070713_100022189 | 3300005436 | Bacteria | 4901 |
| 58 | Ga0070713_100082041 | 3300005436 | Bacteria | 2753 |
| 59 | Ga0070713_100350026 | 3300005436 | Bacteria | 1370 |
| 60 | Ga0070713_101303645 | 3300005436 | Bacteria | 704 |
| 61 | Ga0070710_10002341 | 3300005437 | Bacteria | 8966 |
| 62 | Ga0070710_10020436 | 3300005437 | Bacteria | 3435 |
| 63 | Ga0070710_11416750 | 3300005437 | Unclassified | 520 |
| 64 | Ga0070711_100008253 | 3300005439 | Bacteria | 6371 |
| 65 | Ga0070711_100028351 | 3300005439 | Bacteria | 3684 |
| 66 | Ga0070711_100125191 | 3300005439 | Bacteria | 1907 |
| 67 | Ga0070711_100212829 | 3300005439 | Bacteria | 1498 |
| 68 | Ga0070711_100352477 | 3300005439 | Bacteria | 1184 |
| 69 | Ga0070705_101272999 | 3300005440 | Bacteria | 609 |
| 70 | Ga0070700_100000891 | 3300005441 | Bacteria | 14734 |
| 71 | Ga0070694_100182245 | 3300005444 | Bacteria | 1554 |
| 72 | Ga0070708_100160796 | 3300005445 | Bacteria | 2093 |
| 73 | Ga0070663_100164084 | 3300005455 | Bacteria | 1712 |
| 74 | Ga0070663_100926308 | 3300005455 | Bacteria | 754 |
| 75 | Ga0070678_100243020 | 3300005456 | Bacteria | 1506 |
| 76 | Ga0070678_100647592 | 3300005456 | Bacteria | 947 |
| 77 | Ga0070681_10060719 | 3300005458 | Bacteria | 3756 |
| 78 | Ga0070681_10097911 | 3300005458 | Bacteria | 2880 |
| 79 | Ga0070681_10141560 | 3300005458 | Bacteria | 2335 |
| 80 | Ga0070681_10273737 | 3300005458 | Bacteria | 1600 |
| 81 | Ga0070681_11411912 | 3300005458 | Bacteria | 620 |
| 82 | Ga0068867_100125084 | 3300005459 | Bacteria | 1991 |
| 83 | Ga0070685_10141831 | 3300005466 | Bacteria | 1513 |
| 84 | Ga0070706_100097485 | 3300005467 | Bacteria | 2731 |
| 85 | Ga0070707_100003577 | 3300005468 | Bacteria | 14661 |
| 86 | Ga0070707_100103581 | 3300005468 | Bacteria | 2758 |
| 87 | Ga0070707_100190846 | 3300005468 | Bacteria | 1998 |
| 88 | Ga0070707_100456273 | 3300005468 | Bacteria | 1239 |
| 89 | Ga0070707_100532451 | 3300005468 | Bacteria | 1137 |
| 90 | Ga0070698_100071346 | 3300005471 | Bacteria | 3483 |
| 91 | Ga0070698_100219569 | 3300005471 | Bacteria | 1835 |
| 92 | Ga0070698_100416571 | 3300005471 | Bacteria | 1277 |
| 93 | Ga0070698_101194016 | 3300005471 | Bacteria | 710 |
| 94 | Ga0070699_101114199 | 3300005518 | Unclassified | 724 |
| 95 | Ga0070699_101214808 | 3300005518 | Bacteria | 691 |
| 96 | Ga0070679_100089311 | 3300005530 | Bacteria | 3069 |
| 97 | Ga0070679_100116757 | 3300005530 | Bacteria | 2653 |
| 98 | Ga0070679_100219284 | 3300005530 | Bacteria | 1864 |
| 99 | Ga0070679_100249696 | 3300005530 | Bacteria | 1731 |
| 100 | Ga0070679_101295846 | 3300005530 | Unclassified | 674 |
| 101 | Ga0070684_100150985 | 3300005535 | Bacteria | 2105 |
| 102 | Ga0070684_100172478 | 3300005535 | Bacteria | 1965 |
| 103 | Ga0070684_100396613 | 3300005535 | Bacteria | 1272 |
| 104 | Ga0070684_100509356 | 3300005535 | Bacteria | 1115 |
| 105 | Ga0070684_100659595 | 3300005535 | Bacteria | 974 |
| 106 | Ga0070684_101301828 | 3300005535 | Unclassified | 684 |
| 107 | Ga0070697_101904306 | 3300005536 | Unclassified | 532 |
| 108 | Ga0068853_100816252 | 3300005539 | Bacteria | 893 |
| 109 | Ga0068853_101208404 | 3300005539 | Bacteria | 730 |
| 110 | Ga0070686_100479449 | 3300005544 | Bacteria | 961 |
| 111 | Ga0070686_100826276 | 3300005544 | Bacteria | 749 |
| 112 | Ga0070695_100000670 | 3300005545 | Bacteria | 18279 |
| 113 | Ga0070695_100113305 | 3300005545 | Unclassified | 1844 |
| 114 | Ga0070695_100853114 | 3300005545 | Unclassified | 733 |
| 115 | Ga0070696_100184219 | 3300005546 | Bacteria | 1550 |
| 116 | Ga0070693_100029063 | 3300005547 | Bacteria | 3011 |
| 117 | Ga0070693_100105429 | 3300005547 | Bacteria | 1725 |
| 118 | Ga0070693_100238725 | 3300005547 | Bacteria | 1199 |
| 119 | Ga0070665_100579743 | 3300005548 | Bacteria | 1135 |
| 120 | Ga0070665_101254305 | 3300005548 | Bacteria | 752 |
| 121 | Ga0070704_100040941 | 3300005549 | Bacteria | 3194 |
| 122 | Ga0068855_100051631 | 3300005563 | Bacteria | 4843 |
| 123 | Ga0068855_100099345 | 3300005563 | Bacteria | 3352 |
| 124 | Ga0068855_101169745 | 3300005563 | Bacteria | 801 |
| 125 | Ga0068855_101312603 | 3300005563 | Bacteria | 748 |
| 126 | Ga0068855_102212282 | 3300005563 | Bacteria | 552 |
| 127 | Ga0068855_102567498 | 3300005563 | Bacteria | 506 |
| 128 | Ga0070664_100261715 | 3300005564 | Bacteria | 1556 |
| 129 | Ga0070664_100880022 | 3300005564 | Bacteria | 839 |
| 130 | Ga0068854_101488408 | 3300005578 | Bacteria | 614 |
| 131 | Ga0068856_100033197 | 3300005614 | Bacteria | 5054 |
| 132 | Ga0068856_100195519 | 3300005614 | Bacteria | 2036 |
| 133 | Ga0068856_100338351 | 3300005614 | Bacteria | 1523 |
| 134 | Ga0068856_101749704 | 3300005614 | Bacteria | 634 |
| 135 | Ga0068856_102369151 | 3300005614 | Bacteria | 538 |
| 136 | Ga0068856_102450041 | 3300005614 | Unclassified | 529 |
| 137 | Ga0070702_100193714 | 3300005615 | Bacteria | 1340 |
| 138 | Ga0068852_100125695 | 3300005616 | Bacteria | 2355 |
| 139 | Ga0068852_100183790 | 3300005616 | Bacteria | 1968 |
| 140 | Ga0068852_101863981 | 3300005616 | Unclassified | 624 |
| 141 | Ga0068864_100367993 | 3300005618 | Bacteria | 1360 |
| 142 | Ga0068864_100579814 | 3300005618 | Bacteria | 1087 |
| 143 | Ga0068864_100863295 | 3300005618 | Bacteria | 892 |
| 144 | Ga0068866_10037942 | 3300005718 | Bacteria | 2369 |
| 145 | Ga0068861_100034407 | 3300005719 | Bacteria | 3747 |
| 146 | Ga0068863_100976453 | 3300005841 | Bacteria | 849 |
| 147 | Ga0068858_100801980 | 3300005842 | Bacteria | 919 |
| 148 | Ga0068858_100892333 | 3300005842 | Bacteria | 869 |
| 149 | Ga0068860_102322432 | 3300005843 | Bacteria | 557 |
| 150 | Ga0068862_100050448 | 3300005844 | Bacteria | 3557 |
| 151 | Ga0081539_10010499 | 3300005985 | Bacteria | 7512 |
| 152 | Ga0070717_10001487 | 3300006028 | Bacteria | 16225 |
| 153 | Ga0070717_10026131 | 3300006028 | Bacteria | 4654 |
| 154 | Ga0070717_10040736 | 3300006028 | Bacteria | 3785 |
| 155 | Ga0070717_10279542 | 3300006028 | Bacteria | 1480 |
| 156 | Ga0070717_10410781 | 3300006028 | Bacteria | 1217 |
| 157 | Ga0070717_10663487 | 3300006028 | Bacteria | 947 |
| 158 | Ga0070717_10707959 | 3300006028 | Unclassified | 915 |
| 159 | Ga0070717_10882494 | 3300006028 | Unclassified | 814 |
| 160 | Ga0070717_11099991 | 3300006028 | Bacteria | 724 |
| 161 | Ga0070715_10082743 | 3300006163 | Bacteria | 1460 |
| 162 | Ga0070715_10243114 | 3300006163 | Bacteria | 937 |
| 163 | Ga0070716_100384148 | 3300006173 | Bacteria | 1004 |
| 164 | Ga0070716_100718646 | 3300006173 | Bacteria | 765 |
| 165 | Ga0070712_100096722 | 3300006175 | Bacteria | 2174 |
| 166 | Ga0070712_100107235 | 3300006175 | Bacteria | 2078 |
| 167 | Ga0070712_100168261 | 3300006175 | Bacteria | 1698 |
| 168 | Ga0070712_100270609 | 3300006175 | Bacteria | 1365 |
| 169 | Ga0070712_100940576 | 3300006175 | Bacteria | 746 |
| 170 | Ga0097621_100205385 | 3300006237 | Bacteria | 1712 |
| 171 | Ga0068871_100018881 | 3300006358 | Bacteria | 5253 |
| 172 | Ga0075428_100824470 | 3300006844 | Bacteria | 985 |
| 173 | Ga0075431_100020819 | 3300006847 | Bacteria | 6702 |
| 174 | Ga0075433_10527011 | 3300006852 | Bacteria | 1039 |
| 175 | Ga0075434_101055633 | 3300006871 | Bacteria | 826 |
| 176 | Ga0075429_100002524 | 3300006880 | Bacteria | 15407 |
| 177 | Ga0068865_100878083 | 3300006881 | Bacteria | 778 |
| 178 | Ga0068865_100985894 | 3300006881 | Unclassified | 737 |
| 179 | Ga0075435_100643019 | 3300007076 | Bacteria | 920 |
| 180 | Ga0099795_10600980 | 3300007788 | Unclassified | 523 |
| 181 | Ga0105240_10128695 | 3300009093 | Bacteria | 3040 |
| 182 | Ga0105240_11941186 | 3300009093 | Bacteria | 612 |
| 183 | Ga0105245_10016135 | 3300009098 | Bacteria | 6508 |
| 184 | Ga0105245_10066687 | 3300009098 | Bacteria | 3258 |
| 185 | Ga0105245_10443101 | 3300009098 | Bacteria | 1306 |
| 186 | Ga0105245_11014151 | 3300009098 | Unclassified | 875 |
| 187 | Ga0105245_12726390 | 3300009098 | Bacteria | 547 |
| 188 | Ga0105247_10073977 | 3300009101 | Bacteria | 2136 |
| 189 | Ga0105247_10557778 | 3300009101 | Bacteria | 843 |
| 190 | Ga0105247_11276685 | 3300009101 | Bacteria | 588 |
| 191 | Ga0114129_10120074 | 3300009147 | Bacteria | 3620 |
| 192 | Ga0114129_10197834 | 3300009147 | Bacteria | 2724 |
| 193 | Ga0114129_11560113 | 3300009147 | Bacteria | 810 |
| 194 | Ga0105243_10154064 | 3300009148 | Bacteria | 1974 |
| 195 | Ga0105243_12599260 | 3300009148 | Unclassified | 546 |
| 196 | Ga0105243_12800367 | 3300009148 | Bacteria | 528 |
| 197 | Ga0105241_10297035 | 3300009174 | Bacteria | 1385 |
| 198 | Ga0105241_12087617 | 3300009174 | Bacteria | 560 |
| 199 | Ga0105248_10025251 | 3300009177 | Bacteria | 6607 |
| 200 | Ga0105248_10493547 | 3300009177 | Archaea | 1380 |
| 201 | Ga0105248_10694609 | 3300009177 | Bacteria | 1148 |
| 202 | Ga0105237_10056866 | 3300009545 | Bacteria | 3915 |
| 203 | Ga0105237_10231304 | 3300009545 | Bacteria | 1849 |
| 204 | Ga0105237_10666056 | 3300009545 | Bacteria | 1047 |
| 205 | Ga0105237_10855280 | 3300009545 | Bacteria | 916 |
| 206 | Ga0105238_10037789 | 3300009551 | Bacteria | 4906 |
| 207 | Ga0105238_10167317 | 3300009551 | Bacteria | 2174 |
| 208 | Ga0105238_10944528 | 3300009551 | Bacteria | 882 |
| 209 | Ga0105238_11065158 | 3300009551 | Bacteria | 830 |
| 210 | Ga0105249_10004496 | 3300009553 | Bacteria | 12054 |
| 211 | Ga0099796_10100928 | 3300010159 | Unclassified | 1085 |
| 212 | Ga0105239_10025569 | 3300010375 | Bacteria | 6499 |
| 213 | Ga0105239_12892088 | 3300010375 | Bacteria | 560 |
| 214 | Ga0105246_10130073 | 3300011119 | Bacteria | 1879 |
| 215 | Ga0105246_10220770 | 3300011119 | Bacteria | 1486 |
| 216 | Ga0157373_10066219 | 3300013100 | Bacteria | 2556 |
| 217 | Ga0157373_10157682 | 3300013100 | Bacteria | 1596 |
| 218 | Ga0157373_10186577 | 3300013100 | Bacteria | 1461 |
| 219 | Ga0157373_10740147 | 3300013100 | Bacteria | 722 |
| 220 | Ga0157371_10163186 | 3300013102 | Bacteria | 1591 |
| 221 | Ga0157370_10012865 | 3300013104 | Bacteria | 8651 |
| 222 | Ga0157370_10054012 | 3300013104 | Bacteria | 3830 |
| 223 | Ga0157370_10067480 | 3300013104 | Bacteria | 3381 |
| 224 | Ga0157370_10761466 | 3300013104 | Bacteria | 882 |
| 225 | Ga0157369_10063544 | 3300013105 | Bacteria | 3977 |
| 226 | Ga0157369_10116370 | 3300013105 | Bacteria | 2839 |
| 227 | Ga0157369_10129273 | 3300013105 | Bacteria | 2677 |
| 228 | Ga0157369_10157434 | 3300013105 | Bacteria | 2399 |
| 229 | Ga0157369_10167975 | 3300013105 | Bacteria | 2313 |
| 230 | Ga0157369_10359971 | 3300013105 | Bacteria | 1511 |
| 231 | Ga0157369_12025189 | 3300013105 | Unclassified | 584 |
| 232 | Ga0157369_12100024 | 3300013105 | Bacteria | 573 |
| 233 | Ga0157374_10023216 | 3300013296 | Bacteria | 5544 |
| 234 | Ga0157378_10010022 | 3300013297 | Bacteria | 8261 |
| 235 | Ga0163162_10026703 | 3300013306 | Bacteria | 5709 |
| 236 | Ga0163162_10407874 | 3300013306 | Bacteria | 1492 |
| 237 | Ga0157372_10072409 | 3300013307 | Bacteria | 3884 |
| 238 | Ga0157372_10140964 | 3300013307 | Bacteria | 2777 |
| 239 | Ga0157372_11392438 | 3300013307 | Bacteria | 809 |
| 240 | Ga0157372_12006164 | 3300013307 | Bacteria | 665 |
| 241 | Ga0157375_13346932 | 3300013308 | Bacteria | 534 |
| 242 | Ga0182008_10010399 | 3300014497 | Bacteria | 4981 |
| 243 | Ga0182008_10028234 | 3300014497 | Bacteria | 2837 |
| 244 | Ga0182008_10040828 | 3300014497 | Bacteria | 2315 |
| 245 | Ga0182008_10138382 | 3300014497 | Bacteria | 1217 |
| 246 | Ga0157377_10060167 | 3300014745 | Bacteria | 2168 |
| 247 | Ga0157379_11715082 | 3300014968 | Unclassified | 616 |
| 248 | Ga0157376_10054523 | 3300014969 | Bacteria | 3333 |
| 249 | Ga0157376_10143874 | 3300014969 | Bacteria | 2142 |
| 250 | Ga0182006_1014920 | 3300015261 | Bacteria | 3341 |
| 251 | Ga0182006_1098267 | 3300015261 | Bacteria | 1043 |
| 252 | Ga0182007_10012652 | 3300015262 | Bacteria | 3240 |
| 253 | Ga0182007_10177883 | 3300015262 | Unclassified | 734 |
| 254 | Ga0182007_10192700 | 3300015262 | Bacteria | 709 |
| 255 | Ga0206356_10947349 | 3300020070 | Bacteria | 1743 |
| 256 | Ga0206356_11446365 | 3300020070 | Unclassified | 538 |
| 257 | Ga0206354_11484271 | 3300020081 | Unclassified | 794 |
| 258 | Ga0206354_11532083 | 3300020081 | Bacteria | 595 |
| 259 | Ga0206353_10033182 | 3300020082 | Bacteria | 537 |
| 260 | Ga0206353_10146321 | 3300020082 | Bacteria | 1076 |
| 261 | Ga0206353_10323144 | 3300020082 | Bacteria | 3568 |
| 262 | Ga0206353_10826660 | 3300020082 | Bacteria | 1398 |
| 263 | Ga0206353_11117289 | 3300020082 | Bacteria | 614 |
| 264 | Ga0206353_11545420 | 3300020082 | Bacteria | 2381 |
| 265 | Ga0213871_10116273 | 3300021441 | Bacteria | 794 |
| 266 | Ga0207653_10064888 | 3300025885 | Bacteria | 1239 |
| 267 | Ga0207692_10009923 | 3300025898 | Bacteria | 3992 |
| 268 | Ga0207692_10052109 | 3300025898 | Unclassified | 2078 |
| 269 | Ga0207692_10074635 | 3300025898 | Bacteria | 1797 |
| 270 | Ga0207692_10343038 | 3300025898 | Bacteria | 919 |
| 271 | Ga0207642_10046983 | 3300025899 | Bacteria | 1927 |
| 272 | Ga0207710_10103688 | 3300025900 | Bacteria | 1344 |
| 273 | Ga0207710_10297603 | 3300025900 | Bacteria | 815 |
| 274 | Ga0207680_10117281 | 3300025903 | Bacteria | 1736 |
| 275 | Ga0207647_10454309 | 3300025904 | Bacteria | 718 |
| 276 | Ga0207685_10159924 | 3300025905 | Bacteria | 1027 |
| 277 | Ga0207685_10861762 | 3300025905 | Unclassified | 502 |
| 278 | Ga0207699_10018714 | 3300025906 | Bacteria | 3676 |
| 279 | Ga0207699_10022093 | 3300025906 | Bacteria | 3442 |
| 280 | Ga0207699_10031955 | 3300025906 | Bacteria | 2961 |
| 281 | Ga0207699_10257999 | 3300025906 | Bacteria | 1204 |
| 282 | Ga0207705_10048891 | 3300025909 | Bacteria | 3043 |
| 283 | Ga0207705_10142189 | 3300025909 | Bacteria | 1792 |
| 284 | Ga0207705_10304571 | 3300025909 | Bacteria | 1222 |
| 285 | Ga0207705_10383635 | 3300025909 | Unclassified | 1085 |
| 286 | Ga0207654_10193044 | 3300025911 | Bacteria | 1336 |
| 287 | Ga0207707_10096086 | 3300025912 | Bacteria | 2589 |
| 288 | Ga0207707_10171310 | 3300025912 | Bacteria | 1897 |
| 289 | Ga0207707_10257291 | 3300025912 | Bacteria | 1516 |
| 290 | Ga0207707_10643239 | 3300025912 | Bacteria | 894 |
| 291 | Ga0207707_10951745 | 3300025912 | Bacteria | 707 |
| 292 | Ga0207707_10985834 | 3300025912 | Bacteria | 692 |
| 293 | Ga0207707_11194301 | 3300025912 | Bacteria | 616 |
| 294 | Ga0207695_10015652 | 3300025913 | Bacteria | 8921 |
| 295 | Ga0207695_10136893 | 3300025913 | Bacteria | 2402 |
| 296 | Ga0207695_10227844 | 3300025913 | Bacteria | 1769 |
| 297 | Ga0207695_11136087 | 3300025913 | Bacteria | 661 |
| 298 | Ga0207671_10095099 | 3300025914 | Bacteria | 2249 |
| 299 | Ga0207671_10656715 | 3300025914 | Bacteria | 835 |
| 300 | Ga0207693_10000745 | 3300025915 | Bacteria | 29290 |
| 301 | Ga0207693_10001551 | 3300025915 | Bacteria | 20284 |
| 302 | Ga0207693_10036544 | 3300025915 | Bacteria | 3872 |
| 303 | Ga0207693_10039934 | 3300025915 | Bacteria | 3695 |
| 304 | Ga0207693_10418274 | 3300025915 | Unclassified | 1048 |
| 305 | Ga0207663_10006473 | 3300025916 | Bacteria | 5994 |
| 306 | Ga0207663_10325736 | 3300025916 | Unclassified | 1156 |
| 307 | Ga0207663_11623886 | 3300025916 | Bacteria | 520 |
| 308 | Ga0207660_10036675 | 3300025917 | Bacteria | 3410 |
| 309 | Ga0207660_10040765 | 3300025917 | Bacteria | 3252 |
| 310 | Ga0207660_10487091 | 3300025917 | Bacteria | 1000 |
| 311 | Ga0207660_10590811 | 3300025917 | Bacteria | 904 |
| 312 | Ga0207660_10777763 | 3300025917 | Bacteria | 781 |
| 313 | Ga0207660_10911638 | 3300025917 | Bacteria | 717 |
| 314 | Ga0207660_11646691 | 3300025917 | Unclassified | 517 |
| 315 | Ga0207657_10002003 | 3300025919 | Bacteria | 22017 |
| 316 | Ga0207657_10009290 | 3300025919 | Bacteria | 9904 |
| 317 | Ga0207657_10052187 | 3300025919 | Bacteria | 3550 |
| 318 | Ga0207657_10363015 | 3300025919 | Bacteria | 1141 |
| 319 | Ga0207649_10073776 | 3300025920 | Bacteria | 2187 |
| 320 | Ga0207649_10760129 | 3300025920 | Bacteria | 755 |
| 321 | Ga0207649_11586852 | 3300025920 | Bacteria | 518 |
| 322 | Ga0207652_10020844 | 3300025921 | Bacteria | 5403 |
| 323 | Ga0207652_10044647 | 3300025921 | Bacteria | 3776 |
| 324 | Ga0207652_10101900 | 3300025921 | Bacteria | 2536 |
| 325 | Ga0207652_10317093 | 3300025921 | Bacteria | 1407 |
| 326 | Ga0207652_10341511 | 3300025921 | Bacteria | 1352 |
| 327 | Ga0207652_10812611 | 3300025921 | Bacteria | 830 |
| 328 | Ga0207652_10919708 | 3300025921 | Bacteria | 772 |
| 329 | Ga0207652_11060257 | 3300025921 | Bacteria | 710 |
| 330 | Ga0207646_10000785 | 3300025922 | Bacteria | 41163 |
| 331 | Ga0207646_10027291 | 3300025922 | Bacteria | 5207 |
| 332 | Ga0207646_10151621 | 3300025922 | Bacteria | 2091 |
| 333 | Ga0207646_10392196 | 3300025922 | Bacteria | 1254 |
| 334 | Ga0207646_10651246 | 3300025922 | Bacteria | 944 |
| 335 | Ga0207646_11150282 | 3300025922 | Bacteria | 682 |
| 336 | Ga0207694_10018445 | 3300025924 | Bacteria | 5274 |
| 337 | Ga0207694_10494739 | 3300025924 | Bacteria | 1023 |
| 338 | Ga0207694_10592951 | 3300025924 | Bacteria | 932 |
| 339 | Ga0207694_10883620 | 3300025924 | Bacteria | 756 |
| 340 | Ga0207687_10048591 | 3300025927 | Bacteria | 2947 |
| 341 | Ga0207687_10381626 | 3300025927 | Bacteria | 1155 |
| 342 | Ga0207700_10002676 | 3300025928 | Bacteria | 10263 |
| 343 | Ga0207700_10124498 | 3300025928 | Bacteria | 2095 |
| 344 | Ga0207700_10226240 | 3300025928 | Bacteria | 1588 |
| 345 | Ga0207700_10706538 | 3300025928 | Bacteria | 900 |
| 346 | Ga0207700_10808487 | 3300025928 | Bacteria | 839 |
| 347 | Ga0207664_10003292 | 3300025929 | Bacteria | 10740 |
| 348 | Ga0207664_10006985 | 3300025929 | Bacteria | 7812 |
| 349 | Ga0207664_10033341 | 3300025929 | Bacteria | 3955 |
| 350 | Ga0207664_10065601 | 3300025929 | Bacteria | 2907 |
| 351 | Ga0207664_10076263 | 3300025929 | Bacteria | 2713 |
| 352 | Ga0207664_10084568 | 3300025929 | Bacteria | 2588 |
| 353 | Ga0207664_10134686 | 3300025929 | Bacteria | 2083 |
| 354 | Ga0207664_10170719 | 3300025929 | Bacteria | 1861 |
| 355 | Ga0207664_10221472 | 3300025929 | Bacteria | 1641 |
| 356 | Ga0207664_10496766 | 3300025929 | Bacteria | 1092 |
| 357 | Ga0207664_10809311 | 3300025929 | Bacteria | 843 |
| 358 | Ga0207664_10999267 | 3300025929 | Bacteria | 750 |
| 359 | Ga0207664_11357001 | 3300025929 | Bacteria | 631 |
| 360 | Ga0207644_10545705 | 3300025931 | Bacteria | 959 |
| 361 | Ga0207690_10351348 | 3300025932 | Bacteria | 1166 |
| 362 | Ga0207690_10480839 | 3300025932 | Bacteria | 1002 |
| 363 | Ga0207690_10755384 | 3300025932 | Bacteria | 802 |
| 364 | Ga0207706_11476694 | 3300025933 | Bacteria | 555 |
| 365 | Ga0207686_10008680 | 3300025934 | Bacteria | 5489 |
| 366 | Ga0207709_10014134 | 3300025935 | Bacteria | 4407 |
| 367 | Ga0207709_11542856 | 3300025935 | Unclassified | 551 |
| 368 | Ga0207670_10347830 | 3300025936 | Bacteria | 1173 |
| 369 | Ga0207670_10798730 | 3300025936 | Bacteria | 786 |
| 370 | Ga0207669_10001097 | 3300025937 | Bacteria | 11569 |
| 371 | Ga0207704_10352309 | 3300025938 | Bacteria | 1147 |
| 372 | Ga0207665_10001126 | 3300025939 | Bacteria | 17976 |
| 373 | Ga0207665_10060117 | 3300025939 | Bacteria | 2572 |
| 374 | Ga0207665_10133428 | 3300025939 | Bacteria | 1765 |
| 375 | Ga0207665_10433682 | 3300025939 | Bacteria | 1006 |
| 376 | Ga0207665_10762583 | 3300025939 | Bacteria | 763 |
| 377 | Ga0207691_10001540 | 3300025940 | Bacteria | 22940 |
| 378 | Ga0207711_10564476 | 3300025941 | Bacteria | 1062 |
| 379 | Ga0207711_10640649 | 3300025941 | Bacteria | 991 |
| 380 | Ga0207711_11276860 | 3300025941 | Bacteria | 676 |
| 381 | Ga0207711_11423029 | 3300025941 | Bacteria | 636 |
| 382 | Ga0207661_10024274 | 3300025944 | Bacteria | 4593 |
| 383 | Ga0207661_10151201 | 3300025944 | Bacteria | 2007 |
| 384 | Ga0207661_10173632 | 3300025944 | Bacteria | 1878 |
| 385 | Ga0207661_10190536 | 3300025944 | Bacteria | 1797 |
| 386 | Ga0207661_10500862 | 3300025944 | Bacteria | 1110 |
| 387 | Ga0207661_10515939 | 3300025944 | Bacteria | 1093 |
| 388 | Ga0207661_10790317 | 3300025944 | Bacteria | 874 |
| 389 | Ga0207661_11508377 | 3300025944 | Bacteria | 616 |
| 390 | Ga0207667_10050633 | 3300025949 | Bacteria | 4381 |
| 391 | Ga0207667_10669312 | 3300025949 | Unclassified | 1042 |
| 392 | Ga0207667_12133208 | 3300025949 | Bacteria | 518 |
| 393 | Ga0207651_10246216 | 3300025960 | Bacteria | 1460 |
| 394 | Ga0207712_10122587 | 3300025961 | Bacteria | 1969 |
| 395 | Ga0207640_11248861 | 3300025981 | Bacteria | 662 |
| 396 | Ga0207677_10019621 | 3300026023 | Bacteria | 4088 |
| 397 | Ga0207677_10617745 | 3300026023 | Bacteria | 953 |
| 398 | Ga0207703_11584799 | 3300026035 | Unclassified | 630 |
| 399 | Ga0207639_10766908 | 3300026041 | Bacteria | 897 |
| 400 | Ga0207678_10055915 | 3300026067 | Bacteria | 3399 |
| 401 | Ga0207708_10000757 | 3300026075 | Bacteria | 24232 |
| 402 | Ga0207702_10408030 | 3300026078 | Bacteria | 1311 |
| 403 | Ga0207702_10557829 | 3300026078 | Bacteria | 1121 |
| 404 | Ga0207702_10743840 | 3300026078 | Bacteria | 968 |
| 405 | Ga0207702_10948366 | 3300026078 | Bacteria | 853 |
| 406 | Ga0207702_11120158 | 3300026078 | Bacteria | 781 |
| 407 | Ga0207702_11127669 | 3300026078 | Bacteria | 778 |
| 408 | Ga0207641_10805086 | 3300026088 | Bacteria | 930 |
| 409 | Ga0207648_10002049 | 3300026089 | Bacteria | 21957 |
| 410 | Ga0207676_10069200 | 3300026095 | Bacteria | 2826 |
| 411 | Ga0207676_10724146 | 3300026095 | Bacteria | 966 |
| 412 | Ga0207674_10599462 | 3300026116 | Bacteria | 1064 |
| 413 | Ga0207675_100052929 | 3300026118 | Bacteria | 3788 |
| 414 | Ga0207683_10004507 | 3300026121 | Bacteria | 12018 |
| 415 | Ga0207698_10072099 | 3300026142 | Bacteria | 2744 |
| 416 | Ga0207698_10222335 | 3300026142 | Bacteria | 1707 |
| 417 | Ga0207698_10257251 | 3300026142 | Bacteria | 1602 |
| 418 | Ga0207698_10663252 | 3300026142 | Bacteria | 1034 |
| 419 | Ga0268266_12101662 | 3300028379 | Unclassified | 537 |
| 420 | Ga0268265_10731126 | 3300028380 | Bacteria | 959 |
| 421 | Ga0268264_10315359 | 3300028381 | Bacteria | 1477 |
| 422 | Ga0265337_1139887 | 3300028556 | Unclassified | 655 |
| 423 | Ga0265334_10004671 | 3300028573 | Bacteria | 6041 |
| 424 | Ga0265318_10000633 | 3300028577 | Bacteria | 24181 |
| 425 | Ga0265318_10089713 | 3300028577 | Archaea | 1132 |
| 426 | Ga0265336_10016538 | 3300028666 | Bacteria | 2412 |
| 427 | Ga0265336_10070919 | 3300028666 | Unclassified | 1041 |
| 428 | Ga0265338_10017133 | 3300028800 | Bacteria | 7830 |
| 429 | Ga0265338_10100854 | 3300028800 | Bacteria | 2352 |
| 430 | Ga0265338_10111758 | 3300028800 | Bacteria | 2198 |
| 431 | Ga0265324_10008957 | 3300029957 | Bacteria | 3937 |
| 432 | Ga0265330_10002779 | 3300031235 | Bacteria | 9395 |
| 433 | Ga0265332_10006125 | 3300031238 | Bacteria | 5490 |
| 434 | Ga0265332_10028477 | 3300031238 | Bacteria | 2445 |
| 435 | Ga0265328_10003728 | 3300031239 | Bacteria | 6719 |
| 436 | Ga0265328_10211552 | 3300031239 | Bacteria | 737 |
| 437 | Ga0265325_10008761 | 3300031241 | Bacteria | 5949 |
| 438 | Ga0265325_10288001 | 3300031241 | Bacteria | 735 |
| 439 | Ga0265329_10001093 | 3300031242 | Bacteria | 13312 |
| 440 | Ga0265340_10003071 | 3300031247 | Bacteria | 9478 |
| 441 | Ga0265339_10006107 | 3300031249 | Bacteria | 7947 |
| 442 | Ga0265339_10019201 | 3300031249 | Bacteria | 4015 |
| 443 | Ga0265331_10082825 | 3300031250 | Bacteria | 1488 |
| 444 | Ga0265327_10018223 | 3300031251 | Bacteria | 4362 |
| 445 | Ga0265327_10027814 | 3300031251 | Bacteria | 3247 |
| 446 | Ga0265316_10013122 | 3300031344 | Bacteria | 7380 |
| 447 | Ga0265316_10189063 | 3300031344 | Unclassified | 1530 |
| 448 | Ga0265313_10010591 | 3300031595 | Bacteria | 5809 |
| 449 | Ga0265313_10227376 | 3300031595 | Unclassified | 767 |
| 450 | Ga0265314_10040948 | 3300031711 | Bacteria | 3320 |
| 451 | Ga0265314_10052382 | 3300031711 | Bacteria | 2837 |
| 452 | Ga0265314_10406622 | 3300031711 | Bacteria | 735 |
| 453 | Ga0265342_10130223 | 3300031712 | Unclassified | 1410 |
| 454 | Ga0265342_10385091 | 3300031712 | Unclassified | 726 |
| 455 | Ga0373934_0100170 | 3300035086 | Bacteria | 1172 |
| 456 | Ga0373940_0253938 | 3300035088 | Unclassified | 593 |
| 457 | Ga0373936_0065168 | 3300035113 | Unclassified | 1494 |
| 458 | Ga0373939_0221727 | 3300035114 | Bacteria | 724 |
| 459 | Ga0373945_0228175 | 3300035116 | Bacteria | 781 |
| 460 | Ga0373954_0071174 | 3300035118 | Bacteria | 1653 |
| 461 | Ga0373954_0698962 | 3300035118 | Unclassified | 503 |
| 462 | Ga0373957_0050881 | 3300035120 | Unclassified | 1584 |
| 463 | Ga0373943_0046679 | 3300035170 | Bacteria | 2115 |
| 464 | Ga0373955_0639572 | 3300035172 | Unclassified | 652 |
| 465 | Ga0373924_0069746 | 3300035410 | Unclassified | 1481 |
| 466 | Ga0373931_0310390 | 3300035691 | Unclassified | 977 |
| 467 | Ga0373935_0379407 | 3300035692 | Unclassified | 1012 |
| 468 | Ga0373933_0114976 | 3300035724 | Unclassified | 1681 |
| 469 | Ga0373947_0853188 | 3300035725 | Bacteria | 622 |
| 470 | Ga0373947_1037867 | 3300035725 | Bacteria | 559 |
| 471 | Ga0373937_0102641 | 3300036401 | Bacteria | 2655 |
| 472 | Ga0373937_0934924 | 3300036401 | Bacteria | 816 |
| 473 | Ga0373925_0690175 | 3300037068 | Bacteria | 842 |
| 474 | Ga0373925_1606894 | 3300037068 | Bacteria | 531 |
| 475 | Ga0373925_1727097 | 3300037068 | Bacteria | 511 |
| 476 | Ga0395899_0108998 | 3300037312 | Bacteria | 1993 |
| 477 | Ga0395899_0456060 | 3300037312 | Bacteria | 836 |
| 478 | Ga0395899_0469062 | 3300037312 | Bacteria | 821 |
| 479 | Ga0395900_0035416 | 3300037418 | Bacteria | 5141 |
| 480 | Ga0395900_0063432 | 3300037418 | Bacteria | 3798 |
| 481 | Ga0395900_0157692 | 3300037418 | Bacteria | 2317 |
| 482 | Ga0395900_0261141 | 3300037418 | Bacteria | 1730 |
| 483 | Ga0395900_0292880 | 3300037418 | Bacteria | 1616 |
| 484 | Ga0395900_0357144 | 3300037418 | Bacteria | 1433 |
| 485 | Ga0395900_0394816 | 3300037418 | Bacteria | 1349 |
| 486 | Ga0395900_0435836 | 3300037418 | Bacteria | 1269 |
| 487 | Ga0395900_1039310 | 3300037418 | Unclassified | 738 |
| 488 | Ga0395898_0005111 | 3300037466 | Bacteria | 14219 |
| 489 | Ga0395898_0047265 | 3300037466 | Bacteria | 4224 |
| 490 | Ga0395898_0144482 | 3300037466 | Bacteria | 2277 |
| 491 | Ga0395898_0251952 | 3300037466 | Bacteria | 1684 |
| 492 | Ga0395898_0365206 | 3300037466 | Bacteria | 1376 |
| 493 | Ga0395898_0394630 | 3300037466 | Bacteria | 1319 |
| 494 | Ga0395898_0696209 | 3300037466 | Bacteria | 958 |
| 495 | Ga0395898_1180166 | 3300037466 | Unclassified | 697 |
| 496 | Ga0395905_0090318 | 3300037471 | Bacteria | 2871 |
| 497 | Ga0395905_0091689 | 3300037471 | Bacteria | 2849 |
| 498 | Ga0395905_0259722 | 3300037471 | Bacteria | 1622 |
| 499 | Ga0395905_0470046 | 3300037471 | Bacteria | 1156 |
| 500 | Ga0395905_0848502 | 3300037471 | Unclassified | 816 |
| 501 | Ga0395905_1350705 | 3300037471 | Bacteria | 617 |
| 502 | Ga0395901_0062296 | 3300038443 | Bacteria | 3882 |
| 503 | Ga0395901_0099199 | 3300038443 | Bacteria | 3054 |
| 504 | Ga0395901_0132173 | 3300038443 | Bacteria | 2623 |
| 505 | Ga0395901_0168960 | 3300038443 | Bacteria | 2295 |
| 506 | Ga0395901_0322399 | 3300038443 | Bacteria | 1598 |
| 507 | Ga0395901_0650965 | 3300038443 | Bacteria | 1057 |
| 508 | Ga0395901_0836144 | 3300038443 | Unclassified | 907 |
| 509 | Ga0436360_0731594 | 3300039438 | Bacteria | 15643 |
| 510 | Ga0451839_1156050 | 3300041496 | Bacteria | 760 |
| 511 | Ga0451849_0488422 | 3300041505 | Unclassified | 548 |
| 512 | Ga0451853_0743404 | 3300041512 | Bacteria | 735 |
| 513 | Ga0451853_2551273 | 3300041512 | Bacteria | 1210 |
| 514 | Ga0439448_0065366 | 3300042005 | Bacteria | 1206 |
| 515 | Ga0439458_0232219 | 3300042157 | Unclassified | 510 |
| 516 | Ga0453683_0750435 | 3300044673 | Unclassified | 641 |
| 517 | Ga0466965_0022433 | 3300044683 | Bacteria | 3043 |
| 518 | Ga0466965_0098501 | 3300044683 | Bacteria | 1493 |
| 519 | Ga0466965_0209800 | 3300044683 | Bacteria | 1035 |
| 520 | Ga0466966_0056927 | 3300044684 | Unclassified | 2472 |
| 521 | Ga0466961_0001489 | 3300044693 | Bacteria | 14537 |
| 522 | Ga0466961_0028288 | 3300044693 | Bacteria | 3603 |
| 523 | Ga0466961_0053749 | 3300044693 | Bacteria | 2569 |
| 524 | Ga0466961_0414083 | 3300044693 | Bacteria | 817 |
| 525 | Ga0466961_0585211 | 3300044693 | Bacteria | 671 |
| 526 | Ga0466963_0000049 | 3300044694 | Bacteria | 39571 |
| 527 | Ga0466963_0000702 | 3300044694 | Bacteria | 16334 |
| 528 | Ga0466963_0006992 | 3300044694 | Bacteria | 6716 |
| 529 | Ga0466963_0007471 | 3300044694 | Bacteria | 6520 |
| 530 | Ga0466963_0008847 | 3300044694 | Bacteria | 6042 |
| 531 | Ga0466963_0011460 | 3300044694 | Bacteria | 5400 |
| 532 | Ga0466963_0011474 | 3300044694 | Bacteria | 5396 |
| 533 | Ga0466963_0015847 | 3300044694 | Bacteria | 4678 |
| 534 | Ga0466963_0026131 | 3300044694 | Bacteria | 3732 |
| 535 | Ga0466963_0035227 | 3300044694 | Bacteria | 3260 |
| 536 | Ga0466963_0042322 | 3300044694 | Bacteria | 2990 |
| 537 | Ga0466963_0079951 | 3300044694 | Bacteria | 2212 |
| 538 | Ga0466963_0084311 | 3300044694 | Bacteria | 2156 |
| 539 | Ga0466963_0097741 | 3300044694 | Bacteria | 2006 |
| 540 | Ga0466963_0120403 | 3300044694 | Bacteria | 1806 |
| 541 | Ga0466963_0137765 | 3300044694 | Bacteria | 1689 |
| 542 | Ga0466963_0205764 | 3300044694 | Bacteria | 1376 |
| 543 | Ga0466963_0424176 | 3300044694 | Unclassified | 938 |
| 544 | Ga0466963_0560735 | 3300044694 | Bacteria | 807 |
| 545 | Ga0466963_0790512 | 3300044694 | Bacteria | 669 |
| 546 | Ga0466964_0003456 | 3300044706 | Bacteria | 5764 |
| 547 | Ga0466964_0005312 | 3300044706 | Bacteria | 4780 |
| 548 | Ga0466964_0012506 | 3300044706 | Bacteria | 3212 |
| 549 | Ga0466964_0018531 | 3300044706 | Bacteria | 2672 |
| 550 | Ga0466964_0024447 | 3300044706 | Bacteria | 2354 |
| 551 | Ga0466964_0053153 | 3300044706 | Bacteria | 1667 |
| 552 | Ga0466964_0160607 | 3300044706 | Unclassified | 1050 |
| 553 | Ga0466964_0176008 | 3300044706 | Bacteria | 1011 |
| 554 | Ga0466964_0216770 | 3300044706 | Bacteria | 927 |
| 555 | Ga0466964_0372864 | 3300044706 | Bacteria | 739 |
| 556 | Ga0466964_0635252 | 3300044706 | Bacteria | 589 |
| 557 | Ga0466964_0812087 | 3300044706 | Bacteria | 529 |
| 558 | Ga0466971_0007230 | 3300044719 | Bacteria | 4835 |
| 559 | Ga0466971_0010458 | 3300044719 | Bacteria | 4055 |
| 560 | Ga0466971_0041173 | 3300044719 | Bacteria | 2074 |
| 561 | Ga0466971_0056281 | 3300044719 | Bacteria | 1774 |
| 562 | Ga0466971_0109453 | 3300044719 | Unclassified | 1274 |
| 563 | Ga0466971_0221810 | 3300044719 | Bacteria | 896 |
| 564 | Ga0466968_0003890 | 3300044735 | Bacteria | 5542 |
| 565 | Ga0466968_0004685 | 3300044735 | Bacteria | 5125 |
| 566 | Ga0466968_0021882 | 3300044735 | Bacteria | 2593 |
| 567 | Ga0466968_0022276 | 3300044735 | Bacteria | 2574 |
| 568 | Ga0466968_0034558 | 3300044735 | Bacteria | 2110 |
| 569 | Ga0466968_0068973 | 3300044735 | Bacteria | 1536 |
| 570 | Ga0466968_0437213 | 3300044735 | Bacteria | 645 |
| 571 | Ga0466968_0446494 | 3300044735 | Bacteria | 639 |
| 572 | Ga0466968_0516125 | 3300044735 | Bacteria | 597 |
| 573 | Ga0466970_0312272 | 3300044765 | Bacteria | 888 |
| 574 | Ga0466957_0002669 | 3300044842 | Bacteria | 9634 |
| 575 | Ga0466957_0011273 | 3300044842 | Bacteria | 5150 |
| 576 | Ga0466957_0041436 | 3300044842 | Bacteria | 2785 |
| 577 | Ga0466957_0045546 | 3300044842 | Bacteria | 2660 |
| 578 | Ga0466957_0075614 | 3300044842 | Bacteria | 2090 |
| 579 | Ga0466957_0089568 | 3300044842 | Bacteria | 1926 |
| 580 | Ga0466957_0099409 | 3300044842 | Bacteria | 1832 |
| 581 | Ga0466957_0133631 | 3300044842 | Bacteria | 1592 |
| 582 | Ga0466957_0244682 | 3300044842 | Bacteria | 1191 |
| 583 | Ga0466957_0583596 | 3300044842 | Unclassified | 781 |
| 584 | Ga0466957_0626997 | 3300044842 | Bacteria | 754 |
| 585 | Ga0466960_0002510 | 3300044901 | Bacteria | 6901 |
| 586 | Ga0466960_0050980 | 3300044901 | Bacteria | 1997 |
| 587 | Ga0466960_0204995 | 3300044901 | Bacteria | 1079 |
| 588 | Ga0466960_0205402 | 3300044901 | Bacteria | 1078 |
| 589 | Ga0466960_0261752 | 3300044901 | Bacteria | 964 |
| 590 | Ga0466960_0894601 | 3300044901 | Unclassified | 541 |
| 591 | Ga0466959_0002913 | 3300045049 | Bacteria | 11034 |
| 592 | Ga0466959_0050239 | 3300045049 | Bacteria | 3062 |
| 593 | Ga0466959_0064340 | 3300045049 | Bacteria | 2662 |
| 594 | Ga0466959_0560520 | 3300045049 | Bacteria | 770 |
| 595 | Ga0466959_0969914 | 3300045049 | Bacteria | 566 |
| 596 | Ga0466959_1011539 | 3300045049 | Bacteria | 553 |
| 597 | Ga0466958_0002299 | 3300045836 | Bacteria | 9531 |
| 598 | Ga0466958_0003313 | 3300045836 | Bacteria | 8340 |
| 599 | Ga0466958_0003751 | 3300045836 | Bacteria | 7933 |
| 600 | Ga0466958_0006335 | 3300045836 | Bacteria | 6432 |
| 601 | Ga0466958_0016686 | 3300045836 | Bacteria | 4232 |
| 602 | Ga0466958_0016982 | 3300045836 | Bacteria | 4198 |
| 603 | Ga0466958_0057162 | 3300045836 | Bacteria | 2371 |
| 604 | Ga0466958_0111884 | 3300045836 | Unclassified | 1705 |
| 605 | Ga0466958_0545285 | 3300045836 | Bacteria | 753 |
| 606 | Ga0466958_0667298 | 3300045836 | Bacteria | 677 |
| 607 | Ga0466967_0003030 | 3300045976 | Bacteria | 10780 |
| 608 | Ga0466967_0004223 | 3300045976 | Bacteria | 9637 |
| 609 | Ga0466967_0004913 | 3300045976 | Bacteria | 9135 |
| 610 | Ga0466967_0028212 | 3300045976 | Bacteria | 4683 |
| 611 | Ga0466967_0028214 | 3300045976 | Bacteria | 4683 |
| 612 | Ga0466967_0033554 | 3300045976 | Bacteria | 4346 |
| 613 | Ga0466967_0034562 | 3300045976 | Bacteria | 4292 |
| 614 | Ga0466967_0045393 | 3300045976 | Bacteria | 3817 |
| 615 | Ga0466967_0066380 | 3300045976 | Bacteria | 3214 |
| 616 | Ga0466967_0075464 | 3300045976 | Bacteria | 3030 |
| 617 | Ga0466967_0081903 | 3300045976 | Bacteria | 2916 |
| 618 | Ga0466967_0099687 | 3300045976 | Bacteria | 2653 |
| 619 | Ga0466967_0105596 | 3300045976 | Bacteria | 2580 |
| 620 | Ga0466967_0130980 | 3300045976 | Bacteria | 2328 |
| 621 | Ga0466967_0134398 | 3300045976 | Bacteria | 2299 |
| 622 | Ga0466967_0145122 | 3300045976 | Bacteria | 2213 |
| 623 | Ga0466967_0160874 | 3300045976 | Bacteria | 2107 |
| 624 | Ga0466967_0197590 | 3300045976 | Unclassified | 1903 |
| 625 | Ga0466967_0224249 | 3300045976 | Bacteria | 1787 |
| 626 | Ga0466967_0234016 | 3300045976 | Bacteria | 1750 |
| 627 | Ga0466967_0237341 | 3300045976 | Bacteria | 1738 |
| 628 | Ga0466967_0268088 | 3300045976 | Bacteria | 1635 |
| 629 | Ga0466967_0286129 | 3300045976 | Bacteria | 1582 |
| 630 | Ga0466967_0297852 | 3300045976 | Bacteria | 1551 |
| 631 | Ga0466967_0303018 | 3300045976 | Unclassified | 1538 |
| 632 | Ga0466967_0309017 | 3300045976 | Bacteria | 1522 |
| 633 | Ga0466967_0353770 | 3300045976 | Bacteria | 1422 |
| 634 | Ga0466967_0437022 | 3300045976 | Bacteria | 1277 |
| 635 | Ga0466967_0552409 | 3300045976 | Unclassified | 1133 |
| 636 | Ga0466967_0598937 | 3300045976 | Bacteria | 1087 |
| 637 | Ga0466967_0616781 | 3300045976 | Bacteria | 1071 |
| 638 | Ga0466967_1051176 | 3300045976 | Bacteria | 811 |
| 639 | Ga0466967_1072300 | 3300045976 | Unclassified | 802 |
| 640 | Ga0466967_1828382 | 3300045976 | Bacteria | 604 |
| 641 | Ga0466967_2493273 | 3300045976 | Bacteria | 512 |
| 642 | Ga0495592_0014667 | 3300046454 | Bacteria | 5949 |
| 643 | Ga0495592_0701565 | 3300046454 | Bacteria | 609 |
| 644 | Ga0495603_0212391 | 3300046455 | Unclassified | 1117 |
| 645 | Ga0495629_0074600 | 3300046459 | Bacteria | 2368 |
| 646 | Ga0495629_0107025 | 3300046459 | Bacteria | 1951 |
| 647 | Ga0495629_0135661 | 3300046459 | Bacteria | 1713 |
| 648 | Ga0495629_0296248 | 3300046459 | Unclassified | 1108 |
| 649 | Ga0495641_0073273 | 3300046461 | Bacteria | 1536 |
| 650 | Ga0495641_0098443 | 3300046461 | Bacteria | 1305 |
| 651 | Ga0495641_0155142 | 3300046461 | Unclassified | 1024 |
| 652 | Ga0495651_0087441 | 3300046462 | Bacteria | 2344 |
| 653 | Ga0495651_0839351 | 3300046462 | Bacteria | 565 |
| 654 | Ga0495653_0061173 | 3300046463 | Bacteria | 2850 |
| 655 | Ga0495653_0066208 | 3300046463 | Bacteria | 2718 |
| 656 | Ga0495653_0711506 | 3300046463 | Bacteria | 609 |
| 657 | Ga0495582_0041166 | 3300046473 | Bacteria | 2546 |
| 658 | Ga0495582_0412164 | 3300046473 | Bacteria | 779 |
| 659 | Ga0495582_0528148 | 3300046473 | Bacteria | 682 |
| 660 | Ga0495639_0349976 | 3300046475 | Bacteria | 742 |
| 661 | Ga0495662_0027704 | 3300046476 | Bacteria | 2737 |
| 662 | Ga0495594_0123403 | 3300046499 | Bacteria | 1465 |
| 663 | Ga0495608_0043847 | 3300046511 | Bacteria | 2988 |
| 664 | Ga0495608_0044061 | 3300046511 | Bacteria | 2979 |
| 665 | Ga0495608_0048619 | 3300046511 | Bacteria | 2817 |
| 666 | Ga0495618_0034726 | 3300046514 | Bacteria | 3164 |
| 667 | Ga0495618_0037834 | 3300046514 | Bacteria | 3031 |
| 668 | Ga0495628_0232139 | 3300046516 | Bacteria | 1383 |
| 669 | Ga0495628_0421559 | 3300046516 | Bacteria | 973 |
| 670 | Ga0495630_0078194 | 3300046517 | Bacteria | 2494 |
| 671 | Ga0495630_0135047 | 3300046517 | Bacteria | 1875 |
| 672 | Ga0495630_1432851 | 3300046517 | Unclassified | 519 |
| 673 | Ga0495652_0358974 | 3300046529 | Bacteria | 1042 |
| 674 | Ga0495652_0408293 | 3300046529 | Bacteria | 960 |
| 675 | Ga0495665_0457190 | 3300046531 | Bacteria | 645 |
| 676 | Ga0495640_0009269 | 3300046533 | Bacteria | 7673 |
| 677 | Ga0495640_0171807 | 3300046533 | Unclassified | 1385 |
| 678 | Ga0495587_0040939 | 3300046536 | Bacteria | 2766 |
| 679 | Ga0495587_0817854 | 3300046536 | Unclassified | 508 |
| 680 | Ga0495667_0023385 | 3300046559 | Bacteria | 4163 |
| 681 | Ga0495667_0043603 | 3300046559 | Bacteria | 2972 |
| 682 | Ga0495667_0094236 | 3300046559 | Bacteria | 1939 |
| 683 | Ga0495634_0086551 | 3300046642 | Unclassified | 2041 |
| 684 | Ga0495634_0202216 | 3300046642 | Bacteria | 1233 |
| 685 | Ga0495635_0015823 | 3300046663 | Bacteria | 5269 |
| 686 | Ga0495635_0047594 | 3300046663 | Bacteria | 2957 |
| 687 | Ga0495588_0675617 | 3300046674 | Bacteria | 540 |
| 688 | Ga0495657_0005251 | 3300046675 | Bacteria | 10253 |
| 689 | Ga0495599_0487349 | 3300046678 | Bacteria | 727 |
| 690 | Ga0495647_0087043 | 3300046681 | Bacteria | 1275 |
| 691 | Ga0495658_0124455 | 3300046683 | Bacteria | 1563 |
| 692 | Ga0495658_0132780 | 3300046683 | Bacteria | 1517 |
| 693 | Ga0495613_0008298 | 3300046689 | Bacteria | 7711 |
| 694 | Ga0495613_0178567 | 3300046689 | Bacteria | 1504 |
| 695 | Ga0495613_0399049 | 3300046689 | Unclassified | 938 |
| 696 | Ga0495624_0036445 | 3300046690 | Bacteria | 3171 |
| 697 | Ga0495624_0397694 | 3300046690 | Bacteria | 827 |
| 698 | Ga0495600_0165848 | 3300046809 | Unclassified | 1427 |
| 699 | Ga0495600_0468870 | 3300046809 | Bacteria | 777 |
| 700 | Ga0495581_0044857 | 3300047315 | Bacteria | 2556 |
| 701 | Ga0495604_0222749 | 3300047317 | Bacteria | 1298 |
| 702 | Ga0495604_0240503 | 3300047317 | Bacteria | 1238 |
| 703 | Ga0495604_0377414 | 3300047317 | Bacteria | 937 |
| 704 | Ga0495674_0365750 | 3300047319 | Bacteria | 1169 |
| 705 | Ga0495674_0593249 | 3300047319 | Unclassified | 878 |
| 706 | Ga0495676_0057156 | 3300047321 | Bacteria | 3080 |
| 707 | Ga0495676_0074833 | 3300047321 | Bacteria | 2592 |
| 708 | Ga0495676_0945797 | 3300047321 | Unclassified | 551 |
| 709 | Ga0495680_0007127 | 3300047322 | Bacteria | 10296 |
| 710 | Ga0495680_0011938 | 3300047322 | Bacteria | 7665 |
| 711 | Ga0495680_0141654 | 3300047322 | Bacteria | 1759 |
| 712 | Ga0495680_0671790 | 3300047322 | Bacteria | 687 |
| 713 | Ga0495675_0085616 | 3300047444 | Unclassified | 1982 |
| 714 | Ga0495675_0450094 | 3300047444 | Bacteria | 745 |
| 715 | Ga0495684_0003752 | 3300047471 | Bacteria | 11850 |
| 716 | Ga0495684_0070860 | 3300047471 | Bacteria | 2649 |
| 717 | Ga0495684_0147308 | 3300047471 | Bacteria | 1762 |
| 718 | Ga0495593_0381242 | 3300047673 | Bacteria | 705 |
| 719 | Ga0495602_0258546 | 3300048088 | Bacteria | 1293 |
| 720 | Ga0495602_0707905 | 3300048088 | Unclassified | 683 |
| 721 | Ga0495614_0573887 | 3300048089 | Unclassified | 540 |
| 722 | Ga0495614_0630409 | 3300048089 | Unclassified | 516 |
| 723 | Ga0496100_0052986 | 3300048903 | Bacteria | 2640 |
| 724 | Ga0496100_0061935 | 3300048903 | Bacteria | 2467 |
| 725 | Ga0496100_0074430 | 3300048903 | Bacteria | 2276 |
| 726 | Ga0496100_0109133 | 3300048903 | Bacteria | 1920 |
| 727 | Ga0496100_0249336 | 3300048903 | Bacteria | 1313 |
| 728 | Ga0496100_0330253 | 3300048903 | Bacteria | 1147 |
| 729 | Ga0496100_0490090 | 3300048903 | Bacteria | 946 |
| 730 | Ga0496100_0580047 | 3300048903 | Bacteria | 869 |
| 731 | Ga0496101_0015173 | 3300048904 | Bacteria | 5186 |
| 732 | Ga0496101_0037768 | 3300048904 | Bacteria | 3428 |
| 733 | Ga0496101_0048534 | 3300048904 | Bacteria | 3051 |
| 734 | Ga0496101_0054319 | 3300048904 | Bacteria | 2892 |
| 735 | Ga0496101_0398214 | 3300048904 | Bacteria | 1084 |
| 736 | Ga0496101_0544558 | 3300048904 | Bacteria | 917 |
| 737 | Ga0496101_1034991 | 3300048904 | Bacteria | 645 |
| 738 | Ga0496102_0028463 | 3300048905 | Bacteria | 4991 |
| 739 | Ga0496102_0063204 | 3300048905 | Bacteria | 3389 |
| 740 | Ga0496102_0114004 | 3300048905 | Bacteria | 2522 |
| 741 | Ga0496102_0456170 | 3300048905 | Bacteria | 1199 |
| 742 | Ga0496102_0780795 | 3300048905 | Unclassified | 878 |
| 743 | Ga0496102_1420943 | 3300048905 | Unclassified | 613 |
| 744 | Ga0496102_1615210 | 3300048905 | Unclassified | 566 |
| 745 | Ga0496103_0117115 | 3300048906 | Bacteria | 1696 |
| 746 | Ga0496103_0170535 | 3300048906 | Bacteria | 1397 |
| 747 | Ga0496103_0302197 | 3300048906 | Bacteria | 1029 |
| 748 | Ga0496103_0354990 | 3300048906 | Bacteria | 942 |
| 749 | Ga0496103_0801636 | 3300048906 | Bacteria | 594 |
| 750 | Ga0496104_0002863 | 3300048907 | Bacteria | 14870 |
| 751 | Ga0496104_0051681 | 3300048907 | Bacteria | 3879 |
| 752 | Ga0496104_0057294 | 3300048907 | Bacteria | 3686 |
| 753 | Ga0496104_0287267 | 3300048907 | Bacteria | 1557 |
| 754 | Ga0496104_0314253 | 3300048907 | Bacteria | 1479 |
| 755 | Ga0496104_0456035 | 3300048907 | Bacteria | 1190 |
| 756 | Ga0496104_0536355 | 3300048907 | Bacteria | 1081 |
| 757 | Ga0496105_0001941 | 3300048908 | Bacteria | 14854 |
| 758 | Ga0496105_0025023 | 3300048908 | Bacteria | 4853 |
| 759 | Ga0496105_0069297 | 3300048908 | Bacteria | 2914 |
| 760 | Ga0496105_0078234 | 3300048908 | Bacteria | 2731 |
| 761 | Ga0496105_0108889 | 3300048908 | Bacteria | 2287 |
| 762 | Ga0496105_0354046 | 3300048908 | Bacteria | 1172 |
| 763 | Ga0496105_0580019 | 3300048908 | Bacteria | 872 |
| 764 | Ga0496106_0000350 | 3300048909 | Bacteria | 32656 |
| 765 | Ga0496106_0011764 | 3300048909 | Bacteria | 6459 |
| 766 | Ga0496106_0034147 | 3300048909 | Bacteria | 3798 |
| 767 | Ga0496106_0177432 | 3300048909 | Archaea | 1690 |
| 768 | Ga0496106_1162939 | 3300048909 | Bacteria | 603 |
| 769 | Ga0496106_1374721 | 3300048909 | Unclassified | 546 |
| 770 | Ga0496107_0002689 | 3300048910 | Bacteria | 11655 |
| 771 | Ga0496107_0003956 | 3300048910 | Bacteria | 9970 |
| 772 | Ga0496107_0049688 | 3300048910 | Bacteria | 3023 |
| 773 | Ga0496107_0056103 | 3300048910 | Bacteria | 2846 |
| 774 | Ga0496107_0114583 | 3300048910 | Bacteria | 1983 |
| 775 | Ga0496108_0004233 | 3300048911 | Bacteria | 11549 |
| 776 | Ga0496108_0059812 | 3300048911 | Bacteria | 3204 |
| 777 | Ga0496108_0095032 | 3300048911 | Bacteria | 2537 |
| 778 | Ga0496108_0491770 | 3300048911 | Bacteria | 1071 |
| 779 | Ga0496108_0617215 | 3300048911 | Bacteria | 944 |
| 780 | Ga0496108_1756867 | 3300048911 | Unclassified | 509 |
| 781 | Ga0496109_0012761 | 3300048912 | Bacteria | 7262 |
| 782 | Ga0496109_0017047 | 3300048912 | Bacteria | 6357 |
| 783 | Ga0496109_0020161 | 3300048912 | Bacteria | 5890 |
| 784 | Ga0496109_0063148 | 3300048912 | Bacteria | 3387 |
| 785 | Ga0496109_0063339 | 3300048912 | Bacteria | 3382 |
| 786 | Ga0496109_0206683 | 3300048912 | Bacteria | 1846 |
| 787 | Ga0496109_0878201 | 3300048912 | Bacteria | 835 |
| 788 | Ga0496110_0003879 | 3300048913 | Bacteria | 11510 |
| 789 | Ga0496110_0009448 | 3300048913 | Bacteria | 7897 |
| 790 | Ga0496110_0242658 | 3300048913 | Bacteria | 1639 |
| 791 | Ga0496110_0271349 | 3300048913 | Bacteria | 1544 |
| 792 | Ga0496110_1818481 | 3300048913 | Bacteria | 519 |
| 793 | Ga0496111_0000620 | 3300048914 | Bacteria | 18783 |
| 794 | Ga0496111_0004132 | 3300048914 | Bacteria | 9121 |
| 795 | Ga0496111_0016841 | 3300048914 | Bacteria | 5044 |
| 796 | Ga0496111_0096277 | 3300048914 | Bacteria | 2172 |
| 797 | Ga0496112_0024061 | 3300048915 | Bacteria | 5828 |
| 798 | Ga0496112_0045242 | 3300048915 | Bacteria | 4315 |
| 799 | Ga0496112_0088616 | 3300048915 | Bacteria | 3062 |
| 800 | Ga0496112_0171765 | 3300048915 | Bacteria | 2133 |
| 801 | Ga0496112_0702624 | 3300048915 | Bacteria | 939 |
| 802 | Ga0496112_0789762 | 3300048915 | Bacteria | 874 |
| 803 | Ga0496112_0830957 | 3300048915 | Bacteria | 848 |
| 804 | Ga0496112_1643125 | 3300048915 | Unclassified | 555 |
| 805 | Ga0496112_1723140 | 3300048915 | Unclassified | 539 |
| 806 | Ga0496113_0064467 | 3300048916 | Bacteria | 2770 |
| 807 | Ga0496113_0158276 | 3300048916 | Bacteria | 1790 |
| 808 | Ga0496113_0202570 | 3300048916 | Bacteria | 1577 |
| 809 | Ga0496113_0432005 | 3300048916 | Bacteria | 1058 |
| 810 | Ga0496113_0977342 | 3300048916 | Bacteria | 667 |
| 811 | Ga0496114_0007533 | 3300048917 | Bacteria | 8610 |
| 812 | Ga0496114_0016919 | 3300048917 | Bacteria | 5881 |
| 813 | Ga0496114_0021553 | 3300048917 | Bacteria | 5242 |
| 814 | Ga0496114_0033748 | 3300048917 | Bacteria | 4218 |
| 815 | Ga0496114_0039336 | 3300048917 | Bacteria | 3913 |
| 816 | Ga0496114_0086686 | 3300048917 | Bacteria | 2654 |
| 817 | Ga0496114_0194949 | 3300048917 | Bacteria | 1773 |
| 818 | Ga0496114_1276512 | 3300048917 | Bacteria | 621 |
| 819 | Ga0496115_0010734 | 3300048918 | Bacteria | 6850 |
| 820 | Ga0496115_0032248 | 3300048918 | Bacteria | 4132 |
| 821 | Ga0496115_0067550 | 3300048918 | Bacteria | 2892 |
| 822 | Ga0496115_0077768 | 3300048918 | Bacteria | 2698 |
| 823 | Ga0496115_0104862 | 3300048918 | Bacteria | 2320 |
| 824 | Ga0496115_0130438 | 3300048918 | Bacteria | 2071 |
| 825 | Ga0496115_0340317 | 3300048918 | Bacteria | 1224 |
| 826 | Ga0501036_0174712 | 3300049572 | Bacteria | 1809 |
| 827 | Ga0501040_0113875 | 3300049576 | Bacteria | 1893 |
| 828 | Ga0501046_0703539 | 3300049580 | Bacteria | 712 |
| 829 | Ga0501047_0633698 | 3300049581 | Bacteria | 889 |
| 830 | Ga0501067_0008976 | 3300049583 | Bacteria | 5542 |
| 831 | Ga0501067_0134848 | 3300049583 | Bacteria | 1374 |
| 832 | Ga0501067_0181760 | 3300049583 | Bacteria | 1171 |
| 833 | Ga0501067_0573557 | 3300049583 | Bacteria | 632 |
| 834 | Ga0501069_0040908 | 3300049585 | Bacteria | 2561 |
| 835 | Ga0501069_0090906 | 3300049585 | Bacteria | 1726 |
| 836 | Ga0501069_0216522 | 3300049585 | Bacteria | 1112 |
| 837 | Ga0501069_0517960 | 3300049585 | Bacteria | 712 |
| 838 | Ga0501070_0042954 | 3300049586 | Bacteria | 3763 |
| 839 | Ga0501070_1088434 | 3300049586 | Bacteria | 617 |
| 840 | Ga0501071_0405440 | 3300049587 | Bacteria | 1041 |
| 841 | Ga0501072_0005382 | 3300049588 | Bacteria | 9743 |
| 842 | Ga0501073_0020331 | 3300049589 | Bacteria | 4790 |
| 843 | Ga0501074_0083746 | 3300049590 | Bacteria | 2286 |
| 844 | Ga0501079_0121210 | 3300049741 | Bacteria | 2034 |
| 845 | Ga0501079_0383671 | 3300049741 | Bacteria | 1102 |
| 846 | Ga0501080_0053575 | 3300049742 | Bacteria | 3756 |
| 847 | Ga0501081_0516486 | 3300049743 | Bacteria | 891 |
| 848 | Ga0501083_0000241 | 3300049744 | Bacteria | 35214 |
| 849 | Ga0501045_0893361 | 3300049824 | Bacteria | 653 |
| 850 | nmdc:mga05p37_210715_c1 | 3300050507 | Bacteria | 2349 |
| 851 | nmdc:mga05p37_323100_c1 | 3300050507 | Bacteria | 1826 |
| 852 | nmdc:mga09592_1402288_c1 | 3300050508 | Bacteria | 571 |
| 853 | nmdc:mga09592_23722_c1 | 3300050508 | Bacteria | 5068 |
| 854 | nmdc:mga0qj67_49810_c1 | 3300050509 | Bacteria | 3311 |
| 855 | nmdc:mga06r32_81539_c1 | 3300050510 | Bacteria | 3151 |
| 856 | nmdc:mga0n895_315514_c1 | 3300050512 | Bacteria | 1584 |
| 857 | nmdc:mga0rr50_405383_c1 | 3300050513 | Bacteria | 1152 |
| 858 | nmdc:mga0a205_381272_c1 | 3300050515 | Bacteria | 1275 |
| 859 | nmdc:mga0a205_950269_c1 | 3300050515 | Bacteria | 706 |
| 860 | Ga0495601_0089745 | 3300053077 | Unclassified | 1977 |
| 861 | Ga0495601_0666822 | 3300053077 | Bacteria | 665 |
| 862 | Ga0495655_0048250 | 3300053083 | Bacteria | 1117 |
| 863 | Ga0495595_0005681 | 3300053084 | Bacteria | 5049 |
| 864 | Ga0495595_0065863 | 3300053084 | Bacteria | 1704 |
| 865 | Ga0495619_0047162 | 3300053085 | Bacteria | 2836 |
| 866 | Ga0495619_0055558 | 3300053085 | Bacteria | 2622 |
| 867 | Ga0495619_0067238 | 3300053085 | Bacteria | 2392 |
| 868 | Ga0495619_0596108 | 3300053085 | Unclassified | 756 |
| 869 | Ga0495619_0861131 | 3300053085 | Bacteria | 611 |
| 870 | Ga0466962_0016648 | 3300061719 | Bacteria | 3545 |
| 871 | Ga0466962_0037141 | 3300061719 | Bacteria | 2332 |
| 872 | Ga0466962_0058691 | 3300061719 | Bacteria | 1836 |
| 873 | Ga0466962_0075147 | 3300061719 | Bacteria | 1614 |
| 874 | Ga0466962_0150496 | 3300061719 | Unclassified | 1129 |
| 875 | Ga0466962_0377104 | 3300061719 | Bacteria | 708 |
| 876 | Ga0530510_0593507 | 3300061734 | Bacteria | 842 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0435836 | Ga0395900_0435836_752_1045 | 90 |
| 2 | 3300037466 | Ga0395898_0696209 | Ga0395898_0696209_152_445 | 90 |
| 3 | 3300037471 | Ga0395905_0848502 | Ga0395905_0848502_95_388 | 90 |
| 4 | 3300038443 | Ga0395901_0099199 | Ga0395901_0099199_245_538 | 90 |
| 5 | 3300005468 | Ga0070707_100532451 | Ga0070707_1005324512 | 91 |
| 6 | 3300005614 | Ga0068856_101749704 | Ga0068856_1017497042 | 91 |
| 7 | 3300005615 | Ga0070702_100193714 | Ga0070702_1001937142 | 91 |
| 8 | 3300013100 | Ga0157373_10186577 | Ga0157373_101865772 | 91 |
| 9 | 3300026078 | Ga0207702_11120158 | Ga0207702_111201582 | 91 |
| 10 | 3300048915 | Ga0496112_0088616 | Ga0496112_0088616_314_607 | 91 |
| 11 | 3300002244 | JGI24742J22300_10037227 | JGI24742J22300_100372272 | 92 |
| 12 | 3300005330 | Ga0070690_100039369 | Ga0070690_1000393693 | 92 |
| 13 | 3300005337 | Ga0070682_100845158 | Ga0070682_1008451582 | 92 |
| 14 | 3300005338 | Ga0068868_100057661 | Ga0068868_1000576615 | 92 |
| 15 | 3300005340 | Ga0070689_100989943 | Ga0070689_1009899432 | 92 |
| 16 | 3300005347 | Ga0070668_100006039 | Ga0070668_1000060392 | 92 |
| 17 | 3300005356 | Ga0070674_101880383 | Ga0070674_1018803832 | 92 |
| 18 | 3300005364 | Ga0070673_100461553 | Ga0070673_1004615532 | 92 |
| 19 | 3300005367 | Ga0070667_100934875 | Ga0070667_1009348751 | 92 |
| 20 | 3300005406 | Ga0070703_10461397 | Ga0070703_104613971 | 92 |
| 21 | 3300005434 | Ga0070709_10023261 | Ga0070709_100232615 | 92 |
| 22 | 3300005435 | Ga0070714_101121641 | Ga0070714_1011216411 | 92 |
| 23 | 3300005439 | Ga0070711_100125191 | Ga0070711_1001251912 | 92 |
| 24 | 3300005441 | Ga0070700_100000891 | Ga0070700_10000089111 | 92 |
| 25 | 3300005455 | Ga0070663_100164084 | Ga0070663_1001640842 | 92 |
| 26 | 3300005456 | Ga0070678_100647592 | Ga0070678_1006475922 | 92 |
| 27 | 3300005459 | Ga0068867_100125084 | Ga0068867_1001250842 | 92 |
| 28 | 3300005466 | Ga0070685_10141831 | Ga0070685_101418312 | 92 |
| 29 | 3300005468 | Ga0070707_100103581 | Ga0070707_1001035814 | 92 |
| 30 | 3300005530 | Ga0070679_100219284 | Ga0070679_1002192842 | 92 |
| 31 | 3300005539 | Ga0068853_100816252 | Ga0068853_1008162522 | 92 |
| 32 | 3300005544 | Ga0070686_100479449 | Ga0070686_1004794492 | 92 |
| 33 | 3300005545 | Ga0070695_100853114 | Ga0070695_1008531142 | 92 |
| 34 | 3300005546 | Ga0070696_100184219 | Ga0070696_1001842192 | 92 |
| 35 | 3300005547 | Ga0070693_100029063 | Ga0070693_1000290632 | 92 |
| 36 | 3300005548 | Ga0070665_101254305 | Ga0070665_1012543052 | 92 |
| 37 | 3300005563 | Ga0068855_101312603 | Ga0068855_1013126032 | 92 |
| 38 | 3300005564 | Ga0070664_100880022 | Ga0070664_1008800222 | 92 |
| 39 | 3300005614 | Ga0068856_100033197 | Ga0068856_1000331972 | 92 |
| 40 | 3300005616 | Ga0068852_101863981 | Ga0068852_1018639811 | 92 |
| 41 | 3300005618 | Ga0068864_100863295 | Ga0068864_1008632952 | 92 |
| 42 | 3300005718 | Ga0068866_10037942 | Ga0068866_100379423 | 92 |
| 43 | 3300005719 | Ga0068861_100034407 | Ga0068861_1000344074 | 92 |
| 44 | 3300005842 | Ga0068858_100801980 | Ga0068858_1008019802 | 92 |
| 45 | 3300005843 | Ga0068860_102322432 | Ga0068860_1023224322 | 92 |
| 46 | 3300005844 | Ga0068862_100050448 | Ga0068862_1000504482 | 92 |
| 47 | 3300006163 | Ga0070715_10243114 | Ga0070715_102431142 | 92 |
| 48 | 3300006175 | Ga0070712_100096722 | Ga0070712_1000967223 | 92 |
| 49 | 3300006358 | Ga0068871_100018881 | Ga0068871_1000188817 | 92 |
| 50 | 3300006881 | Ga0068865_100878083 | Ga0068865_1008780832 | 92 |
| 51 | 3300009098 | Ga0105245_10016135 | Ga0105245_100161352 | 92 |
| 52 | 3300009101 | Ga0105247_10557778 | Ga0105247_105577781 | 92 |
| 53 | 3300009148 | Ga0105243_10154064 | Ga0105243_101540643 | 92 |
| 54 | 3300009174 | Ga0105241_10297035 | Ga0105241_102970352 | 92 |
| 55 | 3300009177 | Ga0105248_10694609 | Ga0105248_106946092 | 92 |
| 56 | 3300009551 | Ga0105238_10167317 | Ga0105238_101673172 | 92 |
| 57 | 3300009553 | Ga0105249_10004496 | Ga0105249_100044964 | 92 |
| 58 | 3300010375 | Ga0105239_10025569 | Ga0105239_100255696 | 92 |
| 59 | 3300011119 | Ga0105246_10130073 | Ga0105246_101300733 | 92 |
| 60 | 3300013105 | Ga0157369_10116370 | Ga0157369_101163704 | 92 |
| 61 | 3300013297 | Ga0157378_10010022 | Ga0157378_100100226 | 92 |
| 62 | 3300013306 | Ga0163162_10026703 | Ga0163162_100267034 | 92 |
| 63 | 3300013307 | Ga0157372_10140964 | Ga0157372_101409642 | 92 |
| 64 | 3300014745 | Ga0157377_10060167 | Ga0157377_100601673 | 92 |
| 65 | 3300014969 | Ga0157376_10054523 | Ga0157376_100545232 | 92 |
| 66 | 3300025885 | Ga0207653_10064888 | Ga0207653_100648882 | 92 |
| 67 | 3300025898 | Ga0207692_10074635 | Ga0207692_100746353 | 92 |
| 68 | 3300025899 | Ga0207642_10046983 | Ga0207642_100469833 | 92 |
| 69 | 3300025900 | Ga0207710_10297603 | Ga0207710_102976031 | 92 |
| 70 | 3300025903 | Ga0207680_10117281 | Ga0207680_101172813 | 92 |
| 71 | 3300025904 | Ga0207647_10454309 | Ga0207647_104543092 | 92 |
| 72 | 3300025905 | Ga0207685_10159924 | Ga0207685_101599242 | 92 |
| 73 | 3300025906 | Ga0207699_10031955 | Ga0207699_100319552 | 92 |
| 74 | 3300025911 | Ga0207654_10193044 | Ga0207654_101930441 | 92 |
| 75 | 3300025915 | Ga0207693_10001551 | Ga0207693_1000155123 | 92 |
| 76 | 3300025917 | Ga0207660_10777763 | Ga0207660_107777632 | 92 |
| 77 | 3300025921 | Ga0207652_10341511 | Ga0207652_103415112 | 92 |
| 78 | 3300025922 | Ga0207646_10027291 | Ga0207646_100272917 | 92 |
| 79 | 3300025922 | Ga0207646_11150282 | Ga0207646_111502822 | 92 |
| 80 | 3300025924 | Ga0207694_10018445 | Ga0207694_100184454 | 92 |
| 81 | 3300025927 | Ga0207687_10381626 | Ga0207687_103816262 | 92 |
| 82 | 3300025929 | Ga0207664_10999267 | Ga0207664_109992672 | 92 |
| 83 | 3300025934 | Ga0207686_10008680 | Ga0207686_100086807 | 92 |
| 84 | 3300025935 | Ga0207709_10014134 | Ga0207709_100141342 | 92 |
| 85 | 3300025936 | Ga0207670_10347830 | Ga0207670_103478302 | 92 |
| 86 | 3300025937 | Ga0207669_10001097 | Ga0207669_100010975 | 92 |
| 87 | 3300025940 | Ga0207691_10001540 | Ga0207691_100015403 | 92 |
| 88 | 3300025941 | Ga0207711_10564476 | Ga0207711_105644762 | 92 |
| 89 | 3300025944 | Ga0207661_11508377 | Ga0207661_115083772 | 92 |
| 90 | 3300025960 | Ga0207651_10246216 | Ga0207651_102462162 | 92 |
| 91 | 3300025961 | Ga0207712_10122587 | Ga0207712_101225872 | 92 |
| 92 | 3300026023 | Ga0207677_10019621 | Ga0207677_100196213 | 92 |
| 93 | 3300026067 | Ga0207678_10055915 | Ga0207678_100559153 | 92 |
| 94 | 3300026075 | Ga0207708_10000757 | Ga0207708_100007578 | 92 |
| 95 | 3300026078 | Ga0207702_10948366 | Ga0207702_109483662 | 92 |
| 96 | 3300026089 | Ga0207648_10002049 | Ga0207648_100020499 | 92 |
| 97 | 3300026095 | Ga0207676_10724146 | Ga0207676_107241462 | 92 |
| 98 | 3300026118 | Ga0207675_100052929 | Ga0207675_1000529294 | 92 |
| 99 | 3300026121 | Ga0207683_10004507 | Ga0207683_100045077 | 92 |
| 100 | 3300026142 | Ga0207698_10222335 | Ga0207698_102223353 | 92 |
| 101 | 3300028379 | Ga0268266_12101662 | Ga0268266_121016622 | 92 |
| 102 | 3300028380 | Ga0268265_10731126 | Ga0268265_107311262 | 92 |
| 103 | 3300028381 | Ga0268264_10315359 | Ga0268264_103153592 | 92 |
| 104 | 3300037418 | Ga0395900_0394816 | Ga0395900_0394816_128_406 | 92 |
| 105 | 3300037466 | Ga0395898_0005111 | Ga0395898_0005111_11928_12206 | 92 |
| 106 | 3300048903 | Ga0496100_0330253 | Ga0496100_0330253_478_756 | 92 |
| 107 | 3300048904 | Ga0496101_0015173 | Ga0496101_0015173_4797_5075 | 92 |
| 108 | 3300048905 | Ga0496102_1615210 | Ga0496102_1615210_56_334 | 92 |
| 109 | 3300048906 | Ga0496103_0354990 | Ga0496103_0354990_512_790 | 92 |
| 110 | 3300048907 | Ga0496104_0287267 | Ga0496104_0287267_795_1073 | 92 |
| 111 | 3300048908 | Ga0496105_0580019 | Ga0496105_0580019_59_337 | 92 |
| 112 | 3300048909 | Ga0496106_0034147 | Ga0496106_0034147_421_699 | 92 |
| 113 | 3300048910 | Ga0496107_0114583 | Ga0496107_0114583_1169_1447 | 92 |
| 114 | 3300048911 | Ga0496108_0617215 | Ga0496108_0617215_533_811 | 92 |
| 115 | 3300048917 | Ga0496114_0033748 | Ga0496114_0033748_3131_3409 | 92 |
| 116 | 3300048918 | Ga0496115_0032248 | Ga0496115_0032248_242_520 | 92 |
| 117 | 3300006871 | Ga0075434_101055633 | Ga0075434_1010556332 | 93 |
| 118 | 3300007076 | Ga0075435_100643019 | Ga0075435_1006430192 | 93 |
| 119 | 3300037312 | Ga0395899_0456060 | Ga0395899_0456060_195_476 | 93 |
| 120 | 3300037418 | Ga0395900_0292880 | Ga0395900_0292880_456_737 | 93 |
| 121 | 3300037466 | Ga0395898_0251952 | Ga0395898_0251952_516_797 | 93 |
| 122 | 3300038443 | Ga0395901_0132173 | Ga0395901_0132173_351_632 | 93 |
| 123 | 3300045976 | Ga0466967_0303018 | Ga0466967_0303018_61_348 | 93 |
| 124 | 3300048911 | Ga0496108_1756867 | Ga0496108_1756867_174_461 | 93 |
| 125 | 3300048915 | Ga0496112_0171765 | Ga0496112_0171765_1539_1826 | 93 |
| 126 | 3300048916 | Ga0496113_0158276 | Ga0496113_0158276_49_336 | 93 |
| 127 | 3300050512 | nmdc:mga0n895_315514_c1 | nmdc:mga0n895_315514_c1_1187_1474 | 93 |
| 128 | 3300050513 | nmdc:mga0rr50_405383_c1 | nmdc:mga0rr50_405383_c1_307_594 | 93 |
| 129 | 3300050515 | nmdc:mga0a205_381272_c1 | nmdc:mga0a205_381272_c1_275_562 | 93 |
| 130 | 3300003322 | rootL2_10161100 | rootL2_101611002 | 94 |
| 131 | 3300005434 | Ga0070709_10159763 | Ga0070709_101597632 | 94 |
| 132 | 3300005435 | Ga0070714_100160390 | Ga0070714_1001603903 | 94 |
| 133 | 3300005435 | Ga0070714_101918119 | Ga0070714_1019181192 | 94 |
| 134 | 3300005436 | Ga0070713_101303645 | Ga0070713_1013036452 | 94 |
| 135 | 3300005985 | Ga0081539_10010499 | Ga0081539_100104995 | 94 |
| 136 | 3300006173 | Ga0070716_100718646 | Ga0070716_1007186461 | 94 |
| 137 | 3300006175 | Ga0070712_100270609 | Ga0070712_1002706092 | 94 |
| 138 | 3300006844 | Ga0075428_100824470 | Ga0075428_1008244702 | 94 |
| 139 | 3300007788 | Ga0099795_10600980 | Ga0099795_106009802 | 94 |
| 140 | 3300025906 | Ga0207699_10257999 | Ga0207699_102579992 | 94 |
| 141 | 3300025915 | Ga0207693_10036544 | Ga0207693_100365444 | 94 |
| 142 | 3300025928 | Ga0207700_10706538 | Ga0207700_107065382 | 94 |
| 143 | 3300025929 | Ga0207664_10170719 | Ga0207664_101707192 | 94 |
| 144 | 3300025939 | Ga0207665_10060117 | Ga0207665_100601173 | 94 |
| 145 | 3300025941 | Ga0207711_11423029 | Ga0207711_114230291 | 94 |
| 146 | 3300005337 | Ga0070682_100069940 | Ga0070682_1000699401 | 95 |
| 147 | 3300005339 | Ga0070660_100032597 | Ga0070660_1000325973 | 95 |
| 148 | 3300005366 | Ga0070659_100069384 | Ga0070659_1000693843 | 95 |
| 149 | 3300005471 | Ga0070698_101194016 | Ga0070698_1011940161 | 95 |
| 150 | 3300005535 | Ga0070684_100509356 | Ga0070684_1005093561 | 95 |
| 151 | 3300005616 | Ga0068852_100125695 | Ga0068852_1001256952 | 95 |
| 152 | 3300009551 | Ga0105238_11065158 | Ga0105238_110651581 | 95 |
| 153 | 3300020070 | Ga0206356_11446365 | Ga0206356_114463651 | 95 |
| 154 | 3300020082 | Ga0206353_11117289 | Ga0206353_111172891 | 95 |
| 155 | 3300020082 | Ga0206353_11545420 | Ga0206353_115454203 | 95 |
| 156 | 3300025913 | Ga0207695_10227844 | Ga0207695_102278442 | 95 |
| 157 | 3300025917 | Ga0207660_10040765 | Ga0207660_100407652 | 95 |
| 158 | 3300025917 | Ga0207660_11646691 | Ga0207660_116466911 | 95 |
| 159 | 3300025919 | Ga0207657_10052187 | Ga0207657_100521874 | 95 |
| 160 | 3300025921 | Ga0207652_10044647 | Ga0207652_100446473 | 95 |
| 161 | 3300025921 | Ga0207652_10812611 | Ga0207652_108126112 | 95 |
| 162 | 3300025924 | Ga0207694_10883620 | Ga0207694_108836202 | 95 |
| 163 | 3300025929 | Ga0207664_10809311 | Ga0207664_108093111 | 95 |
| 164 | 3300026142 | Ga0207698_10257251 | Ga0207698_102572511 | 95 |
| 165 | 3300028800 | Ga0265338_10100854 | Ga0265338_101008543 | 95 |
| 166 | 3300037418 | Ga0395900_0063432 | Ga0395900_0063432_3048_3335 | 95 |
| 167 | 3300037466 | Ga0395898_0047265 | Ga0395898_0047265_1269_1556 | 95 |
| 168 | 3300037471 | Ga0395905_0259722 | Ga0395905_0259722_872_1159 | 95 |
| 169 | 3300038443 | Ga0395901_0168960 | Ga0395901_0168960_1608_1895 | 95 |
| 170 | 3300044694 | Ga0466963_0000049 | Ga0466963_0000049_1990_2277 | 95 |
| 171 | 3300044694 | Ga0466963_0042322 | Ga0466963_0042322_2428_2730 | 95 |
| 172 | 3300044842 | Ga0466957_0099409 | Ga0466957_0099409_333_635 | 95 |
| 173 | 3300045836 | Ga0466958_0003313 | Ga0466958_0003313_1838_2125 | 95 |
| 174 | 3300045836 | Ga0466958_0006335 | Ga0466958_0006335_2646_2948 | 95 |
| 175 | 3300045976 | Ga0466967_0003030 | Ga0466967_0003030_6682_6969 | 95 |
| 176 | 3300045976 | Ga0466967_0004913 | Ga0466967_0004913_5078_5380 | 95 |
| 177 | 3300045976 | Ga0466967_0197590 | Ga0466967_0197590_402_689 | 95 |
| 178 | 3300045976 | Ga0466967_0224249 | Ga0466967_0224249_370_657 | 95 |
| 179 | 3300048905 | Ga0496102_1420943 | Ga0496102_1420943_299_586 | 95 |
| 180 | 3300049572 | Ga0501036_0174712 | Ga0501036_0174712_810_1106 | 95 |
| 181 | 3300049576 | Ga0501040_0113875 | Ga0501040_0113875_512_808 | 95 |
| 182 | 3300049585 | Ga0501069_0517960 | Ga0501069_0517960_14_310 | 95 |
| 183 | 3300049587 | Ga0501071_0405440 | Ga0501071_0405440_361_657 | 95 |
| 184 | 3300049741 | Ga0501079_0383671 | Ga0501079_0383671_61_357 | 95 |
| 185 | 3300049743 | Ga0501081_0516486 | Ga0501081_0516486_206_502 | 95 |
| 186 | 3300049824 | Ga0501045_0893361 | Ga0501045_0893361_20_316 | 95 |
| 187 | 3300005327 | Ga0070658_10039434 | Ga0070658_100394342 | 96 |
| 188 | 3300005329 | Ga0070683_101172969 | Ga0070683_1011729692 | 96 |
| 189 | 3300005329 | Ga0070683_101882290 | Ga0070683_1018822901 | 96 |
| 190 | 3300005339 | Ga0070660_100001894 | Ga0070660_1000018945 | 96 |
| 191 | 3300005344 | Ga0070661_100002256 | Ga0070661_1000022565 | 96 |
| 192 | 3300005354 | Ga0070675_100545582 | Ga0070675_1005455822 | 96 |
| 193 | 3300005435 | Ga0070714_100007475 | Ga0070714_1000074755 | 96 |
| 194 | 3300005458 | Ga0070681_10141560 | Ga0070681_101415603 | 96 |
| 195 | 3300005563 | Ga0068855_100051631 | Ga0068855_1000516312 | 96 |
| 196 | 3300005563 | Ga0068855_101169745 | Ga0068855_1011697452 | 96 |
| 197 | 3300005614 | Ga0068856_100338351 | Ga0068856_1003383512 | 96 |
| 198 | 3300005616 | Ga0068852_100183790 | Ga0068852_1001837902 | 96 |
| 199 | 3300005618 | Ga0068864_100579814 | Ga0068864_1005798143 | 96 |
| 200 | 3300006852 | Ga0075433_10527011 | Ga0075433_105270112 | 96 |
| 201 | 3300006881 | Ga0068865_100985894 | Ga0068865_1009858942 | 96 |
| 202 | 3300009093 | Ga0105240_10128695 | Ga0105240_101286953 | 96 |
| 203 | 3300009098 | Ga0105245_11014151 | Ga0105245_110141512 | 96 |
| 204 | 3300009147 | Ga0114129_10197834 | Ga0114129_101978342 | 96 |
| 205 | 3300009148 | Ga0105243_12800367 | Ga0105243_128003672 | 96 |
| 206 | 3300009174 | Ga0105241_12087617 | Ga0105241_120876172 | 96 |
| 207 | 3300009177 | Ga0105248_10025251 | Ga0105248_100252513 | 96 |
| 208 | 3300009545 | Ga0105237_10231304 | Ga0105237_102313043 | 96 |
| 209 | 3300013100 | Ga0157373_10157682 | Ga0157373_101576822 | 96 |
| 210 | 3300013102 | Ga0157371_10163186 | Ga0157371_101631861 | 96 |
| 211 | 3300013104 | Ga0157370_10012865 | Ga0157370_100128652 | 96 |
| 212 | 3300013104 | Ga0157370_10067480 | Ga0157370_100674802 | 96 |
| 213 | 3300013105 | Ga0157369_10063544 | Ga0157369_100635442 | 96 |
| 214 | 3300013105 | Ga0157369_10359971 | Ga0157369_103599712 | 96 |
| 215 | 3300013105 | Ga0157369_12100024 | Ga0157369_121000242 | 96 |
| 216 | 3300013308 | Ga0157375_13346932 | Ga0157375_133469322 | 96 |
| 217 | 3300020070 | Ga0206356_10947349 | Ga0206356_109473492 | 96 |
| 218 | 3300020081 | Ga0206354_11532083 | Ga0206354_115320832 | 96 |
| 219 | 3300020082 | Ga0206353_10323144 | Ga0206353_103231443 | 96 |
| 220 | 3300025909 | Ga0207705_10304571 | Ga0207705_103045712 | 96 |
| 221 | 3300025912 | Ga0207707_10257291 | Ga0207707_102572912 | 96 |
| 222 | 3300025913 | Ga0207695_10136893 | Ga0207695_101368932 | 96 |
| 223 | 3300025914 | Ga0207671_10656715 | Ga0207671_106567152 | 96 |
| 224 | 3300025917 | Ga0207660_10590811 | Ga0207660_105908112 | 96 |
| 225 | 3300025920 | Ga0207649_10073776 | Ga0207649_100737762 | 96 |
| 226 | 3300025921 | Ga0207652_10020844 | Ga0207652_100208444 | 96 |
| 227 | 3300025921 | Ga0207652_10919708 | Ga0207652_109197082 | 96 |
| 228 | 3300025929 | Ga0207664_10065601 | Ga0207664_100656013 | 96 |
| 229 | 3300025936 | Ga0207670_10798730 | Ga0207670_107987302 | 96 |
| 230 | 3300025941 | Ga0207711_11276860 | Ga0207711_112768602 | 96 |
| 231 | 3300025944 | Ga0207661_10515939 | Ga0207661_105159392 | 96 |
| 232 | 3300025944 | Ga0207661_10790317 | Ga0207661_107903172 | 96 |
| 233 | 3300025949 | Ga0207667_10050633 | Ga0207667_100506332 | 96 |
| 234 | 3300025949 | Ga0207667_10669312 | Ga0207667_106693122 | 96 |
| 235 | 3300026142 | Ga0207698_10072099 | Ga0207698_100720992 | 96 |
| 236 | 3300037312 | Ga0395899_0108998 | Ga0395899_0108998_822_1112 | 96 |
| 237 | 3300037312 | Ga0395899_0469062 | Ga0395899_0469062_455_745 | 96 |
| 238 | 3300037418 | Ga0395900_0157692 | Ga0395900_0157692_70_360 | 96 |
| 239 | 3300037418 | Ga0395900_0261141 | Ga0395900_0261141_119_409 | 96 |
| 240 | 3300037418 | Ga0395900_0357144 | Ga0395900_0357144_637_927 | 96 |
| 241 | 3300037466 | Ga0395898_0144482 | Ga0395898_0144482_502_792 | 96 |
| 242 | 3300037466 | Ga0395898_0365206 | Ga0395898_0365206_806_1096 | 96 |
| 243 | 3300037466 | Ga0395898_0394630 | Ga0395898_0394630_157_447 | 96 |
| 244 | 3300037466 | Ga0395898_1180166 | Ga0395898_1180166_359_658 | 96 |
| 245 | 3300037471 | Ga0395905_0090318 | Ga0395905_0090318_1778_2068 | 96 |
| 246 | 3300037471 | Ga0395905_0470046 | Ga0395905_0470046_787_1077 | 96 |
| 247 | 3300038443 | Ga0395901_0322399 | Ga0395901_0322399_687_977 | 96 |
| 248 | 3300044694 | Ga0466963_0007471 | Ga0466963_0007471_1856_2146 | 96 |
| 249 | 3300044694 | Ga0466963_0120403 | Ga0466963_0120403_1429_1719 | 96 |
| 250 | 3300046454 | Ga0495592_0701565 | Ga0495592_0701565_233_523 | 96 |
| 251 | 3300046514 | Ga0495618_0037834 | Ga0495618_0037834_1111_1401 | 96 |
| 252 | 3300046516 | Ga0495628_0421559 | Ga0495628_0421559_281_571 | 96 |
| 253 | 3300046517 | Ga0495630_1432851 | Ga0495630_1432851_129_419 | 96 |
| 254 | 3300046533 | Ga0495640_0171807 | Ga0495640_0171807_507_797 | 96 |
| 255 | 3300047322 | Ga0495680_0141654 | Ga0495680_0141654_448_738 | 96 |
| 256 | 3300047444 | Ga0495675_0450094 | Ga0495675_0450094_324_614 | 96 |
| 257 | 3300048088 | Ga0495602_0707905 | Ga0495602_0707905_60_350 | 96 |
| 258 | 3300050507 | nmdc:mga05p37_323100_c1 | nmdc:mga05p37_323100_c1_834_1124 | 96 |
| 259 | 3300050508 | nmdc:mga09592_1402288_c1 | nmdc:mga09592_1402288_c1_55_345 | 96 |
| 260 | 3300050515 | nmdc:mga0a205_950269_c1 | nmdc:mga0a205_950269_c1_353_643 | 96 |
| 261 | 3300053077 | Ga0495601_0089745 | Ga0495601_0089745_991_1281 | 96 |
| 262 | 3300053085 | Ga0495619_0596108 | Ga0495619_0596108_168_458 | 96 |
| 263 | 3300005327 | Ga0070658_10024182 | Ga0070658_100241823 | 97 |
| 264 | 3300005329 | Ga0070683_100029947 | Ga0070683_1000299475 | 97 |
| 265 | 3300005329 | Ga0070683_100068886 | Ga0070683_1000688866 | 97 |
| 266 | 3300005329 | Ga0070683_101975090 | Ga0070683_1019750901 | 97 |
| 267 | 3300005336 | Ga0070680_100214185 | Ga0070680_1002141852 | 97 |
| 268 | 3300005337 | Ga0070682_100619010 | Ga0070682_1006190102 | 97 |
| 269 | 3300005337 | Ga0070682_101640652 | Ga0070682_1016406522 | 97 |
| 270 | 3300005338 | Ga0068868_100657715 | Ga0068868_1006577151 | 97 |
| 271 | 3300005339 | Ga0070660_100087839 | Ga0070660_1000878393 | 97 |
| 272 | 3300005339 | Ga0070660_100124143 | Ga0070660_1001241431 | 97 |
| 273 | 3300005339 | Ga0070660_100390291 | Ga0070660_1003902912 | 97 |
| 274 | 3300005366 | Ga0070659_100181629 | Ga0070659_1001816292 | 97 |
| 275 | 3300005366 | Ga0070659_100943158 | Ga0070659_1009431582 | 97 |
| 276 | 3300005366 | Ga0070659_101830697 | Ga0070659_1018306971 | 97 |
| 277 | 3300005435 | Ga0070714_100029145 | Ga0070714_1000291453 | 97 |
| 278 | 3300005435 | Ga0070714_100283219 | Ga0070714_1002832192 | 97 |
| 279 | 3300005437 | Ga0070710_11416750 | Ga0070710_114167501 | 97 |
| 280 | 3300005445 | Ga0070708_100160796 | Ga0070708_1001607962 | 97 |
| 281 | 3300005455 | Ga0070663_100926308 | Ga0070663_1009263081 | 97 |
| 282 | 3300005458 | Ga0070681_10060719 | Ga0070681_100607196 | 97 |
| 283 | 3300005458 | Ga0070681_10273737 | Ga0070681_102737373 | 97 |
| 284 | 3300005530 | Ga0070679_100116757 | Ga0070679_1001167572 | 97 |
| 285 | 3300005530 | Ga0070679_100249696 | Ga0070679_1002496962 | 97 |
| 286 | 3300005535 | Ga0070684_100659595 | Ga0070684_1006595952 | 97 |
| 287 | 3300005539 | Ga0068853_101208404 | Ga0068853_1012084041 | 97 |
| 288 | 3300005547 | Ga0070693_100238725 | Ga0070693_1002387253 | 97 |
| 289 | 3300005563 | Ga0068855_100099345 | Ga0068855_1000993455 | 97 |
| 290 | 3300005564 | Ga0070664_100261715 | Ga0070664_1002617152 | 97 |
| 291 | 3300005614 | Ga0068856_100195519 | Ga0068856_1001955192 | 97 |
| 292 | 3300005614 | Ga0068856_102450041 | Ga0068856_1024500411 | 97 |
| 293 | 3300006028 | Ga0070717_10882494 | Ga0070717_108824942 | 97 |
| 294 | 3300006847 | Ga0075431_100020819 | Ga0075431_1000208192 | 97 |
| 295 | 3300006880 | Ga0075429_100002524 | Ga0075429_1000025249 | 97 |
| 296 | 3300009098 | Ga0105245_12726390 | Ga0105245_127263902 | 97 |
| 297 | 3300009147 | Ga0114129_10120074 | Ga0114129_101200744 | 97 |
| 298 | 3300009147 | Ga0114129_11560113 | Ga0114129_115601132 | 97 |
| 299 | 3300009545 | Ga0105237_10666056 | Ga0105237_106660562 | 97 |
| 300 | 3300009545 | Ga0105237_10855280 | Ga0105237_108552803 | 97 |
| 301 | 3300009551 | Ga0105238_10037789 | Ga0105238_100377893 | 97 |
| 302 | 3300010375 | Ga0105239_12892088 | Ga0105239_128920882 | 97 |
| 303 | 3300013100 | Ga0157373_10740147 | Ga0157373_107401472 | 97 |
| 304 | 3300013105 | Ga0157369_12025189 | Ga0157369_120251892 | 97 |
| 305 | 3300013307 | Ga0157372_11392438 | Ga0157372_113924382 | 97 |
| 306 | 3300014497 | Ga0182008_10028234 | Ga0182008_100282342 | 97 |
| 307 | 3300014497 | Ga0182008_10040828 | Ga0182008_100408283 | 97 |
| 308 | 3300014497 | Ga0182008_10138382 | Ga0182008_101383821 | 97 |
| 309 | 3300015261 | Ga0182006_1014920 | Ga0182006_10149202 | 97 |
| 310 | 3300015262 | Ga0182007_10012652 | Ga0182007_100126521 | 97 |
| 311 | 3300015262 | Ga0182007_10177883 | Ga0182007_101778832 | 97 |
| 312 | 3300015262 | Ga0182007_10192700 | Ga0182007_101927003 | 97 |
| 313 | 3300020082 | Ga0206353_10033182 | Ga0206353_100331822 | 97 |
| 314 | 3300020082 | Ga0206353_10826660 | Ga0206353_108266601 | 97 |
| 315 | 3300025898 | Ga0207692_10343038 | Ga0207692_103430381 | 97 |
| 316 | 3300025909 | Ga0207705_10048891 | Ga0207705_100488912 | 97 |
| 317 | 3300025909 | Ga0207705_10142189 | Ga0207705_101421892 | 97 |
| 318 | 3300025909 | Ga0207705_10383635 | Ga0207705_103836352 | 97 |
| 319 | 3300025912 | Ga0207707_10171310 | Ga0207707_101713103 | 97 |
| 320 | 3300025912 | Ga0207707_10951745 | Ga0207707_109517452 | 97 |
| 321 | 3300025912 | Ga0207707_11194301 | Ga0207707_111943011 | 97 |
| 322 | 3300025917 | Ga0207660_10036675 | Ga0207660_100366755 | 97 |
| 323 | 3300025919 | Ga0207657_10002003 | Ga0207657_100020032 | 97 |
| 324 | 3300025919 | Ga0207657_10009290 | Ga0207657_100092902 | 97 |
| 325 | 3300025919 | Ga0207657_10363015 | Ga0207657_103630152 | 97 |
| 326 | 3300025921 | Ga0207652_10317093 | Ga0207652_103170932 | 97 |
| 327 | 3300025921 | Ga0207652_11060257 | Ga0207652_110602572 | 97 |
| 328 | 3300025922 | Ga0207646_10392196 | Ga0207646_103921962 | 97 |
| 329 | 3300025924 | Ga0207694_10494739 | Ga0207694_104947392 | 97 |
| 330 | 3300025929 | Ga0207664_10084568 | Ga0207664_100845683 | 97 |
| 331 | 3300025929 | Ga0207664_10134686 | Ga0207664_101346862 | 97 |
| 332 | 3300025929 | Ga0207664_11357001 | Ga0207664_113570011 | 97 |
| 333 | 3300025932 | Ga0207690_10351348 | Ga0207690_103513482 | 97 |
| 334 | 3300025932 | Ga0207690_10480839 | Ga0207690_104808391 | 97 |
| 335 | 3300025932 | Ga0207690_10755384 | Ga0207690_107553842 | 97 |
| 336 | 3300025933 | Ga0207706_11476694 | Ga0207706_114766941 | 97 |
| 337 | 3300025944 | Ga0207661_10024274 | Ga0207661_100242745 | 97 |
| 338 | 3300025944 | Ga0207661_10190536 | Ga0207661_101905362 | 97 |
| 339 | 3300026023 | Ga0207677_10617745 | Ga0207677_106177451 | 97 |
| 340 | 3300026041 | Ga0207639_10766908 | Ga0207639_107669081 | 97 |
| 341 | 3300026078 | Ga0207702_10408030 | Ga0207702_104080302 | 97 |
| 342 | 3300026078 | Ga0207702_11127669 | Ga0207702_111276691 | 97 |
| 343 | 3300026116 | Ga0207674_10599462 | Ga0207674_105994622 | 97 |
| 344 | 3300026142 | Ga0207698_10663252 | Ga0207698_106632523 | 97 |
| 345 | 3300028573 | Ga0265334_10004671 | Ga0265334_100046716 | 97 |
| 346 | 3300028577 | Ga0265318_10000633 | Ga0265318_100006335 | 97 |
| 347 | 3300028666 | Ga0265336_10070919 | Ga0265336_100709192 | 97 |
| 348 | 3300028800 | Ga0265338_10017133 | Ga0265338_100171335 | 97 |
| 349 | 3300029957 | Ga0265324_10008957 | Ga0265324_100089573 | 97 |
| 350 | 3300031235 | Ga0265330_10002779 | Ga0265330_100027794 | 97 |
| 351 | 3300031238 | Ga0265332_10006125 | Ga0265332_100061256 | 97 |
| 352 | 3300031239 | Ga0265328_10003728 | Ga0265328_100037287 | 97 |
| 353 | 3300031241 | Ga0265325_10008761 | Ga0265325_100087612 | 97 |
| 354 | 3300031242 | Ga0265329_10001093 | Ga0265329_100010937 | 97 |
| 355 | 3300031247 | Ga0265340_10003071 | Ga0265340_100030717 | 97 |
| 356 | 3300031249 | Ga0265339_10006107 | Ga0265339_100061074 | 97 |
| 357 | 3300031251 | Ga0265327_10018223 | Ga0265327_100182232 | 97 |
| 358 | 3300031344 | Ga0265316_10013122 | Ga0265316_100131225 | 97 |
| 359 | 3300031595 | Ga0265313_10010591 | Ga0265313_100105916 | 97 |
| 360 | 3300031711 | Ga0265314_10040948 | Ga0265314_100409485 | 97 |
| 361 | 3300031712 | Ga0265342_10130223 | Ga0265342_101302232 | 97 |
| 362 | 3300031712 | Ga0265342_10385091 | Ga0265342_103850912 | 97 |
| 363 | 3300035086 | Ga0373934_0100170 | Ga0373934_0100170_379_672 | 97 |
| 364 | 3300035088 | Ga0373940_0253938 | Ga0373940_0253938_155_448 | 97 |
| 365 | 3300035118 | Ga0373954_0071174 | Ga0373954_0071174_10_303 | 97 |
| 366 | 3300035120 | Ga0373957_0050881 | Ga0373957_0050881_1255_1548 | 97 |
| 367 | 3300035410 | Ga0373924_0069746 | Ga0373924_0069746_897_1190 | 97 |
| 368 | 3300035724 | Ga0373933_0114976 | Ga0373933_0114976_520_813 | 97 |
| 369 | 3300036401 | Ga0373937_0102641 | Ga0373937_0102641_746_1039 | 97 |
| 370 | 3300037068 | Ga0373925_0690175 | Ga0373925_0690175_140_433 | 97 |
| 371 | 3300037418 | Ga0395900_1039310 | Ga0395900_1039310_180_473 | 97 |
| 372 | 3300038443 | Ga0395901_0836144 | Ga0395901_0836144_312_605 | 97 |
| 373 | 3300041505 | Ga0451849_0488422 | Ga0451849_0488422_206_499 | 97 |
| 374 | 3300041512 | Ga0451853_0743404 | Ga0451853_0743404_172_471 | 97 |
| 375 | 3300041512 | Ga0451853_2551273 | Ga0451853_2551273_182_475 | 97 |
| 376 | 3300042005 | Ga0439448_0065366 | Ga0439448_0065366_212_505 | 97 |
| 377 | 3300042157 | Ga0439458_0232219 | Ga0439458_0232219_116_409 | 97 |
| 378 | 3300044683 | Ga0466965_0022433 | Ga0466965_0022433_2592_2885 | 97 |
| 379 | 3300044683 | Ga0466965_0098501 | Ga0466965_0098501_757_1050 | 97 |
| 380 | 3300044684 | Ga0466966_0056927 | Ga0466966_0056927_1074_1376 | 97 |
| 381 | 3300044693 | Ga0466961_0001489 | Ga0466961_0001489_14073_14375 | 97 |
| 382 | 3300044693 | Ga0466961_0028288 | Ga0466961_0028288_100_420 | 97 |
| 383 | 3300044693 | Ga0466961_0585211 | Ga0466961_0585211_198_491 | 97 |
| 384 | 3300044694 | Ga0466963_0006992 | Ga0466963_0006992_2955_3248 | 97 |
| 385 | 3300044694 | Ga0466963_0008847 | Ga0466963_0008847_835_1128 | 97 |
| 386 | 3300044694 | Ga0466963_0011474 | Ga0466963_0011474_2012_2314 | 97 |
| 387 | 3300044694 | Ga0466963_0026131 | Ga0466963_0026131_1328_1630 | 97 |
| 388 | 3300044694 | Ga0466963_0079951 | Ga0466963_0079951_1568_1861 | 97 |
| 389 | 3300044694 | Ga0466963_0097741 | Ga0466963_0097741_58_351 | 97 |
| 390 | 3300044694 | Ga0466963_0137765 | Ga0466963_0137765_813_1106 | 97 |
| 391 | 3300044694 | Ga0466963_0205764 | Ga0466963_0205764_1021_1314 | 97 |
| 392 | 3300044694 | Ga0466963_0424176 | Ga0466963_0424176_388_681 | 97 |
| 393 | 3300044706 | Ga0466964_0005312 | Ga0466964_0005312_1565_1858 | 97 |
| 394 | 3300044706 | Ga0466964_0018531 | Ga0466964_0018531_1320_1622 | 97 |
| 395 | 3300044706 | Ga0466964_0053153 | Ga0466964_0053153_686_979 | 97 |
| 396 | 3300044706 | Ga0466964_0160607 | Ga0466964_0160607_585_878 | 97 |
| 397 | 3300044706 | Ga0466964_0176008 | Ga0466964_0176008_54_347 | 97 |
| 398 | 3300044706 | Ga0466964_0372864 | Ga0466964_0372864_421_714 | 97 |
| 399 | 3300044706 | Ga0466964_0635252 | Ga0466964_0635252_85_378 | 97 |
| 400 | 3300044706 | Ga0466964_0812087 | Ga0466964_0812087_89_382 | 97 |
| 401 | 3300044719 | Ga0466971_0010458 | Ga0466971_0010458_2938_3258 | 97 |
| 402 | 3300044719 | Ga0466971_0041173 | Ga0466971_0041173_1557_1850 | 97 |
| 403 | 3300044719 | Ga0466971_0056281 | Ga0466971_0056281_1189_1482 | 97 |
| 404 | 3300044735 | Ga0466968_0004685 | Ga0466968_0004685_1587_1880 | 97 |
| 405 | 3300044735 | Ga0466968_0021882 | Ga0466968_0021882_1850_2152 | 97 |
| 406 | 3300044735 | Ga0466968_0034558 | Ga0466968_0034558_59_352 | 97 |
| 407 | 3300044735 | Ga0466968_0437213 | Ga0466968_0437213_146_439 | 97 |
| 408 | 3300044765 | Ga0466970_0312272 | Ga0466970_0312272_424_717 | 97 |
| 409 | 3300044842 | Ga0466957_0002669 | Ga0466957_0002669_2510_2803 | 97 |
| 410 | 3300044842 | Ga0466957_0041436 | Ga0466957_0041436_1349_1651 | 97 |
| 411 | 3300044842 | Ga0466957_0045546 | Ga0466957_0045546_144_437 | 97 |
| 412 | 3300044842 | Ga0466957_0075614 | Ga0466957_0075614_42_344 | 97 |
| 413 | 3300044842 | Ga0466957_0089568 | Ga0466957_0089568_1486_1779 | 97 |
| 414 | 3300044842 | Ga0466957_0133631 | Ga0466957_0133631_824_1117 | 97 |
| 415 | 3300044842 | Ga0466957_0244682 | Ga0466957_0244682_374_667 | 97 |
| 416 | 3300044842 | Ga0466957_0583596 | Ga0466957_0583596_425_727 | 97 |
| 417 | 3300044901 | Ga0466960_0261752 | Ga0466960_0261752_432_728 | 97 |
| 418 | 3300044901 | Ga0466960_0894601 | Ga0466960_0894601_185_478 | 97 |
| 419 | 3300045049 | Ga0466959_0002913 | Ga0466959_0002913_9621_9923 | 97 |
| 420 | 3300045049 | Ga0466959_0064340 | Ga0466959_0064340_2243_2563 | 97 |
| 421 | 3300045049 | Ga0466959_0560520 | Ga0466959_0560520_219_512 | 97 |
| 422 | 3300045836 | Ga0466958_0002299 | Ga0466958_0002299_5356_5649 | 97 |
| 423 | 3300045836 | Ga0466958_0003751 | Ga0466958_0003751_3391_3693 | 97 |
| 424 | 3300045836 | Ga0466958_0016982 | Ga0466958_0016982_395_715 | 97 |
| 425 | 3300045836 | Ga0466958_0057162 | Ga0466958_0057162_349_642 | 97 |
| 426 | 3300045836 | Ga0466958_0545285 | Ga0466958_0545285_344_637 | 97 |
| 427 | 3300045836 | Ga0466958_0667298 | Ga0466958_0667298_235_537 | 97 |
| 428 | 3300045976 | Ga0466967_0004223 | Ga0466967_0004223_4097_4390 | 97 |
| 429 | 3300045976 | Ga0466967_0028212 | Ga0466967_0028212_1763_2056 | 97 |
| 430 | 3300045976 | Ga0466967_0028214 | Ga0466967_0028214_1227_1520 | 97 |
| 431 | 3300045976 | Ga0466967_0033554 | Ga0466967_0033554_1454_1747 | 97 |
| 432 | 3300045976 | Ga0466967_0045393 | Ga0466967_0045393_865_1158 | 97 |
| 433 | 3300045976 | Ga0466967_0081903 | Ga0466967_0081903_2138_2431 | 97 |
| 434 | 3300045976 | Ga0466967_0099687 | Ga0466967_0099687_1923_2216 | 97 |
| 435 | 3300045976 | Ga0466967_0105596 | Ga0466967_0105596_2098_2391 | 97 |
| 436 | 3300045976 | Ga0466967_0134398 | Ga0466967_0134398_564_857 | 97 |
| 437 | 3300045976 | Ga0466967_0234016 | Ga0466967_0234016_755_1048 | 97 |
| 438 | 3300045976 | Ga0466967_0237341 | Ga0466967_0237341_1229_1531 | 97 |
| 439 | 3300045976 | Ga0466967_0268088 | Ga0466967_0268088_1286_1585 | 97 |
| 440 | 3300045976 | Ga0466967_0297852 | Ga0466967_0297852_625_918 | 97 |
| 441 | 3300045976 | Ga0466967_0309017 | Ga0466967_0309017_289_591 | 97 |
| 442 | 3300045976 | Ga0466967_0353770 | Ga0466967_0353770_735_1028 | 97 |
| 443 | 3300045976 | Ga0466967_0437022 | Ga0466967_0437022_98_391 | 97 |
| 444 | 3300045976 | Ga0466967_0552409 | Ga0466967_0552409_800_1102 | 97 |
| 445 | 3300045976 | Ga0466967_0616781 | Ga0466967_0616781_753_1046 | 97 |
| 446 | 3300045976 | Ga0466967_1051176 | Ga0466967_1051176_353_646 | 97 |
| 447 | 3300045976 | Ga0466967_1072300 | Ga0466967_1072300_42_344 | 97 |
| 448 | 3300045976 | Ga0466967_2493273 | Ga0466967_2493273_207_500 | 97 |
| 449 | 3300046459 | Ga0495629_0296248 | Ga0495629_0296248_572_865 | 97 |
| 450 | 3300046462 | Ga0495651_0087441 | Ga0495651_0087441_1848_2141 | 97 |
| 451 | 3300046462 | Ga0495651_0839351 | Ga0495651_0839351_73_366 | 97 |
| 452 | 3300046463 | Ga0495653_0061173 | Ga0495653_0061173_343_636 | 97 |
| 453 | 3300046511 | Ga0495608_0048619 | Ga0495608_0048619_612_905 | 97 |
| 454 | 3300046517 | Ga0495630_0135047 | Ga0495630_0135047_98_391 | 97 |
| 455 | 3300046529 | Ga0495652_0358974 | Ga0495652_0358974_510_803 | 97 |
| 456 | 3300046536 | Ga0495587_0040939 | Ga0495587_0040939_2089_2382 | 97 |
| 457 | 3300046536 | Ga0495587_0817854 | Ga0495587_0817854_154_447 | 97 |
| 458 | 3300046559 | Ga0495667_0043603 | Ga0495667_0043603_1548_1841 | 97 |
| 459 | 3300046642 | Ga0495634_0086551 | Ga0495634_0086551_614_907 | 97 |
| 460 | 3300046663 | Ga0495635_0047594 | Ga0495635_0047594_2578_2871 | 97 |
| 461 | 3300046689 | Ga0495613_0399049 | Ga0495613_0399049_194_487 | 97 |
| 462 | 3300046809 | Ga0495600_0165848 | Ga0495600_0165848_643_936 | 97 |
| 463 | 3300047317 | Ga0495604_0377414 | Ga0495604_0377414_613_906 | 97 |
| 464 | 3300047319 | Ga0495674_0365750 | Ga0495674_0365750_224_517 | 97 |
| 465 | 3300047321 | Ga0495676_0945797 | Ga0495676_0945797_166_459 | 97 |
| 466 | 3300047322 | Ga0495680_0007127 | Ga0495680_0007127_1093_1386 | 97 |
| 467 | 3300047444 | Ga0495675_0085616 | Ga0495675_0085616_620_913 | 97 |
| 468 | 3300047471 | Ga0495684_0070860 | Ga0495684_0070860_771_1064 | 97 |
| 469 | 3300047471 | Ga0495684_0147308 | Ga0495684_0147308_393_686 | 97 |
| 470 | 3300048903 | Ga0496100_0109133 | Ga0496100_0109133_1343_1636 | 97 |
| 471 | 3300048903 | Ga0496100_0249336 | Ga0496100_0249336_804_1097 | 97 |
| 472 | 3300048904 | Ga0496101_0054319 | Ga0496101_0054319_2053_2346 | 97 |
| 473 | 3300048904 | Ga0496101_0398214 | Ga0496101_0398214_51_344 | 97 |
| 474 | 3300048906 | Ga0496103_0801636 | Ga0496103_0801636_189_482 | 97 |
| 475 | 3300048907 | Ga0496104_0456035 | Ga0496104_0456035_604_897 | 97 |
| 476 | 3300048908 | Ga0496105_0354046 | Ga0496105_0354046_520_813 | 97 |
| 477 | 3300048909 | Ga0496106_1162939 | Ga0496106_1162939_167_460 | 97 |
| 478 | 3300048909 | Ga0496106_1374721 | Ga0496106_1374721_218_511 | 97 |
| 479 | 3300048910 | Ga0496107_0056103 | Ga0496107_0056103_2008_2301 | 97 |
| 480 | 3300048912 | Ga0496109_0020161 | Ga0496109_0020161_3956_4249 | 97 |
| 481 | 3300048912 | Ga0496109_0063148 | Ga0496109_0063148_846_1139 | 97 |
| 482 | 3300048913 | Ga0496110_0271349 | Ga0496110_0271349_887_1180 | 97 |
| 483 | 3300048913 | Ga0496110_1818481 | Ga0496110_1818481_168_461 | 97 |
| 484 | 3300048914 | Ga0496111_0096277 | Ga0496111_0096277_901_1194 | 97 |
| 485 | 3300048915 | Ga0496112_0024061 | Ga0496112_0024061_604_897 | 97 |
| 486 | 3300048916 | Ga0496113_0432005 | Ga0496113_0432005_589_882 | 97 |
| 487 | 3300048917 | Ga0496114_1276512 | Ga0496114_1276512_251_544 | 97 |
| 488 | 3300049580 | Ga0501046_0703539 | Ga0501046_0703539_361_663 | 97 |
| 489 | 3300049581 | Ga0501047_0633698 | Ga0501047_0633698_46_348 | 97 |
| 490 | 3300049583 | Ga0501067_0134848 | Ga0501067_0134848_671_964 | 97 |
| 491 | 3300049585 | Ga0501069_0040908 | Ga0501069_0040908_1463_1756 | 97 |
| 492 | 3300049586 | Ga0501070_0042954 | Ga0501070_0042954_1871_2173 | 97 |
| 493 | 3300049586 | Ga0501070_1088434 | Ga0501070_1088434_300_593 | 97 |
| 494 | 3300049588 | Ga0501072_0005382 | Ga0501072_0005382_7350_7652 | 97 |
| 495 | 3300049589 | Ga0501073_0020331 | Ga0501073_0020331_2648_2950 | 97 |
| 496 | 3300049590 | Ga0501074_0083746 | Ga0501074_0083746_602_904 | 97 |
| 497 | 3300049741 | Ga0501079_0121210 | Ga0501079_0121210_705_1007 | 97 |
| 498 | 3300049742 | Ga0501080_0053575 | Ga0501080_0053575_3118_3420 | 97 |
| 499 | 3300049744 | Ga0501083_0000241 | Ga0501083_0000241_2897_3199 | 97 |
| 500 | 3300050507 | nmdc:mga05p37_210715_c1 | nmdc:mga05p37_210715_c1_739_1050 | 97 |
| 501 | 3300050508 | nmdc:mga09592_23722_c1 | nmdc:mga09592_23722_c1_3974_4285 | 97 |
| 502 | 3300050509 | nmdc:mga0qj67_49810_c1 | nmdc:mga0qj67_49810_c1_807_1118 | 97 |
| 503 | 3300050510 | nmdc:mga06r32_81539_c1 | nmdc:mga06r32_81539_c1_2194_2505 | 97 |
| 504 | 3300053084 | Ga0495595_0005681 | Ga0495595_0005681_3998_4291 | 97 |
| 505 | 3300053085 | Ga0495619_0055558 | Ga0495619_0055558_1576_1869 | 97 |
| 506 | 3300053085 | Ga0495619_0861131 | Ga0495619_0861131_286_579 | 97 |
| 507 | 3300061719 | Ga0466962_0058691 | Ga0466962_0058691_1233_1553 | 97 |
| 508 | 3300061719 | Ga0466962_0075147 | Ga0466962_0075147_811_1104 | 97 |
| 509 | 3300061719 | Ga0466962_0377104 | Ga0466962_0377104_202_495 | 97 |
| 510 | 3300061734 | Ga0530510_0593507 | Ga0530510_0593507_296_589 | 97 |
| 511 | 3300005335 | Ga0070666_11059650 | Ga0070666_110596501 | 98 |
| 512 | 3300005336 | Ga0070680_100129688 | Ga0070680_1001296882 | 98 |
| 513 | 3300005336 | Ga0070680_100866375 | Ga0070680_1008663752 | 98 |
| 514 | 3300005355 | Ga0070671_100075864 | Ga0070671_1000758642 | 98 |
| 515 | 3300005435 | Ga0070714_100047788 | Ga0070714_1000477882 | 98 |
| 516 | 3300005435 | Ga0070714_100384979 | Ga0070714_1003849792 | 98 |
| 517 | 3300005436 | Ga0070713_100022189 | Ga0070713_1000221894 | 98 |
| 518 | 3300005439 | Ga0070711_100212829 | Ga0070711_1002128292 | 98 |
| 519 | 3300005439 | Ga0070711_100352477 | Ga0070711_1003524772 | 98 |
| 520 | 3300005444 | Ga0070694_100182245 | Ga0070694_1001822452 | 98 |
| 521 | 3300005456 | Ga0070678_100243020 | Ga0070678_1002430203 | 98 |
| 522 | 3300005458 | Ga0070681_10097911 | Ga0070681_100979112 | 98 |
| 523 | 3300005458 | Ga0070681_11411912 | Ga0070681_114119121 | 98 |
| 524 | 3300005467 | Ga0070706_100097485 | Ga0070706_1000974853 | 98 |
| 525 | 3300005471 | Ga0070698_100071346 | Ga0070698_1000713462 | 98 |
| 526 | 3300005518 | Ga0070699_101214808 | Ga0070699_1012148081 | 98 |
| 527 | 3300005530 | Ga0070679_100089311 | Ga0070679_1000893112 | 98 |
| 528 | 3300005530 | Ga0070679_101295846 | Ga0070679_1012958461 | 98 |
| 529 | 3300005535 | Ga0070684_101301828 | Ga0070684_1013018282 | 98 |
| 530 | 3300005536 | Ga0070697_101904306 | Ga0070697_1019043061 | 98 |
| 531 | 3300005545 | Ga0070695_100000670 | Ga0070695_10000067011 | 98 |
| 532 | 3300005545 | Ga0070695_100113305 | Ga0070695_1001133053 | 98 |
| 533 | 3300005563 | Ga0068855_102567498 | Ga0068855_1025674981 | 98 |
| 534 | 3300005578 | Ga0068854_101488408 | Ga0068854_1014884082 | 98 |
| 535 | 3300006028 | Ga0070717_10026131 | Ga0070717_100261316 | 98 |
| 536 | 3300006175 | Ga0070712_100940576 | Ga0070712_1009405761 | 98 |
| 537 | 3300009093 | Ga0105240_11941186 | Ga0105240_119411862 | 98 |
| 538 | 3300009101 | Ga0105247_11276685 | Ga0105247_112766852 | 98 |
| 539 | 3300009177 | Ga0105248_10493547 | Ga0105248_104935472 | 98 |
| 540 | 3300009545 | Ga0105237_10056866 | Ga0105237_100568664 | 98 |
| 541 | 3300013100 | Ga0157373_10066219 | Ga0157373_100662192 | 98 |
| 542 | 3300013104 | Ga0157370_10054012 | Ga0157370_100540122 | 98 |
| 543 | 3300013104 | Ga0157370_10761466 | Ga0157370_107614662 | 98 |
| 544 | 3300013105 | Ga0157369_10129273 | Ga0157369_101292733 | 98 |
| 545 | 3300013105 | Ga0157369_10157434 | Ga0157369_101574343 | 98 |
| 546 | 3300013307 | Ga0157372_10072409 | Ga0157372_100724093 | 98 |
| 547 | 3300013307 | Ga0157372_12006164 | Ga0157372_120061642 | 98 |
| 548 | 3300014497 | Ga0182008_10010399 | Ga0182008_100103997 | 98 |
| 549 | 3300015261 | Ga0182006_1098267 | Ga0182006_10982672 | 98 |
| 550 | 3300020081 | Ga0206354_11484271 | Ga0206354_114842711 | 98 |
| 551 | 3300020082 | Ga0206353_10146321 | Ga0206353_101463212 | 98 |
| 552 | 3300021441 | Ga0213871_10116273 | Ga0213871_101162732 | 98 |
| 553 | 3300025912 | Ga0207707_10096086 | Ga0207707_100960864 | 98 |
| 554 | 3300025912 | Ga0207707_10643239 | Ga0207707_106432392 | 98 |
| 555 | 3300025913 | Ga0207695_10015652 | Ga0207695_100156527 | 98 |
| 556 | 3300025913 | Ga0207695_11136087 | Ga0207695_111360872 | 98 |
| 557 | 3300025914 | Ga0207671_10095099 | Ga0207671_100950993 | 98 |
| 558 | 3300025917 | Ga0207660_10911638 | Ga0207660_109116382 | 98 |
| 559 | 3300025920 | Ga0207649_10760129 | Ga0207649_107601292 | 98 |
| 560 | 3300025920 | Ga0207649_11586852 | Ga0207649_115868522 | 98 |
| 561 | 3300025921 | Ga0207652_10101900 | Ga0207652_101019003 | 98 |
| 562 | 3300025929 | Ga0207664_10003292 | Ga0207664_1000329211 | 98 |
| 563 | 3300025929 | Ga0207664_10006985 | Ga0207664_100069857 | 98 |
| 564 | 3300025929 | Ga0207664_10076263 | Ga0207664_100762634 | 98 |
| 565 | 3300025931 | Ga0207644_10545705 | Ga0207644_105457052 | 98 |
| 566 | 3300025939 | Ga0207665_10433682 | Ga0207665_104336822 | 98 |
| 567 | 3300025939 | Ga0207665_10762583 | Ga0207665_107625832 | 98 |
| 568 | 3300025941 | Ga0207711_10640649 | Ga0207711_106406492 | 98 |
| 569 | 3300025944 | Ga0207661_10500862 | Ga0207661_105008622 | 98 |
| 570 | 3300025981 | Ga0207640_11248861 | Ga0207640_112488611 | 98 |
| 571 | 3300026078 | Ga0207702_10743840 | Ga0207702_107438402 | 98 |
| 572 | 3300037471 | Ga0395905_1350705 | Ga0395905_1350705_92_388 | 98 |
| 573 | 3300039438 | Ga0436360_0731594 | Ga0436360_0731594_12377_12673 | 98 |
| 574 | 3300044673 | Ga0453683_0750435 | Ga0453683_0750435_224_520 | 98 |
| 575 | 3300044683 | Ga0466965_0209800 | Ga0466965_0209800_703_999 | 98 |
| 576 | 3300044693 | Ga0466961_0053749 | Ga0466961_0053749_1097_1393 | 98 |
| 577 | 3300044693 | Ga0466961_0414083 | Ga0466961_0414083_283_579 | 98 |
| 578 | 3300044694 | Ga0466963_0000702 | Ga0466963_0000702_15034_15330 | 98 |
| 579 | 3300044694 | Ga0466963_0011460 | Ga0466963_0011460_4420_4716 | 98 |
| 580 | 3300044694 | Ga0466963_0035227 | Ga0466963_0035227_1727_2023 | 98 |
| 581 | 3300044706 | Ga0466964_0012506 | Ga0466964_0012506_2163_2459 | 98 |
| 582 | 3300044706 | Ga0466964_0024447 | Ga0466964_0024447_1930_2226 | 98 |
| 583 | 3300044706 | Ga0466964_0216770 | Ga0466964_0216770_217_513 | 98 |
| 584 | 3300044719 | Ga0466971_0007230 | Ga0466971_0007230_1565_1861 | 98 |
| 585 | 3300044719 | Ga0466971_0109453 | Ga0466971_0109453_183_479 | 98 |
| 586 | 3300044719 | Ga0466971_0221810 | Ga0466971_0221810_75_371 | 98 |
| 587 | 3300044735 | Ga0466968_0003890 | Ga0466968_0003890_5111_5407 | 98 |
| 588 | 3300044735 | Ga0466968_0068973 | Ga0466968_0068973_965_1261 | 98 |
| 589 | 3300044735 | Ga0466968_0446494 | Ga0466968_0446494_103_399 | 98 |
| 590 | 3300044735 | Ga0466968_0516125 | Ga0466968_0516125_286_582 | 98 |
| 591 | 3300044842 | Ga0466957_0011273 | Ga0466957_0011273_3549_3845 | 98 |
| 592 | 3300044842 | Ga0466957_0626997 | Ga0466957_0626997_129_425 | 98 |
| 593 | 3300044901 | Ga0466960_0205402 | Ga0466960_0205402_173_469 | 98 |
| 594 | 3300045049 | Ga0466959_0050239 | Ga0466959_0050239_577_873 | 98 |
| 595 | 3300045836 | Ga0466958_0016686 | Ga0466958_0016686_1056_1352 | 98 |
| 596 | 3300045836 | Ga0466958_0111884 | Ga0466958_0111884_499_795 | 98 |
| 597 | 3300045976 | Ga0466967_0130980 | Ga0466967_0130980_1066_1362 | 98 |
| 598 | 3300045976 | Ga0466967_0145122 | Ga0466967_0145122_852_1148 | 98 |
| 599 | 3300045976 | Ga0466967_0286129 | Ga0466967_0286129_682_978 | 98 |
| 600 | 3300045976 | Ga0466967_1828382 | Ga0466967_1828382_199_495 | 98 |
| 601 | 3300047319 | Ga0495674_0593249 | Ga0495674_0593249_329_625 | 98 |
| 602 | 3300048903 | Ga0496100_0061935 | Ga0496100_0061935_1648_1962 | 98 |
| 603 | 3300048904 | Ga0496101_0037768 | Ga0496101_0037768_1828_2142 | 98 |
| 604 | 3300048905 | Ga0496102_0028463 | Ga0496102_0028463_3730_4026 | 98 |
| 605 | 3300048905 | Ga0496102_0780795 | Ga0496102_0780795_209_505 | 98 |
| 606 | 3300048906 | Ga0496103_0117115 | Ga0496103_0117115_350_664 | 98 |
| 607 | 3300048907 | Ga0496104_0051681 | Ga0496104_0051681_2118_2432 | 98 |
| 608 | 3300048908 | Ga0496105_0108889 | Ga0496105_0108889_308_622 | 98 |
| 609 | 3300048909 | Ga0496106_0177432 | Ga0496106_0177432_938_1252 | 98 |
| 610 | 3300048911 | Ga0496108_0004233 | Ga0496108_0004233_5887_6201 | 98 |
| 611 | 3300048912 | Ga0496109_0012761 | Ga0496109_0012761_20_334 | 98 |
| 612 | 3300048913 | Ga0496110_0003879 | Ga0496110_0003879_1854_2168 | 98 |
| 613 | 3300048914 | Ga0496111_0000620 | Ga0496111_0000620_9021_9335 | 98 |
| 614 | 3300048915 | Ga0496112_0045242 | Ga0496112_0045242_1284_1598 | 98 |
| 615 | 3300048915 | Ga0496112_1643125 | Ga0496112_1643125_56_352 | 98 |
| 616 | 3300048916 | Ga0496113_0064467 | Ga0496113_0064467_1499_1813 | 98 |
| 617 | 3300048917 | Ga0496114_0007533 | Ga0496114_0007533_289_603 | 98 |
| 618 | 3300048918 | Ga0496115_0067550 | Ga0496115_0067550_225_539 | 98 |
| 619 | 3300049583 | Ga0501067_0008976 | Ga0501067_0008976_4053_4349 | 98 |
| 620 | 3300049583 | Ga0501067_0573557 | Ga0501067_0573557_111_407 | 98 |
| 621 | 3300049585 | Ga0501069_0090906 | Ga0501069_0090906_1180_1476 | 98 |
| 622 | 3300061719 | Ga0466962_0016648 | Ga0466962_0016648_3220_3516 | 98 |
| 623 | 3300061719 | Ga0466962_0150496 | Ga0466962_0150496_406_702 | 98 |
| 624 | 2149837012 | _F7QKVOU01CGDIP | LJQ_0002.00000100 | 99 |
| 625 | 3300005329 | Ga0070683_100419970 | Ga0070683_1004199702 | 99 |
| 626 | 3300005336 | Ga0070680_100857562 | Ga0070680_1008575622 | 99 |
| 627 | 3300005337 | Ga0070682_100124742 | Ga0070682_1001247421 | 99 |
| 628 | 3300005355 | Ga0070671_100235750 | Ga0070671_1002357502 | 99 |
| 629 | 3300005435 | Ga0070714_100051138 | Ga0070714_1000511382 | 99 |
| 630 | 3300005435 | Ga0070714_100647102 | Ga0070714_1006471022 | 99 |
| 631 | 3300005435 | Ga0070714_101174865 | Ga0070714_1011748652 | 99 |
| 632 | 3300005436 | Ga0070713_100082041 | Ga0070713_1000820411 | 99 |
| 633 | 3300005436 | Ga0070713_100350026 | Ga0070713_1003500262 | 99 |
| 634 | 3300005437 | Ga0070710_10002341 | Ga0070710_100023417 | 99 |
| 635 | 3300005437 | Ga0070710_10020436 | Ga0070710_100204362 | 99 |
| 636 | 3300005439 | Ga0070711_100008253 | Ga0070711_1000082535 | 99 |
| 637 | 3300005439 | Ga0070711_100028351 | Ga0070711_1000283514 | 99 |
| 638 | 3300005440 | Ga0070705_101272999 | Ga0070705_1012729992 | 99 |
| 639 | 3300005468 | Ga0070707_100003577 | Ga0070707_1000035776 | 99 |
| 640 | 3300005468 | Ga0070707_100190846 | Ga0070707_1001908462 | 99 |
| 641 | 3300005468 | Ga0070707_100456273 | Ga0070707_1004562732 | 99 |
| 642 | 3300005471 | Ga0070698_100219569 | Ga0070698_1002195691 | 99 |
| 643 | 3300005471 | Ga0070698_100416571 | Ga0070698_1004165712 | 99 |
| 644 | 3300005518 | Ga0070699_101114199 | Ga0070699_1011141992 | 99 |
| 645 | 3300005535 | Ga0070684_100150985 | Ga0070684_1001509852 | 99 |
| 646 | 3300005535 | Ga0070684_100172478 | Ga0070684_1001724782 | 99 |
| 647 | 3300005535 | Ga0070684_100396613 | Ga0070684_1003966132 | 99 |
| 648 | 3300005544 | Ga0070686_100826276 | Ga0070686_1008262762 | 99 |
| 649 | 3300005547 | Ga0070693_100105429 | Ga0070693_1001054291 | 99 |
| 650 | 3300005548 | Ga0070665_100579743 | Ga0070665_1005797432 | 99 |
| 651 | 3300005549 | Ga0070704_100040941 | Ga0070704_1000409414 | 99 |
| 652 | 3300005563 | Ga0068855_102212282 | Ga0068855_1022122822 | 99 |
| 653 | 3300005614 | Ga0068856_102369151 | Ga0068856_1023691511 | 99 |
| 654 | 3300005618 | Ga0068864_100367993 | Ga0068864_1003679932 | 99 |
| 655 | 3300005841 | Ga0068863_100976453 | Ga0068863_1009764532 | 99 |
| 656 | 3300005842 | Ga0068858_100892333 | Ga0068858_1008923332 | 99 |
| 657 | 3300006028 | Ga0070717_10001487 | Ga0070717_1000148712 | 99 |
| 658 | 3300006028 | Ga0070717_10040736 | Ga0070717_100407365 | 99 |
| 659 | 3300006028 | Ga0070717_10279542 | Ga0070717_102795423 | 99 |
| 660 | 3300006028 | Ga0070717_10410781 | Ga0070717_104107812 | 99 |
| 661 | 3300006028 | Ga0070717_10663487 | Ga0070717_106634872 | 99 |
| 662 | 3300006028 | Ga0070717_10707959 | Ga0070717_107079592 | 99 |
| 663 | 3300006028 | Ga0070717_11099991 | Ga0070717_110999911 | 99 |
| 664 | 3300006163 | Ga0070715_10082743 | Ga0070715_100827432 | 99 |
| 665 | 3300006173 | Ga0070716_100384148 | Ga0070716_1003841482 | 99 |
| 666 | 3300006175 | Ga0070712_100107235 | Ga0070712_1001072353 | 99 |
| 667 | 3300006175 | Ga0070712_100168261 | Ga0070712_1001682613 | 99 |
| 668 | 3300006237 | Ga0097621_100205385 | Ga0097621_1002053853 | 99 |
| 669 | 3300009098 | Ga0105245_10066687 | Ga0105245_100666872 | 99 |
| 670 | 3300009098 | Ga0105245_10443101 | Ga0105245_104431012 | 99 |
| 671 | 3300009101 | Ga0105247_10073977 | Ga0105247_100739772 | 99 |
| 672 | 3300009148 | Ga0105243_12599260 | Ga0105243_125992602 | 99 |
| 673 | 3300009551 | Ga0105238_10944528 | Ga0105238_109445282 | 99 |
| 674 | 3300010159 | Ga0099796_10100928 | Ga0099796_101009282 | 99 |
| 675 | 3300011119 | Ga0105246_10220770 | Ga0105246_102207701 | 99 |
| 676 | 3300013105 | Ga0157369_10167975 | Ga0157369_101679752 | 99 |
| 677 | 3300013296 | Ga0157374_10023216 | Ga0157374_100232162 | 99 |
| 678 | 3300013306 | Ga0163162_10407874 | Ga0163162_104078742 | 99 |
| 679 | 3300014968 | Ga0157379_11715082 | Ga0157379_117150822 | 99 |
| 680 | 3300014969 | Ga0157376_10143874 | Ga0157376_101438743 | 99 |
| 681 | 3300025898 | Ga0207692_10009923 | Ga0207692_100099233 | 99 |
| 682 | 3300025898 | Ga0207692_10052109 | Ga0207692_100521092 | 99 |
| 683 | 3300025900 | Ga0207710_10103688 | Ga0207710_101036882 | 99 |
| 684 | 3300025905 | Ga0207685_10861762 | Ga0207685_108617621 | 99 |
| 685 | 3300025906 | Ga0207699_10018714 | Ga0207699_100187142 | 99 |
| 686 | 3300025906 | Ga0207699_10022093 | Ga0207699_100220934 | 99 |
| 687 | 3300025912 | Ga0207707_10985834 | Ga0207707_109858342 | 99 |
| 688 | 3300025915 | Ga0207693_10000745 | Ga0207693_1000074516 | 99 |
| 689 | 3300025915 | Ga0207693_10039934 | Ga0207693_100399342 | 99 |
| 690 | 3300025915 | Ga0207693_10418274 | Ga0207693_104182742 | 99 |
| 691 | 3300025916 | Ga0207663_10006473 | Ga0207663_100064735 | 99 |
| 692 | 3300025916 | Ga0207663_10325736 | Ga0207663_103257362 | 99 |
| 693 | 3300025916 | Ga0207663_11623886 | Ga0207663_116238862 | 99 |
| 694 | 3300025917 | Ga0207660_10487091 | Ga0207660_104870912 | 99 |
| 695 | 3300025922 | Ga0207646_10000785 | Ga0207646_1000078534 | 99 |
| 696 | 3300025922 | Ga0207646_10151621 | Ga0207646_101516212 | 99 |
| 697 | 3300025922 | Ga0207646_10651246 | Ga0207646_106512462 | 99 |
| 698 | 3300025924 | Ga0207694_10592951 | Ga0207694_105929512 | 99 |
| 699 | 3300025927 | Ga0207687_10048591 | Ga0207687_100485914 | 99 |
| 700 | 3300025928 | Ga0207700_10002676 | Ga0207700_100026768 | 99 |
| 701 | 3300025928 | Ga0207700_10124498 | Ga0207700_101244983 | 99 |
| 702 | 3300025928 | Ga0207700_10226240 | Ga0207700_102262402 | 99 |
| 703 | 3300025928 | Ga0207700_10808487 | Ga0207700_108084872 | 99 |
| 704 | 3300025929 | Ga0207664_10033341 | Ga0207664_100333413 | 99 |
| 705 | 3300025929 | Ga0207664_10221472 | Ga0207664_102214721 | 99 |
| 706 | 3300025929 | Ga0207664_10496766 | Ga0207664_104967662 | 99 |
| 707 | 3300025935 | Ga0207709_11542856 | Ga0207709_115428561 | 99 |
| 708 | 3300025938 | Ga0207704_10352309 | Ga0207704_103523092 | 99 |
| 709 | 3300025939 | Ga0207665_10001126 | Ga0207665_1000112613 | 99 |
| 710 | 3300025939 | Ga0207665_10133428 | Ga0207665_101334282 | 99 |
| 711 | 3300025944 | Ga0207661_10151201 | Ga0207661_101512012 | 99 |
| 712 | 3300025944 | Ga0207661_10173632 | Ga0207661_101736322 | 99 |
| 713 | 3300025949 | Ga0207667_12133208 | Ga0207667_121332082 | 99 |
| 714 | 3300026035 | Ga0207703_11584799 | Ga0207703_115847992 | 99 |
| 715 | 3300026078 | Ga0207702_10557829 | Ga0207702_105578292 | 99 |
| 716 | 3300026088 | Ga0207641_10805086 | Ga0207641_108050862 | 99 |
| 717 | 3300026095 | Ga0207676_10069200 | Ga0207676_100692003 | 99 |
| 718 | 3300028556 | Ga0265337_1139887 | Ga0265337_11398872 | 99 |
| 719 | 3300028577 | Ga0265318_10089713 | Ga0265318_100897132 | 99 |
| 720 | 3300028666 | Ga0265336_10016538 | Ga0265336_100165382 | 99 |
| 721 | 3300028800 | Ga0265338_10111758 | Ga0265338_101117583 | 99 |
| 722 | 3300031238 | Ga0265332_10028477 | Ga0265332_100284774 | 99 |
| 723 | 3300031239 | Ga0265328_10211552 | Ga0265328_102115522 | 99 |
| 724 | 3300031241 | Ga0265325_10288001 | Ga0265325_102880012 | 99 |
| 725 | 3300031249 | Ga0265339_10019201 | Ga0265339_100192014 | 99 |
| 726 | 3300031250 | Ga0265331_10082825 | Ga0265331_100828252 | 99 |
| 727 | 3300031251 | Ga0265327_10027814 | Ga0265327_100278143 | 99 |
| 728 | 3300031344 | Ga0265316_10189063 | Ga0265316_101890632 | 99 |
| 729 | 3300031595 | Ga0265313_10227376 | Ga0265313_102273761 | 99 |
| 730 | 3300031711 | Ga0265314_10052382 | Ga0265314_100523823 | 99 |
| 731 | 3300031711 | Ga0265314_10406622 | Ga0265314_104066222 | 99 |
| 732 | 3300035113 | Ga0373936_0065168 | Ga0373936_0065168_715_1020 | 99 |
| 733 | 3300035114 | Ga0373939_0221727 | Ga0373939_0221727_343_651 | 99 |
| 734 | 3300035116 | Ga0373945_0228175 | Ga0373945_0228175_439_738 | 99 |
| 735 | 3300035118 | Ga0373954_0698962 | Ga0373954_0698962_119_418 | 99 |
| 736 | 3300035170 | Ga0373943_0046679 | Ga0373943_0046679_724_1023 | 99 |
| 737 | 3300035172 | Ga0373955_0639572 | Ga0373955_0639572_298_597 | 99 |
| 738 | 3300035691 | Ga0373931_0310390 | Ga0373931_0310390_305_604 | 99 |
| 739 | 3300035692 | Ga0373935_0379407 | Ga0373935_0379407_568_873 | 99 |
| 740 | 3300035725 | Ga0373947_0853188 | Ga0373947_0853188_22_321 | 99 |
| 741 | 3300035725 | Ga0373947_1037867 | Ga0373947_1037867_12_311 | 99 |
| 742 | 3300036401 | Ga0373937_0934924 | Ga0373937_0934924_475_774 | 99 |
| 743 | 3300037068 | Ga0373925_1606894 | Ga0373925_1606894_19_318 | 99 |
| 744 | 3300037068 | Ga0373925_1727097 | Ga0373925_1727097_40_345 | 99 |
| 745 | 3300037418 | Ga0395900_0035416 | Ga0395900_0035416_4622_4921 | 99 |
| 746 | 3300037471 | Ga0395905_0091689 | Ga0395905_0091689_2176_2475 | 99 |
| 747 | 3300038443 | Ga0395901_0062296 | Ga0395901_0062296_1080_1379 | 99 |
| 748 | 3300038443 | Ga0395901_0650965 | Ga0395901_0650965_389_688 | 99 |
| 749 | 3300041496 | Ga0451839_1156050 | Ga0451839_1156050_57_356 | 99 |
| 750 | 3300044694 | Ga0466963_0015847 | Ga0466963_0015847_495_794 | 99 |
| 751 | 3300044694 | Ga0466963_0084311 | Ga0466963_0084311_1662_1961 | 99 |
| 752 | 3300044694 | Ga0466963_0560735 | Ga0466963_0560735_377_676 | 99 |
| 753 | 3300044694 | Ga0466963_0790512 | Ga0466963_0790512_112_411 | 99 |
| 754 | 3300044706 | Ga0466964_0003456 | Ga0466964_0003456_1148_1456 | 99 |
| 755 | 3300044735 | Ga0466968_0022276 | Ga0466968_0022276_2184_2483 | 99 |
| 756 | 3300044901 | Ga0466960_0002510 | Ga0466960_0002510_448_747 | 99 |
| 757 | 3300044901 | Ga0466960_0050980 | Ga0466960_0050980_592_891 | 99 |
| 758 | 3300044901 | Ga0466960_0204995 | Ga0466960_0204995_631_930 | 99 |
| 759 | 3300045049 | Ga0466959_0969914 | Ga0466959_0969914_12_311 | 99 |
| 760 | 3300045049 | Ga0466959_1011539 | Ga0466959_1011539_114_413 | 99 |
| 761 | 3300045976 | Ga0466967_0034562 | Ga0466967_0034562_1453_1752 | 99 |
| 762 | 3300045976 | Ga0466967_0066380 | Ga0466967_0066380_2387_2686 | 99 |
| 763 | 3300045976 | Ga0466967_0075464 | Ga0466967_0075464_2378_2677 | 99 |
| 764 | 3300045976 | Ga0466967_0160874 | Ga0466967_0160874_1386_1685 | 99 |
| 765 | 3300045976 | Ga0466967_0598937 | Ga0466967_0598937_251_559 | 99 |
| 766 | 3300046454 | Ga0495592_0014667 | Ga0495592_0014667_2191_2490 | 99 |
| 767 | 3300046455 | Ga0495603_0212391 | Ga0495603_0212391_507_806 | 99 |
| 768 | 3300046459 | Ga0495629_0074600 | Ga0495629_0074600_422_721 | 99 |
| 769 | 3300046459 | Ga0495629_0107025 | Ga0495629_0107025_492_791 | 99 |
| 770 | 3300046459 | Ga0495629_0135661 | Ga0495629_0135661_401_700 | 99 |
| 771 | 3300046461 | Ga0495641_0073273 | Ga0495641_0073273_402_701 | 99 |
| 772 | 3300046461 | Ga0495641_0098443 | Ga0495641_0098443_657_956 | 99 |
| 773 | 3300046461 | Ga0495641_0155142 | Ga0495641_0155142_388_687 | 99 |
| 774 | 3300046463 | Ga0495653_0066208 | Ga0495653_0066208_1593_1892 | 99 |
| 775 | 3300046463 | Ga0495653_0711506 | Ga0495653_0711506_171_470 | 99 |
| 776 | 3300046473 | Ga0495582_0041166 | Ga0495582_0041166_2188_2487 | 99 |
| 777 | 3300046473 | Ga0495582_0412164 | Ga0495582_0412164_380_679 | 99 |
| 778 | 3300046473 | Ga0495582_0528148 | Ga0495582_0528148_52_351 | 99 |
| 779 | 3300046475 | Ga0495639_0349976 | Ga0495639_0349976_211_510 | 99 |
| 780 | 3300046476 | Ga0495662_0027704 | Ga0495662_0027704_2164_2463 | 99 |
| 781 | 3300046499 | Ga0495594_0123403 | Ga0495594_0123403_89_388 | 99 |
| 782 | 3300046511 | Ga0495608_0043847 | Ga0495608_0043847_180_479 | 99 |
| 783 | 3300046511 | Ga0495608_0044061 | Ga0495608_0044061_841_1140 | 99 |
| 784 | 3300046514 | Ga0495618_0034726 | Ga0495618_0034726_2496_2795 | 99 |
| 785 | 3300046516 | Ga0495628_0232139 | Ga0495628_0232139_878_1177 | 99 |
| 786 | 3300046517 | Ga0495630_0078194 | Ga0495630_0078194_1668_1967 | 99 |
| 787 | 3300046529 | Ga0495652_0408293 | Ga0495652_0408293_22_321 | 99 |
| 788 | 3300046531 | Ga0495665_0457190 | Ga0495665_0457190_132_431 | 99 |
| 789 | 3300046533 | Ga0495640_0009269 | Ga0495640_0009269_1111_1410 | 99 |
| 790 | 3300046559 | Ga0495667_0023385 | Ga0495667_0023385_3426_3725 | 99 |
| 791 | 3300046559 | Ga0495667_0094236 | Ga0495667_0094236_1063_1362 | 99 |
| 792 | 3300046642 | Ga0495634_0202216 | Ga0495634_0202216_528_827 | 99 |
| 793 | 3300046663 | Ga0495635_0015823 | Ga0495635_0015823_2120_2419 | 99 |
| 794 | 3300046674 | Ga0495588_0675617 | Ga0495588_0675617_83_382 | 99 |
| 795 | 3300046675 | Ga0495657_0005251 | Ga0495657_0005251_6762_7061 | 99 |
| 796 | 3300046678 | Ga0495599_0487349 | Ga0495599_0487349_283_582 | 99 |
| 797 | 3300046681 | Ga0495647_0087043 | Ga0495647_0087043_304_603 | 99 |
| 798 | 3300046683 | Ga0495658_0124455 | Ga0495658_0124455_677_976 | 99 |
| 799 | 3300046683 | Ga0495658_0132780 | Ga0495658_0132780_384_683 | 99 |
| 800 | 3300046689 | Ga0495613_0008298 | Ga0495613_0008298_6486_6785 | 99 |
| 801 | 3300046689 | Ga0495613_0178567 | Ga0495613_0178567_316_615 | 99 |
| 802 | 3300046690 | Ga0495624_0036445 | Ga0495624_0036445_2043_2342 | 99 |
| 803 | 3300046690 | Ga0495624_0397694 | Ga0495624_0397694_209_508 | 99 |
| 804 | 3300046809 | Ga0495600_0468870 | Ga0495600_0468870_457_756 | 99 |
| 805 | 3300047315 | Ga0495581_0044857 | Ga0495581_0044857_504_803 | 99 |
| 806 | 3300047317 | Ga0495604_0222749 | Ga0495604_0222749_869_1168 | 99 |
| 807 | 3300047317 | Ga0495604_0240503 | Ga0495604_0240503_318_617 | 99 |
| 808 | 3300047321 | Ga0495676_0057156 | Ga0495676_0057156_510_809 | 99 |
| 809 | 3300047321 | Ga0495676_0074833 | Ga0495676_0074833_1432_1731 | 99 |
| 810 | 3300047322 | Ga0495680_0011938 | Ga0495680_0011938_6798_7097 | 99 |
| 811 | 3300047322 | Ga0495680_0671790 | Ga0495680_0671790_147_446 | 99 |
| 812 | 3300047471 | Ga0495684_0003752 | Ga0495684_0003752_926_1225 | 99 |
| 813 | 3300047673 | Ga0495593_0381242 | Ga0495593_0381242_255_554 | 99 |
| 814 | 3300048088 | Ga0495602_0258546 | Ga0495602_0258546_349_648 | 99 |
| 815 | 3300048089 | Ga0495614_0573887 | Ga0495614_0573887_20_319 | 99 |
| 816 | 3300048089 | Ga0495614_0630409 | Ga0495614_0630409_121_420 | 99 |
| 817 | 3300048903 | Ga0496100_0052986 | Ga0496100_0052986_900_1208 | 99 |
| 818 | 3300048903 | Ga0496100_0074430 | Ga0496100_0074430_317_616 | 99 |
| 819 | 3300048903 | Ga0496100_0490090 | Ga0496100_0490090_14_316 | 99 |
| 820 | 3300048903 | Ga0496100_0580047 | Ga0496100_0580047_236_535 | 99 |
| 821 | 3300048904 | Ga0496101_0048534 | Ga0496101_0048534_2473_2772 | 99 |
| 822 | 3300048904 | Ga0496101_0544558 | Ga0496101_0544558_342_641 | 99 |
| 823 | 3300048904 | Ga0496101_1034991 | Ga0496101_1034991_299_598 | 99 |
| 824 | 3300048905 | Ga0496102_0063204 | Ga0496102_0063204_991_1299 | 99 |
| 825 | 3300048905 | Ga0496102_0114004 | Ga0496102_0114004_1134_1433 | 99 |
| 826 | 3300048905 | Ga0496102_0456170 | Ga0496102_0456170_525_833 | 99 |
| 827 | 3300048906 | Ga0496103_0170535 | Ga0496103_0170535_788_1090 | 99 |
| 828 | 3300048906 | Ga0496103_0302197 | Ga0496103_0302197_647_955 | 99 |
| 829 | 3300048907 | Ga0496104_0002863 | Ga0496104_0002863_14184_14483 | 99 |
| 830 | 3300048907 | Ga0496104_0057294 | Ga0496104_0057294_1724_2023 | 99 |
| 831 | 3300048907 | Ga0496104_0314253 | Ga0496104_0314253_1060_1368 | 99 |
| 832 | 3300048907 | Ga0496104_0536355 | Ga0496104_0536355_693_992 | 99 |
| 833 | 3300048908 | Ga0496105_0001941 | Ga0496105_0001941_377_676 | 99 |
| 834 | 3300048908 | Ga0496105_0025023 | Ga0496105_0025023_1870_2169 | 99 |
| 835 | 3300048908 | Ga0496105_0069297 | Ga0496105_0069297_1521_1829 | 99 |
| 836 | 3300048908 | Ga0496105_0078234 | Ga0496105_0078234_1765_2064 | 99 |
| 837 | 3300048909 | Ga0496106_0000350 | Ga0496106_0000350_31221_31523 | 99 |
| 838 | 3300048909 | Ga0496106_0011764 | Ga0496106_0011764_5551_5859 | 99 |
| 839 | 3300048910 | Ga0496107_0002689 | Ga0496107_0002689_7282_7590 | 99 |
| 840 | 3300048910 | Ga0496107_0003956 | Ga0496107_0003956_8351_8653 | 99 |
| 841 | 3300048910 | Ga0496107_0049688 | Ga0496107_0049688_939_1238 | 99 |
| 842 | 3300048911 | Ga0496108_0059812 | Ga0496108_0059812_1862_2161 | 99 |
| 843 | 3300048911 | Ga0496108_0095032 | Ga0496108_0095032_900_1208 | 99 |
| 844 | 3300048911 | Ga0496108_0491770 | Ga0496108_0491770_541_840 | 99 |
| 845 | 3300048912 | Ga0496109_0017047 | Ga0496109_0017047_707_1006 | 99 |
| 846 | 3300048912 | Ga0496109_0063339 | Ga0496109_0063339_400_708 | 99 |
| 847 | 3300048912 | Ga0496109_0206683 | Ga0496109_0206683_303_605 | 99 |
| 848 | 3300048912 | Ga0496109_0878201 | Ga0496109_0878201_381_680 | 99 |
| 849 | 3300048913 | Ga0496110_0009448 | Ga0496110_0009448_661_969 | 99 |
| 850 | 3300048913 | Ga0496110_0242658 | Ga0496110_0242658_410_709 | 99 |
| 851 | 3300048914 | Ga0496111_0004132 | Ga0496111_0004132_5475_5783 | 99 |
| 852 | 3300048914 | Ga0496111_0016841 | Ga0496111_0016841_1279_1578 | 99 |
| 853 | 3300048915 | Ga0496112_0702624 | Ga0496112_0702624_579_881 | 99 |
| 854 | 3300048915 | Ga0496112_0789762 | Ga0496112_0789762_455_763 | 99 |
| 855 | 3300048915 | Ga0496112_0830957 | Ga0496112_0830957_194_493 | 99 |
| 856 | 3300048915 | Ga0496112_1723140 | Ga0496112_1723140_210_509 | 99 |
| 857 | 3300048916 | Ga0496113_0202570 | Ga0496113_0202570_1120_1428 | 99 |
| 858 | 3300048916 | Ga0496113_0977342 | Ga0496113_0977342_295_594 | 99 |
| 859 | 3300048917 | Ga0496114_0016919 | Ga0496114_0016919_3668_3967 | 99 |
| 860 | 3300048917 | Ga0496114_0021553 | Ga0496114_0021553_777_1076 | 99 |
| 861 | 3300048917 | Ga0496114_0039336 | Ga0496114_0039336_3531_3839 | 99 |
| 862 | 3300048917 | Ga0496114_0086686 | Ga0496114_0086686_1700_1999 | 99 |
| 863 | 3300048917 | Ga0496114_0194949 | Ga0496114_0194949_234_533 | 99 |
| 864 | 3300048918 | Ga0496115_0010734 | Ga0496115_0010734_2942_3241 | 99 |
| 865 | 3300048918 | Ga0496115_0077768 | Ga0496115_0077768_1449_1748 | 99 |
| 866 | 3300048918 | Ga0496115_0104862 | Ga0496115_0104862_739_1047 | 99 |
| 867 | 3300048918 | Ga0496115_0130438 | Ga0496115_0130438_1076_1375 | 99 |
| 868 | 3300048918 | Ga0496115_0340317 | Ga0496115_0340317_408_707 | 99 |
| 869 | 3300049583 | Ga0501067_0181760 | Ga0501067_0181760_599_898 | 99 |
| 870 | 3300049585 | Ga0501069_0216522 | Ga0501069_0216522_328_627 | 99 |
| 871 | 3300053077 | Ga0495601_0666822 | Ga0495601_0666822_68_367 | 99 |
| 872 | 3300053083 | Ga0495655_0048250 | Ga0495655_0048250_507_806 | 99 |
| 873 | 3300053084 | Ga0495595_0065863 | Ga0495595_0065863_579_878 | 99 |
| 874 | 3300053085 | Ga0495619_0047162 | Ga0495619_0047162_2200_2499 | 99 |
| 875 | 3300053085 | Ga0495619_0067238 | Ga0495619_0067238_479_778 | 99 |
| 876 | 3300061719 | Ga0466962_0037141 | Ga0466962_0037141_1200_1499 | 99 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j9r-assembly1.cif.gz_C | structure of penicillin v acylase from agrobacterium tumefaciens | 0.8104 | 74 | 90 |
| 4j3b-assembly1.cif.gz_A | a naturally variable residue in the s1 subsite of m1-family aminopeptidases modulates catalytic properties and promotes functional specialization | 0.7296 | 2 | 43 |
| 5y1h-assembly1.cif.gz_A | crystal structure of plasmodium falciparum aminopeptidase n in complex with (s)-2-(3-(2,4-difluorobenzyl)ureido)-n-hydroxy-4-methylpentanamide | 0.7237 | 2 | 43 |
| 4p04-assembly1.cif.gz_B | apo form of bacterial arylsulfate sulfotransferase (asst) h436n mutant with mpo in the active site | 0.6581 | 74 | 93 |
| 5osi-assembly3.cif.gz_G | structure of retromer vps29-vps35c subunits complexed with ridl harpin loop (163-176) | 0.6555 | 74 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5j9rA00 | Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A;Penicillin V Acylase; Chain A | 0.8229 | 74 | 90 | 3.60.60.10 |
| af_F8Y416_51_178_3.80.10.10 | Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor | 0.8208 | 74 | 89 | 3.80.10.10 |
| 3ebgA01 | Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain | 0.7286 | 2 | 43 | 2.60.40.1730 |
| 1vraA00 | Alpha Beta;4-Layer Sandwich;L-amino peptidase D-ALA esterase/amidase;L-amino peptidase D-ALA esterase/amidase | 0.7089 | 74 | 92 | 3.60.70.12 |
| af_Q21182_133_330_2.110.10.10 | Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain | 0.6917 | 74 | 91 | 2.110.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A368WEF9-F1-model_v4 | deleted | 0.821 | 7 | 43 |
|
| AF-A0A538HR50-F1-model_v4 | Uncharacterized protein | 0.786 | 10 | 95 |
|
| AF-A0A7M2Z1L9-F1-model_v4 | Uncharacterized protein | 0.7848 | 3 | 95 |
|
| AF-A0A7W0SGR1-F1-model_v4 | Uncharacterized protein | 0.7817 | 2 | 78 |
|
| AF-A0A7W0PLV8-F1-model_v4 | Uncharacterized protein | 0.7802 | 1 | 95 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar