F484331
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 875 | 463 | 806 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0489775|Ga0496105_0489775_86_709 |
| Length | 207 |
| Sequence | VSQHTIEIDDSRTDAGERIDRRAFVGDLLAQTPEALVVTGLGSPTYDVFATTPRPGHFHLWGAMGASIPLGLGLALAQPDKSVVVITGDGEQLMGIGALGTVGAQLPANLTIVVLDNGHFGETGMQQSHTSLGTDLVAVAKGFNISNAFLVTDQRGHKTIADHIVARTGTTYAQVLIAADEPPRVLPPRDGVANKNSFRAELGLPTF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 5 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 6 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 7 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 8 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 9 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 10 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 11 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 14 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 15 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 16 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 17 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 18 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 19 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 20 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 21 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 22 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 23 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 24 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 25 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 26 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 27 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 28 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 29 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 30 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 31 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 32 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 33 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 34 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 35 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 36 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 37 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 38 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 39 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 40 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 41 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 42 | 2904699407 | |||
| 43 | 2906610324 | |||
| 44 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 45 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 46 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 47 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 48 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 49 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 50 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 51 | 2922425934 | |||
| 52 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 53 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 54 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 55 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 56 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 57 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 58 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 59 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 60 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 61 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 62 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 63 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 64 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 66 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 73 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 97 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 102 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 107 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 108 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 109 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 111 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 112 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 113 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 114 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 115 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 116 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 117 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 118 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 119 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 120 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 121 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 122 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 123 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 124 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 126 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 127 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 128 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 132 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 133 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 134 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 135 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 136 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 138 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 139 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 140 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 141 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 173 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 174 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 175 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 176 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 242 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 243 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 249 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 250 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 251 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 252 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 253 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 260 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 265 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 266 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 267 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 268 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 269 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 270 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 271 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 272 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 273 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 274 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 275 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 276 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 277 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 278 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 279 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 280 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 281 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 282 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 283 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 284 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 285 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 286 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 287 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 290 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 291 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 292 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 293 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 294 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 295 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 296 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 297 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 372 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 378 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 379 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 380 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 381 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 382 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 383 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 384 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 385 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 386 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 387 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 388 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 389 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 390 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 391 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 406 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 407 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 408 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 409 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 410 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 411 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 412 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 421 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 423 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 424 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 426 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 427 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 428 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 429 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 430 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 431 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 432 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 433 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 435 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 436 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 438 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 439 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 440 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 442 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 443 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 444 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 445 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 446 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 447 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 448 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 449 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 450 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 452 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 453 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 454 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 457 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 458 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 459 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 460 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 461 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 462 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 463 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.32 |
| Metatranscriptomes | 0.11 |
| Isolates | 7.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.46 |
| Nodule | 4.11 |
| Rhizoplane | 2.74 |
| Rhizosphere | 67.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_802 | 2124908027 | Bacteria | 4905 |
| 2 | JGI24744J21845_10016867 | 3300002077 | Unclassified | 1453 |
| 3 | JGI25151J46595_10015039 | 3300003187 | Bacteria | 3430 |
| 4 | JGI25404J52841_10005115 | 3300003659 | Bacteria | 2701 |
| 5 | JGI25404J52841_10006721 | 3300003659 | Bacteria | 2414 |
| 6 | JGI25404J52841_10011730 | 3300003659 | Bacteria | 1893 |
| 7 | Ga0055530_10032187 | 3300003791 | Bacteria | 1367 |
| 8 | Ga0065714_10032856 | 3300005288 | Bacteria | 716 |
| 9 | Ga0065714_10073987 | 3300005288 | Bacteria | 3097 |
| 10 | Ga0065714_10075886 | 3300005288 | Bacteria | 2853 |
| 11 | Ga0065714_10133304 | 3300005288 | Bacteria | 1230 |
| 12 | Ga0065714_10145153 | 3300005288 | Bacteria | 1143 |
| 13 | Ga0065714_10268002 | 3300005288 | Bacteria | 744 |
| 14 | Ga0065704_10266369 | 3300005289 | Bacteria | 953 |
| 15 | Ga0065707_10083763 | 3300005295 | Bacteria | 8296 |
| 16 | Ga0070676_10075749 | 3300005328 | Bacteria | 2029 |
| 17 | Ga0070676_10519996 | 3300005328 | Bacteria | 848 |
| 18 | Ga0070690_100008552 | 3300005330 | Bacteria | 5900 |
| 19 | Ga0070670_100076157 | 3300005331 | Bacteria | 2883 |
| 20 | Ga0068869_100184186 | 3300005334 | Bacteria | 1638 |
| 21 | Ga0070666_10366943 | 3300005335 | Bacteria | 1032 |
| 22 | Ga0068868_100358742 | 3300005338 | Bacteria | 1250 |
| 23 | Ga0068868_100820002 | 3300005338 | Bacteria | 841 |
| 24 | Ga0068868_100829551 | 3300005338 | Bacteria | 836 |
| 25 | Ga0070689_100357515 | 3300005340 | Bacteria | 1226 |
| 26 | Ga0070687_100243817 | 3300005343 | Bacteria | 1113 |
| 27 | Ga0070687_100317877 | 3300005343 | Bacteria | 994 |
| 28 | Ga0070661_100210586 | 3300005344 | Bacteria | 1488 |
| 29 | Ga0070692_10395283 | 3300005345 | Bacteria | 871 |
| 30 | Ga0070668_100608193 | 3300005347 | Bacteria | 957 |
| 31 | Ga0070669_100012891 | 3300005353 | Bacteria | 5937 |
| 32 | Ga0070669_100018866 | 3300005353 | Bacteria | 4930 |
| 33 | Ga0070669_100279652 | 3300005353 | Bacteria | 1337 |
| 34 | Ga0070675_100368672 | 3300005354 | Bacteria | 1276 |
| 35 | Ga0070675_101054076 | 3300005354 | Bacteria | 747 |
| 36 | Ga0070671_100075829 | 3300005355 | Bacteria | 2810 |
| 37 | Ga0070671_101363638 | 3300005355 | Bacteria | 626 |
| 38 | Ga0070674_100004356 | 3300005356 | Bacteria | 8071 |
| 39 | Ga0070673_100077132 | 3300005364 | Bacteria | 2693 |
| 40 | Ga0070673_100634843 | 3300005364 | Bacteria | 976 |
| 41 | Ga0070688_100072259 | 3300005365 | Unclassified | 2210 |
| 42 | Ga0070667_100154202 | 3300005367 | Unclassified | 2020 |
| 43 | Ga0070667_100355633 | 3300005367 | Bacteria | 1327 |
| 44 | Ga0070709_10164174 | 3300005434 | Bacteria | 1547 |
| 45 | Ga0070714_100025074 | 3300005435 | Bacteria | 4918 |
| 46 | Ga0070713_100141794 | 3300005436 | Bacteria | 2129 |
| 47 | Ga0070713_100393664 | 3300005436 | Bacteria | 1293 |
| 48 | Ga0070713_100768958 | 3300005436 | Bacteria | 922 |
| 49 | Ga0070713_101365959 | 3300005436 | Bacteria | 687 |
| 50 | Ga0070710_10539375 | 3300005437 | Bacteria | 804 |
| 51 | Ga0070711_100546739 | 3300005439 | Bacteria | 960 |
| 52 | Ga0070700_100452940 | 3300005441 | Bacteria | 977 |
| 53 | Ga0070708_100339816 | 3300005445 | Bacteria | 1415 |
| 54 | Ga0070678_100082518 | 3300005456 | Bacteria | 2441 |
| 55 | Ga0070678_100107211 | 3300005456 | Bacteria | 2178 |
| 56 | Ga0070678_100447304 | 3300005456 | Bacteria | 1131 |
| 57 | Ga0070678_100585835 | 3300005456 | Bacteria | 994 |
| 58 | Ga0070662_100366473 | 3300005457 | Bacteria | 1183 |
| 59 | Ga0068867_100042610 | 3300005459 | Viruses | 3321 |
| 60 | Ga0070685_10020415 | 3300005466 | Viruses | 3584 |
| 61 | Ga0070706_100001696 | 3300005467 | Bacteria | 22935 |
| 62 | Ga0070698_100026347 | 3300005471 | Bacteria | 6051 |
| 63 | Ga0070699_100450385 | 3300005518 | Bacteria | 1167 |
| 64 | Ga0068853_100318534 | 3300005539 | Bacteria | 1441 |
| 65 | Ga0068853_100611294 | 3300005539 | Bacteria | 1036 |
| 66 | Ga0070672_100213922 | 3300005543 | Bacteria | 1615 |
| 67 | Ga0070686_100034486 | 3300005544 | Bacteria | 3119 |
| 68 | Ga0070695_100603225 | 3300005545 | Bacteria | 862 |
| 69 | Ga0070665_100382110 | 3300005548 | Bacteria | 1416 |
| 70 | Ga0070665_101027716 | 3300005548 | Bacteria | 836 |
| 71 | Ga0068855_100014536 | 3300005563 | Bacteria | 9481 |
| 72 | Ga0068855_100223814 | 3300005563 | Bacteria | 2109 |
| 73 | Ga0068857_100111626 | 3300005577 | Bacteria | 2458 |
| 74 | Ga0068857_100324916 | 3300005577 | Bacteria | 1421 |
| 75 | Ga0068856_100184679 | 3300005614 | Bacteria | 2099 |
| 76 | Ga0070702_100195635 | 3300005615 | Bacteria | 1334 |
| 77 | Ga0068859_100468511 | 3300005617 | Bacteria | 1355 |
| 78 | Ga0068864_100111411 | 3300005618 | Bacteria | 2438 |
| 79 | Ga0068864_100127751 | 3300005618 | Bacteria | 2280 |
| 80 | Ga0068866_10293503 | 3300005718 | Unclassified | 1012 |
| 81 | Ga0068861_100082903 | 3300005719 | Unclassified | 2514 |
| 82 | Ga0068863_100088352 | 3300005841 | Bacteria | 2937 |
| 83 | Ga0068863_100162888 | 3300005841 | Bacteria | 2138 |
| 84 | Ga0068863_100789709 | 3300005841 | Bacteria | 947 |
| 85 | Ga0068863_101123489 | 3300005841 | Bacteria | 791 |
| 86 | Ga0068858_100148467 | 3300005842 | Bacteria | 2203 |
| 87 | Ga0068858_100189830 | 3300005842 | Bacteria | 1942 |
| 88 | Ga0068860_100002010 | 3300005843 | Bacteria | 21458 |
| 89 | Ga0081455_10004636 | 3300005937 | Bacteria | 15315 |
| 90 | Ga0081455_10020916 | 3300005937 | Bacteria | 6149 |
| 91 | Ga0081540_1004587 | 3300005983 | Bacteria | 10460 |
| 92 | Ga0081540_1025653 | 3300005983 | Bacteria | 3386 |
| 93 | Ga0081540_1031606 | 3300005983 | Bacteria | 2908 |
| 94 | Ga0081540_1064824 | 3300005983 | Bacteria | 1722 |
| 95 | Ga0081539_10152530 | 3300005985 | Bacteria | 1110 |
| 96 | Ga0075365_10008449 | 3300006038 | Bacteria | 5848 |
| 97 | Ga0075365_10012820 | 3300006038 | Bacteria | 4993 |
| 98 | Ga0075365_10051253 | 3300006038 | Bacteria | 2725 |
| 99 | Ga0075365_10470835 | 3300006038 | Bacteria | 887 |
| 100 | Ga0075363_100005959 | 3300006048 | Bacteria | 5495 |
| 101 | Ga0075363_100039008 | 3300006048 | Bacteria | 2499 |
| 102 | Ga0075363_100150935 | 3300006048 | Bacteria | 1312 |
| 103 | Ga0075364_10000521 | 3300006051 | Bacteria | 19552 |
| 104 | Ga0075364_10001007 | 3300006051 | Bacteria | 14921 |
| 105 | Ga0075364_10006108 | 3300006051 | Bacteria | 7055 |
| 106 | Ga0075364_10033900 | 3300006051 | Bacteria | 3290 |
| 107 | Ga0075364_10106916 | 3300006051 | Bacteria | 1864 |
| 108 | Ga0075364_10120341 | 3300006051 | Bacteria | 1757 |
| 109 | Ga0075364_10579238 | 3300006051 | Bacteria | 767 |
| 110 | Ga0075432_10000692 | 3300006058 | Bacteria | 10373 |
| 111 | Ga0075432_10018168 | 3300006058 | Bacteria | 2398 |
| 112 | Ga0075432_10054035 | 3300006058 | Bacteria | 1421 |
| 113 | Ga0075432_10055723 | 3300006058 | Bacteria | 1401 |
| 114 | Ga0075432_10118629 | 3300006058 | Bacteria | 992 |
| 115 | Ga0075432_10125886 | 3300006058 | Bacteria | 966 |
| 116 | Ga0075432_10256760 | 3300006058 | Bacteria | 711 |
| 117 | Ga0070716_100231530 | 3300006173 | Bacteria | 1247 |
| 118 | Ga0075362_10004185 | 3300006177 | Bacteria | 5149 |
| 119 | Ga0075362_10013135 | 3300006177 | Bacteria | 3307 |
| 120 | Ga0075362_10046148 | 3300006177 | Bacteria | 1937 |
| 121 | Ga0075362_10166408 | 3300006177 | Bacteria | 1063 |
| 122 | Ga0075369_10034089 | 3300006186 | Bacteria | 2160 |
| 123 | Ga0075366_10008335 | 3300006195 | Bacteria | 5757 |
| 124 | Ga0075366_10024268 | 3300006195 | Bacteria | 3537 |
| 125 | Ga0075366_10065815 | 3300006195 | Bacteria | 2156 |
| 126 | Ga0075366_10101778 | 3300006195 | Bacteria | 1724 |
| 127 | Ga0075366_10131781 | 3300006195 | Bacteria | 1509 |
| 128 | Ga0075366_10156790 | 3300006195 | Bacteria | 1379 |
| 129 | Ga0097621_100373161 | 3300006237 | Bacteria | 1273 |
| 130 | Ga0097621_100430227 | 3300006237 | Bacteria | 1186 |
| 131 | Ga0075370_10008628 | 3300006353 | Bacteria | 5253 |
| 132 | Ga0075370_10008840 | 3300006353 | Bacteria | 5201 |
| 133 | Ga0075370_10061355 | 3300006353 | Bacteria | 2142 |
| 134 | Ga0068871_100031823 | 3300006358 | Viruses | 4162 |
| 135 | Ga0075430_100004962 | 3300006846 | Bacteria | 11199 |
| 136 | Ga0075430_100322430 | 3300006846 | Bacteria | 1277 |
| 137 | Ga0075431_100237759 | 3300006847 | Bacteria | 1854 |
| 138 | Ga0075434_100067553 | 3300006871 | Bacteria | 3560 |
| 139 | Ga0075434_100885008 | 3300006871 | Bacteria | 908 |
| 140 | Ga0075429_100005817 | 3300006880 | Bacteria | 10639 |
| 141 | Ga0075436_100241275 | 3300006914 | Bacteria | 1285 |
| 142 | Ga0075436_100488983 | 3300006914 | Unclassified | 899 |
| 143 | Ga0097620_100468522 | 3300006931 | Bacteria | 1355 |
| 144 | Ga0099825_1047979 | 3300006941 | Bacteria | 994 |
| 145 | Ga0099824_1004050 | 3300006942 | Bacteria | 21204 |
| 146 | Ga0099822_1000838 | 3300006943 | Bacteria | 32461 |
| 147 | Ga0075435_100123083 | 3300007076 | Bacteria | 2166 |
| 148 | Ga0105251_10005081 | 3300009011 | Bacteria | 8716 |
| 149 | Ga0105244_10004844 | 3300009036 | Bacteria | 9127 |
| 150 | Ga0105244_10008013 | 3300009036 | Bacteria | 6645 |
| 151 | Ga0105244_10385900 | 3300009036 | Bacteria | 645 |
| 152 | Ga0105250_10009214 | 3300009092 | Bacteria | 4162 |
| 153 | Ga0105250_10011333 | 3300009092 | Bacteria | 3699 |
| 154 | Ga0105250_10090525 | 3300009092 | Bacteria | 1244 |
| 155 | Ga0105250_10144120 | 3300009092 | Bacteria | 989 |
| 156 | Ga0105250_10221277 | 3300009092 | Bacteria | 803 |
| 157 | Ga0105240_10005569 | 3300009093 | Bacteria | 18721 |
| 158 | Ga0105240_10201140 | 3300009093 | Bacteria | 2334 |
| 159 | Ga0111539_10692636 | 3300009094 | Bacteria | 1186 |
| 160 | Ga0105245_10159249 | 3300009098 | Bacteria | 2141 |
| 161 | Ga0105247_10068052 | 3300009101 | Bacteria | 2220 |
| 162 | Ga0105247_10097716 | 3300009101 | Bacteria | 1873 |
| 163 | Ga0105241_10592272 | 3300009174 | Bacteria | 1001 |
| 164 | Ga0105242_10097873 | 3300009176 | Unclassified | 2481 |
| 165 | Ga0105242_10772235 | 3300009176 | Bacteria | 948 |
| 166 | Ga0105248_10393192 | 3300009177 | Bacteria | 1561 |
| 167 | Ga0105248_10411793 | 3300009177 | Bacteria | 1522 |
| 168 | Ga0105248_10597311 | 3300009177 | Bacteria | 1245 |
| 169 | Ga0105237_10022573 | 3300009545 | Bacteria | 6455 |
| 170 | Ga0105237_10026227 | 3300009545 | Bacteria | 5956 |
| 171 | Ga0105237_10063278 | 3300009545 | Bacteria | 3697 |
| 172 | Ga0105238_10647933 | 3300009551 | Bacteria | 1066 |
| 173 | Ga0105249_10610120 | 3300009553 | Bacteria | 1146 |
| 174 | Ga0105239_10000839 | 3300010375 | Bacteria | 43658 |
| 175 | Ga0105239_10193698 | 3300010375 | Bacteria | 2276 |
| 176 | Ga0105246_10015011 | 3300011119 | Bacteria | 4880 |
| 177 | Ga0157373_10007217 | 3300013100 | Bacteria | 8287 |
| 178 | Ga0157373_10007637 | 3300013100 | Bacteria | 8031 |
| 179 | Ga0157370_10000335 | 3300013104 | Bacteria | 59202 |
| 180 | Ga0157370_10010674 | 3300013104 | Bacteria | 9662 |
| 181 | Ga0157370_10012653 | 3300013104 | Bacteria | 8740 |
| 182 | Ga0157370_10103245 | 3300013104 | Bacteria | 2669 |
| 183 | Ga0157370_10391672 | 3300013104 | Bacteria | 1279 |
| 184 | Ga0157369_10087235 | 3300013105 | Bacteria | 3332 |
| 185 | Ga0157369_10130823 | 3300013105 | Bacteria | 2660 |
| 186 | Ga0157374_10849957 | 3300013296 | Bacteria | 929 |
| 187 | Ga0157378_10019428 | 3300013297 | Bacteria | 5973 |
| 188 | Ga0163162_10103461 | 3300013306 | Bacteria | 2942 |
| 189 | Ga0163162_10374249 | 3300013306 | Bacteria | 1557 |
| 190 | Ga0163162_10458776 | 3300013306 | Bacteria | 1406 |
| 191 | Ga0163162_10778671 | 3300013306 | Bacteria | 1075 |
| 192 | Ga0157375_10080404 | 3300013308 | Unclassified | 3297 |
| 193 | Ga0157375_10443723 | 3300013308 | Bacteria | 1463 |
| 194 | Ga0163163_11220184 | 3300014325 | Bacteria | 815 |
| 195 | Ga0163163_11304906 | 3300014325 | Bacteria | 788 |
| 196 | Ga0157380_10073032 | 3300014326 | Bacteria | 2780 |
| 197 | Ga0182008_10000377 | 3300014497 | Bacteria | 34436 |
| 198 | Ga0182008_10003201 | 3300014497 | Bacteria | 10002 |
| 199 | Ga0182008_10018577 | 3300014497 | Bacteria | 3599 |
| 200 | Ga0182008_10036097 | 3300014497 | Bacteria | 2474 |
| 201 | Ga0182008_10149717 | 3300014497 | Bacteria | 1170 |
| 202 | Ga0157379_10340472 | 3300014968 | Bacteria | 1372 |
| 203 | Ga0157379_10364488 | 3300014968 | Bacteria | 1325 |
| 204 | Ga0157376_10114077 | 3300014969 | Unclassified | 2383 |
| 205 | Ga0182006_1006091 | 3300015261 | Bacteria | 5641 |
| 206 | Ga0182007_10002571 | 3300015262 | Bacteria | 8935 |
| 207 | Ga0182007_10006498 | 3300015262 | Bacteria | 5015 |
| 208 | Ga0163161_10003570 | 3300017792 | Bacteria | 10894 |
| 209 | Ga0163161_10009160 | 3300017792 | Bacteria | 6841 |
| 210 | Ga0206353_10735147 | 3300020082 | Bacteria | 1626 |
| 211 | Ga0213874_10001796 | 3300021377 | Bacteria | 4504 |
| 212 | Ga0213876_10008528 | 3300021384 | Bacteria | 5548 |
| 213 | Ga0213876_10150104 | 3300021384 | Bacteria | 1239 |
| 214 | Ga0213875_10006049 | 3300021388 | Bacteria | 6407 |
| 215 | Ga0228711_1000090 | 3300022739 | Bacteria | 71335 |
| 216 | Ga0209759_1008336 | 3300025256 | Bacteria | 3240 |
| 217 | Ga0209129_1001072 | 3300025258 | Bacteria | 16142 |
| 218 | Ga0209673_1001085 | 3300025273 | Bacteria | 30631 |
| 219 | Ga0209675_1029475 | 3300025291 | Bacteria | 1320 |
| 220 | Ga0209676_1001213 | 3300025292 | Bacteria | 27426 |
| 221 | Ga0209676_1024168 | 3300025292 | Bacteria | 1975 |
| 222 | Ga0209025_1000049 | 3300025294 | Bacteria | 333459 |
| 223 | Ga0209025_1000432 | 3300025294 | Bacteria | 82875 |
| 224 | Ga0209564_1020708 | 3300025295 | Bacteria | 2398 |
| 225 | Ga0209050_1001546 | 3300025298 | Bacteria | 24090 |
| 226 | Ga0209050_1001665 | 3300025298 | Bacteria | 22438 |
| 227 | Ga0209051_1001880 | 3300025303 | Bacteria | 16459 |
| 228 | Ga0209051_1009683 | 3300025303 | Bacteria | 4942 |
| 229 | Ga0209051_1013359 | 3300025303 | Bacteria | 3914 |
| 230 | Ga0207656_10249042 | 3300025321 | Bacteria | 870 |
| 231 | Ga0207696_1000006 | 3300025711 | Bacteria | 616498 |
| 232 | Ga0207696_1021860 | 3300025711 | Bacteria | 2042 |
| 233 | Ga0207655_1000077 | 3300025728 | Bacteria | 219418 |
| 234 | Ga0207655_1008254 | 3300025728 | Bacteria | 6633 |
| 235 | Ga0207655_1017632 | 3300025728 | Bacteria | 3840 |
| 236 | Ga0207655_1027069 | 3300025728 | Bacteria | 2740 |
| 237 | Ga0207713_1000724 | 3300025735 | Bacteria | 30902 |
| 238 | Ga0207713_1014369 | 3300025735 | Bacteria | 4119 |
| 239 | Ga0207713_1014477 | 3300025735 | Bacteria | 4096 |
| 240 | Ga0207713_1043701 | 3300025735 | Bacteria | 1849 |
| 241 | Ga0207713_1062936 | 3300025735 | Bacteria | 1404 |
| 242 | Ga0207682_10000382 | 3300025893 | Bacteria | 20446 |
| 243 | Ga0207692_10134426 | 3300025898 | Bacteria | 1400 |
| 244 | Ga0207692_10470288 | 3300025898 | Bacteria | 794 |
| 245 | Ga0207710_10048610 | 3300025900 | Bacteria | 1899 |
| 246 | Ga0207688_10134685 | 3300025901 | Bacteria | 1450 |
| 247 | Ga0207647_10057824 | 3300025904 | Bacteria | 2377 |
| 248 | Ga0207645_10004537 | 3300025907 | Bacteria | 10259 |
| 249 | Ga0207645_10353085 | 3300025907 | Bacteria | 984 |
| 250 | Ga0207643_10022889 | 3300025908 | Bacteria | 3443 |
| 251 | Ga0207684_10001749 | 3300025910 | Bacteria | 22938 |
| 252 | Ga0207654_10473237 | 3300025911 | Bacteria | 881 |
| 253 | Ga0207695_10009502 | 3300025913 | Bacteria | 12026 |
| 254 | Ga0207695_10399770 | 3300025913 | Bacteria | 1258 |
| 255 | Ga0207671_10019532 | 3300025914 | Bacteria | 5180 |
| 256 | Ga0207671_10212210 | 3300025914 | Bacteria | 1515 |
| 257 | Ga0207693_10049887 | 3300025915 | Bacteria | 3287 |
| 258 | Ga0207663_10404956 | 3300025916 | Bacteria | 1044 |
| 259 | Ga0207662_10049770 | 3300025918 | Bacteria | 2487 |
| 260 | Ga0207646_10077368 | 3300025922 | Bacteria | 2973 |
| 261 | Ga0207681_10010912 | 3300025923 | Bacteria | 5580 |
| 262 | Ga0207681_10071399 | 3300025923 | Bacteria | 2422 |
| 263 | Ga0207681_10102773 | 3300025923 | Unclassified | 2064 |
| 264 | Ga0207694_10102695 | 3300025924 | Bacteria | 2267 |
| 265 | Ga0207659_10387775 | 3300025926 | Bacteria | 1166 |
| 266 | Ga0207659_10582071 | 3300025926 | Unclassified | 953 |
| 267 | Ga0207687_10115032 | 3300025927 | Bacteria | 2003 |
| 268 | Ga0207700_10015666 | 3300025928 | Bacteria | 5010 |
| 269 | Ga0207700_10097728 | 3300025928 | Bacteria | 2334 |
| 270 | Ga0207700_10651458 | 3300025928 | Bacteria | 939 |
| 271 | Ga0207664_10141687 | 3300025929 | Bacteria | 2034 |
| 272 | Ga0207644_10063063 | 3300025931 | Bacteria | 2690 |
| 273 | Ga0207706_10336488 | 3300025933 | Bacteria | 1313 |
| 274 | Ga0207686_10193850 | 3300025934 | Unclassified | 1450 |
| 275 | Ga0207709_10072479 | 3300025935 | Bacteria | 2191 |
| 276 | Ga0207709_10080881 | 3300025935 | Bacteria | 2093 |
| 277 | Ga0207670_10221752 | 3300025936 | Bacteria | 1448 |
| 278 | Ga0207670_10362796 | 3300025936 | Bacteria | 1150 |
| 279 | Ga0207669_10002543 | 3300025937 | Bacteria | 7789 |
| 280 | Ga0207704_11017236 | 3300025938 | Bacteria | 701 |
| 281 | Ga0207691_10055076 | 3300025940 | Bacteria | 3626 |
| 282 | Ga0207691_10055931 | 3300025940 | Unclassified | 3595 |
| 283 | Ga0207711_10290821 | 3300025941 | Bacteria | 1506 |
| 284 | Ga0207711_10325150 | 3300025941 | Bacteria | 1422 |
| 285 | Ga0207689_10195432 | 3300025942 | Bacteria | 1670 |
| 286 | Ga0207651_10029123 | 3300025960 | Bacteria | 3494 |
| 287 | Ga0207651_10033973 | 3300025960 | Bacteria | 3297 |
| 288 | Ga0207651_10785371 | 3300025960 | Bacteria | 843 |
| 289 | Ga0207651_10817305 | 3300025960 | Bacteria | 827 |
| 290 | Ga0207640_10388724 | 3300025981 | Bacteria | 1133 |
| 291 | Ga0207658_10228086 | 3300025986 | Bacteria | 1571 |
| 292 | Ga0207658_10606204 | 3300025986 | Bacteria | 984 |
| 293 | Ga0207677_10543296 | 3300026023 | Bacteria | 1011 |
| 294 | Ga0207703_10416869 | 3300026035 | Bacteria | 1249 |
| 295 | Ga0207703_10736389 | 3300026035 | Bacteria | 939 |
| 296 | Ga0207639_10073041 | 3300026041 | Bacteria | 2688 |
| 297 | Ga0207639_11038541 | 3300026041 | Bacteria | 768 |
| 298 | Ga0207708_10244090 | 3300026075 | Bacteria | 1445 |
| 299 | Ga0207641_10461088 | 3300026088 | Bacteria | 1229 |
| 300 | Ga0207641_10966895 | 3300026088 | Bacteria | 847 |
| 301 | Ga0207648_10015626 | 3300026089 | Bacteria | 6975 |
| 302 | Ga0207676_10105634 | 3300026095 | Bacteria | 2345 |
| 303 | Ga0207674_10028891 | 3300026116 | Bacteria | 5845 |
| 304 | Ga0207674_10775829 | 3300026116 | Bacteria | 925 |
| 305 | Ga0207675_100976810 | 3300026118 | Bacteria | 865 |
| 306 | Ga0207683_10020747 | 3300026121 | Bacteria | 5621 |
| 307 | Ga0207683_10324636 | 3300026121 | Bacteria | 1410 |
| 308 | Ga0207683_10492906 | 3300026121 | Bacteria | 1131 |
| 309 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 310 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 311 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 312 | Ga0207428_10149883 | 3300027907 | Bacteria | 1776 |
| 313 | Ga0207428_10481730 | 3300027907 | Bacteria | 902 |
| 314 | Ga0207428_10500371 | 3300027907 | Bacteria | 883 |
| 315 | Ga0207428_10505261 | 3300027907 | Bacteria | 878 |
| 316 | Ga0268266_10061575 | 3300028379 | Bacteria | 3237 |
| 317 | Ga0268264_10000403 | 3300028381 | Bacteria | 61631 |
| 318 | Ga0268264_10000429 | 3300028381 | Bacteria | 58174 |
| 319 | Ga0268264_11288066 | 3300028381 | Bacteria | 741 |
| 320 | Ga0265316_10196533 | 3300031344 | Bacteria | 1497 |
| 321 | Ga0307408_100009897 | 3300031548 | Bacteria | 6282 |
| 322 | Ga0307408_100040524 | 3300031548 | Bacteria | 3298 |
| 323 | Ga0307408_100816641 | 3300031548 | Bacteria | 847 |
| 324 | Ga0307508_10122188 | 3300031616 | Bacteria | 2207 |
| 325 | Ga0307516_10070237 | 3300031730 | Bacteria | 3366 |
| 326 | Ga0307413_10556454 | 3300031824 | Unclassified | 931 |
| 327 | Ga0307406_10482218 | 3300031901 | Bacteria | 1002 |
| 328 | Ga0307412_10021171 | 3300031911 | Bacteria | 3968 |
| 329 | Ga0307412_10858724 | 3300031911 | Bacteria | 792 |
| 330 | Ga0307409_100207361 | 3300031995 | Bacteria | 1759 |
| 331 | Ga0307416_100704861 | 3300032002 | Bacteria | 1099 |
| 332 | Ga0307414_10018264 | 3300032004 | Bacteria | 4312 |
| 333 | Ga0307414_10738111 | 3300032004 | Bacteria | 894 |
| 334 | Ga0307411_10748053 | 3300032005 | Bacteria | 856 |
| 335 | Ga0307415_100685318 | 3300032126 | Bacteria | 923 |
| 336 | Ga0307507_10073944 | 3300033179 | Bacteria | 3060 |
| 337 | Ga0315911_1000007 | 3300033442 | Bacteria | 413725 |
| 338 | Ga0373934_0249200 | 3300035086 | Bacteria | 734 |
| 339 | Ga0373935_0401229 | 3300035692 | Bacteria | 985 |
| 340 | Ga0373927_0025122 | 3300035695 | Bacteria | 3895 |
| 341 | Ga0373947_0308827 | 3300035725 | Bacteria | 1056 |
| 342 | Ga0373937_0058954 | 3300036401 | Bacteria | 3527 |
| 343 | Ga0373937_0194573 | 3300036401 | Bacteria | 1906 |
| 344 | Ga0373925_0019721 | 3300037068 | Bacteria | 4908 |
| 345 | Ga0373925_0146078 | 3300037068 | Bacteria | 1854 |
| 346 | Ga0395899_0012525 | 3300037312 | Bacteria | 6499 |
| 347 | Ga0395899_0244942 | 3300037312 | Bacteria | 1232 |
| 348 | Ga0395900_0061125 | 3300037418 | Bacteria | 3874 |
| 349 | Ga0395900_0168333 | 3300037418 | Bacteria | 2232 |
| 350 | Ga0395900_0302761 | 3300037418 | Bacteria | 1584 |
| 351 | Ga0395898_0274127 | 3300037466 | Bacteria | 1609 |
| 352 | Ga0436364_0017649 | 3300037853 | Bacteria | 4776 |
| 353 | Ga0436364_0607526 | 3300037853 | Bacteria | 3493 |
| 354 | Ga0395901_0118581 | 3300038443 | Bacteria | 2781 |
| 355 | Ga0395901_0351714 | 3300038443 | Bacteria | 1520 |
| 356 | Ga0436365_0247948 | 3300039437 | Bacteria | 48555 |
| 357 | Ga0436365_0615596 | 3300039437 | Bacteria | 1527 |
| 358 | Ga0436365_1690415 | 3300039437 | Bacteria | 2339 |
| 359 | Ga0436365_1912359 | 3300039437 | Bacteria | 5618 |
| 360 | Ga0436360_0251041 | 3300039438 | Bacteria | 909 |
| 361 | Ga0436363_0106692 | 3300039450 | Bacteria | 15781 |
| 362 | Ga0436363_0710564 | 3300039450 | Bacteria | 2712 |
| 363 | Ga0436363_0957601 | 3300039450 | Bacteria | 1668 |
| 364 | Ga0439438_000163 | 3300041405 | Bacteria | 30548 |
| 365 | Ga0439438_000737 | 3300041405 | Bacteria | 14700 |
| 366 | Ga0439438_013856 | 3300041405 | Bacteria | 2416 |
| 367 | Ga0439447_000211 | 3300041407 | Bacteria | 20579 |
| 368 | Ga0439447_061219 | 3300041407 | Bacteria | 885 |
| 369 | Ga0439447_086358 | 3300041407 | Bacteria | 722 |
| 370 | Ga0439466_0018776 | 3300041411 | Bacteria | 2478 |
| 371 | Ga0439466_0050089 | 3300041411 | Bacteria | 1370 |
| 372 | Ga0451853_1495030 | 3300041512 | Bacteria | 13527 |
| 373 | Ga0439445_0111969 | 3300042004 | Bacteria | 779 |
| 374 | Ga0439432_023075 | 3300042006 | Bacteria | 2051 |
| 375 | Ga0439451_000757 | 3300042009 | Bacteria | 6135 |
| 376 | Ga0439451_042068 | 3300042009 | Bacteria | 917 |
| 377 | Ga0439452_001610 | 3300042010 | Bacteria | 8922 |
| 378 | Ga0439456_001175 | 3300042013 | Bacteria | 5195 |
| 379 | Ga0439456_004550 | 3300042013 | Bacteria | 2804 |
| 380 | Ga0439456_063682 | 3300042013 | Bacteria | 812 |
| 381 | Ga0450911_000117 | 3300042115 | Bacteria | 31836 |
| 382 | Ga0450911_009912 | 3300042115 | Bacteria | 1326 |
| 383 | Ga0450920_022032 | 3300042122 | Bacteria | 1233 |
| 384 | Ga0450902_009128 | 3300042137 | Bacteria | 1559 |
| 385 | Ga0450903_000724 | 3300042138 | Bacteria | 6533 |
| 386 | Ga0450903_007618 | 3300042138 | Bacteria | 1778 |
| 387 | Ga0450903_016007 | 3300042138 | Bacteria | 1178 |
| 388 | Ga0450905_006389 | 3300042142 | Bacteria | 1594 |
| 389 | Ga0450905_025767 | 3300042142 | Bacteria | 886 |
| 390 | Ga0450906_021269 | 3300042145 | Bacteria | 1160 |
| 391 | Ga0450907_000283 | 3300042146 | Bacteria | 17199 |
| 392 | Ga0450908_000101 | 3300042184 | Bacteria | 17206 |
| 393 | Ga0439434_0146557 | 3300042435 | Bacteria | 780 |
| 394 | Ga0439460_0003018 | 3300042461 | Bacteria | 4063 |
| 395 | Ga0466966_0043244 | 3300044684 | Bacteria | 2889 |
| 396 | Ga0466961_0307696 | 3300044693 | Bacteria | 967 |
| 397 | Ga0453684_0015372 | 3300044712 | Bacteria | 12117 |
| 398 | Ga0466968_0000008 | 3300044735 | Bacteria | 73540 |
| 399 | Ga0466970_0104087 | 3300044765 | Bacteria | 1547 |
| 400 | Ga0466957_0045017 | 3300044842 | Bacteria | 2675 |
| 401 | Ga0466960_0032713 | 3300044901 | Bacteria | 2411 |
| 402 | Ga0466959_0140759 | 3300045049 | Bacteria | 1705 |
| 403 | Ga0466959_0754691 | 3300045049 | Bacteria | 651 |
| 404 | Ga0451576_0302602 | 3300045051 | Bacteria | 1673 |
| 405 | Ga0466958_0048891 | 3300045836 | Bacteria | 2557 |
| 406 | Ga0466958_0356370 | 3300045836 | Bacteria | 942 |
| 407 | Ga0466967_0094486 | 3300045976 | Bacteria | 2723 |
| 408 | Ga0466967_0094767 | 3300045976 | Bacteria | 2719 |
| 409 | Ga0495617_000633 | 3300046452 | Bacteria | 17644 |
| 410 | Ga0495617_003137 | 3300046452 | Bacteria | 6293 |
| 411 | Ga0495617_033296 | 3300046452 | Bacteria | 1729 |
| 412 | Ga0495617_087949 | 3300046452 | Bacteria | 1015 |
| 413 | Ga0495627_001773 | 3300046453 | Bacteria | 11594 |
| 414 | Ga0495627_026356 | 3300046453 | Bacteria | 1875 |
| 415 | Ga0495603_0010415 | 3300046455 | Bacteria | 5631 |
| 416 | Ga0495603_0092043 | 3300046455 | Bacteria | 1772 |
| 417 | Ga0495590_0014969 | 3300046457 | Bacteria | 2824 |
| 418 | Ga0495590_0027762 | 3300046457 | Bacteria | 1985 |
| 419 | Ga0495590_0044585 | 3300046457 | Bacteria | 1546 |
| 420 | Ga0495591_000730 | 3300046458 | Bacteria | 23791 |
| 421 | Ga0495591_001059 | 3300046458 | Bacteria | 18504 |
| 422 | Ga0495629_0392073 | 3300046459 | Bacteria | 944 |
| 423 | Ga0495638_0011540 | 3300046460 | Bacteria | 6085 |
| 424 | Ga0495638_0016359 | 3300046460 | Bacteria | 4969 |
| 425 | Ga0495638_0043614 | 3300046460 | Bacteria | 2829 |
| 426 | Ga0495638_0082168 | 3300046460 | Bacteria | 1954 |
| 427 | Ga0495638_0109477 | 3300046460 | Bacteria | 1642 |
| 428 | Ga0495638_0397002 | 3300046460 | Bacteria | 716 |
| 429 | Ga0495653_0001150 | 3300046463 | Bacteria | 20361 |
| 430 | Ga0495650_0001328 | 3300046471 | Bacteria | 24822 |
| 431 | Ga0495650_0002139 | 3300046471 | Bacteria | 16815 |
| 432 | Ga0495650_0008143 | 3300046471 | Bacteria | 6169 |
| 433 | Ga0495650_0020467 | 3300046471 | Bacteria | 3225 |
| 434 | Ga0495650_0100398 | 3300046471 | Unclassified | 1087 |
| 435 | Ga0495580_0002934 | 3300046472 | Bacteria | 14643 |
| 436 | Ga0495605_0001099 | 3300046474 | Bacteria | 18029 |
| 437 | Ga0495605_0001937 | 3300046474 | Bacteria | 13167 |
| 438 | Ga0495605_0002177 | 3300046474 | Bacteria | 12245 |
| 439 | Ga0495605_0016277 | 3300046474 | Bacteria | 4027 |
| 440 | Ga0495605_0034203 | 3300046474 | Bacteria | 2574 |
| 441 | Ga0495605_0082552 | 3300046474 | Bacteria | 1501 |
| 442 | Ga0495639_0075898 | 3300046475 | Bacteria | 1559 |
| 443 | Ga0495584_0000851 | 3300046491 | Bacteria | 19724 |
| 444 | Ga0495584_0023748 | 3300046491 | Bacteria | 3108 |
| 445 | Ga0495584_0037424 | 3300046491 | Bacteria | 2452 |
| 446 | Ga0495584_0113452 | 3300046491 | Bacteria | 1371 |
| 447 | Ga0495585_0010531 | 3300046492 | Bacteria | 5500 |
| 448 | Ga0495594_0007401 | 3300046499 | Bacteria | 5648 |
| 449 | Ga0495594_0013066 | 3300046499 | Bacteria | 4330 |
| 450 | Ga0495596_0000421 | 3300046500 | Bacteria | 27052 |
| 451 | Ga0495607_0063801 | 3300046501 | Bacteria | 2082 |
| 452 | Ga0495607_0188944 | 3300046501 | Bacteria | 1027 |
| 453 | Ga0495607_0272920 | 3300046501 | Bacteria | 805 |
| 454 | Ga0495583_0000172 | 3300046506 | Bacteria | 109791 |
| 455 | Ga0495583_0011494 | 3300046506 | Bacteria | 5078 |
| 456 | Ga0495583_0015244 | 3300046506 | Bacteria | 4189 |
| 457 | Ga0495583_0052429 | 3300046506 | Bacteria | 1856 |
| 458 | Ga0495606_0001019 | 3300046507 | Bacteria | 40637 |
| 459 | Ga0495610_0009130 | 3300046512 | Bacteria | 6309 |
| 460 | Ga0495610_0113762 | 3300046512 | Bacteria | 1195 |
| 461 | Ga0495616_0000456 | 3300046513 | Bacteria | 31180 |
| 462 | Ga0495616_0006807 | 3300046513 | Bacteria | 6888 |
| 463 | Ga0495616_0092756 | 3300046513 | Bacteria | 1427 |
| 464 | Ga0495620_0000006 | 3300046515 | Bacteria | 273098 |
| 465 | Ga0495620_0001273 | 3300046515 | Bacteria | 15374 |
| 466 | Ga0495620_0004743 | 3300046515 | Bacteria | 7645 |
| 467 | Ga0495630_0020504 | 3300046517 | Bacteria | 4874 |
| 468 | Ga0495630_0603503 | 3300046517 | Bacteria | 841 |
| 469 | Ga0495631_0066030 | 3300046518 | Bacteria | 1565 |
| 470 | Ga0495631_0260185 | 3300046518 | Bacteria | 739 |
| 471 | Ga0495632_0000031 | 3300046519 | Bacteria | 166613 |
| 472 | Ga0495632_0000170 | 3300046519 | Bacteria | 66918 |
| 473 | Ga0495632_0001021 | 3300046519 | Bacteria | 24197 |
| 474 | Ga0495632_0002096 | 3300046519 | Bacteria | 15613 |
| 475 | Ga0495637_0000799 | 3300046520 | Bacteria | 20925 |
| 476 | Ga0495637_0001764 | 3300046520 | Bacteria | 12389 |
| 477 | Ga0495637_0009093 | 3300046520 | Bacteria | 4853 |
| 478 | Ga0495637_0043837 | 3300046520 | Bacteria | 1907 |
| 479 | Ga0495643_0012198 | 3300046522 | Bacteria | 5191 |
| 480 | Ga0495643_0013461 | 3300046522 | Bacteria | 4892 |
| 481 | Ga0495643_0022047 | 3300046522 | Bacteria | 3641 |
| 482 | Ga0495643_0129090 | 3300046522 | Bacteria | 1270 |
| 483 | Ga0495644_0210516 | 3300046523 | Bacteria | 750 |
| 484 | Ga0495648_0000267 | 3300046524 | Bacteria | 58885 |
| 485 | Ga0495648_0000402 | 3300046524 | Bacteria | 47633 |
| 486 | Ga0495648_0014286 | 3300046524 | Bacteria | 5821 |
| 487 | Ga0495648_0015925 | 3300046524 | Bacteria | 5434 |
| 488 | Ga0495648_0032837 | 3300046524 | Bacteria | 3399 |
| 489 | Ga0495666_0002052 | 3300046526 | Bacteria | 9969 |
| 490 | Ga0495666_0040601 | 3300046526 | Bacteria | 2255 |
| 491 | Ga0495642_0000584 | 3300046528 | Bacteria | 18271 |
| 492 | Ga0495642_0000977 | 3300046528 | Bacteria | 13311 |
| 493 | Ga0495654_0010877 | 3300046530 | Bacteria | 4943 |
| 494 | Ga0495654_0061793 | 3300046530 | Bacteria | 1797 |
| 495 | Ga0495654_0099023 | 3300046530 | Bacteria | 1344 |
| 496 | Ga0495654_0124773 | 3300046530 | Bacteria | 1161 |
| 497 | Ga0495665_0011202 | 3300046531 | Bacteria | 4856 |
| 498 | Ga0495665_0058750 | 3300046531 | Bacteria | 2030 |
| 499 | Ga0495587_0000835 | 3300046536 | Bacteria | 20361 |
| 500 | Ga0495598_0008123 | 3300046537 | Unclassified | 2434 |
| 501 | Ga0495609_0000552 | 3300046538 | Bacteria | 29569 |
| 502 | Ga0495609_0001596 | 3300046538 | Bacteria | 14815 |
| 503 | Ga0495609_0016775 | 3300046538 | Bacteria | 3410 |
| 504 | Ga0495609_0030749 | 3300046538 | Bacteria | 2444 |
| 505 | Ga0495621_0021407 | 3300046539 | Unclassified | 2131 |
| 506 | Ga0495621_0193580 | 3300046539 | Bacteria | 816 |
| 507 | Ga0495597_0004922 | 3300046542 | Bacteria | 7183 |
| 508 | Ga0495597_0021913 | 3300046542 | Bacteria | 2967 |
| 509 | Ga0495597_0078768 | 3300046542 | Bacteria | 1411 |
| 510 | Ga0495622_0013456 | 3300046557 | Bacteria | 3795 |
| 511 | Ga0495622_0315722 | 3300046557 | Bacteria | 679 |
| 512 | Ga0495633_0002829 | 3300046558 | Bacteria | 11955 |
| 513 | Ga0495633_0042079 | 3300046558 | Bacteria | 2171 |
| 514 | Ga0495633_0140577 | 3300046558 | Bacteria | 1116 |
| 515 | Ga0495656_0014112 | 3300046615 | Bacteria | 2988 |
| 516 | Ga0495656_0076937 | 3300046615 | Bacteria | 1496 |
| 517 | Ga0495668_0001425 | 3300046616 | Bacteria | 23196 |
| 518 | Ga0495634_0000347 | 3300046642 | Bacteria | 44864 |
| 519 | Ga0495611_0132362 | 3300046648 | Bacteria | 1163 |
| 520 | Ga0495625_0005230 | 3300046660 | Bacteria | 11945 |
| 521 | Ga0495625_0010607 | 3300046660 | Bacteria | 7602 |
| 522 | Ga0495625_0089038 | 3300046660 | Bacteria | 2137 |
| 523 | Ga0495625_0113577 | 3300046660 | Bacteria | 1849 |
| 524 | Ga0495625_0156972 | 3300046660 | Bacteria | 1526 |
| 525 | Ga0495635_0000402 | 3300046663 | Bacteria | 27473 |
| 526 | Ga0495635_0564407 | 3300046663 | Bacteria | 745 |
| 527 | Ga0495659_0000252 | 3300046664 | Bacteria | 22168 |
| 528 | Ga0495659_0002938 | 3300046664 | Bacteria | 5474 |
| 529 | Ga0495659_0146539 | 3300046664 | Bacteria | 945 |
| 530 | Ga0495661_0036598 | 3300046665 | Bacteria | 3071 |
| 531 | Ga0495661_0109816 | 3300046665 | Bacteria | 1538 |
| 532 | Ga0495661_0116931 | 3300046665 | Bacteria | 1478 |
| 533 | Ga0495661_0156942 | 3300046665 | Bacteria | 1224 |
| 534 | Ga0495588_0000444 | 3300046674 | Bacteria | 20968 |
| 535 | Ga0495588_0002335 | 3300046674 | Bacteria | 8133 |
| 536 | Ga0495588_0476177 | 3300046674 | Bacteria | 655 |
| 537 | Ga0495646_0000541 | 3300046680 | Bacteria | 20361 |
| 538 | Ga0495658_0577562 | 3300046683 | Bacteria | 720 |
| 539 | Ga0495669_0000022 | 3300046684 | Bacteria | 117864 |
| 540 | Ga0495669_0000576 | 3300046684 | Bacteria | 16289 |
| 541 | Ga0495669_0006562 | 3300046684 | Bacteria | 4864 |
| 542 | Ga0495669_0155276 | 3300046684 | Bacteria | 1084 |
| 543 | Ga0495624_0150196 | 3300046690 | Bacteria | 1425 |
| 544 | Ga0495624_0173755 | 3300046690 | Bacteria | 1314 |
| 545 | Ga0495670_0001231 | 3300046691 | Bacteria | 12472 |
| 546 | Ga0495670_0004594 | 3300046691 | Bacteria | 6777 |
| 547 | Ga0495670_0092196 | 3300046691 | Bacteria | 1551 |
| 548 | Ga0495670_0176837 | 3300046691 | Bacteria | 1125 |
| 549 | Ga0495671_0002464 | 3300046692 | Bacteria | 11679 |
| 550 | Ga0495671_0002792 | 3300046692 | Bacteria | 10923 |
| 551 | Ga0495649_0000106 | 3300046694 | Bacteria | 74615 |
| 552 | Ga0495649_0000811 | 3300046694 | Bacteria | 25193 |
| 553 | Ga0495649_0031264 | 3300046694 | Bacteria | 2936 |
| 554 | Ga0495589_0008767 | 3300046794 | Bacteria | 5263 |
| 555 | Ga0495589_0015375 | 3300046794 | Bacteria | 3939 |
| 556 | Ga0495589_0024430 | 3300046794 | Bacteria | 3072 |
| 557 | Ga0495660_0013968 | 3300046810 | Bacteria | 4655 |
| 558 | Ga0495660_0017097 | 3300046810 | Bacteria | 4176 |
| 559 | Ga0495660_0022090 | 3300046810 | Bacteria | 3636 |
| 560 | Ga0495660_0066028 | 3300046810 | Bacteria | 1930 |
| 561 | Ga0495660_0127284 | 3300046810 | Bacteria | 1281 |
| 562 | Ga0495660_0127579 | 3300046810 | Bacteria | 1279 |
| 563 | Ga0495660_0281446 | 3300046810 | Bacteria | 760 |
| 564 | Ga0495604_0012438 | 3300047317 | Bacteria | 6769 |
| 565 | Ga0495604_0094408 | 3300047317 | Bacteria | 2211 |
| 566 | Ga0495636_0000436 | 3300047318 | Bacteria | 15466 |
| 567 | Ga0495636_0002142 | 3300047318 | Bacteria | 7584 |
| 568 | Ga0495674_0076560 | 3300047319 | Bacteria | 2877 |
| 569 | Ga0495672_0000357 | 3300047320 | Bacteria | 58589 |
| 570 | Ga0495672_0000987 | 3300047320 | Bacteria | 29395 |
| 571 | Ga0495672_0003208 | 3300047320 | Bacteria | 14216 |
| 572 | Ga0495672_0005169 | 3300047320 | Bacteria | 10418 |
| 573 | Ga0495672_0141779 | 3300047320 | Bacteria | 1254 |
| 574 | Ga0495672_0161133 | 3300047320 | Bacteria | 1153 |
| 575 | Ga0495672_0194306 | 3300047320 | Bacteria | 1018 |
| 576 | Ga0495676_0000456 | 3300047321 | Bacteria | 33576 |
| 577 | Ga0495683_0005131 | 3300047323 | Bacteria | 7298 |
| 578 | Ga0495683_0005677 | 3300047323 | Bacteria | 6893 |
| 579 | Ga0495683_0057323 | 3300047323 | Bacteria | 1936 |
| 580 | Ga0495683_0113173 | 3300047323 | Bacteria | 1293 |
| 581 | Ga0495683_0196426 | 3300047323 | Bacteria | 912 |
| 582 | Ga0495687_000159 | 3300047443 | Bacteria | 101178 |
| 583 | Ga0495687_000343 | 3300047443 | Bacteria | 59599 |
| 584 | Ga0495687_002486 | 3300047443 | Bacteria | 14699 |
| 585 | Ga0495677_0000308 | 3300047445 | Bacteria | 21215 |
| 586 | Ga0495679_025105 | 3300047446 | Bacteria | 1997 |
| 587 | Ga0495685_054055 | 3300047447 | Bacteria | 1359 |
| 588 | Ga0495685_056544 | 3300047447 | Bacteria | 1326 |
| 589 | Ga0495673_0000142 | 3300047469 | Bacteria | 128538 |
| 590 | Ga0495673_0001971 | 3300047469 | Bacteria | 15192 |
| 591 | Ga0495673_0013732 | 3300047469 | Bacteria | 4239 |
| 592 | Ga0495673_0022217 | 3300047469 | Bacteria | 3113 |
| 593 | Ga0495681_0011182 | 3300047470 | Bacteria | 5367 |
| 594 | Ga0495681_0013602 | 3300047470 | Bacteria | 4710 |
| 595 | Ga0495681_0068702 | 3300047470 | Bacteria | 1611 |
| 596 | Ga0495681_0219752 | 3300047470 | Bacteria | 762 |
| 597 | Ga0495593_0000536 | 3300047673 | Bacteria | 21520 |
| 598 | Ga0495593_0003207 | 3300047673 | Bacteria | 9813 |
| 599 | Ga0495593_0054980 | 3300047673 | Bacteria | 2097 |
| 600 | Ga0495593_0142471 | 3300047673 | Bacteria | 1214 |
| 601 | Ga0495602_0077339 | 3300048088 | Bacteria | 2816 |
| 602 | Ga0495614_0000445 | 3300048089 | Bacteria | 16992 |
| 603 | Ga0495626_0002671 | 3300048091 | Bacteria | 12079 |
| 604 | Ga0495626_0002800 | 3300048091 | Bacteria | 11693 |
| 605 | Ga0495626_0011624 | 3300048091 | Bacteria | 4648 |
| 606 | Ga0495626_0014962 | 3300048091 | Bacteria | 3980 |
| 607 | Ga0495626_0021804 | 3300048091 | Bacteria | 3171 |
| 608 | Ga0496102_0000444 | 3300048905 | Bacteria | 47025 |
| 609 | Ga0496102_0344646 | 3300048905 | Bacteria | 1403 |
| 610 | Ga0496103_0000290 | 3300048906 | Bacteria | 47006 |
| 611 | Ga0496103_0067436 | 3300048906 | Bacteria | 2235 |
| 612 | Ga0496103_0424747 | 3300048906 | Bacteria | 853 |
| 613 | Ga0496105_0489775 | 3300048908 | Bacteria | 966 |
| 614 | Ga0496106_0001400 | 3300048909 | Bacteria | 18078 |
| 615 | Ga0496106_0040227 | 3300048909 | Bacteria | 3501 |
| 616 | Ga0496106_0095899 | 3300048909 | Bacteria | 2295 |
| 617 | Ga0496107_0390987 | 3300048910 | Bacteria | 1034 |
| 618 | Ga0496108_0349077 | 3300048911 | Bacteria | 1291 |
| 619 | Ga0496110_0048556 | 3300048913 | Bacteria | 3721 |
| 620 | Ga0496112_0368077 | 3300048915 | Bacteria | 1379 |
| 621 | Ga0496112_0613369 | 3300048915 | Bacteria | 1019 |
| 622 | Ga0496114_0015450 | 3300048917 | Bacteria | 6141 |
| 623 | Ga0496114_0076715 | 3300048917 | Bacteria | 2816 |
| 624 | Ga0496114_0269582 | 3300048917 | Bacteria | 1500 |
| 625 | Ga0496114_0271380 | 3300048917 | Bacteria | 1495 |
| 626 | Ga0496114_0478191 | 3300048917 | Bacteria | 1102 |
| 627 | Ga0496115_0018008 | 3300048918 | Bacteria | 5412 |
| 628 | Ga0496115_0646931 | 3300048918 | Bacteria | 836 |
| 629 | Ga0496116_0000231 | 3300048919 | Bacteria | 103493 |
| 630 | Ga0496116_0001738 | 3300048919 | Bacteria | 23730 |
| 631 | Ga0496116_0012086 | 3300048919 | Bacteria | 7075 |
| 632 | Ga0496116_0021642 | 3300048919 | Bacteria | 4842 |
| 633 | Ga0496117_0000428 | 3300048920 | Bacteria | 70517 |
| 634 | Ga0496117_0000460 | 3300048920 | Bacteria | 68039 |
| 635 | Ga0496117_0005335 | 3300048920 | Bacteria | 13552 |
| 636 | Ga0496117_0069886 | 3300048920 | Bacteria | 2362 |
| 637 | Ga0496117_0155803 | 3300048920 | Bacteria | 1345 |
| 638 | Ga0496117_0169612 | 3300048920 | Bacteria | 1268 |
| 639 | Ga0496118_0000106 | 3300048921 | Bacteria | 155884 |
| 640 | Ga0496118_0001373 | 3300048921 | Bacteria | 36687 |
| 641 | Ga0496118_0002522 | 3300048921 | Bacteria | 24575 |
| 642 | Ga0496118_0004391 | 3300048921 | Bacteria | 16756 |
| 643 | Ga0496118_0036942 | 3300048921 | Bacteria | 3940 |
| 644 | Ga0496118_0042526 | 3300048921 | Bacteria | 3583 |
| 645 | Ga0496118_0131345 | 3300048921 | Bacteria | 1607 |
| 646 | Ga0496118_0214010 | 3300048921 | Bacteria | 1128 |
| 647 | Ga0496119_0024932 | 3300048922 | Bacteria | 4190 |
| 648 | Ga0496119_0057100 | 3300048922 | Bacteria | 2361 |
| 649 | Ga0496119_0145051 | 3300048922 | Bacteria | 1278 |
| 650 | Ga0496121_0000233 | 3300048924 | Bacteria | 119434 |
| 651 | Ga0496121_0000602 | 3300048924 | Bacteria | 67586 |
| 652 | Ga0496121_0002550 | 3300048924 | Bacteria | 27617 |
| 653 | Ga0496121_0034085 | 3300048924 | Bacteria | 4589 |
| 654 | Ga0496121_0038513 | 3300048924 | Bacteria | 4231 |
| 655 | Ga0496121_0040873 | 3300048924 | Bacteria | 4062 |
| 656 | Ga0496121_0046322 | 3300048924 | Bacteria | 3723 |
| 657 | Ga0496121_0058950 | 3300048924 | Bacteria | 3169 |
| 658 | Ga0496121_0068058 | 3300048924 | Bacteria | 2883 |
| 659 | Ga0496121_0108695 | 3300048924 | Bacteria | 2121 |
| 660 | Ga0496121_0146496 | 3300048924 | Bacteria | 1744 |
| 661 | Ga0496121_0207410 | 3300048924 | Bacteria | 1391 |
| 662 | Ga0496121_0218056 | 3300048924 | Bacteria | 1346 |
| 663 | Ga0496121_0241898 | 3300048924 | Bacteria | 1257 |
| 664 | Ga0496121_0338216 | 3300048924 | Bacteria | 1007 |
| 665 | Ga0496121_0382764 | 3300048924 | Bacteria | 927 |
| 666 | Ga0496122_0000582 | 3300048925 | Bacteria | 74845 |
| 667 | Ga0496122_0003924 | 3300048925 | Bacteria | 19025 |
| 668 | Ga0496122_0028198 | 3300048925 | Bacteria | 4774 |
| 669 | Ga0496122_0052736 | 3300048925 | Bacteria | 3075 |
| 670 | Ga0496122_0244818 | 3300048925 | Bacteria | 1008 |
| 671 | Ga0496122_0296592 | 3300048925 | Bacteria | 874 |
| 672 | Ga0496122_0302168 | 3300048925 | Bacteria | 862 |
| 673 | Ga0496123_0000479 | 3300048926 | Bacteria | 69250 |
| 674 | Ga0496123_0001070 | 3300048926 | Bacteria | 41381 |
| 675 | Ga0496123_0151128 | 3300048926 | Bacteria | 1253 |
| 676 | Ga0496123_0184946 | 3300048926 | Bacteria | 1084 |
| 677 | Ga0496124_0000036 | 3300048927 | Bacteria | 318032 |
| 678 | Ga0496124_0002300 | 3300048927 | Bacteria | 25227 |
| 679 | Ga0496124_0007825 | 3300048927 | Bacteria | 11281 |
| 680 | Ga0496124_0041675 | 3300048927 | Bacteria | 3959 |
| 681 | Ga0496124_0053031 | 3300048927 | Bacteria | 3441 |
| 682 | Ga0496124_0087639 | 3300048927 | Bacteria | 2546 |
| 683 | Ga0496124_0096438 | 3300048927 | Bacteria | 2402 |
| 684 | Ga0496124_0178078 | 3300048927 | Bacteria | 1639 |
| 685 | Ga0496125_0000038 | 3300048928 | Bacteria | 328120 |
| 686 | Ga0496125_0015470 | 3300048928 | Bacteria | 7376 |
| 687 | Ga0496125_0033974 | 3300048928 | Bacteria | 4503 |
| 688 | Ga0496125_0043559 | 3300048928 | Bacteria | 3806 |
| 689 | Ga0496125_0053328 | 3300048928 | Bacteria | 3316 |
| 690 | Ga0496125_0060589 | 3300048928 | Bacteria | 3040 |
| 691 | Ga0496125_0212054 | 3300048928 | Bacteria | 1257 |
| 692 | Ga0496125_0274507 | 3300048928 | Bacteria | 1048 |
| 693 | Ga0496126_0001857 | 3300048929 | Bacteria | 30790 |
| 694 | Ga0496126_0019278 | 3300048929 | Bacteria | 6721 |
| 695 | Ga0496126_0029405 | 3300048929 | Bacteria | 5220 |
| 696 | Ga0496126_0031802 | 3300048929 | Bacteria | 4979 |
| 697 | Ga0496126_0048088 | 3300048929 | Bacteria | 3901 |
| 698 | Ga0496126_0085695 | 3300048929 | Bacteria | 2777 |
| 699 | Ga0496126_0104389 | 3300048929 | Bacteria | 2476 |
| 700 | Ga0496126_0555464 | 3300048929 | Bacteria | 910 |
| 701 | Ga0495678_004472 | 3300049459 | Bacteria | 8073 |
| 702 | Ga0495678_008649 | 3300049459 | Bacteria | 5116 |
| 703 | Ga0495678_014566 | 3300049459 | Bacteria | 3652 |
| 704 | Ga0495678_037128 | 3300049459 | Bacteria | 1982 |
| 705 | Ga0495678_042992 | 3300049459 | Bacteria | 1797 |
| 706 | Ga0495678_080193 | 3300049459 | Bacteria | 1173 |
| 707 | Ga0495682_0000057 | 3300049460 | Bacteria | 102695 |
| 708 | Ga0495682_0000497 | 3300049460 | Bacteria | 27198 |
| 709 | Ga0495682_0000755 | 3300049460 | Bacteria | 20873 |
| 710 | Ga0495682_0013167 | 3300049460 | Bacteria | 3153 |
| 711 | Ga0495682_0022002 | 3300049460 | Bacteria | 2387 |
| 712 | Ga0501033_0449075 | 3300049570 | Bacteria | 896 |
| 713 | Ga0501038_0383047 | 3300049574 | Bacteria | 1091 |
| 714 | Ga0501039_0229305 | 3300049575 | Bacteria | 1460 |
| 715 | Ga0501041_0186625 | 3300049577 | Bacteria | 1299 |
| 716 | Ga0501047_0172843 | 3300049581 | Bacteria | 2029 |
| 717 | Ga0501047_0332511 | 3300049581 | Bacteria | 1358 |
| 718 | Ga0501047_0747653 | 3300049581 | Bacteria | 794 |
| 719 | Ga0501072_0000980 | 3300049588 | Bacteria | 21092 |
| 720 | Ga0501076_0054908 | 3300049592 | Bacteria | 3158 |
| 721 | Ga0501081_0092147 | 3300049743 | Bacteria | 2132 |
| 722 | Ga0501083_0111255 | 3300049744 | Bacteria | 1800 |
| 723 | Ga0501083_0636818 | 3300049744 | Unclassified | 693 |
| 724 | Ga0501035_0058359 | 3300049822 | Bacteria | 3439 |
| 725 | Ga0501044_0018701 | 3300049823 | Bacteria | 7420 |
| 726 | Ga0501044_0101349 | 3300049823 | Bacteria | 2897 |
| 727 | Ga0501045_0513342 | 3300049824 | Bacteria | 890 |
| 728 | nmdc:mga03683_133221_c1 | 3300050489 | Bacteria | 1113 |
| 729 | nmdc:mga03683_306335_c1 | 3300050489 | Bacteria | 746 |
| 730 | nmdc:mga03683_64866_c1 | 3300050489 | Bacteria | 1551 |
| 731 | nmdc:mga03683_65817_c1 | 3300050489 | Bacteria | 1540 |
| 732 | nmdc:mga03n38_10883_c1 | 3300050490 | Bacteria | 3368 |
| 733 | nmdc:mga03n38_187252_c1 | 3300050490 | Bacteria | 1064 |
| 734 | nmdc:mga03n38_246124_c1 | 3300050490 | Bacteria | 943 |
| 735 | nmdc:mga03n38_30608_c1 | 3300050490 | Bacteria | 2264 |
| 736 | nmdc:mga00v17_190318_c1 | 3300050491 | Bacteria | 1325 |
| 737 | nmdc:mga00v17_230353_c1 | 3300050491 | Bacteria | 1200 |
| 738 | nmdc:mga00v17_2321_c1 | 3300050491 | Bacteria | 9740 |
| 739 | nmdc:mga00v17_36690_c2 | 3300050491 | Unclassified | 1994 |
| 740 | nmdc:mga00v17_445192_c1 | 3300050491 | Bacteria | 841 |
| 741 | nmdc:mga00v17_97197_c1 | 3300050491 | Bacteria | 1856 |
| 742 | nmdc:mga0yw44_140905_c1 | 3300050492 | Bacteria | 1567 |
| 743 | nmdc:mga0yw44_4500_c1 | 3300050492 | Bacteria | 6406 |
| 744 | nmdc:mga0k408_164479_c1 | 3300050493 | Bacteria | 1322 |
| 745 | nmdc:mga0k408_80734_c1 | 3300050493 | Bacteria | 1904 |
| 746 | nmdc:mga06z11_20687_c1 | 3300050494 | Bacteria | 3045 |
| 747 | nmdc:mga06z11_339634_c1 | 3300050494 | Bacteria | 898 |
| 748 | nmdc:mga07m45_123815_c1 | 3300050496 | Bacteria | 1494 |
| 749 | nmdc:mga07m45_43444_c1 | 3300050496 | Bacteria | 2520 |
| 750 | nmdc:mga07m45_9626_c1 | 3300050496 | Bacteria | 5022 |
| 751 | nmdc:mga05p37_305676_c1 | 3300050507 | Bacteria | 1000 |
| 752 | nmdc:mga09592_728_c1 | 3300050508 | Bacteria | 25328 |
| 753 | nmdc:mga0qj67_27874_c1 | 3300050509 | Bacteria | 4380 |
| 754 | nmdc:mga06r32_529118_c1 | 3300050510 | Bacteria | 1154 |
| 755 | nmdc:mga0n895_107513_c1 | 3300050512 | Bacteria | 2803 |
| 756 | nmdc:mga0n895_209856_c1 | 3300050512 | Bacteria | 1978 |
| 757 | nmdc:mga0n895_277879_c1 | 3300050512 | Bacteria | 1698 |
| 758 | nmdc:mga0n895_543892_c1 | 3300050512 | Bacteria | 1167 |
| 759 | nmdc:mga0rr50_481794_c1 | 3300050513 | Bacteria | 1054 |
| 760 | nmdc:mga08x19_84623_c2 | 3300050514 | Bacteria | 1097 |
| 761 | nmdc:mga0a205_751896_c1 | 3300050515 | Bacteria | 823 |
| 762 | nmdc:mga0sz30_263700_c1 | 3300050516 | Bacteria | 767 |
| 763 | Ga0500610_0000141 | 3300053079 | Bacteria | 21515 |
| 764 | Ga0500635_0085252 | 3300053080 | Bacteria | 1141 |
| 765 | Ga0500643_010084 | 3300053087 | Bacteria | 3548 |
| 766 | Ga0500643_044372 | 3300053087 | Bacteria | 1292 |
| 767 | Ga0500644_0003496 | 3300053088 | Bacteria | 3891 |
| 768 | Ga0500644_0008007 | 3300053088 | Bacteria | 2773 |
| 769 | Ga0500581_063378 | 3300053089 | Bacteria | 1868 |
| 770 | Ga0500651_0000099 | 3300053093 | Bacteria | 53568 |
| 771 | Ga0500651_0103858 | 3300053093 | Bacteria | 1740 |
| 772 | Ga0500566_0000214 | 3300053094 | Bacteria | 30715 |
| 773 | Ga0500566_0008235 | 3300053094 | Bacteria | 6170 |
| 774 | Ga0500650_0030296 | 3300053098 | Bacteria | 2453 |
| 775 | Ga0500556_0000216 | 3300053104 | Bacteria | 46888 |
| 776 | Ga0500560_003344 | 3300053107 | Bacteria | 3231 |
| 777 | Ga0500562_001385 | 3300053108 | Bacteria | 5981 |
| 778 | Ga0500569_006309 | 3300053109 | Bacteria | 2599 |
| 779 | Ga0500569_036810 | 3300053109 | Bacteria | 1411 |
| 780 | Ga0500571_000006 | 3300053110 | Bacteria | 105538 |
| 781 | Ga0500597_004806 | 3300053120 | Bacteria | 4256 |
| 782 | Ga0500608_065151 | 3300053122 | Bacteria | 1738 |
| 783 | Ga0500618_001190 | 3300053125 | Bacteria | 12512 |
| 784 | Ga0500642_0000012 | 3300053130 | Bacteria | 206424 |
| 785 | Ga0500642_0308788 | 3300053130 | Bacteria | 712 |
| 786 | Ga0500652_000403 | 3300053131 | Bacteria | 15465 |
| 787 | Ga0500655_000056 | 3300053133 | Bacteria | 30742 |
| 788 | Ga0500658_0000091 | 3300053134 | Bacteria | 41865 |
| 789 | Ga0500658_0022293 | 3300053134 | Bacteria | 2406 |
| 790 | Ga0500659_0001844 | 3300053135 | Bacteria | 13201 |
| 791 | Ga0500559_0000167 | 3300053136 | Bacteria | 51877 |
| 792 | Ga0500568_0001627 | 3300053139 | Bacteria | 14157 |
| 793 | Ga0500574_000057 | 3300053141 | Bacteria | 12891 |
| 794 | Ga0500586_000481 | 3300053145 | Bacteria | 8013 |
| 795 | Ga0500604_0005154 | 3300053151 | Bacteria | 3450 |
| 796 | Ga0500616_0000515 | 3300053153 | Bacteria | 48965 |
| 797 | Ga0500616_0049606 | 3300053153 | Bacteria | 2220 |
| 798 | Ga0500619_034805 | 3300053154 | Bacteria | 1559 |
| 799 | Ga0500622_0002295 | 3300053156 | Bacteria | 14006 |
| 800 | Ga0500627_0075634 | 3300053158 | Bacteria | 1496 |
| 801 | Ga0500634_0012052 | 3300053161 | Bacteria | 4490 |
| 802 | Ga0500636_0009790 | 3300053177 | Bacteria | 5581 |
| 803 | Ga0500636_0049435 | 3300053177 | Bacteria | 2474 |
| 804 | Ga0500645_068054 | 3300053730 | Bacteria | 1024 |
| 805 | Ga0501084_0354427 | 3300054114 | Bacteria | 1239 |
| 806 | Ga0501082_0301212 | 3300060353 | Bacteria | 1396 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048924 | Ga0496121_0382764 | Ga0496121_0382764_17_502 | 160 |
| 2 | 3300005355 | Ga0070671_101363638 | Ga0070671_1013636381 | 172 |
| 3 | 3300031824 | Ga0307413_10556454 | Ga0307413_105564541 | 173 |
| 4 | 3300032004 | Ga0307414_10018264 | Ga0307414_100182644 | 173 |
| 5 | 3300045051 | Ga0451576_0302602 | Ga0451576_0302602_364_960 | 173 |
| 6 | 3300046674 | Ga0495588_0002335 | Ga0495588_0002335_1254_1850 | 175 |
| 7 | 3300046690 | Ga0495624_0150196 | Ga0495624_0150196_604_1200 | 175 |
| 8 | 3300047321 | Ga0495676_0000456 | Ga0495676_0000456_31602_32198 | 175 |
| 9 | 3300047673 | Ga0495593_0003207 | Ga0495593_0003207_7493_8089 | 175 |
| 10 | 3300048088 | Ga0495602_0077339 | Ga0495602_0077339_551_1147 | 175 |
| 11 | 3300048089 | Ga0495614_0000445 | Ga0495614_0000445_2101_2697 | 175 |
| 12 | 3300053087 | Ga0500643_010084 | Ga0500643_010084_297_893 | 175 |
| 13 | 3300053093 | Ga0500651_0000099 | Ga0500651_0000099_10182_10778 | 175 |
| 14 | 3300053094 | Ga0500566_0008235 | Ga0500566_0008235_1829_2425 | 175 |
| 15 | 3300053107 | Ga0500560_003344 | Ga0500560_003344_1147_1743 | 175 |
| 16 | 3300053110 | Ga0500571_000006 | Ga0500571_000006_33496_34092 | 175 |
| 17 | 3300053120 | Ga0500597_004806 | Ga0500597_004806_1048_1644 | 175 |
| 18 | 3300053134 | Ga0500658_0000091 | Ga0500658_0000091_32811_33407 | 175 |
| 19 | 3300053141 | Ga0500574_000057 | Ga0500574_000057_6144_6740 | 175 |
| 20 | 3300053161 | Ga0500634_0012052 | Ga0500634_0012052_2110_2706 | 175 |
| 21 | 3300053177 | Ga0500636_0049435 | Ga0500636_0049435_1212_1808 | 175 |
| 22 | 3300048924 | Ga0496121_0000233 | Ga0496121_0000233_92417_93013 | 177 |
| 23 | 3300048929 | Ga0496126_0001857 | Ga0496126_0001857_3952_4548 | 177 |
| 24 | 3300003187 | JGI25151J46595_10015039 | JGI25151J46595_100150393 | 178 |
| 25 | 3300005518 | Ga0070699_100450385 | Ga0070699_1004503851 | 178 |
| 26 | 3300025294 | Ga0209025_1000049 | Ga0209025_1000049148 | 178 |
| 27 | 3300053079 | Ga0500610_0000141 | Ga0500610_0000141_4883_5479 | 178 |
| 28 | 3300053133 | Ga0500655_000056 | Ga0500655_000056_14837_15433 | 179 |
| 29 | 3300046471 | Ga0495650_0100398 | Ga0495650_0100398_216_812 | 182 |
| 30 | 3300006058 | Ga0075432_10018168 | Ga0075432_100181683 | 183 |
| 31 | 3300027907 | Ga0207428_10481730 | Ga0207428_104817302 | 183 |
| 32 | 3300048915 | Ga0496112_0613369 | Ga0496112_0613369_408_1001 | 183 |
| 33 | 3300048924 | Ga0496121_0146496 | Ga0496121_0146496_39_632 | 183 |
| 34 | 3300048928 | Ga0496125_0274507 | Ga0496125_0274507_309_923 | 183 |
| 35 | 3300041407 | Ga0439447_061219 | Ga0439447_061219_42_596 | 184 |
| 36 | 3300042004 | Ga0439445_0111969 | Ga0439445_0111969_30_620 | 184 |
| 37 | 3300042115 | Ga0450911_000117 | Ga0450911_000117_13006_13596 | 184 |
| 38 | 3300046452 | Ga0495617_087949 | Ga0495617_087949_35_589 | 184 |
| 39 | 3300046557 | Ga0495622_0315722 | Ga0495622_0315722_40_594 | 184 |
| 40 | 3300048920 | Ga0496117_0000428 | Ga0496117_0000428_9740_10336 | 184 |
| 41 | 3300048921 | Ga0496118_0001373 | Ga0496118_0001373_17908_18504 | 184 |
| 42 | 3300049459 | Ga0495678_014566 | Ga0495678_014566_2949_3503 | 184 |
| 43 | 3300050489 | nmdc:mga03683_306335_c1 | nmdc:mga03683_306335_c1_40_594 | 184 |
| 44 | 3300005355 | Ga0070671_100075829 | Ga0070671_1000758293 | 185 |
| 45 | 3300005985 | Ga0081539_10152530 | Ga0081539_101525302 | 185 |
| 46 | 3300009174 | Ga0105241_10592272 | Ga0105241_105922721 | 185 |
| 47 | 3300025273 | Ga0209673_1001085 | Ga0209673_100108510 | 185 |
| 48 | 3300025911 | Ga0207654_10473237 | Ga0207654_104732372 | 185 |
| 49 | 3300025931 | Ga0207644_10063063 | Ga0207644_100630633 | 185 |
| 50 | 3300046539 | Ga0495621_0193580 | Ga0495621_0193580_96_674 | 185 |
| 51 | 3300048917 | Ga0496114_0478191 | Ga0496114_0478191_320_898 | 185 |
| 52 | 3300048924 | Ga0496121_0038513 | Ga0496121_0038513_1233_1832 | 185 |
| 53 | 3300048925 | Ga0496122_0302168 | Ga0496122_0302168_145_744 | 185 |
| 54 | 3300048927 | Ga0496124_0000036 | Ga0496124_0000036_72617_73216 | 185 |
| 55 | iso_pu_bacteria | 2558860112 | 2558907290 | 185 |
| 56 | iso_pu_bacteria | 2894772417 | 2894776802 | 185 |
| 57 | 3300006051 | Ga0075364_10120341 | Ga0075364_101203412 | 186 |
| 58 | 3300006846 | Ga0075430_100004962 | Ga0075430_1000049628 | 186 |
| 59 | 3300006880 | Ga0075429_100005817 | Ga0075429_1000058173 | 186 |
| 60 | 3300013104 | Ga0157370_10000335 | Ga0157370_1000033521 | 186 |
| 61 | 3300014497 | Ga0182008_10000377 | Ga0182008_1000037715 | 186 |
| 62 | 3300045049 | Ga0466959_0754691 | Ga0466959_0754691_46_636 | 186 |
| 63 | 3300050508 | nmdc:mga09592_728_c1 | nmdc:mga09592_728_c1_22891_23487 | 186 |
| 64 | 3300050509 | nmdc:mga0qj67_27874_c1 | nmdc:mga0qj67_27874_c1_2006_2602 | 186 |
| 65 | 3300005338 | Ga0068868_100829551 | Ga0068868_1008295511 | 187 |
| 66 | 3300005436 | Ga0070713_100393664 | Ga0070713_1003936641 | 187 |
| 67 | 3300025904 | Ga0207647_10057824 | Ga0207647_100578243 | 187 |
| 68 | 3300025907 | Ga0207645_10353085 | Ga0207645_103530852 | 187 |
| 69 | 3300025915 | Ga0207693_10049887 | Ga0207693_100498874 | 187 |
| 70 | 3300036401 | Ga0373937_0194573 | Ga0373937_0194573_441_1004 | 187 |
| 71 | 3300046683 | Ga0495658_0577562 | Ga0495658_0577562_138_701 | 187 |
| 72 | 3300053153 | Ga0500616_0049606 | Ga0500616_0049606_312_905 | 187 |
| 73 | 3300009545 | Ga0105237_10022573 | Ga0105237_100225736 | 188 |
| 74 | 3300025292 | Ga0209676_1024168 | Ga0209676_10241683 | 188 |
| 75 | 3300026118 | Ga0207675_100976810 | Ga0207675_1009768102 | 188 |
| 76 | 3300048925 | Ga0496122_0000582 | Ga0496122_0000582_13656_14255 | 188 |
| 77 | 3300048926 | Ga0496123_0000479 | Ga0496123_0000479_60090_60689 | 188 |
| 78 | 3300003791 | Ga0055530_10032187 | Ga0055530_100321871 | 189 |
| 79 | 3300005539 | Ga0068853_100318534 | Ga0068853_1003185342 | 189 |
| 80 | 3300006871 | Ga0075434_100067553 | Ga0075434_1000675534 | 189 |
| 81 | 3300009093 | Ga0105240_10005569 | Ga0105240_100055696 | 189 |
| 82 | 3300009176 | Ga0105242_10772235 | Ga0105242_107722352 | 189 |
| 83 | 3300010375 | Ga0105239_10000839 | Ga0105239_100008396 | 189 |
| 84 | 3300025292 | Ga0209676_1001213 | Ga0209676_100121322 | 189 |
| 85 | 3300025298 | Ga0209050_1001546 | Ga0209050_100154616 | 189 |
| 86 | 3300025913 | Ga0207695_10009502 | Ga0207695_100095026 | 189 |
| 87 | 3300026041 | Ga0207639_11038541 | Ga0207639_110385412 | 189 |
| 88 | 3300042435 | Ga0439434_0146557 | Ga0439434_0146557_145_741 | 189 |
| 89 | 3300046524 | Ga0495648_0000402 | Ga0495648_0000402_16513_17085 | 189 |
| 90 | 3300046648 | Ga0495611_0132362 | Ga0495611_0132362_430_999 | 189 |
| 91 | 3300047469 | Ga0495673_0022217 | Ga0495673_0022217_1245_1814 | 189 |
| 92 | 3300048924 | Ga0496121_0218056 | Ga0496121_0218056_22_591 | 189 |
| 93 | 3300050512 | nmdc:mga0n895_107513_c1 | nmdc:mga0n895_107513_c1_226_801 | 189 |
| 94 | 3300006051 | Ga0075364_10006108 | Ga0075364_100061085 | 190 |
| 95 | 3300007076 | Ga0075435_100123083 | Ga0075435_1001230832 | 190 |
| 96 | 3300025898 | Ga0207692_10470288 | Ga0207692_104702882 | 190 |
| 97 | 3300032002 | Ga0307416_100704861 | Ga0307416_1007048613 | 190 |
| 98 | 3300035725 | Ga0373947_0308827 | Ga0373947_0308827_46_624 | 190 |
| 99 | 3300037068 | Ga0373925_0146078 | Ga0373925_0146078_541_1119 | 190 |
| 100 | 3300044712 | Ga0453684_0015372 | Ga0453684_0015372_7130_7717 | 190 |
| 101 | 3300046459 | Ga0495629_0392073 | Ga0495629_0392073_350_928 | 190 |
| 102 | 3300046475 | Ga0495639_0075898 | Ga0495639_0075898_734_1312 | 190 |
| 103 | 3300046501 | Ga0495607_0272920 | Ga0495607_0272920_94_666 | 190 |
| 104 | 3300046517 | Ga0495630_0603503 | Ga0495630_0603503_123_701 | 190 |
| 105 | 3300046663 | Ga0495635_0564407 | Ga0495635_0564407_20_598 | 190 |
| 106 | 3300048918 | Ga0496115_0646931 | Ga0496115_0646931_49_630 | 190 |
| 107 | 3300048919 | Ga0496116_0001738 | Ga0496116_0001738_17537_18151 | 190 |
| 108 | 3300053154 | Ga0500619_034805 | Ga0500619_034805_296_868 | 190 |
| 109 | 3300005436 | Ga0070713_101365959 | Ga0070713_1013659591 | 191 |
| 110 | 3300005439 | Ga0070711_100546739 | Ga0070711_1005467391 | 191 |
| 111 | 3300021384 | Ga0213876_10150104 | Ga0213876_101501042 | 191 |
| 112 | 3300025916 | Ga0207663_10404956 | Ga0207663_104049562 | 191 |
| 113 | 3300025928 | Ga0207700_10097728 | Ga0207700_100977283 | 191 |
| 114 | 3300039437 | Ga0436365_1690415 | Ga0436365_1690415_1378_1965 | 191 |
| 115 | 3300039450 | Ga0436363_0957601 | Ga0436363_0957601_482_1069 | 191 |
| 116 | 3300047673 | Ga0495593_0142471 | Ga0495593_0142471_74_655 | 191 |
| 117 | 3300049570 | Ga0501033_0449075 | Ga0501033_0449075_59_643 | 191 |
| 118 | 3300050490 | nmdc:mga03n38_30608_c1 | nmdc:mga03n38_30608_c1_1671_2252 | 191 |
| 119 | 3300050512 | nmdc:mga0n895_277879_c1 | nmdc:mga0n895_277879_c1_1038_1619 | 191 |
| 120 | 3300050515 | nmdc:mga0a205_751896_c1 | nmdc:mga0a205_751896_c1_166_747 | 191 |
| 121 | iso_pu_bacteria | 2643221644 | 2644244089 | 191 |
| 122 | iso_pu_bacteria | 2791355137 | 2792839136 | 191 |
| 123 | iso_pu_bacteria | 2842775625 | 2842779386 | 191 |
| 124 | iso_pu_bacteria | 2908739725 | 2908740648 | 191 |
| 125 | iso_pu_bacteria | 8004021418 | 8004021733 | 191 |
| 126 | iso_pu_bacteria | 8004021418 | 8004023809 | 191 |
| 127 | 3300002077 | JGI24744J21845_10016867 | JGI24744J21845_100168672 | 192 |
| 128 | 3300005288 | Ga0065714_10268002 | Ga0065714_102680021 | 192 |
| 129 | 3300005295 | Ga0065707_10083763 | Ga0065707_100837638 | 192 |
| 130 | 3300005328 | Ga0070676_10075749 | Ga0070676_100757492 | 192 |
| 131 | 3300005328 | Ga0070676_10519996 | Ga0070676_105199961 | 192 |
| 132 | 3300005330 | Ga0070690_100008552 | Ga0070690_1000085526 | 192 |
| 133 | 3300005331 | Ga0070670_100076157 | Ga0070670_1000761574 | 192 |
| 134 | 3300005334 | Ga0068869_100184186 | Ga0068869_1001841862 | 192 |
| 135 | 3300005335 | Ga0070666_10366943 | Ga0070666_103669431 | 192 |
| 136 | 3300005340 | Ga0070689_100357515 | Ga0070689_1003575152 | 192 |
| 137 | 3300005343 | Ga0070687_100243817 | Ga0070687_1002438171 | 192 |
| 138 | 3300005343 | Ga0070687_100317877 | Ga0070687_1003178772 | 192 |
| 139 | 3300005353 | Ga0070669_100012891 | Ga0070669_1000128916 | 192 |
| 140 | 3300005353 | Ga0070669_100018866 | Ga0070669_1000188663 | 192 |
| 141 | 3300005353 | Ga0070669_100279652 | Ga0070669_1002796522 | 192 |
| 142 | 3300005354 | Ga0070675_100368672 | Ga0070675_1003686722 | 192 |
| 143 | 3300005354 | Ga0070675_101054076 | Ga0070675_1010540761 | 192 |
| 144 | 3300005356 | Ga0070674_100004356 | Ga0070674_1000043565 | 192 |
| 145 | 3300005364 | Ga0070673_100634843 | Ga0070673_1006348432 | 192 |
| 146 | 3300005365 | Ga0070688_100072259 | Ga0070688_1000722592 | 192 |
| 147 | 3300005367 | Ga0070667_100154202 | Ga0070667_1001542022 | 192 |
| 148 | 3300005367 | Ga0070667_100355633 | Ga0070667_1003556332 | 192 |
| 149 | 3300005441 | Ga0070700_100452940 | Ga0070700_1004529402 | 192 |
| 150 | 3300005456 | Ga0070678_100082518 | Ga0070678_1000825183 | 192 |
| 151 | 3300005456 | Ga0070678_100447304 | Ga0070678_1004473042 | 192 |
| 152 | 3300005456 | Ga0070678_100585835 | Ga0070678_1005858351 | 192 |
| 153 | 3300005459 | Ga0068867_100042610 | Ga0068867_1000426104 | 192 |
| 154 | 3300005466 | Ga0070685_10020415 | Ga0070685_100204152 | 192 |
| 155 | 3300005539 | Ga0068853_100611294 | Ga0068853_1006112942 | 192 |
| 156 | 3300005544 | Ga0070686_100034486 | Ga0070686_1000344863 | 192 |
| 157 | 3300005548 | Ga0070665_100382110 | Ga0070665_1003821102 | 192 |
| 158 | 3300005563 | Ga0068855_100014536 | Ga0068855_1000145362 | 192 |
| 159 | 3300005577 | Ga0068857_100324916 | Ga0068857_1003249162 | 192 |
| 160 | 3300005615 | Ga0070702_100195635 | Ga0070702_1001956352 | 192 |
| 161 | 3300005617 | Ga0068859_100468511 | Ga0068859_1004685111 | 192 |
| 162 | 3300005618 | Ga0068864_100111411 | Ga0068864_1001114112 | 192 |
| 163 | 3300005718 | Ga0068866_10293503 | Ga0068866_102935032 | 192 |
| 164 | 3300005719 | Ga0068861_100082903 | Ga0068861_1000829033 | 192 |
| 165 | 3300005841 | Ga0068863_100088352 | Ga0068863_1000883525 | 192 |
| 166 | 3300005841 | Ga0068863_101123489 | Ga0068863_1011234891 | 192 |
| 167 | 3300005842 | Ga0068858_100189830 | Ga0068858_1001898301 | 192 |
| 168 | 3300006195 | Ga0075366_10156790 | Ga0075366_101567902 | 192 |
| 169 | 3300006237 | Ga0097621_100430227 | Ga0097621_1004302272 | 192 |
| 170 | 3300006358 | Ga0068871_100031823 | Ga0068871_1000318233 | 192 |
| 171 | 3300006931 | Ga0097620_100468522 | Ga0097620_1004685223 | 192 |
| 172 | 3300009094 | Ga0111539_10692636 | Ga0111539_106926362 | 192 |
| 173 | 3300009098 | Ga0105245_10159249 | Ga0105245_101592492 | 192 |
| 174 | 3300009101 | Ga0105247_10097716 | Ga0105247_100977162 | 192 |
| 175 | 3300009176 | Ga0105242_10097873 | Ga0105242_100978733 | 192 |
| 176 | 3300009177 | Ga0105248_10393192 | Ga0105248_103931923 | 192 |
| 177 | 3300009177 | Ga0105248_10411793 | Ga0105248_104117931 | 192 |
| 178 | 3300009177 | Ga0105248_10597311 | Ga0105248_105973112 | 192 |
| 179 | 3300013297 | Ga0157378_10019428 | Ga0157378_100194285 | 192 |
| 180 | 3300013306 | Ga0163162_10374249 | Ga0163162_103742492 | 192 |
| 181 | 3300013308 | Ga0157375_10080404 | Ga0157375_100804043 | 192 |
| 182 | 3300013308 | Ga0157375_10443723 | Ga0157375_104437233 | 192 |
| 183 | 3300014325 | Ga0163163_11220184 | Ga0163163_112201842 | 192 |
| 184 | 3300014325 | Ga0163163_11304906 | Ga0163163_113049061 | 192 |
| 185 | 3300014326 | Ga0157380_10073032 | Ga0157380_100730323 | 192 |
| 186 | 3300014968 | Ga0157379_10340472 | Ga0157379_103404722 | 192 |
| 187 | 3300014969 | Ga0157376_10114077 | Ga0157376_101140772 | 192 |
| 188 | 3300025258 | Ga0209129_1001072 | Ga0209129_10010729 | 192 |
| 189 | 3300025294 | Ga0209025_1000432 | Ga0209025_100043250 | 192 |
| 190 | 3300025303 | Ga0209051_1001880 | Ga0209051_100188010 | 192 |
| 191 | 3300025893 | Ga0207682_10000382 | Ga0207682_100003826 | 192 |
| 192 | 3300025901 | Ga0207688_10134685 | Ga0207688_101346852 | 192 |
| 193 | 3300025907 | Ga0207645_10004537 | Ga0207645_100045377 | 192 |
| 194 | 3300025908 | Ga0207643_10022889 | Ga0207643_100228893 | 192 |
| 195 | 3300025913 | Ga0207695_10399770 | Ga0207695_103997702 | 192 |
| 196 | 3300025918 | Ga0207662_10049770 | Ga0207662_100497702 | 192 |
| 197 | 3300025923 | Ga0207681_10010912 | Ga0207681_100109124 | 192 |
| 198 | 3300025923 | Ga0207681_10071399 | Ga0207681_100713993 | 192 |
| 199 | 3300025923 | Ga0207681_10102773 | Ga0207681_101027732 | 192 |
| 200 | 3300025926 | Ga0207659_10582071 | Ga0207659_105820711 | 192 |
| 201 | 3300025927 | Ga0207687_10115032 | Ga0207687_101150322 | 192 |
| 202 | 3300025934 | Ga0207686_10193850 | Ga0207686_101938502 | 192 |
| 203 | 3300025935 | Ga0207709_10080881 | Ga0207709_100808813 | 192 |
| 204 | 3300025936 | Ga0207670_10221752 | Ga0207670_102217521 | 192 |
| 205 | 3300025936 | Ga0207670_10362796 | Ga0207670_103627962 | 192 |
| 206 | 3300025937 | Ga0207669_10002543 | Ga0207669_100025436 | 192 |
| 207 | 3300025938 | Ga0207704_11017236 | Ga0207704_110172361 | 192 |
| 208 | 3300025940 | Ga0207691_10055931 | Ga0207691_100559315 | 192 |
| 209 | 3300025941 | Ga0207711_10290821 | Ga0207711_102908212 | 192 |
| 210 | 3300025941 | Ga0207711_10325150 | Ga0207711_103251502 | 192 |
| 211 | 3300025942 | Ga0207689_10195432 | Ga0207689_101954322 | 192 |
| 212 | 3300025960 | Ga0207651_10029123 | Ga0207651_100291233 | 192 |
| 213 | 3300025960 | Ga0207651_10785371 | Ga0207651_107853711 | 192 |
| 214 | 3300025981 | Ga0207640_10388724 | Ga0207640_103887242 | 192 |
| 215 | 3300025986 | Ga0207658_10228086 | Ga0207658_102280862 | 192 |
| 216 | 3300025986 | Ga0207658_10606204 | Ga0207658_106062042 | 192 |
| 217 | 3300026035 | Ga0207703_10416869 | Ga0207703_104168692 | 192 |
| 218 | 3300026075 | Ga0207708_10244090 | Ga0207708_102440902 | 192 |
| 219 | 3300026088 | Ga0207641_10966895 | Ga0207641_109668951 | 192 |
| 220 | 3300026089 | Ga0207648_10015626 | Ga0207648_100156264 | 192 |
| 221 | 3300026116 | Ga0207674_10028891 | Ga0207674_100288912 | 192 |
| 222 | 3300026121 | Ga0207683_10020747 | Ga0207683_100207475 | 192 |
| 223 | 3300026121 | Ga0207683_10324636 | Ga0207683_103246362 | 192 |
| 224 | 3300026121 | Ga0207683_10492906 | Ga0207683_104929062 | 192 |
| 225 | 3300028379 | Ga0268266_10061575 | Ga0268266_100615752 | 192 |
| 226 | 3300031548 | Ga0307408_100009897 | Ga0307408_1000098977 | 192 |
| 227 | 3300031616 | Ga0307508_10122188 | Ga0307508_101221883 | 192 |
| 228 | 3300031911 | Ga0307412_10858724 | Ga0307412_108587242 | 192 |
| 229 | 3300032126 | Ga0307415_100685318 | Ga0307415_1006853181 | 192 |
| 230 | 3300033179 | Ga0307507_10073944 | Ga0307507_100739443 | 192 |
| 231 | 3300045976 | Ga0466967_0094767 | Ga0466967_0094767_616_1212 | 192 |
| 232 | 3300046471 | Ga0495650_0008143 | Ga0495650_0008143_272_862 | 192 |
| 233 | 3300046474 | Ga0495605_0082552 | Ga0495605_0082552_788_1378 | 192 |
| 234 | 3300046537 | Ga0495598_0008123 | Ga0495598_0008123_939_1529 | 192 |
| 235 | 3300046539 | Ga0495621_0021407 | Ga0495621_0021407_1137_1727 | 192 |
| 236 | 3300046615 | Ga0495656_0076937 | Ga0495656_0076937_144_737 | 192 |
| 237 | 3300046674 | Ga0495588_0476177 | Ga0495588_0476177_27_617 | 192 |
| 238 | 3300047447 | Ga0495685_056544 | Ga0495685_056544_80_670 | 192 |
| 239 | 3300048091 | Ga0495626_0002671 | Ga0495626_0002671_930_1523 | 192 |
| 240 | 3300049588 | Ga0501072_0000980 | Ga0501072_0000980_2668_3258 | 192 |
| 241 | 3300049744 | Ga0501083_0111255 | Ga0501083_0111255_68_658 | 192 |
| 242 | 3300049744 | Ga0501083_0636818 | Ga0501083_0636818_69_659 | 192 |
| 243 | 3300049824 | Ga0501045_0513342 | Ga0501045_0513342_74_667 | 192 |
| 244 | 3300050493 | nmdc:mga0k408_164479_c1 | nmdc:mga0k408_164479_c1_51_644 | 192 |
| 245 | 3300050512 | nmdc:mga0n895_543892_c1 | nmdc:mga0n895_543892_c1_394_981 | 192 |
| 246 | 3300054114 | Ga0501084_0354427 | Ga0501084_0354427_67_657 | 192 |
| 247 | 3300060353 | Ga0501082_0301212 | Ga0501082_0301212_242_835 | 192 |
| 248 | iso_pu_bacteria | 2501025502 | 2501081030 | 192 |
| 249 | iso_pu_bacteria | 2510917013 | 2511091713 | 192 |
| 250 | iso_pu_bacteria | 2513237096 | 2513657826 | 192 |
| 251 | iso_pu_bacteria | 2513237137 | 2513861489 | 192 |
| 252 | iso_pu_bacteria | 2513237145 | 2513919824 | 192 |
| 253 | iso_pu_bacteria | 2517572143 | 2517895162 | 192 |
| 254 | iso_pu_bacteria | 2524023228 | 2524536290 | 192 |
| 255 | iso_pu_bacteria | 2643221569 | 2643860166 | 192 |
| 256 | iso_pu_bacteria | 2643221621 | 2644119994 | 192 |
| 257 | iso_pu_bacteria | 2667528175 | 2671121806 | 192 |
| 258 | iso_pu_bacteria | 2728368998 | 2728752229 | 192 |
| 259 | iso_pu_bacteria | 2738543012 | 2739243704 | 192 |
| 260 | iso_pu_bacteria | 2791355197 | 2793069117 | 192 |
| 261 | iso_pu_bacteria | 2885270888 | 2885273886 | 192 |
| 262 | iso_pu_bacteria | 2885374607 | 2885376491 | 192 |
| 263 | iso_pu_bacteria | 2903748898 | 2903750673 | 192 |
| 264 | iso_pu_bacteria | 2904541872 | 2904542158 | 192 |
| 265 | iso_pu_bacteria | 2904690495 | 2904698323 | 192 |
| 266 | iso_pu_bacteria | 2904699407 | 2904699998 | 192 |
| 267 | iso_pu_bacteria | 2906610324 | 2906611830 | 192 |
| 268 | iso_pu_bacteria | 2906635258 | 2906641048 | 192 |
| 269 | iso_pu_bacteria | 2906660503 | 2906665489 | 192 |
| 270 | iso_pu_bacteria | 2908756301 | 2908762924 | 192 |
| 271 | iso_pu_bacteria | 2922425934 | 2922427466 | 192 |
| 272 | iso_pu_bacteria | 2929160207 | 2929167443 | 192 |
| 273 | iso_pu_bacteria | 2935630451 | 2935637125 | 192 |
| 274 | iso_pu_bacteria | 2941507105 | 2941513788 | 192 |
| 275 | iso_pu_bacteria | 2941515067 | 2941521750 | 192 |
| 276 | iso_pu_bacteria | 2941523033 | 2941529680 | 192 |
| 277 | iso_pu_bacteria | 3005474847 | 3005477182 | 192 |
| 278 | iso_pu_bacteria | 8006973647 | 8006978467 | 192 |
| 279 | iso_pu_bacteria | 8019555841 | 8019560635 | 192 |
| 280 | iso_pu_bacteria | 8019565922 | 8019570720 | 192 |
| 281 | iso_pu_bacteria | 8056689827 | 8056691561 | 192 |
| 282 | 3300003659 | JGI25404J52841_10005115 | JGI25404J52841_100051152 | 193 |
| 283 | 3300003659 | JGI25404J52841_10006721 | JGI25404J52841_100067213 | 193 |
| 284 | 3300003659 | JGI25404J52841_10011730 | JGI25404J52841_100117302 | 193 |
| 285 | 3300005338 | Ga0068868_100358742 | Ga0068868_1003587421 | 193 |
| 286 | 3300005347 | Ga0070668_100608193 | Ga0070668_1006081931 | 193 |
| 287 | 3300005364 | Ga0070673_100077132 | Ga0070673_1000771322 | 193 |
| 288 | 3300005445 | Ga0070708_100339816 | Ga0070708_1003398162 | 193 |
| 289 | 3300005456 | Ga0070678_100107211 | Ga0070678_1001072112 | 193 |
| 290 | 3300005467 | Ga0070706_100001696 | Ga0070706_10000169614 | 193 |
| 291 | 3300005471 | Ga0070698_100026347 | Ga0070698_1000263474 | 193 |
| 292 | 3300005618 | Ga0068864_100127751 | Ga0068864_1001277512 | 193 |
| 293 | 3300005937 | Ga0081455_10004636 | Ga0081455_100046363 | 193 |
| 294 | 3300005937 | Ga0081455_10020916 | Ga0081455_100209165 | 193 |
| 295 | 3300005983 | Ga0081540_1004587 | Ga0081540_100458711 | 193 |
| 296 | 3300005983 | Ga0081540_1025653 | Ga0081540_10256535 | 193 |
| 297 | 3300005983 | Ga0081540_1031606 | Ga0081540_10316062 | 193 |
| 298 | 3300005983 | Ga0081540_1064824 | Ga0081540_10648242 | 193 |
| 299 | 3300006048 | Ga0075363_100039008 | Ga0075363_1000390083 | 193 |
| 300 | 3300006051 | Ga0075364_10000521 | Ga0075364_1000052113 | 193 |
| 301 | 3300006173 | Ga0070716_100231530 | Ga0070716_1002315302 | 193 |
| 302 | 3300006177 | Ga0075362_10004185 | Ga0075362_100041856 | 193 |
| 303 | 3300006195 | Ga0075366_10008335 | Ga0075366_100083354 | 193 |
| 304 | 3300006195 | Ga0075366_10024268 | Ga0075366_100242682 | 193 |
| 305 | 3300006195 | Ga0075366_10101778 | Ga0075366_101017783 | 193 |
| 306 | 3300006237 | Ga0097621_100373161 | Ga0097621_1003731612 | 193 |
| 307 | 3300006353 | Ga0075370_10008840 | Ga0075370_100088406 | 193 |
| 308 | 3300006871 | Ga0075434_100885008 | Ga0075434_1008850082 | 193 |
| 309 | 3300025910 | Ga0207684_10001749 | Ga0207684_1000174914 | 193 |
| 310 | 3300025922 | Ga0207646_10077368 | Ga0207646_100773682 | 193 |
| 311 | 3300025960 | Ga0207651_10033973 | Ga0207651_100339732 | 193 |
| 312 | 3300026023 | Ga0207677_10543296 | Ga0207677_105432962 | 193 |
| 313 | 3300026035 | Ga0207703_10736389 | Ga0207703_107363892 | 193 |
| 314 | 3300026095 | Ga0207676_10105634 | Ga0207676_101056342 | 193 |
| 315 | 3300031548 | Ga0307408_100816641 | Ga0307408_1008166412 | 193 |
| 316 | 3300031730 | Ga0307516_10070237 | Ga0307516_100702372 | 193 |
| 317 | 3300046471 | Ga0495650_0020467 | Ga0495650_0020467_1487_2083 | 193 |
| 318 | 3300048917 | Ga0496114_0271380 | Ga0496114_0271380_230_826 | 193 |
| 319 | 3300049575 | Ga0501039_0229305 | Ga0501039_0229305_272_862 | 193 |
| 320 | 3300050489 | nmdc:mga03683_64866_c1 | nmdc:mga03683_64866_c1_714_1310 | 193 |
| 321 | 3300050490 | nmdc:mga03n38_187252_c1 | nmdc:mga03n38_187252_c1_464_1054 | 193 |
| 322 | 3300050493 | nmdc:mga0k408_80734_c1 | nmdc:mga0k408_80734_c1_46_642 | 193 |
| 323 | 3300050496 | nmdc:mga07m45_9626_c1 | nmdc:mga07m45_9626_c1_2962_3558 | 193 |
| 324 | 3300050507 | nmdc:mga05p37_305676_c1 | nmdc:mga05p37_305676_c1_295_891 | 193 |
| 325 | 3300050512 | nmdc:mga0n895_209856_c1 | nmdc:mga0n895_209856_c1_1290_1877 | 193 |
| 326 | 3300050513 | nmdc:mga0rr50_481794_c1 | nmdc:mga0rr50_481794_c1_22_609 | 193 |
| 327 | 3300053080 | Ga0500635_0085252 | Ga0500635_0085252_140_736 | 193 |
| 328 | 3300053088 | Ga0500644_0003496 | Ga0500644_0003496_1610_2206 | 193 |
| 329 | 3300053108 | Ga0500562_001385 | Ga0500562_001385_345_941 | 193 |
| 330 | 3300053109 | Ga0500569_036810 | Ga0500569_036810_669_1265 | 193 |
| 331 | iso_pu_bacteria | 2643221733 | 2644729872 | 193 |
| 332 | iso_pu_bacteria | 2917699015 | 2917705674 | 193 |
| 333 | 3300005344 | Ga0070661_100210586 | Ga0070661_1002105862 | 194 |
| 334 | 3300005434 | Ga0070709_10164174 | Ga0070709_101641742 | 194 |
| 335 | 3300005435 | Ga0070714_100025074 | Ga0070714_1000250745 | 194 |
| 336 | 3300005436 | Ga0070713_100141794 | Ga0070713_1001417942 | 194 |
| 337 | 3300005436 | Ga0070713_100768958 | Ga0070713_1007689582 | 194 |
| 338 | 3300005437 | Ga0070710_10539375 | Ga0070710_105393752 | 194 |
| 339 | 3300005543 | Ga0070672_100213922 | Ga0070672_1002139223 | 194 |
| 340 | 3300005548 | Ga0070665_101027716 | Ga0070665_1010277162 | 194 |
| 341 | 3300005563 | Ga0068855_100223814 | Ga0068855_1002238143 | 194 |
| 342 | 3300005577 | Ga0068857_100111626 | Ga0068857_1001116263 | 194 |
| 343 | 3300005614 | Ga0068856_100184679 | Ga0068856_1001846793 | 194 |
| 344 | 3300006038 | Ga0075365_10012820 | Ga0075365_100128203 | 194 |
| 345 | 3300006048 | Ga0075363_100005959 | Ga0075363_1000059594 | 194 |
| 346 | 3300006051 | Ga0075364_10001007 | Ga0075364_100010073 | 194 |
| 347 | 3300006058 | Ga0075432_10054035 | Ga0075432_100540352 | 194 |
| 348 | 3300006058 | Ga0075432_10256760 | Ga0075432_102567601 | 194 |
| 349 | 3300006177 | Ga0075362_10046148 | Ga0075362_100461483 | 194 |
| 350 | 3300006186 | Ga0075369_10034089 | Ga0075369_100340892 | 194 |
| 351 | 3300006195 | Ga0075366_10065815 | Ga0075366_100658151 | 194 |
| 352 | 3300006195 | Ga0075366_10131781 | Ga0075366_101317811 | 194 |
| 353 | 3300006353 | Ga0075370_10008628 | Ga0075370_100086283 | 194 |
| 354 | 3300006914 | Ga0075436_100488983 | Ga0075436_1004889832 | 194 |
| 355 | 3300006941 | Ga0099825_1047979 | Ga0099825_10479792 | 194 |
| 356 | 3300006942 | Ga0099824_1004050 | Ga0099824_10040509 | 194 |
| 357 | 3300006943 | Ga0099822_1000838 | Ga0099822_100083819 | 194 |
| 358 | 3300009093 | Ga0105240_10201140 | Ga0105240_102011403 | 194 |
| 359 | 3300009545 | Ga0105237_10026227 | Ga0105237_100262274 | 194 |
| 360 | 3300009551 | Ga0105238_10647933 | Ga0105238_106479331 | 194 |
| 361 | 3300013104 | Ga0157370_10010674 | Ga0157370_100106743 | 194 |
| 362 | 3300013104 | Ga0157370_10103245 | Ga0157370_101032453 | 194 |
| 363 | 3300013105 | Ga0157369_10130823 | Ga0157369_101308233 | 194 |
| 364 | 3300020082 | Ga0206353_10735147 | Ga0206353_107351472 | 194 |
| 365 | 3300025291 | Ga0209675_1029475 | Ga0209675_10294752 | 194 |
| 366 | 3300025303 | Ga0209051_1013359 | Ga0209051_10133592 | 194 |
| 367 | 3300025321 | Ga0207656_10249042 | Ga0207656_102490422 | 194 |
| 368 | 3300025898 | Ga0207692_10134426 | Ga0207692_101344262 | 194 |
| 369 | 3300025914 | Ga0207671_10212210 | Ga0207671_102122102 | 194 |
| 370 | 3300025924 | Ga0207694_10102695 | Ga0207694_101026955 | 194 |
| 371 | 3300025926 | Ga0207659_10387775 | Ga0207659_103877752 | 194 |
| 372 | 3300025928 | Ga0207700_10015666 | Ga0207700_100156665 | 194 |
| 373 | 3300025928 | Ga0207700_10651458 | Ga0207700_106514581 | 194 |
| 374 | 3300025929 | Ga0207664_10141687 | Ga0207664_101416872 | 194 |
| 375 | 3300025940 | Ga0207691_10055076 | Ga0207691_100550765 | 194 |
| 376 | 3300025960 | Ga0207651_10817305 | Ga0207651_108173052 | 194 |
| 377 | 3300026041 | Ga0207639_10073041 | Ga0207639_100730412 | 194 |
| 378 | 3300026116 | Ga0207674_10775829 | Ga0207674_107758291 | 194 |
| 379 | 3300027357 | Ga0209589_1000007 | Ga0209589_1000007201 | 194 |
| 380 | 3300027361 | Ga0209489_100008 | Ga0209489_100008201 | 194 |
| 381 | 3300027363 | Ga0209700_100009 | Ga0209700_100009201 | 194 |
| 382 | 3300027907 | Ga0207428_10149883 | Ga0207428_101498833 | 194 |
| 383 | 3300033442 | Ga0315911_1000007 | Ga0315911_1000007149 | 194 |
| 384 | 3300035086 | Ga0373934_0249200 | Ga0373934_0249200_56_655 | 194 |
| 385 | 3300035692 | Ga0373935_0401229 | Ga0373935_0401229_340_939 | 194 |
| 386 | 3300036401 | Ga0373937_0058954 | Ga0373937_0058954_975_1574 | 194 |
| 387 | 3300037418 | Ga0395900_0168333 | Ga0395900_0168333_1068_1661 | 194 |
| 388 | 3300037466 | Ga0395898_0274127 | Ga0395898_0274127_227_820 | 194 |
| 389 | 3300039438 | Ga0436360_0251041 | Ga0436360_0251041_276_860 | 194 |
| 390 | 3300041512 | Ga0451853_1495030 | Ga0451853_1495030_10317_10916 | 194 |
| 391 | 3300046457 | Ga0495590_0044585 | Ga0495590_0044585_40_639 | 194 |
| 392 | 3300046558 | Ga0495633_0002829 | Ga0495633_0002829_1614_2225 | 194 |
| 393 | 3300046660 | Ga0495625_0113577 | Ga0495625_0113577_89_682 | 194 |
| 394 | 3300046810 | Ga0495660_0066028 | Ga0495660_0066028_826_1425 | 194 |
| 395 | 3300047318 | Ga0495636_0002142 | Ga0495636_0002142_4130_4735 | 194 |
| 396 | 3300048906 | Ga0496103_0424747 | Ga0496103_0424747_180_776 | 194 |
| 397 | 3300048908 | Ga0496105_0489775 | Ga0496105_0489775_86_709 | 194 |
| 398 | 3300048911 | Ga0496108_0349077 | Ga0496108_0349077_240_863 | 194 |
| 399 | 3300048917 | Ga0496114_0269582 | Ga0496114_0269582_572_1195 | 194 |
| 400 | 3300048924 | Ga0496121_0034085 | Ga0496121_0034085_1267_1860 | 194 |
| 401 | 3300048924 | Ga0496121_0040873 | Ga0496121_0040873_406_1005 | 194 |
| 402 | 3300048924 | Ga0496121_0068058 | Ga0496121_0068058_2064_2657 | 194 |
| 403 | 3300048924 | Ga0496121_0108695 | Ga0496121_0108695_485_1078 | 194 |
| 404 | 3300048929 | Ga0496126_0031802 | Ga0496126_0031802_858_1451 | 194 |
| 405 | 3300048929 | Ga0496126_0085695 | Ga0496126_0085695_2172_2765 | 194 |
| 406 | 3300049581 | Ga0501047_0172843 | Ga0501047_0172843_929_1534 | 194 |
| 407 | 3300049581 | Ga0501047_0332511 | Ga0501047_0332511_696_1292 | 194 |
| 408 | 3300049823 | Ga0501044_0101349 | Ga0501044_0101349_1505_2110 | 194 |
| 409 | 3300050489 | nmdc:mga03683_133221_c1 | nmdc:mga03683_133221_c1_249_848 | 194 |
| 410 | 3300050490 | nmdc:mga03n38_10883_c1 | nmdc:mga03n38_10883_c1_2302_2901 | 194 |
| 411 | 3300050491 | nmdc:mga00v17_97197_c1 | nmdc:mga00v17_97197_c1_950_1549 | 194 |
| 412 | 3300050492 | nmdc:mga0yw44_4500_c1 | nmdc:mga0yw44_4500_c1_755_1354 | 194 |
| 413 | 3300050496 | nmdc:mga07m45_43444_c1 | nmdc:mga07m45_43444_c1_1162_1767 | 194 |
| 414 | 3300050514 | nmdc:mga08x19_84623_c2 | nmdc:mga08x19_84623_c2_127_726 | 194 |
| 415 | 3300050516 | nmdc:mga0sz30_263700_c1 | nmdc:mga0sz30_263700_c1_69_674 | 194 |
| 416 | iso_pu_bacteria | 2511231004 | 2511253439 | 194 |
| 417 | iso_pu_bacteria | 2511231012 | 2511304909 | 194 |
| 418 | iso_pu_bacteria | 2511231015 | 2511321771 | 194 |
| 419 | iso_pu_bacteria | 2511231017 | 2511333784 | 194 |
| 420 | iso_pu_bacteria | 2511231020 | 2511348987 | 194 |
| 421 | iso_pu_bacteria | 2511231021 | 2511358901 | 194 |
| 422 | iso_pu_bacteria | 2511231022 | 2511364442 | 194 |
| 423 | iso_pu_bacteria | 2600254931 | 2600367572 | 194 |
| 424 | iso_pu_bacteria | 2602042107 | 2603857415 | 194 |
| 425 | iso_pu_bacteria | 2643221565 | 2643843375 | 194 |
| 426 | iso_pu_bacteria | 2690316117 | 2692314982 | 194 |
| 427 | iso_pu_bacteria | 2738543015 | 2739256962 | 194 |
| 428 | iso_pu_bacteria | 2808606445 | 2809215350 | 194 |
| 429 | iso_pu_bacteria | 2847417321 | 2847419960 | 194 |
| 430 | iso_pu_bacteria | 2857524615 | 2857526795 | 194 |
| 431 | iso_pu_bacteria | 2893066018 | 2893069958 | 194 |
| 432 | iso_pu_bacteria | 2913036834 | 2913040589 | 194 |
| 433 | iso_pu_bacteria | 2919073203 | 2919077694 | 194 |
| 434 | iso_pu_bacteria | 2931396565 | 2931401255 | 194 |
| 435 | iso_pu_bacteria | 2939636861 | 2939639189 | 194 |
| 436 | iso_pu_bacteria | 3007803356 | 3007806933 | 194 |
| 437 | iso_pu_bacteria | 3007855910 | 3007856538 | 194 |
| 438 | iso_pu_bacteria | 643348564 | 643604357 | 194 |
| 439 | iso_pu_bacteria | 8054503363 | 8054507194 | 194 |
| 440 | iso_pu_bacteria | 8056137416 | 8056139974 | 194 |
| 441 | 3300005345 | Ga0070692_10395283 | Ga0070692_103952831 | 195 |
| 442 | 3300005457 | Ga0070662_100366473 | Ga0070662_1003664732 | 195 |
| 443 | 3300005841 | Ga0068863_100789709 | Ga0068863_1007897092 | 195 |
| 444 | 3300005842 | Ga0068858_100148467 | Ga0068858_1001484672 | 195 |
| 445 | 3300005843 | Ga0068860_100002010 | Ga0068860_1000020105 | 195 |
| 446 | 3300006038 | Ga0075365_10008449 | Ga0075365_100084492 | 195 |
| 447 | 3300006038 | Ga0075365_10051253 | Ga0075365_100512531 | 195 |
| 448 | 3300006038 | Ga0075365_10470835 | Ga0075365_104708352 | 195 |
| 449 | 3300006048 | Ga0075363_100150935 | Ga0075363_1001509351 | 195 |
| 450 | 3300006058 | Ga0075432_10118629 | Ga0075432_101186292 | 195 |
| 451 | 3300006847 | Ga0075431_100237759 | Ga0075431_1002377592 | 195 |
| 452 | 3300009545 | Ga0105237_10063278 | Ga0105237_100632784 | 195 |
| 453 | 3300013296 | Ga0157374_10849957 | Ga0157374_108499572 | 195 |
| 454 | 3300021377 | Ga0213874_10001796 | Ga0213874_100017965 | 195 |
| 455 | 3300021384 | Ga0213876_10008528 | Ga0213876_100085284 | 195 |
| 456 | 3300021388 | Ga0213875_10006049 | Ga0213875_100060493 | 195 |
| 457 | 3300025900 | Ga0207710_10048610 | Ga0207710_100486101 | 195 |
| 458 | 3300025914 | Ga0207671_10019532 | Ga0207671_100195325 | 195 |
| 459 | 3300025933 | Ga0207706_10336488 | Ga0207706_103364882 | 195 |
| 460 | 3300026088 | Ga0207641_10461088 | Ga0207641_104610882 | 195 |
| 461 | 3300027907 | Ga0207428_10500371 | Ga0207428_105003711 | 195 |
| 462 | 3300028381 | Ga0268264_10000403 | Ga0268264_1000040354 | 195 |
| 463 | 3300028381 | Ga0268264_10000429 | Ga0268264_1000042923 | 195 |
| 464 | 3300031548 | Ga0307408_100040524 | Ga0307408_1000405243 | 195 |
| 465 | 3300032004 | Ga0307414_10738111 | Ga0307414_107381112 | 195 |
| 466 | 3300037853 | Ga0436364_0017649 | Ga0436364_0017649_1908_2507 | 195 |
| 467 | 3300037853 | Ga0436364_0607526 | Ga0436364_0607526_192_803 | 195 |
| 468 | 3300039437 | Ga0436365_0247948 | Ga0436365_0247948_8243_8842 | 195 |
| 469 | 3300039437 | Ga0436365_1912359 | Ga0436365_1912359_468_1082 | 195 |
| 470 | 3300039450 | Ga0436363_0106692 | Ga0436363_0106692_8212_8823 | 195 |
| 471 | 3300039450 | Ga0436363_0710564 | Ga0436363_0710564_1601_2215 | 195 |
| 472 | 3300044684 | Ga0466966_0043244 | Ga0466966_0043244_430_1035 | 195 |
| 473 | 3300044693 | Ga0466961_0307696 | Ga0466961_0307696_241_846 | 195 |
| 474 | 3300044765 | Ga0466970_0104087 | Ga0466970_0104087_645_1250 | 195 |
| 475 | 3300044842 | Ga0466957_0045017 | Ga0466957_0045017_739_1344 | 195 |
| 476 | 3300044901 | Ga0466960_0032713 | Ga0466960_0032713_1483_2088 | 195 |
| 477 | 3300045049 | Ga0466959_0140759 | Ga0466959_0140759_448_1053 | 195 |
| 478 | 3300045836 | Ga0466958_0048891 | Ga0466958_0048891_153_758 | 195 |
| 479 | 3300045836 | Ga0466958_0356370 | Ga0466958_0356370_211_831 | 195 |
| 480 | 3300045976 | Ga0466967_0094486 | Ga0466967_0094486_1989_2609 | 195 |
| 481 | 3300046531 | Ga0495665_0011202 | Ga0495665_0011202_2620_3234 | 195 |
| 482 | 3300046684 | Ga0495669_0000022 | Ga0495669_0000022_94493_95089 | 195 |
| 483 | 3300046684 | Ga0495669_0000576 | Ga0495669_0000576_4474_5070 | 195 |
| 484 | 3300047320 | Ga0495672_0194306 | Ga0495672_0194306_223_819 | 195 |
| 485 | 3300047673 | Ga0495593_0054980 | Ga0495593_0054980_1110_1724 | 195 |
| 486 | 3300048905 | Ga0496102_0344646 | Ga0496102_0344646_790_1386 | 195 |
| 487 | 3300048924 | Ga0496121_0338216 | Ga0496121_0338216_105_701 | 195 |
| 488 | 3300048929 | Ga0496126_0104389 | Ga0496126_0104389_1075_1671 | 195 |
| 489 | 3300049574 | Ga0501038_0383047 | Ga0501038_0383047_125_736 | 195 |
| 490 | 3300049577 | Ga0501041_0186625 | Ga0501041_0186625_314_910 | 195 |
| 491 | 3300049581 | Ga0501047_0747653 | Ga0501047_0747653_74_685 | 195 |
| 492 | 3300049592 | Ga0501076_0054908 | Ga0501076_0054908_2168_2764 | 195 |
| 493 | 3300049743 | Ga0501081_0092147 | Ga0501081_0092147_563_1159 | 195 |
| 494 | 3300049822 | Ga0501035_0058359 | Ga0501035_0058359_391_1002 | 195 |
| 495 | 3300049823 | Ga0501044_0018701 | Ga0501044_0018701_5696_6307 | 195 |
| 496 | 3300050490 | nmdc:mga03n38_246124_c1 | nmdc:mga03n38_246124_c1_333_926 | 195 |
| 497 | 3300050494 | nmdc:mga06z11_20687_c1 | nmdc:mga06z11_20687_c1_1280_1873 | 195 |
| 498 | 3300050494 | nmdc:mga06z11_339634_c1 | nmdc:mga06z11_339634_c1_270_863 | 195 |
| 499 | 3300050510 | nmdc:mga06r32_529118_c1 | nmdc:mga06r32_529118_c1_221_820 | 195 |
| 500 | 3300053125 | Ga0500618_001190 | Ga0500618_001190_17_631 | 195 |
| 501 | 3300005545 | Ga0070695_100603225 | Ga0070695_1006032252 | 196 |
| 502 | 3300005841 | Ga0068863_100162888 | Ga0068863_1001628881 | 196 |
| 503 | 3300013306 | Ga0163162_10103461 | Ga0163162_101034614 | 196 |
| 504 | 3300037312 | Ga0395899_0012525 | Ga0395899_0012525_2686_3285 | 196 |
| 505 | 3300037312 | Ga0395899_0244942 | Ga0395899_0244942_400_999 | 196 |
| 506 | 3300037418 | Ga0395900_0061125 | Ga0395900_0061125_1956_2555 | 196 |
| 507 | 3300037418 | Ga0395900_0302761 | Ga0395900_0302761_91_690 | 196 |
| 508 | 3300038443 | Ga0395901_0351714 | Ga0395901_0351714_315_914 | 196 |
| 509 | 3300050491 | nmdc:mga00v17_2321_c1 | nmdc:mga00v17_2321_c1_2672_3277 | 196 |
| 510 | 3300050491 | nmdc:mga00v17_36690_c2 | nmdc:mga00v17_36690_c2_211_816 | 196 |
| 511 | 3300005338 | Ga0068868_100820002 | Ga0068868_1008200022 | 197 |
| 512 | 3300039437 | Ga0436365_0615596 | Ga0436365_0615596_501_1100 | 197 |
| 513 | 3300046472 | Ga0495580_0002934 | Ga0495580_0002934_2551_3162 | 197 |
| 514 | 3300046499 | Ga0495594_0013066 | Ga0495594_0013066_282_893 | 197 |
| 515 | 3300046526 | Ga0495666_0002052 | Ga0495666_0002052_3823_4434 | 197 |
| 516 | 3300046531 | Ga0495665_0058750 | Ga0495665_0058750_1039_1650 | 197 |
| 517 | 3300046690 | Ga0495624_0173755 | Ga0495624_0173755_614_1225 | 197 |
| 518 | 3300047317 | Ga0495604_0012438 | Ga0495604_0012438_4452_5063 | 197 |
| 519 | 3300048915 | Ga0496112_0368077 | Ga0496112_0368077_122_733 | 197 |
| 520 | 3300048927 | Ga0496124_0041675 | Ga0496124_0041675_1370_1984 | 197 |
| 521 | 3300048928 | Ga0496125_0060589 | Ga0496125_0060589_839_1453 | 197 |
| 522 | 2124908027 | MRS2a_Contig_802 | MRS2a_00659050 | 198 |
| 523 | 3300005288 | Ga0065714_10032856 | Ga0065714_100328561 | 198 |
| 524 | 3300005288 | Ga0065714_10073987 | Ga0065714_100739872 | 198 |
| 525 | 3300005288 | Ga0065714_10075886 | Ga0065714_100758862 | 198 |
| 526 | 3300005288 | Ga0065714_10133304 | Ga0065714_101333042 | 198 |
| 527 | 3300005288 | Ga0065714_10145153 | Ga0065714_101451532 | 198 |
| 528 | 3300005289 | Ga0065704_10266369 | Ga0065704_102663692 | 198 |
| 529 | 3300006051 | Ga0075364_10033900 | Ga0075364_100339002 | 198 |
| 530 | 3300006051 | Ga0075364_10106916 | Ga0075364_101069162 | 198 |
| 531 | 3300006051 | Ga0075364_10579238 | Ga0075364_105792382 | 198 |
| 532 | 3300006058 | Ga0075432_10000692 | Ga0075432_100006923 | 198 |
| 533 | 3300006058 | Ga0075432_10055723 | Ga0075432_100557232 | 198 |
| 534 | 3300006058 | Ga0075432_10125886 | Ga0075432_101258862 | 198 |
| 535 | 3300006177 | Ga0075362_10013135 | Ga0075362_100131353 | 198 |
| 536 | 3300006177 | Ga0075362_10166408 | Ga0075362_101664082 | 198 |
| 537 | 3300006353 | Ga0075370_10061355 | Ga0075370_100613551 | 198 |
| 538 | 3300006846 | Ga0075430_100322430 | Ga0075430_1003224302 | 198 |
| 539 | 3300006914 | Ga0075436_100241275 | Ga0075436_1002412752 | 198 |
| 540 | 3300009011 | Ga0105251_10005081 | Ga0105251_100050817 | 198 |
| 541 | 3300009036 | Ga0105244_10004844 | Ga0105244_100048446 | 198 |
| 542 | 3300009036 | Ga0105244_10008013 | Ga0105244_100080132 | 198 |
| 543 | 3300009036 | Ga0105244_10385900 | Ga0105244_103859001 | 198 |
| 544 | 3300009092 | Ga0105250_10009214 | Ga0105250_100092142 | 198 |
| 545 | 3300009092 | Ga0105250_10011333 | Ga0105250_100113331 | 198 |
| 546 | 3300009092 | Ga0105250_10090525 | Ga0105250_100905252 | 198 |
| 547 | 3300009092 | Ga0105250_10144120 | Ga0105250_101441202 | 198 |
| 548 | 3300009092 | Ga0105250_10221277 | Ga0105250_102212772 | 198 |
| 549 | 3300009101 | Ga0105247_10068052 | Ga0105247_100680523 | 198 |
| 550 | 3300009553 | Ga0105249_10610120 | Ga0105249_106101202 | 198 |
| 551 | 3300010375 | Ga0105239_10193698 | Ga0105239_101936982 | 198 |
| 552 | 3300011119 | Ga0105246_10015011 | Ga0105246_100150114 | 198 |
| 553 | 3300013100 | Ga0157373_10007217 | Ga0157373_100072177 | 198 |
| 554 | 3300013100 | Ga0157373_10007637 | Ga0157373_100076376 | 198 |
| 555 | 3300013104 | Ga0157370_10012653 | Ga0157370_100126539 | 198 |
| 556 | 3300013104 | Ga0157370_10391672 | Ga0157370_103916722 | 198 |
| 557 | 3300013105 | Ga0157369_10087235 | Ga0157369_100872353 | 198 |
| 558 | 3300013306 | Ga0163162_10458776 | Ga0163162_104587762 | 198 |
| 559 | 3300013306 | Ga0163162_10778671 | Ga0163162_107786712 | 198 |
| 560 | 3300014497 | Ga0182008_10003201 | Ga0182008_1000320110 | 198 |
| 561 | 3300014497 | Ga0182008_10018577 | Ga0182008_100185774 | 198 |
| 562 | 3300014497 | Ga0182008_10036097 | Ga0182008_100360972 | 198 |
| 563 | 3300014497 | Ga0182008_10149717 | Ga0182008_101497172 | 198 |
| 564 | 3300014968 | Ga0157379_10364488 | Ga0157379_103644882 | 198 |
| 565 | 3300015261 | Ga0182006_1006091 | Ga0182006_10060914 | 198 |
| 566 | 3300015262 | Ga0182007_10002571 | Ga0182007_100025716 | 198 |
| 567 | 3300015262 | Ga0182007_10006498 | Ga0182007_100064986 | 198 |
| 568 | 3300017792 | Ga0163161_10003570 | Ga0163161_100035708 | 198 |
| 569 | 3300017792 | Ga0163161_10009160 | Ga0163161_100091604 | 198 |
| 570 | 3300022739 | Ga0228711_1000090 | Ga0228711_100009019 | 198 |
| 571 | 3300025256 | Ga0209759_1008336 | Ga0209759_10083362 | 198 |
| 572 | 3300025295 | Ga0209564_1020708 | Ga0209564_10207083 | 198 |
| 573 | 3300025298 | Ga0209050_1001665 | Ga0209050_10016655 | 198 |
| 574 | 3300025303 | Ga0209051_1009683 | Ga0209051_10096834 | 198 |
| 575 | 3300025711 | Ga0207696_1000006 | Ga0207696_1000006218 | 198 |
| 576 | 3300025711 | Ga0207696_1021860 | Ga0207696_10218603 | 198 |
| 577 | 3300025728 | Ga0207655_1000077 | Ga0207655_1000077130 | 198 |
| 578 | 3300025728 | Ga0207655_1008254 | Ga0207655_10082543 | 198 |
| 579 | 3300025728 | Ga0207655_1017632 | Ga0207655_10176324 | 198 |
| 580 | 3300025728 | Ga0207655_1027069 | Ga0207655_10270692 | 198 |
| 581 | 3300025735 | Ga0207713_1000724 | Ga0207713_100072428 | 198 |
| 582 | 3300025735 | Ga0207713_1014369 | Ga0207713_10143693 | 198 |
| 583 | 3300025735 | Ga0207713_1014477 | Ga0207713_10144773 | 198 |
| 584 | 3300025735 | Ga0207713_1043701 | Ga0207713_10437011 | 198 |
| 585 | 3300025735 | Ga0207713_1062936 | Ga0207713_10629362 | 198 |
| 586 | 3300025935 | Ga0207709_10072479 | Ga0207709_100724793 | 198 |
| 587 | 3300027907 | Ga0207428_10505261 | Ga0207428_105052611 | 198 |
| 588 | 3300028381 | Ga0268264_11288066 | Ga0268264_112880662 | 198 |
| 589 | 3300031344 | Ga0265316_10196533 | Ga0265316_101965332 | 198 |
| 590 | 3300031901 | Ga0307406_10482218 | Ga0307406_104822182 | 198 |
| 591 | 3300031911 | Ga0307412_10021171 | Ga0307412_100211712 | 198 |
| 592 | 3300031995 | Ga0307409_100207361 | Ga0307409_1002073612 | 198 |
| 593 | 3300032005 | Ga0307411_10748053 | Ga0307411_107480532 | 198 |
| 594 | 3300035695 | Ga0373927_0025122 | Ga0373927_0025122_935_1546 | 198 |
| 595 | 3300037068 | Ga0373925_0019721 | Ga0373925_0019721_3291_3902 | 198 |
| 596 | 3300038443 | Ga0395901_0118581 | Ga0395901_0118581_299_910 | 198 |
| 597 | 3300041405 | Ga0439438_000163 | Ga0439438_000163_3300_3896 | 198 |
| 598 | 3300041405 | Ga0439438_000737 | Ga0439438_000737_13599_14195 | 198 |
| 599 | 3300041405 | Ga0439438_013856 | Ga0439438_013856_38_634 | 198 |
| 600 | 3300041407 | Ga0439447_000211 | Ga0439447_000211_6842_7438 | 198 |
| 601 | 3300041407 | Ga0439447_086358 | Ga0439447_086358_83_679 | 198 |
| 602 | 3300041411 | Ga0439466_0018776 | Ga0439466_0018776_925_1521 | 198 |
| 603 | 3300041411 | Ga0439466_0050089 | Ga0439466_0050089_490_1086 | 198 |
| 604 | 3300042006 | Ga0439432_023075 | Ga0439432_023075_1281_1877 | 198 |
| 605 | 3300042009 | Ga0439451_000757 | Ga0439451_000757_2786_3382 | 198 |
| 606 | 3300042009 | Ga0439451_042068 | Ga0439451_042068_229_825 | 198 |
| 607 | 3300042010 | Ga0439452_001610 | Ga0439452_001610_2867_3463 | 198 |
| 608 | 3300042013 | Ga0439456_001175 | Ga0439456_001175_3839_4435 | 198 |
| 609 | 3300042013 | Ga0439456_004550 | Ga0439456_004550_645_1241 | 198 |
| 610 | 3300042013 | Ga0439456_063682 | Ga0439456_063682_132_728 | 198 |
| 611 | 3300042115 | Ga0450911_009912 | Ga0450911_009912_405_1001 | 198 |
| 612 | 3300042122 | Ga0450920_022032 | Ga0450920_022032_514_1110 | 198 |
| 613 | 3300042137 | Ga0450902_009128 | Ga0450902_009128_454_1050 | 198 |
| 614 | 3300042138 | Ga0450903_000724 | Ga0450903_000724_2648_3244 | 198 |
| 615 | 3300042138 | Ga0450903_007618 | Ga0450903_007618_91_687 | 198 |
| 616 | 3300042138 | Ga0450903_016007 | Ga0450903_016007_414_1010 | 198 |
| 617 | 3300042142 | Ga0450905_006389 | Ga0450905_006389_868_1464 | 198 |
| 618 | 3300042142 | Ga0450905_025767 | Ga0450905_025767_186_782 | 198 |
| 619 | 3300042145 | Ga0450906_021269 | Ga0450906_021269_400_996 | 198 |
| 620 | 3300042146 | Ga0450907_000283 | Ga0450907_000283_2895_3491 | 198 |
| 621 | 3300042184 | Ga0450908_000101 | Ga0450908_000101_3028_3624 | 198 |
| 622 | 3300042461 | Ga0439460_0003018 | Ga0439460_0003018_2932_3528 | 198 |
| 623 | 3300044735 | Ga0466968_0000008 | Ga0466968_0000008_36031_36642 | 198 |
| 624 | 3300046452 | Ga0495617_000633 | Ga0495617_000633_2828_3424 | 198 |
| 625 | 3300046452 | Ga0495617_003137 | Ga0495617_003137_487_1083 | 198 |
| 626 | 3300046452 | Ga0495617_033296 | Ga0495617_033296_251_847 | 198 |
| 627 | 3300046453 | Ga0495627_001773 | Ga0495627_001773_3120_3716 | 198 |
| 628 | 3300046453 | Ga0495627_026356 | Ga0495627_026356_171_767 | 198 |
| 629 | 3300046455 | Ga0495603_0010415 | Ga0495603_0010415_228_824 | 198 |
| 630 | 3300046455 | Ga0495603_0092043 | Ga0495603_0092043_210_806 | 198 |
| 631 | 3300046457 | Ga0495590_0014969 | Ga0495590_0014969_1969_2565 | 198 |
| 632 | 3300046457 | Ga0495590_0027762 | Ga0495590_0027762_966_1562 | 198 |
| 633 | 3300046458 | Ga0495591_000730 | Ga0495591_000730_19169_19765 | 198 |
| 634 | 3300046458 | Ga0495591_001059 | Ga0495591_001059_8319_8915 | 198 |
| 635 | 3300046460 | Ga0495638_0011540 | Ga0495638_0011540_44_640 | 198 |
| 636 | 3300046460 | Ga0495638_0016359 | Ga0495638_0016359_3280_3876 | 198 |
| 637 | 3300046460 | Ga0495638_0043614 | Ga0495638_0043614_1743_2339 | 198 |
| 638 | 3300046460 | Ga0495638_0082168 | Ga0495638_0082168_104_700 | 198 |
| 639 | 3300046460 | Ga0495638_0109477 | Ga0495638_0109477_373_969 | 198 |
| 640 | 3300046460 | Ga0495638_0397002 | Ga0495638_0397002_30_626 | 198 |
| 641 | 3300046463 | Ga0495653_0001150 | Ga0495653_0001150_4549_5145 | 198 |
| 642 | 3300046471 | Ga0495650_0001328 | Ga0495650_0001328_23726_24322 | 198 |
| 643 | 3300046471 | Ga0495650_0002139 | Ga0495650_0002139_2980_3576 | 198 |
| 644 | 3300046474 | Ga0495605_0001099 | Ga0495605_0001099_16584_17180 | 198 |
| 645 | 3300046474 | Ga0495605_0001937 | Ga0495605_0001937_11994_12590 | 198 |
| 646 | 3300046474 | Ga0495605_0002177 | Ga0495605_0002177_11281_11877 | 198 |
| 647 | 3300046474 | Ga0495605_0016277 | Ga0495605_0016277_43_639 | 198 |
| 648 | 3300046474 | Ga0495605_0034203 | Ga0495605_0034203_458_1054 | 198 |
| 649 | 3300046491 | Ga0495584_0000851 | Ga0495584_0000851_3344_3940 | 198 |
| 650 | 3300046491 | Ga0495584_0023748 | Ga0495584_0023748_205_801 | 198 |
| 651 | 3300046491 | Ga0495584_0037424 | Ga0495584_0037424_396_992 | 198 |
| 652 | 3300046491 | Ga0495584_0113452 | Ga0495584_0113452_606_1202 | 198 |
| 653 | 3300046492 | Ga0495585_0010531 | Ga0495585_0010531_631_1227 | 198 |
| 654 | 3300046499 | Ga0495594_0007401 | Ga0495594_0007401_4958_5554 | 198 |
| 655 | 3300046500 | Ga0495596_0000421 | Ga0495596_0000421_6597_7193 | 198 |
| 656 | 3300046501 | Ga0495607_0063801 | Ga0495607_0063801_554_1150 | 198 |
| 657 | 3300046501 | Ga0495607_0188944 | Ga0495607_0188944_259_855 | 198 |
| 658 | 3300046506 | Ga0495583_0000172 | Ga0495583_0000172_3116_3712 | 198 |
| 659 | 3300046506 | Ga0495583_0011494 | Ga0495583_0011494_2782_3378 | 198 |
| 660 | 3300046506 | Ga0495583_0015244 | Ga0495583_0015244_3064_3660 | 198 |
| 661 | 3300046506 | Ga0495583_0052429 | Ga0495583_0052429_1056_1652 | 198 |
| 662 | 3300046507 | Ga0495606_0001019 | Ga0495606_0001019_36039_36635 | 198 |
| 663 | 3300046512 | Ga0495610_0009130 | Ga0495610_0009130_428_1024 | 198 |
| 664 | 3300046512 | Ga0495610_0113762 | Ga0495610_0113762_284_880 | 198 |
| 665 | 3300046513 | Ga0495616_0000456 | Ga0495616_0000456_25102_25698 | 198 |
| 666 | 3300046513 | Ga0495616_0006807 | Ga0495616_0006807_2500_3096 | 198 |
| 667 | 3300046513 | Ga0495616_0092756 | Ga0495616_0092756_789_1385 | 198 |
| 668 | 3300046515 | Ga0495620_0000006 | Ga0495620_0000006_201096_201692 | 198 |
| 669 | 3300046515 | Ga0495620_0001273 | Ga0495620_0001273_2833_3429 | 198 |
| 670 | 3300046515 | Ga0495620_0004743 | Ga0495620_0004743_6590_7186 | 198 |
| 671 | 3300046517 | Ga0495630_0020504 | Ga0495630_0020504_3853_4449 | 198 |
| 672 | 3300046518 | Ga0495631_0066030 | Ga0495631_0066030_494_1090 | 198 |
| 673 | 3300046518 | Ga0495631_0260185 | Ga0495631_0260185_20_616 | 198 |
| 674 | 3300046519 | Ga0495632_0000031 | Ga0495632_0000031_484_1080 | 198 |
| 675 | 3300046519 | Ga0495632_0000170 | Ga0495632_0000170_30317_30913 | 198 |
| 676 | 3300046519 | Ga0495632_0001021 | Ga0495632_0001021_2727_3323 | 198 |
| 677 | 3300046519 | Ga0495632_0002096 | Ga0495632_0002096_11999_12595 | 198 |
| 678 | 3300046520 | Ga0495637_0000799 | Ga0495637_0000799_814_1410 | 198 |
| 679 | 3300046520 | Ga0495637_0001764 | Ga0495637_0001764_4082_4678 | 198 |
| 680 | 3300046520 | Ga0495637_0009093 | Ga0495637_0009093_2842_3438 | 198 |
| 681 | 3300046520 | Ga0495637_0043837 | Ga0495637_0043837_1058_1654 | 198 |
| 682 | 3300046522 | Ga0495643_0012198 | Ga0495643_0012198_631_1227 | 198 |
| 683 | 3300046522 | Ga0495643_0013461 | Ga0495643_0013461_3926_4522 | 198 |
| 684 | 3300046522 | Ga0495643_0022047 | Ga0495643_0022047_221_817 | 198 |
| 685 | 3300046522 | Ga0495643_0129090 | Ga0495643_0129090_44_640 | 198 |
| 686 | 3300046523 | Ga0495644_0210516 | Ga0495644_0210516_104_700 | 198 |
| 687 | 3300046524 | Ga0495648_0000267 | Ga0495648_0000267_6859_7455 | 198 |
| 688 | 3300046524 | Ga0495648_0014286 | Ga0495648_0014286_452_1048 | 198 |
| 689 | 3300046524 | Ga0495648_0015925 | Ga0495648_0015925_2420_3016 | 198 |
| 690 | 3300046524 | Ga0495648_0032837 | Ga0495648_0032837_1007_1603 | 198 |
| 691 | 3300046526 | Ga0495666_0040601 | Ga0495666_0040601_1522_2118 | 198 |
| 692 | 3300046528 | Ga0495642_0000584 | Ga0495642_0000584_14666_15262 | 198 |
| 693 | 3300046528 | Ga0495642_0000977 | Ga0495642_0000977_11971_12567 | 198 |
| 694 | 3300046530 | Ga0495654_0010877 | Ga0495654_0010877_910_1506 | 198 |
| 695 | 3300046530 | Ga0495654_0061793 | Ga0495654_0061793_769_1365 | 198 |
| 696 | 3300046530 | Ga0495654_0099023 | Ga0495654_0099023_166_762 | 198 |
| 697 | 3300046530 | Ga0495654_0124773 | Ga0495654_0124773_486_1082 | 198 |
| 698 | 3300046536 | Ga0495587_0000835 | Ga0495587_0000835_15217_15813 | 198 |
| 699 | 3300046538 | Ga0495609_0000552 | Ga0495609_0000552_3010_3606 | 198 |
| 700 | 3300046538 | Ga0495609_0001596 | Ga0495609_0001596_6396_6992 | 198 |
| 701 | 3300046538 | Ga0495609_0016775 | Ga0495609_0016775_178_774 | 198 |
| 702 | 3300046538 | Ga0495609_0030749 | Ga0495609_0030749_1464_2060 | 198 |
| 703 | 3300046542 | Ga0495597_0004922 | Ga0495597_0004922_1784_2380 | 198 |
| 704 | 3300046542 | Ga0495597_0021913 | Ga0495597_0021913_2329_2925 | 198 |
| 705 | 3300046542 | Ga0495597_0078768 | Ga0495597_0078768_374_970 | 198 |
| 706 | 3300046557 | Ga0495622_0013456 | Ga0495622_0013456_2202_2798 | 198 |
| 707 | 3300046558 | Ga0495633_0042079 | Ga0495633_0042079_261_857 | 198 |
| 708 | 3300046558 | Ga0495633_0140577 | Ga0495633_0140577_369_965 | 198 |
| 709 | 3300046615 | Ga0495656_0014112 | Ga0495656_0014112_1951_2547 | 198 |
| 710 | 3300046616 | Ga0495668_0001425 | Ga0495668_0001425_19860_20456 | 198 |
| 711 | 3300046642 | Ga0495634_0000347 | Ga0495634_0000347_22366_22962 | 198 |
| 712 | 3300046660 | Ga0495625_0005230 | Ga0495625_0005230_4030_4626 | 198 |
| 713 | 3300046660 | Ga0495625_0010607 | Ga0495625_0010607_6479_7075 | 198 |
| 714 | 3300046660 | Ga0495625_0089038 | Ga0495625_0089038_1105_1701 | 198 |
| 715 | 3300046660 | Ga0495625_0156972 | Ga0495625_0156972_351_947 | 198 |
| 716 | 3300046663 | Ga0495635_0000402 | Ga0495635_0000402_5049_5645 | 198 |
| 717 | 3300046664 | Ga0495659_0000252 | Ga0495659_0000252_3056_3652 | 198 |
| 718 | 3300046664 | Ga0495659_0002938 | Ga0495659_0002938_488_1084 | 198 |
| 719 | 3300046664 | Ga0495659_0146539 | Ga0495659_0146539_60_656 | 198 |
| 720 | 3300046665 | Ga0495661_0036598 | Ga0495661_0036598_544_1140 | 198 |
| 721 | 3300046665 | Ga0495661_0109816 | Ga0495661_0109816_727_1323 | 198 |
| 722 | 3300046665 | Ga0495661_0116931 | Ga0495661_0116931_602_1198 | 198 |
| 723 | 3300046665 | Ga0495661_0156942 | Ga0495661_0156942_590_1186 | 198 |
| 724 | 3300046674 | Ga0495588_0000444 | Ga0495588_0000444_2755_3351 | 198 |
| 725 | 3300046680 | Ga0495646_0000541 | Ga0495646_0000541_15217_15813 | 198 |
| 726 | 3300046684 | Ga0495669_0006562 | Ga0495669_0006562_4189_4785 | 198 |
| 727 | 3300046684 | Ga0495669_0155276 | Ga0495669_0155276_80_676 | 198 |
| 728 | 3300046691 | Ga0495670_0001231 | Ga0495670_0001231_2820_3416 | 198 |
| 729 | 3300046691 | Ga0495670_0004594 | Ga0495670_0004594_110_706 | 198 |
| 730 | 3300046691 | Ga0495670_0092196 | Ga0495670_0092196_202_798 | 198 |
| 731 | 3300046691 | Ga0495670_0176837 | Ga0495670_0176837_79_675 | 198 |
| 732 | 3300046692 | Ga0495671_0002464 | Ga0495671_0002464_10708_11304 | 198 |
| 733 | 3300046692 | Ga0495671_0002792 | Ga0495671_0002792_8239_8835 | 198 |
| 734 | 3300046694 | Ga0495649_0000106 | Ga0495649_0000106_3019_3615 | 198 |
| 735 | 3300046694 | Ga0495649_0000811 | Ga0495649_0000811_23995_24591 | 198 |
| 736 | 3300046694 | Ga0495649_0031264 | Ga0495649_0031264_2072_2668 | 198 |
| 737 | 3300046794 | Ga0495589_0008767 | Ga0495589_0008767_39_635 | 198 |
| 738 | 3300046794 | Ga0495589_0015375 | Ga0495589_0015375_3052_3648 | 198 |
| 739 | 3300046794 | Ga0495589_0024430 | Ga0495589_0024430_169_765 | 198 |
| 740 | 3300046810 | Ga0495660_0013968 | Ga0495660_0013968_4009_4605 | 198 |
| 741 | 3300046810 | Ga0495660_0017097 | Ga0495660_0017097_2316_2912 | 198 |
| 742 | 3300046810 | Ga0495660_0022090 | Ga0495660_0022090_2626_3222 | 198 |
| 743 | 3300046810 | Ga0495660_0127284 | Ga0495660_0127284_80_676 | 198 |
| 744 | 3300046810 | Ga0495660_0127579 | Ga0495660_0127579_604_1200 | 198 |
| 745 | 3300046810 | Ga0495660_0281446 | Ga0495660_0281446_51_647 | 198 |
| 746 | 3300047317 | Ga0495604_0094408 | Ga0495604_0094408_225_821 | 198 |
| 747 | 3300047318 | Ga0495636_0000436 | Ga0495636_0000436_11999_12595 | 198 |
| 748 | 3300047319 | Ga0495674_0076560 | Ga0495674_0076560_1279_1875 | 198 |
| 749 | 3300047320 | Ga0495672_0000357 | Ga0495672_0000357_55208_55804 | 198 |
| 750 | 3300047320 | Ga0495672_0000987 | Ga0495672_0000987_2836_3432 | 198 |
| 751 | 3300047320 | Ga0495672_0003208 | Ga0495672_0003208_10763_11359 | 198 |
| 752 | 3300047320 | Ga0495672_0005169 | Ga0495672_0005169_487_1083 | 198 |
| 753 | 3300047320 | Ga0495672_0141779 | Ga0495672_0141779_488_1084 | 198 |
| 754 | 3300047320 | Ga0495672_0161133 | Ga0495672_0161133_387_983 | 198 |
| 755 | 3300047323 | Ga0495683_0005131 | Ga0495683_0005131_345_941 | 198 |
| 756 | 3300047323 | Ga0495683_0005677 | Ga0495683_0005677_597_1193 | 198 |
| 757 | 3300047323 | Ga0495683_0057323 | Ga0495683_0057323_476_1072 | 198 |
| 758 | 3300047323 | Ga0495683_0113173 | Ga0495683_0113173_67_663 | 198 |
| 759 | 3300047323 | Ga0495683_0196426 | Ga0495683_0196426_180_776 | 198 |
| 760 | 3300047443 | Ga0495687_000159 | Ga0495687_000159_57206_57802 | 198 |
| 761 | 3300047443 | Ga0495687_000343 | Ga0495687_000343_55936_56532 | 198 |
| 762 | 3300047443 | Ga0495687_002486 | Ga0495687_002486_2791_3387 | 198 |
| 763 | 3300047445 | Ga0495677_0000308 | Ga0495677_0000308_2765_3361 | 198 |
| 764 | 3300047446 | Ga0495679_025105 | Ga0495679_025105_345_941 | 198 |
| 765 | 3300047447 | Ga0495685_054055 | Ga0495685_054055_38_634 | 198 |
| 766 | 3300047469 | Ga0495673_0000142 | Ga0495673_0000142_19975_20571 | 198 |
| 767 | 3300047469 | Ga0495673_0001971 | Ga0495673_0001971_2723_3319 | 198 |
| 768 | 3300047469 | Ga0495673_0013732 | Ga0495673_0013732_2712_3308 | 198 |
| 769 | 3300047470 | Ga0495681_0011182 | Ga0495681_0011182_4474_5070 | 198 |
| 770 | 3300047470 | Ga0495681_0013602 | Ga0495681_0013602_3615_4211 | 198 |
| 771 | 3300047470 | Ga0495681_0068702 | Ga0495681_0068702_303_899 | 198 |
| 772 | 3300047470 | Ga0495681_0219752 | Ga0495681_0219752_144_740 | 198 |
| 773 | 3300047673 | Ga0495593_0000536 | Ga0495593_0000536_4994_5590 | 198 |
| 774 | 3300048091 | Ga0495626_0002800 | Ga0495626_0002800_6453_7049 | 198 |
| 775 | 3300048091 | Ga0495626_0011624 | Ga0495626_0011624_3911_4507 | 198 |
| 776 | 3300048091 | Ga0495626_0014962 | Ga0495626_0014962_2977_3573 | 198 |
| 777 | 3300048091 | Ga0495626_0021804 | Ga0495626_0021804_483_1079 | 198 |
| 778 | 3300048905 | Ga0496102_0000444 | Ga0496102_0000444_22053_22649 | 198 |
| 779 | 3300048906 | Ga0496103_0000290 | Ga0496103_0000290_21557_22153 | 198 |
| 780 | 3300048906 | Ga0496103_0067436 | Ga0496103_0067436_1237_1848 | 198 |
| 781 | 3300048909 | Ga0496106_0001400 | Ga0496106_0001400_14635_15246 | 198 |
| 782 | 3300048909 | Ga0496106_0040227 | Ga0496106_0040227_2443_3039 | 198 |
| 783 | 3300048909 | Ga0496106_0095899 | Ga0496106_0095899_427_1023 | 198 |
| 784 | 3300048910 | Ga0496107_0390987 | Ga0496107_0390987_109_705 | 198 |
| 785 | 3300048913 | Ga0496110_0048556 | Ga0496110_0048556_2103_2699 | 198 |
| 786 | 3300048917 | Ga0496114_0015450 | Ga0496114_0015450_357_953 | 198 |
| 787 | 3300048917 | Ga0496114_0076715 | Ga0496114_0076715_1920_2516 | 198 |
| 788 | 3300048918 | Ga0496115_0018008 | Ga0496115_0018008_349_945 | 198 |
| 789 | 3300048919 | Ga0496116_0000231 | Ga0496116_0000231_3068_3664 | 198 |
| 790 | 3300048919 | Ga0496116_0012086 | Ga0496116_0012086_3292_3903 | 198 |
| 791 | 3300048919 | Ga0496116_0021642 | Ga0496116_0021642_3827_4423 | 198 |
| 792 | 3300048920 | Ga0496117_0000460 | Ga0496117_0000460_66734_67330 | 198 |
| 793 | 3300048920 | Ga0496117_0005335 | Ga0496117_0005335_12319_12915 | 198 |
| 794 | 3300048920 | Ga0496117_0069886 | Ga0496117_0069886_957_1568 | 198 |
| 795 | 3300048920 | Ga0496117_0155803 | Ga0496117_0155803_464_1060 | 198 |
| 796 | 3300048920 | Ga0496117_0169612 | Ga0496117_0169612_220_816 | 198 |
| 797 | 3300048921 | Ga0496118_0000106 | Ga0496118_0000106_17334_17930 | 198 |
| 798 | 3300048921 | Ga0496118_0002522 | Ga0496118_0002522_3242_3853 | 198 |
| 799 | 3300048921 | Ga0496118_0004391 | Ga0496118_0004391_651_1247 | 198 |
| 800 | 3300048921 | Ga0496118_0036942 | Ga0496118_0036942_724_1320 | 198 |
| 801 | 3300048921 | Ga0496118_0042526 | Ga0496118_0042526_604_1200 | 198 |
| 802 | 3300048921 | Ga0496118_0131345 | Ga0496118_0131345_814_1410 | 198 |
| 803 | 3300048921 | Ga0496118_0214010 | Ga0496118_0214010_120_716 | 198 |
| 804 | 3300048922 | Ga0496119_0024932 | Ga0496119_0024932_2876_3472 | 198 |
| 805 | 3300048922 | Ga0496119_0057100 | Ga0496119_0057100_776_1387 | 198 |
| 806 | 3300048922 | Ga0496119_0145051 | Ga0496119_0145051_386_982 | 198 |
| 807 | 3300048924 | Ga0496121_0000602 | Ga0496121_0000602_38861_39472 | 198 |
| 808 | 3300048924 | Ga0496121_0002550 | Ga0496121_0002550_19436_20032 | 198 |
| 809 | 3300048924 | Ga0496121_0046322 | Ga0496121_0046322_2961_3557 | 198 |
| 810 | 3300048924 | Ga0496121_0058950 | Ga0496121_0058950_788_1384 | 198 |
| 811 | 3300048924 | Ga0496121_0207410 | Ga0496121_0207410_39_635 | 198 |
| 812 | 3300048924 | Ga0496121_0241898 | Ga0496121_0241898_151_747 | 198 |
| 813 | 3300048925 | Ga0496122_0003924 | Ga0496122_0003924_15359_15955 | 198 |
| 814 | 3300048925 | Ga0496122_0028198 | Ga0496122_0028198_3724_4320 | 198 |
| 815 | 3300048925 | Ga0496122_0052736 | Ga0496122_0052736_544_1140 | 198 |
| 816 | 3300048925 | Ga0496122_0244818 | Ga0496122_0244818_255_851 | 198 |
| 817 | 3300048925 | Ga0496122_0296592 | Ga0496122_0296592_226_822 | 198 |
| 818 | 3300048926 | Ga0496123_0001070 | Ga0496123_0001070_21845_22441 | 198 |
| 819 | 3300048926 | Ga0496123_0151128 | Ga0496123_0151128_372_968 | 198 |
| 820 | 3300048926 | Ga0496123_0184946 | Ga0496123_0184946_279_875 | 198 |
| 821 | 3300048927 | Ga0496124_0002300 | Ga0496124_0002300_24475_25086 | 198 |
| 822 | 3300048927 | Ga0496124_0007825 | Ga0496124_0007825_2823_3419 | 198 |
| 823 | 3300048927 | Ga0496124_0053031 | Ga0496124_0053031_2448_3044 | 198 |
| 824 | 3300048927 | Ga0496124_0087639 | Ga0496124_0087639_237_833 | 198 |
| 825 | 3300048927 | Ga0496124_0096438 | Ga0496124_0096438_359_955 | 198 |
| 826 | 3300048927 | Ga0496124_0178078 | Ga0496124_0178078_851_1447 | 198 |
| 827 | 3300048928 | Ga0496125_0000038 | Ga0496125_0000038_79880_80476 | 198 |
| 828 | 3300048928 | Ga0496125_0015470 | Ga0496125_0015470_2192_2788 | 198 |
| 829 | 3300048928 | Ga0496125_0033974 | Ga0496125_0033974_434_1030 | 198 |
| 830 | 3300048928 | Ga0496125_0043559 | Ga0496125_0043559_2573_3169 | 198 |
| 831 | 3300048928 | Ga0496125_0053328 | Ga0496125_0053328_108_719 | 198 |
| 832 | 3300048928 | Ga0496125_0212054 | Ga0496125_0212054_448_1044 | 198 |
| 833 | 3300048929 | Ga0496126_0019278 | Ga0496126_0019278_1504_2100 | 198 |
| 834 | 3300048929 | Ga0496126_0029405 | Ga0496126_0029405_3242_3838 | 198 |
| 835 | 3300048929 | Ga0496126_0048088 | Ga0496126_0048088_2909_3520 | 198 |
| 836 | 3300048929 | Ga0496126_0555464 | Ga0496126_0555464_269_865 | 198 |
| 837 | 3300049459 | Ga0495678_004472 | Ga0495678_004472_156_752 | 198 |
| 838 | 3300049459 | Ga0495678_008649 | Ga0495678_008649_3622_4218 | 198 |
| 839 | 3300049459 | Ga0495678_037128 | Ga0495678_037128_156_752 | 198 |
| 840 | 3300049459 | Ga0495678_042992 | Ga0495678_042992_365_961 | 198 |
| 841 | 3300049459 | Ga0495678_080193 | Ga0495678_080193_431_1027 | 198 |
| 842 | 3300049460 | Ga0495682_0000057 | Ga0495682_0000057_98349_98945 | 198 |
| 843 | 3300049460 | Ga0495682_0000497 | Ga0495682_0000497_23453_24049 | 198 |
| 844 | 3300049460 | Ga0495682_0000755 | Ga0495682_0000755_19724_20320 | 198 |
| 845 | 3300049460 | Ga0495682_0013167 | Ga0495682_0013167_39_635 | 198 |
| 846 | 3300049460 | Ga0495682_0022002 | Ga0495682_0022002_1539_2135 | 198 |
| 847 | 3300050489 | nmdc:mga03683_65817_c1 | nmdc:mga03683_65817_c1_462_1058 | 198 |
| 848 | 3300050491 | nmdc:mga00v17_190318_c1 | nmdc:mga00v17_190318_c1_303_899 | 198 |
| 849 | 3300050491 | nmdc:mga00v17_230353_c1 | nmdc:mga00v17_230353_c1_252_848 | 198 |
| 850 | 3300050491 | nmdc:mga00v17_445192_c1 | nmdc:mga00v17_445192_c1_58_654 | 198 |
| 851 | 3300050492 | nmdc:mga0yw44_140905_c1 | nmdc:mga0yw44_140905_c1_175_771 | 198 |
| 852 | 3300050496 | nmdc:mga07m45_123815_c1 | nmdc:mga07m45_123815_c1_460_1056 | 198 |
| 853 | 3300053087 | Ga0500643_044372 | Ga0500643_044372_507_1103 | 198 |
| 854 | 3300053088 | Ga0500644_0008007 | Ga0500644_0008007_862_1458 | 198 |
| 855 | 3300053089 | Ga0500581_063378 | Ga0500581_063378_855_1451 | 198 |
| 856 | 3300053093 | Ga0500651_0103858 | Ga0500651_0103858_793_1389 | 198 |
| 857 | 3300053094 | Ga0500566_0000214 | Ga0500566_0000214_32_628 | 198 |
| 858 | 3300053098 | Ga0500650_0030296 | Ga0500650_0030296_582_1178 | 198 |
| 859 | 3300053104 | Ga0500556_0000216 | Ga0500556_0000216_12938_13534 | 198 |
| 860 | 3300053109 | Ga0500569_006309 | Ga0500569_006309_1640_2236 | 198 |
| 861 | 3300053122 | Ga0500608_065151 | Ga0500608_065151_499_1095 | 198 |
| 862 | 3300053130 | Ga0500642_0000012 | Ga0500642_0000012_69865_70461 | 198 |
| 863 | 3300053130 | Ga0500642_0308788 | Ga0500642_0308788_17_613 | 198 |
| 864 | 3300053131 | Ga0500652_000403 | Ga0500652_000403_4991_5587 | 198 |
| 865 | 3300053134 | Ga0500658_0022293 | Ga0500658_0022293_1613_2209 | 198 |
| 866 | 3300053135 | Ga0500659_0001844 | Ga0500659_0001844_427_1023 | 198 |
| 867 | 3300053136 | Ga0500559_0000167 | Ga0500559_0000167_32103_32699 | 198 |
| 868 | 3300053139 | Ga0500568_0001627 | Ga0500568_0001627_3604_4200 | 198 |
| 869 | 3300053145 | Ga0500586_000481 | Ga0500586_000481_6986_7582 | 198 |
| 870 | 3300053151 | Ga0500604_0005154 | Ga0500604_0005154_1659_2255 | 198 |
| 871 | 3300053153 | Ga0500616_0000515 | Ga0500616_0000515_18235_18831 | 198 |
| 872 | 3300053156 | Ga0500622_0002295 | Ga0500622_0002295_3432_4028 | 198 |
| 873 | 3300053158 | Ga0500627_0075634 | Ga0500627_0075634_853_1449 | 198 |
| 874 | 3300053177 | Ga0500636_0009790 | Ga0500636_0009790_355_951 | 198 |
| 875 | 3300053730 | Ga0500645_068054 | Ga0500645_068054_291_887 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2iht-assembly1.cif.gz_B | carboxyethylarginine synthase from streptomyces clavuligerus: semet structure | 0.832 | 2 | 171 |
| 4q9d-assembly1.cif.gz_A-2 | x-ray structure of a putative thiamin diphosphate-dependent enzyme isolated from mycobacterium smegmatis | 0.8233 | 10 | 171 |
| 1upa-assembly1.cif.gz_C | carboxyethylarginine synthase from streptomyces clavuligerus (semet structure) | 0.8215 | 5 | 172 |
| 3eya-assembly3.cif.gz_K | structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from escherichia coli | 0.8188 | 11 | 172 |
| 1upc-assembly1.cif.gz_C | carboxyethylarginine synthase from streptomyces clavuligerus | 0.8186 | 5 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P58416_5_175_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9421 | 12 | 182 | 3.40.50.970 |
| af_P58416_5_175_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9315 | 12 | 182 | 3.40.50.970 |
| af_A4I3N7_199_405_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8606 | 4 | 186 | 3.40.50.970 |
| af_Q57957_74_243_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8478 | 61 | 170 | 3.40.50.970 |
| af_Q4D595_238_443_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8449 | 2 | 186 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536SBB7-F1-model_v4 | Aldehyde dehydrogenase | 0.9989 | 9 | 108 |
GO:0016831
GO:0030976 GO:0044281 |
| AF-A0A5E7MMF2-F1-model_v4 | deleted | 0.9974 | 1 | 194 |
|
| AF-A0A7Y8C5T8-F1-model_v4 | Aldehyde dehydrogenase | 0.9973 | 1 | 198 |
GO:0016831
GO:0030976 GO:0044281 |
| AF-A0A7H5R5M6-F1-model_v4 | Aldehyde dehydrogenase | 0.9967 | 1 | 198 |
GO:0016831
GO:0030976 GO:0044281 |
| AF-A0A0F4XSL0-F1-model_v4 | Aldehyde dehydrogenase | 0.9956 | 1 | 198 |
GO:0016831
GO:0030976 GO:0044281 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar