F484331

General Info

Members Datasets Scaffolds Average Seq Length
875 463 806 196

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0489775|Ga0496105_0489775_86_709
Length 207
Sequence VSQHTIEIDDSRTDAGERIDRRAFVGDLLAQTPEALVVTGLGSPTYDVFATTPRPGHFHLWGAMGASIPLGLGLALAQPDKSVVVITGDGEQLMGIGALGTVGAQLPANLTIVVLDNGHFGETGMQQSHTSLGTDLVAVAKGFNISNAFLVTDQRGHKTIADHIVARTGTTYAQVLIAADEPPRVLPPRDGVANKNSFRAELGLPTF

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231012 Pseudomonas sp. GM33 Isolate Nodule
6 2511231015 Pseudomonas sp. GM49 Isolate Nodule
7 2511231017 Pseudomonas sp. GM55 Isolate Nodule
8 2511231020 Pseudomonas sp. GM74 Isolate Nodule
9 2511231021 Pseudomonas sp. GM78 Isolate Nodule
10 2511231022 Pseudomonas sp. GM79 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
14 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
15 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
16 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
17 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
18 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
19 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
20 2643221569 Achromobacter sp. Root565 Isolate Unclassified
21 2643221621 Achromobacter sp. Root83 Isolate Unclassified
22 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
23 2643221733 Bosea sp. Root381 Isolate Unclassified
24 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
25 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
26 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
27 2738543012 Acidovorax sp. CF301 Isolate Unclassified
28 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
29 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
30 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
31 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
32 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
33 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
34 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
35 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
36 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
37 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
38 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
39 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
40 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
41 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
42 2904699407
43 2906610324
44 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
45 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
46 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
47 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
48 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
49 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
50 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
51 2922425934
52 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
53 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
54 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
55 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
56 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
57 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
58 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
59 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
60 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
61 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
62 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
76 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
77 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
78 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
82 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
83 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
88 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
89 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
90 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
91 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
94 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
95 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
98 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
99 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
100 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
103 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
104 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
110 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
111 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
112 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
113 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
118 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
119 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
120 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
121 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
122 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
123 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
124 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
125 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
126 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
132 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
133 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
134 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
135 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
138 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
139 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
140 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
141 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
142 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
143 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
147 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
148 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
153 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
169 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
173 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
174 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
175 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
176 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
177 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
178 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
234 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
235 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
242 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
252 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
253 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
254 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
268 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
269 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
270 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
271 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
272 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
273 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
274 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
275 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
276 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
277 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
278 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
279 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
280 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
281 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
282 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
283 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
284 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
285 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
286 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
287 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
290 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
293 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
298 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
299 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
300 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
301 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
310 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
315 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
316 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
317 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
318 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
319 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
320 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
323 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
324 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
325 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
326 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
327 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
328 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
329 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
330 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
331 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
332 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
333 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
334 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
335 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
336 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
337 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
338 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
339 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
340 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
341 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
342 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
343 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
344 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
345 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
346 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
347 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
348 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
349 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
350 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
351 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
352 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
353 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
354 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
355 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
356 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
359 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
360 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
361 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
362 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
363 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
364 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
365 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
366 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
369 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
370 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
371 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
372 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
380 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
381 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
382 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
383 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
384 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
385 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
386 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
387 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
388 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
389 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
390 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
391 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
392 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
393 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
399 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
400 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
401 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
405 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
406 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
407 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
408 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
409 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
410 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
411 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
412 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
413 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
414 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
415 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
419 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
420 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
421 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
422 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
423 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
424 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
425 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
426 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
427 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
428 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
429 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
430 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
431 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
432 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
433 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
434 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
435 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
436 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
437 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
438 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
439 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
440 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
441 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
442 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
443 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
444 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
445 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
446 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
447 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
448 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
449 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
450 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
451 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
452 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
453 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
454 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
455 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
456 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
457 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
458 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
459 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
460 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
461 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
462 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
463 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.32
Metatranscriptomes 0.11
Isolates 7.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.46
Nodule 4.11
Rhizoplane 2.74
Rhizosphere 67.54
Stem 0
Stem Tuber 0
Unclassified 13.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_802 2124908027 Bacteria 4905
2 JGI24744J21845_10016867 3300002077 Unclassified 1453
3 JGI25151J46595_10015039 3300003187 Bacteria 3430
4 JGI25404J52841_10005115 3300003659 Bacteria 2701
5 JGI25404J52841_10006721 3300003659 Bacteria 2414
6 JGI25404J52841_10011730 3300003659 Bacteria 1893
7 Ga0055530_10032187 3300003791 Bacteria 1367
8 Ga0065714_10032856 3300005288 Bacteria 716
9 Ga0065714_10073987 3300005288 Bacteria 3097
10 Ga0065714_10075886 3300005288 Bacteria 2853
11 Ga0065714_10133304 3300005288 Bacteria 1230
12 Ga0065714_10145153 3300005288 Bacteria 1143
13 Ga0065714_10268002 3300005288 Bacteria 744
14 Ga0065704_10266369 3300005289 Bacteria 953
15 Ga0065707_10083763 3300005295 Bacteria 8296
16 Ga0070676_10075749 3300005328 Bacteria 2029
17 Ga0070676_10519996 3300005328 Bacteria 848
18 Ga0070690_100008552 3300005330 Bacteria 5900
19 Ga0070670_100076157 3300005331 Bacteria 2883
20 Ga0068869_100184186 3300005334 Bacteria 1638
21 Ga0070666_10366943 3300005335 Bacteria 1032
22 Ga0068868_100358742 3300005338 Bacteria 1250
23 Ga0068868_100820002 3300005338 Bacteria 841
24 Ga0068868_100829551 3300005338 Bacteria 836
25 Ga0070689_100357515 3300005340 Bacteria 1226
26 Ga0070687_100243817 3300005343 Bacteria 1113
27 Ga0070687_100317877 3300005343 Bacteria 994
28 Ga0070661_100210586 3300005344 Bacteria 1488
29 Ga0070692_10395283 3300005345 Bacteria 871
30 Ga0070668_100608193 3300005347 Bacteria 957
31 Ga0070669_100012891 3300005353 Bacteria 5937
32 Ga0070669_100018866 3300005353 Bacteria 4930
33 Ga0070669_100279652 3300005353 Bacteria 1337
34 Ga0070675_100368672 3300005354 Bacteria 1276
35 Ga0070675_101054076 3300005354 Bacteria 747
36 Ga0070671_100075829 3300005355 Bacteria 2810
37 Ga0070671_101363638 3300005355 Bacteria 626
38 Ga0070674_100004356 3300005356 Bacteria 8071
39 Ga0070673_100077132 3300005364 Bacteria 2693
40 Ga0070673_100634843 3300005364 Bacteria 976
41 Ga0070688_100072259 3300005365 Unclassified 2210
42 Ga0070667_100154202 3300005367 Unclassified 2020
43 Ga0070667_100355633 3300005367 Bacteria 1327
44 Ga0070709_10164174 3300005434 Bacteria 1547
45 Ga0070714_100025074 3300005435 Bacteria 4918
46 Ga0070713_100141794 3300005436 Bacteria 2129
47 Ga0070713_100393664 3300005436 Bacteria 1293
48 Ga0070713_100768958 3300005436 Bacteria 922
49 Ga0070713_101365959 3300005436 Bacteria 687
50 Ga0070710_10539375 3300005437 Bacteria 804
51 Ga0070711_100546739 3300005439 Bacteria 960
52 Ga0070700_100452940 3300005441 Bacteria 977
53 Ga0070708_100339816 3300005445 Bacteria 1415
54 Ga0070678_100082518 3300005456 Bacteria 2441
55 Ga0070678_100107211 3300005456 Bacteria 2178
56 Ga0070678_100447304 3300005456 Bacteria 1131
57 Ga0070678_100585835 3300005456 Bacteria 994
58 Ga0070662_100366473 3300005457 Bacteria 1183
59 Ga0068867_100042610 3300005459 Viruses 3321
60 Ga0070685_10020415 3300005466 Viruses 3584
61 Ga0070706_100001696 3300005467 Bacteria 22935
62 Ga0070698_100026347 3300005471 Bacteria 6051
63 Ga0070699_100450385 3300005518 Bacteria 1167
64 Ga0068853_100318534 3300005539 Bacteria 1441
65 Ga0068853_100611294 3300005539 Bacteria 1036
66 Ga0070672_100213922 3300005543 Bacteria 1615
67 Ga0070686_100034486 3300005544 Bacteria 3119
68 Ga0070695_100603225 3300005545 Bacteria 862
69 Ga0070665_100382110 3300005548 Bacteria 1416
70 Ga0070665_101027716 3300005548 Bacteria 836
71 Ga0068855_100014536 3300005563 Bacteria 9481
72 Ga0068855_100223814 3300005563 Bacteria 2109
73 Ga0068857_100111626 3300005577 Bacteria 2458
74 Ga0068857_100324916 3300005577 Bacteria 1421
75 Ga0068856_100184679 3300005614 Bacteria 2099
76 Ga0070702_100195635 3300005615 Bacteria 1334
77 Ga0068859_100468511 3300005617 Bacteria 1355
78 Ga0068864_100111411 3300005618 Bacteria 2438
79 Ga0068864_100127751 3300005618 Bacteria 2280
80 Ga0068866_10293503 3300005718 Unclassified 1012
81 Ga0068861_100082903 3300005719 Unclassified 2514
82 Ga0068863_100088352 3300005841 Bacteria 2937
83 Ga0068863_100162888 3300005841 Bacteria 2138
84 Ga0068863_100789709 3300005841 Bacteria 947
85 Ga0068863_101123489 3300005841 Bacteria 791
86 Ga0068858_100148467 3300005842 Bacteria 2203
87 Ga0068858_100189830 3300005842 Bacteria 1942
88 Ga0068860_100002010 3300005843 Bacteria 21458
89 Ga0081455_10004636 3300005937 Bacteria 15315
90 Ga0081455_10020916 3300005937 Bacteria 6149
91 Ga0081540_1004587 3300005983 Bacteria 10460
92 Ga0081540_1025653 3300005983 Bacteria 3386
93 Ga0081540_1031606 3300005983 Bacteria 2908
94 Ga0081540_1064824 3300005983 Bacteria 1722
95 Ga0081539_10152530 3300005985 Bacteria 1110
96 Ga0075365_10008449 3300006038 Bacteria 5848
97 Ga0075365_10012820 3300006038 Bacteria 4993
98 Ga0075365_10051253 3300006038 Bacteria 2725
99 Ga0075365_10470835 3300006038 Bacteria 887
100 Ga0075363_100005959 3300006048 Bacteria 5495
101 Ga0075363_100039008 3300006048 Bacteria 2499
102 Ga0075363_100150935 3300006048 Bacteria 1312
103 Ga0075364_10000521 3300006051 Bacteria 19552
104 Ga0075364_10001007 3300006051 Bacteria 14921
105 Ga0075364_10006108 3300006051 Bacteria 7055
106 Ga0075364_10033900 3300006051 Bacteria 3290
107 Ga0075364_10106916 3300006051 Bacteria 1864
108 Ga0075364_10120341 3300006051 Bacteria 1757
109 Ga0075364_10579238 3300006051 Bacteria 767
110 Ga0075432_10000692 3300006058 Bacteria 10373
111 Ga0075432_10018168 3300006058 Bacteria 2398
112 Ga0075432_10054035 3300006058 Bacteria 1421
113 Ga0075432_10055723 3300006058 Bacteria 1401
114 Ga0075432_10118629 3300006058 Bacteria 992
115 Ga0075432_10125886 3300006058 Bacteria 966
116 Ga0075432_10256760 3300006058 Bacteria 711
117 Ga0070716_100231530 3300006173 Bacteria 1247
118 Ga0075362_10004185 3300006177 Bacteria 5149
119 Ga0075362_10013135 3300006177 Bacteria 3307
120 Ga0075362_10046148 3300006177 Bacteria 1937
121 Ga0075362_10166408 3300006177 Bacteria 1063
122 Ga0075369_10034089 3300006186 Bacteria 2160
123 Ga0075366_10008335 3300006195 Bacteria 5757
124 Ga0075366_10024268 3300006195 Bacteria 3537
125 Ga0075366_10065815 3300006195 Bacteria 2156
126 Ga0075366_10101778 3300006195 Bacteria 1724
127 Ga0075366_10131781 3300006195 Bacteria 1509
128 Ga0075366_10156790 3300006195 Bacteria 1379
129 Ga0097621_100373161 3300006237 Bacteria 1273
130 Ga0097621_100430227 3300006237 Bacteria 1186
131 Ga0075370_10008628 3300006353 Bacteria 5253
132 Ga0075370_10008840 3300006353 Bacteria 5201
133 Ga0075370_10061355 3300006353 Bacteria 2142
134 Ga0068871_100031823 3300006358 Viruses 4162
135 Ga0075430_100004962 3300006846 Bacteria 11199
136 Ga0075430_100322430 3300006846 Bacteria 1277
137 Ga0075431_100237759 3300006847 Bacteria 1854
138 Ga0075434_100067553 3300006871 Bacteria 3560
139 Ga0075434_100885008 3300006871 Bacteria 908
140 Ga0075429_100005817 3300006880 Bacteria 10639
141 Ga0075436_100241275 3300006914 Bacteria 1285
142 Ga0075436_100488983 3300006914 Unclassified 899
143 Ga0097620_100468522 3300006931 Bacteria 1355
144 Ga0099825_1047979 3300006941 Bacteria 994
145 Ga0099824_1004050 3300006942 Bacteria 21204
146 Ga0099822_1000838 3300006943 Bacteria 32461
147 Ga0075435_100123083 3300007076 Bacteria 2166
148 Ga0105251_10005081 3300009011 Bacteria 8716
149 Ga0105244_10004844 3300009036 Bacteria 9127
150 Ga0105244_10008013 3300009036 Bacteria 6645
151 Ga0105244_10385900 3300009036 Bacteria 645
152 Ga0105250_10009214 3300009092 Bacteria 4162
153 Ga0105250_10011333 3300009092 Bacteria 3699
154 Ga0105250_10090525 3300009092 Bacteria 1244
155 Ga0105250_10144120 3300009092 Bacteria 989
156 Ga0105250_10221277 3300009092 Bacteria 803
157 Ga0105240_10005569 3300009093 Bacteria 18721
158 Ga0105240_10201140 3300009093 Bacteria 2334
159 Ga0111539_10692636 3300009094 Bacteria 1186
160 Ga0105245_10159249 3300009098 Bacteria 2141
161 Ga0105247_10068052 3300009101 Bacteria 2220
162 Ga0105247_10097716 3300009101 Bacteria 1873
163 Ga0105241_10592272 3300009174 Bacteria 1001
164 Ga0105242_10097873 3300009176 Unclassified 2481
165 Ga0105242_10772235 3300009176 Bacteria 948
166 Ga0105248_10393192 3300009177 Bacteria 1561
167 Ga0105248_10411793 3300009177 Bacteria 1522
168 Ga0105248_10597311 3300009177 Bacteria 1245
169 Ga0105237_10022573 3300009545 Bacteria 6455
170 Ga0105237_10026227 3300009545 Bacteria 5956
171 Ga0105237_10063278 3300009545 Bacteria 3697
172 Ga0105238_10647933 3300009551 Bacteria 1066
173 Ga0105249_10610120 3300009553 Bacteria 1146
174 Ga0105239_10000839 3300010375 Bacteria 43658
175 Ga0105239_10193698 3300010375 Bacteria 2276
176 Ga0105246_10015011 3300011119 Bacteria 4880
177 Ga0157373_10007217 3300013100 Bacteria 8287
178 Ga0157373_10007637 3300013100 Bacteria 8031
179 Ga0157370_10000335 3300013104 Bacteria 59202
180 Ga0157370_10010674 3300013104 Bacteria 9662
181 Ga0157370_10012653 3300013104 Bacteria 8740
182 Ga0157370_10103245 3300013104 Bacteria 2669
183 Ga0157370_10391672 3300013104 Bacteria 1279
184 Ga0157369_10087235 3300013105 Bacteria 3332
185 Ga0157369_10130823 3300013105 Bacteria 2660
186 Ga0157374_10849957 3300013296 Bacteria 929
187 Ga0157378_10019428 3300013297 Bacteria 5973
188 Ga0163162_10103461 3300013306 Bacteria 2942
189 Ga0163162_10374249 3300013306 Bacteria 1557
190 Ga0163162_10458776 3300013306 Bacteria 1406
191 Ga0163162_10778671 3300013306 Bacteria 1075
192 Ga0157375_10080404 3300013308 Unclassified 3297
193 Ga0157375_10443723 3300013308 Bacteria 1463
194 Ga0163163_11220184 3300014325 Bacteria 815
195 Ga0163163_11304906 3300014325 Bacteria 788
196 Ga0157380_10073032 3300014326 Bacteria 2780
197 Ga0182008_10000377 3300014497 Bacteria 34436
198 Ga0182008_10003201 3300014497 Bacteria 10002
199 Ga0182008_10018577 3300014497 Bacteria 3599
200 Ga0182008_10036097 3300014497 Bacteria 2474
201 Ga0182008_10149717 3300014497 Bacteria 1170
202 Ga0157379_10340472 3300014968 Bacteria 1372
203 Ga0157379_10364488 3300014968 Bacteria 1325
204 Ga0157376_10114077 3300014969 Unclassified 2383
205 Ga0182006_1006091 3300015261 Bacteria 5641
206 Ga0182007_10002571 3300015262 Bacteria 8935
207 Ga0182007_10006498 3300015262 Bacteria 5015
208 Ga0163161_10003570 3300017792 Bacteria 10894
209 Ga0163161_10009160 3300017792 Bacteria 6841
210 Ga0206353_10735147 3300020082 Bacteria 1626
211 Ga0213874_10001796 3300021377 Bacteria 4504
212 Ga0213876_10008528 3300021384 Bacteria 5548
213 Ga0213876_10150104 3300021384 Bacteria 1239
214 Ga0213875_10006049 3300021388 Bacteria 6407
215 Ga0228711_1000090 3300022739 Bacteria 71335
216 Ga0209759_1008336 3300025256 Bacteria 3240
217 Ga0209129_1001072 3300025258 Bacteria 16142
218 Ga0209673_1001085 3300025273 Bacteria 30631
219 Ga0209675_1029475 3300025291 Bacteria 1320
220 Ga0209676_1001213 3300025292 Bacteria 27426
221 Ga0209676_1024168 3300025292 Bacteria 1975
222 Ga0209025_1000049 3300025294 Bacteria 333459
223 Ga0209025_1000432 3300025294 Bacteria 82875
224 Ga0209564_1020708 3300025295 Bacteria 2398
225 Ga0209050_1001546 3300025298 Bacteria 24090
226 Ga0209050_1001665 3300025298 Bacteria 22438
227 Ga0209051_1001880 3300025303 Bacteria 16459
228 Ga0209051_1009683 3300025303 Bacteria 4942
229 Ga0209051_1013359 3300025303 Bacteria 3914
230 Ga0207656_10249042 3300025321 Bacteria 870
231 Ga0207696_1000006 3300025711 Bacteria 616498
232 Ga0207696_1021860 3300025711 Bacteria 2042
233 Ga0207655_1000077 3300025728 Bacteria 219418
234 Ga0207655_1008254 3300025728 Bacteria 6633
235 Ga0207655_1017632 3300025728 Bacteria 3840
236 Ga0207655_1027069 3300025728 Bacteria 2740
237 Ga0207713_1000724 3300025735 Bacteria 30902
238 Ga0207713_1014369 3300025735 Bacteria 4119
239 Ga0207713_1014477 3300025735 Bacteria 4096
240 Ga0207713_1043701 3300025735 Bacteria 1849
241 Ga0207713_1062936 3300025735 Bacteria 1404
242 Ga0207682_10000382 3300025893 Bacteria 20446
243 Ga0207692_10134426 3300025898 Bacteria 1400
244 Ga0207692_10470288 3300025898 Bacteria 794
245 Ga0207710_10048610 3300025900 Bacteria 1899
246 Ga0207688_10134685 3300025901 Bacteria 1450
247 Ga0207647_10057824 3300025904 Bacteria 2377
248 Ga0207645_10004537 3300025907 Bacteria 10259
249 Ga0207645_10353085 3300025907 Bacteria 984
250 Ga0207643_10022889 3300025908 Bacteria 3443
251 Ga0207684_10001749 3300025910 Bacteria 22938
252 Ga0207654_10473237 3300025911 Bacteria 881
253 Ga0207695_10009502 3300025913 Bacteria 12026
254 Ga0207695_10399770 3300025913 Bacteria 1258
255 Ga0207671_10019532 3300025914 Bacteria 5180
256 Ga0207671_10212210 3300025914 Bacteria 1515
257 Ga0207693_10049887 3300025915 Bacteria 3287
258 Ga0207663_10404956 3300025916 Bacteria 1044
259 Ga0207662_10049770 3300025918 Bacteria 2487
260 Ga0207646_10077368 3300025922 Bacteria 2973
261 Ga0207681_10010912 3300025923 Bacteria 5580
262 Ga0207681_10071399 3300025923 Bacteria 2422
263 Ga0207681_10102773 3300025923 Unclassified 2064
264 Ga0207694_10102695 3300025924 Bacteria 2267
265 Ga0207659_10387775 3300025926 Bacteria 1166
266 Ga0207659_10582071 3300025926 Unclassified 953
267 Ga0207687_10115032 3300025927 Bacteria 2003
268 Ga0207700_10015666 3300025928 Bacteria 5010
269 Ga0207700_10097728 3300025928 Bacteria 2334
270 Ga0207700_10651458 3300025928 Bacteria 939
271 Ga0207664_10141687 3300025929 Bacteria 2034
272 Ga0207644_10063063 3300025931 Bacteria 2690
273 Ga0207706_10336488 3300025933 Bacteria 1313
274 Ga0207686_10193850 3300025934 Unclassified 1450
275 Ga0207709_10072479 3300025935 Bacteria 2191
276 Ga0207709_10080881 3300025935 Bacteria 2093
277 Ga0207670_10221752 3300025936 Bacteria 1448
278 Ga0207670_10362796 3300025936 Bacteria 1150
279 Ga0207669_10002543 3300025937 Bacteria 7789
280 Ga0207704_11017236 3300025938 Bacteria 701
281 Ga0207691_10055076 3300025940 Bacteria 3626
282 Ga0207691_10055931 3300025940 Unclassified 3595
283 Ga0207711_10290821 3300025941 Bacteria 1506
284 Ga0207711_10325150 3300025941 Bacteria 1422
285 Ga0207689_10195432 3300025942 Bacteria 1670
286 Ga0207651_10029123 3300025960 Bacteria 3494
287 Ga0207651_10033973 3300025960 Bacteria 3297
288 Ga0207651_10785371 3300025960 Bacteria 843
289 Ga0207651_10817305 3300025960 Bacteria 827
290 Ga0207640_10388724 3300025981 Bacteria 1133
291 Ga0207658_10228086 3300025986 Bacteria 1571
292 Ga0207658_10606204 3300025986 Bacteria 984
293 Ga0207677_10543296 3300026023 Bacteria 1011
294 Ga0207703_10416869 3300026035 Bacteria 1249
295 Ga0207703_10736389 3300026035 Bacteria 939
296 Ga0207639_10073041 3300026041 Bacteria 2688
297 Ga0207639_11038541 3300026041 Bacteria 768
298 Ga0207708_10244090 3300026075 Bacteria 1445
299 Ga0207641_10461088 3300026088 Bacteria 1229
300 Ga0207641_10966895 3300026088 Bacteria 847
301 Ga0207648_10015626 3300026089 Bacteria 6975
302 Ga0207676_10105634 3300026095 Bacteria 2345
303 Ga0207674_10028891 3300026116 Bacteria 5845
304 Ga0207674_10775829 3300026116 Bacteria 925
305 Ga0207675_100976810 3300026118 Bacteria 865
306 Ga0207683_10020747 3300026121 Bacteria 5621
307 Ga0207683_10324636 3300026121 Bacteria 1410
308 Ga0207683_10492906 3300026121 Bacteria 1131
309 Ga0209589_1000007 3300027357 Bacteria 425699
310 Ga0209489_100008 3300027361 Bacteria 425699
311 Ga0209700_100009 3300027363 Bacteria 425699
312 Ga0207428_10149883 3300027907 Bacteria 1776
313 Ga0207428_10481730 3300027907 Bacteria 902
314 Ga0207428_10500371 3300027907 Bacteria 883
315 Ga0207428_10505261 3300027907 Bacteria 878
316 Ga0268266_10061575 3300028379 Bacteria 3237
317 Ga0268264_10000403 3300028381 Bacteria 61631
318 Ga0268264_10000429 3300028381 Bacteria 58174
319 Ga0268264_11288066 3300028381 Bacteria 741
320 Ga0265316_10196533 3300031344 Bacteria 1497
321 Ga0307408_100009897 3300031548 Bacteria 6282
322 Ga0307408_100040524 3300031548 Bacteria 3298
323 Ga0307408_100816641 3300031548 Bacteria 847
324 Ga0307508_10122188 3300031616 Bacteria 2207
325 Ga0307516_10070237 3300031730 Bacteria 3366
326 Ga0307413_10556454 3300031824 Unclassified 931
327 Ga0307406_10482218 3300031901 Bacteria 1002
328 Ga0307412_10021171 3300031911 Bacteria 3968
329 Ga0307412_10858724 3300031911 Bacteria 792
330 Ga0307409_100207361 3300031995 Bacteria 1759
331 Ga0307416_100704861 3300032002 Bacteria 1099
332 Ga0307414_10018264 3300032004 Bacteria 4312
333 Ga0307414_10738111 3300032004 Bacteria 894
334 Ga0307411_10748053 3300032005 Bacteria 856
335 Ga0307415_100685318 3300032126 Bacteria 923
336 Ga0307507_10073944 3300033179 Bacteria 3060
337 Ga0315911_1000007 3300033442 Bacteria 413725
338 Ga0373934_0249200 3300035086 Bacteria 734
339 Ga0373935_0401229 3300035692 Bacteria 985
340 Ga0373927_0025122 3300035695 Bacteria 3895
341 Ga0373947_0308827 3300035725 Bacteria 1056
342 Ga0373937_0058954 3300036401 Bacteria 3527
343 Ga0373937_0194573 3300036401 Bacteria 1906
344 Ga0373925_0019721 3300037068 Bacteria 4908
345 Ga0373925_0146078 3300037068 Bacteria 1854
346 Ga0395899_0012525 3300037312 Bacteria 6499
347 Ga0395899_0244942 3300037312 Bacteria 1232
348 Ga0395900_0061125 3300037418 Bacteria 3874
349 Ga0395900_0168333 3300037418 Bacteria 2232
350 Ga0395900_0302761 3300037418 Bacteria 1584
351 Ga0395898_0274127 3300037466 Bacteria 1609
352 Ga0436364_0017649 3300037853 Bacteria 4776
353 Ga0436364_0607526 3300037853 Bacteria 3493
354 Ga0395901_0118581 3300038443 Bacteria 2781
355 Ga0395901_0351714 3300038443 Bacteria 1520
356 Ga0436365_0247948 3300039437 Bacteria 48555
357 Ga0436365_0615596 3300039437 Bacteria 1527
358 Ga0436365_1690415 3300039437 Bacteria 2339
359 Ga0436365_1912359 3300039437 Bacteria 5618
360 Ga0436360_0251041 3300039438 Bacteria 909
361 Ga0436363_0106692 3300039450 Bacteria 15781
362 Ga0436363_0710564 3300039450 Bacteria 2712
363 Ga0436363_0957601 3300039450 Bacteria 1668
364 Ga0439438_000163 3300041405 Bacteria 30548
365 Ga0439438_000737 3300041405 Bacteria 14700
366 Ga0439438_013856 3300041405 Bacteria 2416
367 Ga0439447_000211 3300041407 Bacteria 20579
368 Ga0439447_061219 3300041407 Bacteria 885
369 Ga0439447_086358 3300041407 Bacteria 722
370 Ga0439466_0018776 3300041411 Bacteria 2478
371 Ga0439466_0050089 3300041411 Bacteria 1370
372 Ga0451853_1495030 3300041512 Bacteria 13527
373 Ga0439445_0111969 3300042004 Bacteria 779
374 Ga0439432_023075 3300042006 Bacteria 2051
375 Ga0439451_000757 3300042009 Bacteria 6135
376 Ga0439451_042068 3300042009 Bacteria 917
377 Ga0439452_001610 3300042010 Bacteria 8922
378 Ga0439456_001175 3300042013 Bacteria 5195
379 Ga0439456_004550 3300042013 Bacteria 2804
380 Ga0439456_063682 3300042013 Bacteria 812
381 Ga0450911_000117 3300042115 Bacteria 31836
382 Ga0450911_009912 3300042115 Bacteria 1326
383 Ga0450920_022032 3300042122 Bacteria 1233
384 Ga0450902_009128 3300042137 Bacteria 1559
385 Ga0450903_000724 3300042138 Bacteria 6533
386 Ga0450903_007618 3300042138 Bacteria 1778
387 Ga0450903_016007 3300042138 Bacteria 1178
388 Ga0450905_006389 3300042142 Bacteria 1594
389 Ga0450905_025767 3300042142 Bacteria 886
390 Ga0450906_021269 3300042145 Bacteria 1160
391 Ga0450907_000283 3300042146 Bacteria 17199
392 Ga0450908_000101 3300042184 Bacteria 17206
393 Ga0439434_0146557 3300042435 Bacteria 780
394 Ga0439460_0003018 3300042461 Bacteria 4063
395 Ga0466966_0043244 3300044684 Bacteria 2889
396 Ga0466961_0307696 3300044693 Bacteria 967
397 Ga0453684_0015372 3300044712 Bacteria 12117
398 Ga0466968_0000008 3300044735 Bacteria 73540
399 Ga0466970_0104087 3300044765 Bacteria 1547
400 Ga0466957_0045017 3300044842 Bacteria 2675
401 Ga0466960_0032713 3300044901 Bacteria 2411
402 Ga0466959_0140759 3300045049 Bacteria 1705
403 Ga0466959_0754691 3300045049 Bacteria 651
404 Ga0451576_0302602 3300045051 Bacteria 1673
405 Ga0466958_0048891 3300045836 Bacteria 2557
406 Ga0466958_0356370 3300045836 Bacteria 942
407 Ga0466967_0094486 3300045976 Bacteria 2723
408 Ga0466967_0094767 3300045976 Bacteria 2719
409 Ga0495617_000633 3300046452 Bacteria 17644
410 Ga0495617_003137 3300046452 Bacteria 6293
411 Ga0495617_033296 3300046452 Bacteria 1729
412 Ga0495617_087949 3300046452 Bacteria 1015
413 Ga0495627_001773 3300046453 Bacteria 11594
414 Ga0495627_026356 3300046453 Bacteria 1875
415 Ga0495603_0010415 3300046455 Bacteria 5631
416 Ga0495603_0092043 3300046455 Bacteria 1772
417 Ga0495590_0014969 3300046457 Bacteria 2824
418 Ga0495590_0027762 3300046457 Bacteria 1985
419 Ga0495590_0044585 3300046457 Bacteria 1546
420 Ga0495591_000730 3300046458 Bacteria 23791
421 Ga0495591_001059 3300046458 Bacteria 18504
422 Ga0495629_0392073 3300046459 Bacteria 944
423 Ga0495638_0011540 3300046460 Bacteria 6085
424 Ga0495638_0016359 3300046460 Bacteria 4969
425 Ga0495638_0043614 3300046460 Bacteria 2829
426 Ga0495638_0082168 3300046460 Bacteria 1954
427 Ga0495638_0109477 3300046460 Bacteria 1642
428 Ga0495638_0397002 3300046460 Bacteria 716
429 Ga0495653_0001150 3300046463 Bacteria 20361
430 Ga0495650_0001328 3300046471 Bacteria 24822
431 Ga0495650_0002139 3300046471 Bacteria 16815
432 Ga0495650_0008143 3300046471 Bacteria 6169
433 Ga0495650_0020467 3300046471 Bacteria 3225
434 Ga0495650_0100398 3300046471 Unclassified 1087
435 Ga0495580_0002934 3300046472 Bacteria 14643
436 Ga0495605_0001099 3300046474 Bacteria 18029
437 Ga0495605_0001937 3300046474 Bacteria 13167
438 Ga0495605_0002177 3300046474 Bacteria 12245
439 Ga0495605_0016277 3300046474 Bacteria 4027
440 Ga0495605_0034203 3300046474 Bacteria 2574
441 Ga0495605_0082552 3300046474 Bacteria 1501
442 Ga0495639_0075898 3300046475 Bacteria 1559
443 Ga0495584_0000851 3300046491 Bacteria 19724
444 Ga0495584_0023748 3300046491 Bacteria 3108
445 Ga0495584_0037424 3300046491 Bacteria 2452
446 Ga0495584_0113452 3300046491 Bacteria 1371
447 Ga0495585_0010531 3300046492 Bacteria 5500
448 Ga0495594_0007401 3300046499 Bacteria 5648
449 Ga0495594_0013066 3300046499 Bacteria 4330
450 Ga0495596_0000421 3300046500 Bacteria 27052
451 Ga0495607_0063801 3300046501 Bacteria 2082
452 Ga0495607_0188944 3300046501 Bacteria 1027
453 Ga0495607_0272920 3300046501 Bacteria 805
454 Ga0495583_0000172 3300046506 Bacteria 109791
455 Ga0495583_0011494 3300046506 Bacteria 5078
456 Ga0495583_0015244 3300046506 Bacteria 4189
457 Ga0495583_0052429 3300046506 Bacteria 1856
458 Ga0495606_0001019 3300046507 Bacteria 40637
459 Ga0495610_0009130 3300046512 Bacteria 6309
460 Ga0495610_0113762 3300046512 Bacteria 1195
461 Ga0495616_0000456 3300046513 Bacteria 31180
462 Ga0495616_0006807 3300046513 Bacteria 6888
463 Ga0495616_0092756 3300046513 Bacteria 1427
464 Ga0495620_0000006 3300046515 Bacteria 273098
465 Ga0495620_0001273 3300046515 Bacteria 15374
466 Ga0495620_0004743 3300046515 Bacteria 7645
467 Ga0495630_0020504 3300046517 Bacteria 4874
468 Ga0495630_0603503 3300046517 Bacteria 841
469 Ga0495631_0066030 3300046518 Bacteria 1565
470 Ga0495631_0260185 3300046518 Bacteria 739
471 Ga0495632_0000031 3300046519 Bacteria 166613
472 Ga0495632_0000170 3300046519 Bacteria 66918
473 Ga0495632_0001021 3300046519 Bacteria 24197
474 Ga0495632_0002096 3300046519 Bacteria 15613
475 Ga0495637_0000799 3300046520 Bacteria 20925
476 Ga0495637_0001764 3300046520 Bacteria 12389
477 Ga0495637_0009093 3300046520 Bacteria 4853
478 Ga0495637_0043837 3300046520 Bacteria 1907
479 Ga0495643_0012198 3300046522 Bacteria 5191
480 Ga0495643_0013461 3300046522 Bacteria 4892
481 Ga0495643_0022047 3300046522 Bacteria 3641
482 Ga0495643_0129090 3300046522 Bacteria 1270
483 Ga0495644_0210516 3300046523 Bacteria 750
484 Ga0495648_0000267 3300046524 Bacteria 58885
485 Ga0495648_0000402 3300046524 Bacteria 47633
486 Ga0495648_0014286 3300046524 Bacteria 5821
487 Ga0495648_0015925 3300046524 Bacteria 5434
488 Ga0495648_0032837 3300046524 Bacteria 3399
489 Ga0495666_0002052 3300046526 Bacteria 9969
490 Ga0495666_0040601 3300046526 Bacteria 2255
491 Ga0495642_0000584 3300046528 Bacteria 18271
492 Ga0495642_0000977 3300046528 Bacteria 13311
493 Ga0495654_0010877 3300046530 Bacteria 4943
494 Ga0495654_0061793 3300046530 Bacteria 1797
495 Ga0495654_0099023 3300046530 Bacteria 1344
496 Ga0495654_0124773 3300046530 Bacteria 1161
497 Ga0495665_0011202 3300046531 Bacteria 4856
498 Ga0495665_0058750 3300046531 Bacteria 2030
499 Ga0495587_0000835 3300046536 Bacteria 20361
500 Ga0495598_0008123 3300046537 Unclassified 2434
501 Ga0495609_0000552 3300046538 Bacteria 29569
502 Ga0495609_0001596 3300046538 Bacteria 14815
503 Ga0495609_0016775 3300046538 Bacteria 3410
504 Ga0495609_0030749 3300046538 Bacteria 2444
505 Ga0495621_0021407 3300046539 Unclassified 2131
506 Ga0495621_0193580 3300046539 Bacteria 816
507 Ga0495597_0004922 3300046542 Bacteria 7183
508 Ga0495597_0021913 3300046542 Bacteria 2967
509 Ga0495597_0078768 3300046542 Bacteria 1411
510 Ga0495622_0013456 3300046557 Bacteria 3795
511 Ga0495622_0315722 3300046557 Bacteria 679
512 Ga0495633_0002829 3300046558 Bacteria 11955
513 Ga0495633_0042079 3300046558 Bacteria 2171
514 Ga0495633_0140577 3300046558 Bacteria 1116
515 Ga0495656_0014112 3300046615 Bacteria 2988
516 Ga0495656_0076937 3300046615 Bacteria 1496
517 Ga0495668_0001425 3300046616 Bacteria 23196
518 Ga0495634_0000347 3300046642 Bacteria 44864
519 Ga0495611_0132362 3300046648 Bacteria 1163
520 Ga0495625_0005230 3300046660 Bacteria 11945
521 Ga0495625_0010607 3300046660 Bacteria 7602
522 Ga0495625_0089038 3300046660 Bacteria 2137
523 Ga0495625_0113577 3300046660 Bacteria 1849
524 Ga0495625_0156972 3300046660 Bacteria 1526
525 Ga0495635_0000402 3300046663 Bacteria 27473
526 Ga0495635_0564407 3300046663 Bacteria 745
527 Ga0495659_0000252 3300046664 Bacteria 22168
528 Ga0495659_0002938 3300046664 Bacteria 5474
529 Ga0495659_0146539 3300046664 Bacteria 945
530 Ga0495661_0036598 3300046665 Bacteria 3071
531 Ga0495661_0109816 3300046665 Bacteria 1538
532 Ga0495661_0116931 3300046665 Bacteria 1478
533 Ga0495661_0156942 3300046665 Bacteria 1224
534 Ga0495588_0000444 3300046674 Bacteria 20968
535 Ga0495588_0002335 3300046674 Bacteria 8133
536 Ga0495588_0476177 3300046674 Bacteria 655
537 Ga0495646_0000541 3300046680 Bacteria 20361
538 Ga0495658_0577562 3300046683 Bacteria 720
539 Ga0495669_0000022 3300046684 Bacteria 117864
540 Ga0495669_0000576 3300046684 Bacteria 16289
541 Ga0495669_0006562 3300046684 Bacteria 4864
542 Ga0495669_0155276 3300046684 Bacteria 1084
543 Ga0495624_0150196 3300046690 Bacteria 1425
544 Ga0495624_0173755 3300046690 Bacteria 1314
545 Ga0495670_0001231 3300046691 Bacteria 12472
546 Ga0495670_0004594 3300046691 Bacteria 6777
547 Ga0495670_0092196 3300046691 Bacteria 1551
548 Ga0495670_0176837 3300046691 Bacteria 1125
549 Ga0495671_0002464 3300046692 Bacteria 11679
550 Ga0495671_0002792 3300046692 Bacteria 10923
551 Ga0495649_0000106 3300046694 Bacteria 74615
552 Ga0495649_0000811 3300046694 Bacteria 25193
553 Ga0495649_0031264 3300046694 Bacteria 2936
554 Ga0495589_0008767 3300046794 Bacteria 5263
555 Ga0495589_0015375 3300046794 Bacteria 3939
556 Ga0495589_0024430 3300046794 Bacteria 3072
557 Ga0495660_0013968 3300046810 Bacteria 4655
558 Ga0495660_0017097 3300046810 Bacteria 4176
559 Ga0495660_0022090 3300046810 Bacteria 3636
560 Ga0495660_0066028 3300046810 Bacteria 1930
561 Ga0495660_0127284 3300046810 Bacteria 1281
562 Ga0495660_0127579 3300046810 Bacteria 1279
563 Ga0495660_0281446 3300046810 Bacteria 760
564 Ga0495604_0012438 3300047317 Bacteria 6769
565 Ga0495604_0094408 3300047317 Bacteria 2211
566 Ga0495636_0000436 3300047318 Bacteria 15466
567 Ga0495636_0002142 3300047318 Bacteria 7584
568 Ga0495674_0076560 3300047319 Bacteria 2877
569 Ga0495672_0000357 3300047320 Bacteria 58589
570 Ga0495672_0000987 3300047320 Bacteria 29395
571 Ga0495672_0003208 3300047320 Bacteria 14216
572 Ga0495672_0005169 3300047320 Bacteria 10418
573 Ga0495672_0141779 3300047320 Bacteria 1254
574 Ga0495672_0161133 3300047320 Bacteria 1153
575 Ga0495672_0194306 3300047320 Bacteria 1018
576 Ga0495676_0000456 3300047321 Bacteria 33576
577 Ga0495683_0005131 3300047323 Bacteria 7298
578 Ga0495683_0005677 3300047323 Bacteria 6893
579 Ga0495683_0057323 3300047323 Bacteria 1936
580 Ga0495683_0113173 3300047323 Bacteria 1293
581 Ga0495683_0196426 3300047323 Bacteria 912
582 Ga0495687_000159 3300047443 Bacteria 101178
583 Ga0495687_000343 3300047443 Bacteria 59599
584 Ga0495687_002486 3300047443 Bacteria 14699
585 Ga0495677_0000308 3300047445 Bacteria 21215
586 Ga0495679_025105 3300047446 Bacteria 1997
587 Ga0495685_054055 3300047447 Bacteria 1359
588 Ga0495685_056544 3300047447 Bacteria 1326
589 Ga0495673_0000142 3300047469 Bacteria 128538
590 Ga0495673_0001971 3300047469 Bacteria 15192
591 Ga0495673_0013732 3300047469 Bacteria 4239
592 Ga0495673_0022217 3300047469 Bacteria 3113
593 Ga0495681_0011182 3300047470 Bacteria 5367
594 Ga0495681_0013602 3300047470 Bacteria 4710
595 Ga0495681_0068702 3300047470 Bacteria 1611
596 Ga0495681_0219752 3300047470 Bacteria 762
597 Ga0495593_0000536 3300047673 Bacteria 21520
598 Ga0495593_0003207 3300047673 Bacteria 9813
599 Ga0495593_0054980 3300047673 Bacteria 2097
600 Ga0495593_0142471 3300047673 Bacteria 1214
601 Ga0495602_0077339 3300048088 Bacteria 2816
602 Ga0495614_0000445 3300048089 Bacteria 16992
603 Ga0495626_0002671 3300048091 Bacteria 12079
604 Ga0495626_0002800 3300048091 Bacteria 11693
605 Ga0495626_0011624 3300048091 Bacteria 4648
606 Ga0495626_0014962 3300048091 Bacteria 3980
607 Ga0495626_0021804 3300048091 Bacteria 3171
608 Ga0496102_0000444 3300048905 Bacteria 47025
609 Ga0496102_0344646 3300048905 Bacteria 1403
610 Ga0496103_0000290 3300048906 Bacteria 47006
611 Ga0496103_0067436 3300048906 Bacteria 2235
612 Ga0496103_0424747 3300048906 Bacteria 853
613 Ga0496105_0489775 3300048908 Bacteria 966
614 Ga0496106_0001400 3300048909 Bacteria 18078
615 Ga0496106_0040227 3300048909 Bacteria 3501
616 Ga0496106_0095899 3300048909 Bacteria 2295
617 Ga0496107_0390987 3300048910 Bacteria 1034
618 Ga0496108_0349077 3300048911 Bacteria 1291
619 Ga0496110_0048556 3300048913 Bacteria 3721
620 Ga0496112_0368077 3300048915 Bacteria 1379
621 Ga0496112_0613369 3300048915 Bacteria 1019
622 Ga0496114_0015450 3300048917 Bacteria 6141
623 Ga0496114_0076715 3300048917 Bacteria 2816
624 Ga0496114_0269582 3300048917 Bacteria 1500
625 Ga0496114_0271380 3300048917 Bacteria 1495
626 Ga0496114_0478191 3300048917 Bacteria 1102
627 Ga0496115_0018008 3300048918 Bacteria 5412
628 Ga0496115_0646931 3300048918 Bacteria 836
629 Ga0496116_0000231 3300048919 Bacteria 103493
630 Ga0496116_0001738 3300048919 Bacteria 23730
631 Ga0496116_0012086 3300048919 Bacteria 7075
632 Ga0496116_0021642 3300048919 Bacteria 4842
633 Ga0496117_0000428 3300048920 Bacteria 70517
634 Ga0496117_0000460 3300048920 Bacteria 68039
635 Ga0496117_0005335 3300048920 Bacteria 13552
636 Ga0496117_0069886 3300048920 Bacteria 2362
637 Ga0496117_0155803 3300048920 Bacteria 1345
638 Ga0496117_0169612 3300048920 Bacteria 1268
639 Ga0496118_0000106 3300048921 Bacteria 155884
640 Ga0496118_0001373 3300048921 Bacteria 36687
641 Ga0496118_0002522 3300048921 Bacteria 24575
642 Ga0496118_0004391 3300048921 Bacteria 16756
643 Ga0496118_0036942 3300048921 Bacteria 3940
644 Ga0496118_0042526 3300048921 Bacteria 3583
645 Ga0496118_0131345 3300048921 Bacteria 1607
646 Ga0496118_0214010 3300048921 Bacteria 1128
647 Ga0496119_0024932 3300048922 Bacteria 4190
648 Ga0496119_0057100 3300048922 Bacteria 2361
649 Ga0496119_0145051 3300048922 Bacteria 1278
650 Ga0496121_0000233 3300048924 Bacteria 119434
651 Ga0496121_0000602 3300048924 Bacteria 67586
652 Ga0496121_0002550 3300048924 Bacteria 27617
653 Ga0496121_0034085 3300048924 Bacteria 4589
654 Ga0496121_0038513 3300048924 Bacteria 4231
655 Ga0496121_0040873 3300048924 Bacteria 4062
656 Ga0496121_0046322 3300048924 Bacteria 3723
657 Ga0496121_0058950 3300048924 Bacteria 3169
658 Ga0496121_0068058 3300048924 Bacteria 2883
659 Ga0496121_0108695 3300048924 Bacteria 2121
660 Ga0496121_0146496 3300048924 Bacteria 1744
661 Ga0496121_0207410 3300048924 Bacteria 1391
662 Ga0496121_0218056 3300048924 Bacteria 1346
663 Ga0496121_0241898 3300048924 Bacteria 1257
664 Ga0496121_0338216 3300048924 Bacteria 1007
665 Ga0496121_0382764 3300048924 Bacteria 927
666 Ga0496122_0000582 3300048925 Bacteria 74845
667 Ga0496122_0003924 3300048925 Bacteria 19025
668 Ga0496122_0028198 3300048925 Bacteria 4774
669 Ga0496122_0052736 3300048925 Bacteria 3075
670 Ga0496122_0244818 3300048925 Bacteria 1008
671 Ga0496122_0296592 3300048925 Bacteria 874
672 Ga0496122_0302168 3300048925 Bacteria 862
673 Ga0496123_0000479 3300048926 Bacteria 69250
674 Ga0496123_0001070 3300048926 Bacteria 41381
675 Ga0496123_0151128 3300048926 Bacteria 1253
676 Ga0496123_0184946 3300048926 Bacteria 1084
677 Ga0496124_0000036 3300048927 Bacteria 318032
678 Ga0496124_0002300 3300048927 Bacteria 25227
679 Ga0496124_0007825 3300048927 Bacteria 11281
680 Ga0496124_0041675 3300048927 Bacteria 3959
681 Ga0496124_0053031 3300048927 Bacteria 3441
682 Ga0496124_0087639 3300048927 Bacteria 2546
683 Ga0496124_0096438 3300048927 Bacteria 2402
684 Ga0496124_0178078 3300048927 Bacteria 1639
685 Ga0496125_0000038 3300048928 Bacteria 328120
686 Ga0496125_0015470 3300048928 Bacteria 7376
687 Ga0496125_0033974 3300048928 Bacteria 4503
688 Ga0496125_0043559 3300048928 Bacteria 3806
689 Ga0496125_0053328 3300048928 Bacteria 3316
690 Ga0496125_0060589 3300048928 Bacteria 3040
691 Ga0496125_0212054 3300048928 Bacteria 1257
692 Ga0496125_0274507 3300048928 Bacteria 1048
693 Ga0496126_0001857 3300048929 Bacteria 30790
694 Ga0496126_0019278 3300048929 Bacteria 6721
695 Ga0496126_0029405 3300048929 Bacteria 5220
696 Ga0496126_0031802 3300048929 Bacteria 4979
697 Ga0496126_0048088 3300048929 Bacteria 3901
698 Ga0496126_0085695 3300048929 Bacteria 2777
699 Ga0496126_0104389 3300048929 Bacteria 2476
700 Ga0496126_0555464 3300048929 Bacteria 910
701 Ga0495678_004472 3300049459 Bacteria 8073
702 Ga0495678_008649 3300049459 Bacteria 5116
703 Ga0495678_014566 3300049459 Bacteria 3652
704 Ga0495678_037128 3300049459 Bacteria 1982
705 Ga0495678_042992 3300049459 Bacteria 1797
706 Ga0495678_080193 3300049459 Bacteria 1173
707 Ga0495682_0000057 3300049460 Bacteria 102695
708 Ga0495682_0000497 3300049460 Bacteria 27198
709 Ga0495682_0000755 3300049460 Bacteria 20873
710 Ga0495682_0013167 3300049460 Bacteria 3153
711 Ga0495682_0022002 3300049460 Bacteria 2387
712 Ga0501033_0449075 3300049570 Bacteria 896
713 Ga0501038_0383047 3300049574 Bacteria 1091
714 Ga0501039_0229305 3300049575 Bacteria 1460
715 Ga0501041_0186625 3300049577 Bacteria 1299
716 Ga0501047_0172843 3300049581 Bacteria 2029
717 Ga0501047_0332511 3300049581 Bacteria 1358
718 Ga0501047_0747653 3300049581 Bacteria 794
719 Ga0501072_0000980 3300049588 Bacteria 21092
720 Ga0501076_0054908 3300049592 Bacteria 3158
721 Ga0501081_0092147 3300049743 Bacteria 2132
722 Ga0501083_0111255 3300049744 Bacteria 1800
723 Ga0501083_0636818 3300049744 Unclassified 693
724 Ga0501035_0058359 3300049822 Bacteria 3439
725 Ga0501044_0018701 3300049823 Bacteria 7420
726 Ga0501044_0101349 3300049823 Bacteria 2897
727 Ga0501045_0513342 3300049824 Bacteria 890
728 nmdc:mga03683_133221_c1 3300050489 Bacteria 1113
729 nmdc:mga03683_306335_c1 3300050489 Bacteria 746
730 nmdc:mga03683_64866_c1 3300050489 Bacteria 1551
731 nmdc:mga03683_65817_c1 3300050489 Bacteria 1540
732 nmdc:mga03n38_10883_c1 3300050490 Bacteria 3368
733 nmdc:mga03n38_187252_c1 3300050490 Bacteria 1064
734 nmdc:mga03n38_246124_c1 3300050490 Bacteria 943
735 nmdc:mga03n38_30608_c1 3300050490 Bacteria 2264
736 nmdc:mga00v17_190318_c1 3300050491 Bacteria 1325
737 nmdc:mga00v17_230353_c1 3300050491 Bacteria 1200
738 nmdc:mga00v17_2321_c1 3300050491 Bacteria 9740
739 nmdc:mga00v17_36690_c2 3300050491 Unclassified 1994
740 nmdc:mga00v17_445192_c1 3300050491 Bacteria 841
741 nmdc:mga00v17_97197_c1 3300050491 Bacteria 1856
742 nmdc:mga0yw44_140905_c1 3300050492 Bacteria 1567
743 nmdc:mga0yw44_4500_c1 3300050492 Bacteria 6406
744 nmdc:mga0k408_164479_c1 3300050493 Bacteria 1322
745 nmdc:mga0k408_80734_c1 3300050493 Bacteria 1904
746 nmdc:mga06z11_20687_c1 3300050494 Bacteria 3045
747 nmdc:mga06z11_339634_c1 3300050494 Bacteria 898
748 nmdc:mga07m45_123815_c1 3300050496 Bacteria 1494
749 nmdc:mga07m45_43444_c1 3300050496 Bacteria 2520
750 nmdc:mga07m45_9626_c1 3300050496 Bacteria 5022
751 nmdc:mga05p37_305676_c1 3300050507 Bacteria 1000
752 nmdc:mga09592_728_c1 3300050508 Bacteria 25328
753 nmdc:mga0qj67_27874_c1 3300050509 Bacteria 4380
754 nmdc:mga06r32_529118_c1 3300050510 Bacteria 1154
755 nmdc:mga0n895_107513_c1 3300050512 Bacteria 2803
756 nmdc:mga0n895_209856_c1 3300050512 Bacteria 1978
757 nmdc:mga0n895_277879_c1 3300050512 Bacteria 1698
758 nmdc:mga0n895_543892_c1 3300050512 Bacteria 1167
759 nmdc:mga0rr50_481794_c1 3300050513 Bacteria 1054
760 nmdc:mga08x19_84623_c2 3300050514 Bacteria 1097
761 nmdc:mga0a205_751896_c1 3300050515 Bacteria 823
762 nmdc:mga0sz30_263700_c1 3300050516 Bacteria 767
763 Ga0500610_0000141 3300053079 Bacteria 21515
764 Ga0500635_0085252 3300053080 Bacteria 1141
765 Ga0500643_010084 3300053087 Bacteria 3548
766 Ga0500643_044372 3300053087 Bacteria 1292
767 Ga0500644_0003496 3300053088 Bacteria 3891
768 Ga0500644_0008007 3300053088 Bacteria 2773
769 Ga0500581_063378 3300053089 Bacteria 1868
770 Ga0500651_0000099 3300053093 Bacteria 53568
771 Ga0500651_0103858 3300053093 Bacteria 1740
772 Ga0500566_0000214 3300053094 Bacteria 30715
773 Ga0500566_0008235 3300053094 Bacteria 6170
774 Ga0500650_0030296 3300053098 Bacteria 2453
775 Ga0500556_0000216 3300053104 Bacteria 46888
776 Ga0500560_003344 3300053107 Bacteria 3231
777 Ga0500562_001385 3300053108 Bacteria 5981
778 Ga0500569_006309 3300053109 Bacteria 2599
779 Ga0500569_036810 3300053109 Bacteria 1411
780 Ga0500571_000006 3300053110 Bacteria 105538
781 Ga0500597_004806 3300053120 Bacteria 4256
782 Ga0500608_065151 3300053122 Bacteria 1738
783 Ga0500618_001190 3300053125 Bacteria 12512
784 Ga0500642_0000012 3300053130 Bacteria 206424
785 Ga0500642_0308788 3300053130 Bacteria 712
786 Ga0500652_000403 3300053131 Bacteria 15465
787 Ga0500655_000056 3300053133 Bacteria 30742
788 Ga0500658_0000091 3300053134 Bacteria 41865
789 Ga0500658_0022293 3300053134 Bacteria 2406
790 Ga0500659_0001844 3300053135 Bacteria 13201
791 Ga0500559_0000167 3300053136 Bacteria 51877
792 Ga0500568_0001627 3300053139 Bacteria 14157
793 Ga0500574_000057 3300053141 Bacteria 12891
794 Ga0500586_000481 3300053145 Bacteria 8013
795 Ga0500604_0005154 3300053151 Bacteria 3450
796 Ga0500616_0000515 3300053153 Bacteria 48965
797 Ga0500616_0049606 3300053153 Bacteria 2220
798 Ga0500619_034805 3300053154 Bacteria 1559
799 Ga0500622_0002295 3300053156 Bacteria 14006
800 Ga0500627_0075634 3300053158 Bacteria 1496
801 Ga0500634_0012052 3300053161 Bacteria 4490
802 Ga0500636_0009790 3300053177 Bacteria 5581
803 Ga0500636_0049435 3300053177 Bacteria 2474
804 Ga0500645_068054 3300053730 Bacteria 1024
805 Ga0501084_0354427 3300054114 Bacteria 1239
806 Ga0501082_0301212 3300060353 Bacteria 1396

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0382764 Ga0496121_0382764_17_502 160
2 3300005355 Ga0070671_101363638 Ga0070671_1013636381 172
3 3300031824 Ga0307413_10556454 Ga0307413_105564541 173
4 3300032004 Ga0307414_10018264 Ga0307414_100182644 173
5 3300045051 Ga0451576_0302602 Ga0451576_0302602_364_960 173
6 3300046674 Ga0495588_0002335 Ga0495588_0002335_1254_1850 175
7 3300046690 Ga0495624_0150196 Ga0495624_0150196_604_1200 175
8 3300047321 Ga0495676_0000456 Ga0495676_0000456_31602_32198 175
9 3300047673 Ga0495593_0003207 Ga0495593_0003207_7493_8089 175
10 3300048088 Ga0495602_0077339 Ga0495602_0077339_551_1147 175
11 3300048089 Ga0495614_0000445 Ga0495614_0000445_2101_2697 175
12 3300053087 Ga0500643_010084 Ga0500643_010084_297_893 175
13 3300053093 Ga0500651_0000099 Ga0500651_0000099_10182_10778 175
14 3300053094 Ga0500566_0008235 Ga0500566_0008235_1829_2425 175
15 3300053107 Ga0500560_003344 Ga0500560_003344_1147_1743 175
16 3300053110 Ga0500571_000006 Ga0500571_000006_33496_34092 175
17 3300053120 Ga0500597_004806 Ga0500597_004806_1048_1644 175
18 3300053134 Ga0500658_0000091 Ga0500658_0000091_32811_33407 175
19 3300053141 Ga0500574_000057 Ga0500574_000057_6144_6740 175
20 3300053161 Ga0500634_0012052 Ga0500634_0012052_2110_2706 175
21 3300053177 Ga0500636_0049435 Ga0500636_0049435_1212_1808 175
22 3300048924 Ga0496121_0000233 Ga0496121_0000233_92417_93013 177
23 3300048929 Ga0496126_0001857 Ga0496126_0001857_3952_4548 177
24 3300003187 JGI25151J46595_10015039 JGI25151J46595_100150393 178
25 3300005518 Ga0070699_100450385 Ga0070699_1004503851 178
26 3300025294 Ga0209025_1000049 Ga0209025_1000049148 178
27 3300053079 Ga0500610_0000141 Ga0500610_0000141_4883_5479 178
28 3300053133 Ga0500655_000056 Ga0500655_000056_14837_15433 179
29 3300046471 Ga0495650_0100398 Ga0495650_0100398_216_812 182
30 3300006058 Ga0075432_10018168 Ga0075432_100181683 183
31 3300027907 Ga0207428_10481730 Ga0207428_104817302 183
32 3300048915 Ga0496112_0613369 Ga0496112_0613369_408_1001 183
33 3300048924 Ga0496121_0146496 Ga0496121_0146496_39_632 183
34 3300048928 Ga0496125_0274507 Ga0496125_0274507_309_923 183
35 3300041407 Ga0439447_061219 Ga0439447_061219_42_596 184
36 3300042004 Ga0439445_0111969 Ga0439445_0111969_30_620 184
37 3300042115 Ga0450911_000117 Ga0450911_000117_13006_13596 184
38 3300046452 Ga0495617_087949 Ga0495617_087949_35_589 184
39 3300046557 Ga0495622_0315722 Ga0495622_0315722_40_594 184
40 3300048920 Ga0496117_0000428 Ga0496117_0000428_9740_10336 184
41 3300048921 Ga0496118_0001373 Ga0496118_0001373_17908_18504 184
42 3300049459 Ga0495678_014566 Ga0495678_014566_2949_3503 184
43 3300050489 nmdc:mga03683_306335_c1 nmdc:mga03683_306335_c1_40_594 184
44 3300005355 Ga0070671_100075829 Ga0070671_1000758293 185
45 3300005985 Ga0081539_10152530 Ga0081539_101525302 185
46 3300009174 Ga0105241_10592272 Ga0105241_105922721 185
47 3300025273 Ga0209673_1001085 Ga0209673_100108510 185
48 3300025911 Ga0207654_10473237 Ga0207654_104732372 185
49 3300025931 Ga0207644_10063063 Ga0207644_100630633 185
50 3300046539 Ga0495621_0193580 Ga0495621_0193580_96_674 185
51 3300048917 Ga0496114_0478191 Ga0496114_0478191_320_898 185
52 3300048924 Ga0496121_0038513 Ga0496121_0038513_1233_1832 185
53 3300048925 Ga0496122_0302168 Ga0496122_0302168_145_744 185
54 3300048927 Ga0496124_0000036 Ga0496124_0000036_72617_73216 185
55 iso_pu_bacteria 2558860112 2558907290 185
56 iso_pu_bacteria 2894772417 2894776802 185
57 3300006051 Ga0075364_10120341 Ga0075364_101203412 186
58 3300006846 Ga0075430_100004962 Ga0075430_1000049628 186
59 3300006880 Ga0075429_100005817 Ga0075429_1000058173 186
60 3300013104 Ga0157370_10000335 Ga0157370_1000033521 186
61 3300014497 Ga0182008_10000377 Ga0182008_1000037715 186
62 3300045049 Ga0466959_0754691 Ga0466959_0754691_46_636 186
63 3300050508 nmdc:mga09592_728_c1 nmdc:mga09592_728_c1_22891_23487 186
64 3300050509 nmdc:mga0qj67_27874_c1 nmdc:mga0qj67_27874_c1_2006_2602 186
65 3300005338 Ga0068868_100829551 Ga0068868_1008295511 187
66 3300005436 Ga0070713_100393664 Ga0070713_1003936641 187
67 3300025904 Ga0207647_10057824 Ga0207647_100578243 187
68 3300025907 Ga0207645_10353085 Ga0207645_103530852 187
69 3300025915 Ga0207693_10049887 Ga0207693_100498874 187
70 3300036401 Ga0373937_0194573 Ga0373937_0194573_441_1004 187
71 3300046683 Ga0495658_0577562 Ga0495658_0577562_138_701 187
72 3300053153 Ga0500616_0049606 Ga0500616_0049606_312_905 187
73 3300009545 Ga0105237_10022573 Ga0105237_100225736 188
74 3300025292 Ga0209676_1024168 Ga0209676_10241683 188
75 3300026118 Ga0207675_100976810 Ga0207675_1009768102 188
76 3300048925 Ga0496122_0000582 Ga0496122_0000582_13656_14255 188
77 3300048926 Ga0496123_0000479 Ga0496123_0000479_60090_60689 188
78 3300003791 Ga0055530_10032187 Ga0055530_100321871 189
79 3300005539 Ga0068853_100318534 Ga0068853_1003185342 189
80 3300006871 Ga0075434_100067553 Ga0075434_1000675534 189
81 3300009093 Ga0105240_10005569 Ga0105240_100055696 189
82 3300009176 Ga0105242_10772235 Ga0105242_107722352 189
83 3300010375 Ga0105239_10000839 Ga0105239_100008396 189
84 3300025292 Ga0209676_1001213 Ga0209676_100121322 189
85 3300025298 Ga0209050_1001546 Ga0209050_100154616 189
86 3300025913 Ga0207695_10009502 Ga0207695_100095026 189
87 3300026041 Ga0207639_11038541 Ga0207639_110385412 189
88 3300042435 Ga0439434_0146557 Ga0439434_0146557_145_741 189
89 3300046524 Ga0495648_0000402 Ga0495648_0000402_16513_17085 189
90 3300046648 Ga0495611_0132362 Ga0495611_0132362_430_999 189
91 3300047469 Ga0495673_0022217 Ga0495673_0022217_1245_1814 189
92 3300048924 Ga0496121_0218056 Ga0496121_0218056_22_591 189
93 3300050512 nmdc:mga0n895_107513_c1 nmdc:mga0n895_107513_c1_226_801 189
94 3300006051 Ga0075364_10006108 Ga0075364_100061085 190
95 3300007076 Ga0075435_100123083 Ga0075435_1001230832 190
96 3300025898 Ga0207692_10470288 Ga0207692_104702882 190
97 3300032002 Ga0307416_100704861 Ga0307416_1007048613 190
98 3300035725 Ga0373947_0308827 Ga0373947_0308827_46_624 190
99 3300037068 Ga0373925_0146078 Ga0373925_0146078_541_1119 190
100 3300044712 Ga0453684_0015372 Ga0453684_0015372_7130_7717 190
101 3300046459 Ga0495629_0392073 Ga0495629_0392073_350_928 190
102 3300046475 Ga0495639_0075898 Ga0495639_0075898_734_1312 190
103 3300046501 Ga0495607_0272920 Ga0495607_0272920_94_666 190
104 3300046517 Ga0495630_0603503 Ga0495630_0603503_123_701 190
105 3300046663 Ga0495635_0564407 Ga0495635_0564407_20_598 190
106 3300048918 Ga0496115_0646931 Ga0496115_0646931_49_630 190
107 3300048919 Ga0496116_0001738 Ga0496116_0001738_17537_18151 190
108 3300053154 Ga0500619_034805 Ga0500619_034805_296_868 190
109 3300005436 Ga0070713_101365959 Ga0070713_1013659591 191
110 3300005439 Ga0070711_100546739 Ga0070711_1005467391 191
111 3300021384 Ga0213876_10150104 Ga0213876_101501042 191
112 3300025916 Ga0207663_10404956 Ga0207663_104049562 191
113 3300025928 Ga0207700_10097728 Ga0207700_100977283 191
114 3300039437 Ga0436365_1690415 Ga0436365_1690415_1378_1965 191
115 3300039450 Ga0436363_0957601 Ga0436363_0957601_482_1069 191
116 3300047673 Ga0495593_0142471 Ga0495593_0142471_74_655 191
117 3300049570 Ga0501033_0449075 Ga0501033_0449075_59_643 191
118 3300050490 nmdc:mga03n38_30608_c1 nmdc:mga03n38_30608_c1_1671_2252 191
119 3300050512 nmdc:mga0n895_277879_c1 nmdc:mga0n895_277879_c1_1038_1619 191
120 3300050515 nmdc:mga0a205_751896_c1 nmdc:mga0a205_751896_c1_166_747 191
121 iso_pu_bacteria 2643221644 2644244089 191
122 iso_pu_bacteria 2791355137 2792839136 191
123 iso_pu_bacteria 2842775625 2842779386 191
124 iso_pu_bacteria 2908739725 2908740648 191
125 iso_pu_bacteria 8004021418 8004021733 191
126 iso_pu_bacteria 8004021418 8004023809 191
127 3300002077 JGI24744J21845_10016867 JGI24744J21845_100168672 192
128 3300005288 Ga0065714_10268002 Ga0065714_102680021 192
129 3300005295 Ga0065707_10083763 Ga0065707_100837638 192
130 3300005328 Ga0070676_10075749 Ga0070676_100757492 192
131 3300005328 Ga0070676_10519996 Ga0070676_105199961 192
132 3300005330 Ga0070690_100008552 Ga0070690_1000085526 192
133 3300005331 Ga0070670_100076157 Ga0070670_1000761574 192
134 3300005334 Ga0068869_100184186 Ga0068869_1001841862 192
135 3300005335 Ga0070666_10366943 Ga0070666_103669431 192
136 3300005340 Ga0070689_100357515 Ga0070689_1003575152 192
137 3300005343 Ga0070687_100243817 Ga0070687_1002438171 192
138 3300005343 Ga0070687_100317877 Ga0070687_1003178772 192
139 3300005353 Ga0070669_100012891 Ga0070669_1000128916 192
140 3300005353 Ga0070669_100018866 Ga0070669_1000188663 192
141 3300005353 Ga0070669_100279652 Ga0070669_1002796522 192
142 3300005354 Ga0070675_100368672 Ga0070675_1003686722 192
143 3300005354 Ga0070675_101054076 Ga0070675_1010540761 192
144 3300005356 Ga0070674_100004356 Ga0070674_1000043565 192
145 3300005364 Ga0070673_100634843 Ga0070673_1006348432 192
146 3300005365 Ga0070688_100072259 Ga0070688_1000722592 192
147 3300005367 Ga0070667_100154202 Ga0070667_1001542022 192
148 3300005367 Ga0070667_100355633 Ga0070667_1003556332 192
149 3300005441 Ga0070700_100452940 Ga0070700_1004529402 192
150 3300005456 Ga0070678_100082518 Ga0070678_1000825183 192
151 3300005456 Ga0070678_100447304 Ga0070678_1004473042 192
152 3300005456 Ga0070678_100585835 Ga0070678_1005858351 192
153 3300005459 Ga0068867_100042610 Ga0068867_1000426104 192
154 3300005466 Ga0070685_10020415 Ga0070685_100204152 192
155 3300005539 Ga0068853_100611294 Ga0068853_1006112942 192
156 3300005544 Ga0070686_100034486 Ga0070686_1000344863 192
157 3300005548 Ga0070665_100382110 Ga0070665_1003821102 192
158 3300005563 Ga0068855_100014536 Ga0068855_1000145362 192
159 3300005577 Ga0068857_100324916 Ga0068857_1003249162 192
160 3300005615 Ga0070702_100195635 Ga0070702_1001956352 192
161 3300005617 Ga0068859_100468511 Ga0068859_1004685111 192
162 3300005618 Ga0068864_100111411 Ga0068864_1001114112 192
163 3300005718 Ga0068866_10293503 Ga0068866_102935032 192
164 3300005719 Ga0068861_100082903 Ga0068861_1000829033 192
165 3300005841 Ga0068863_100088352 Ga0068863_1000883525 192
166 3300005841 Ga0068863_101123489 Ga0068863_1011234891 192
167 3300005842 Ga0068858_100189830 Ga0068858_1001898301 192
168 3300006195 Ga0075366_10156790 Ga0075366_101567902 192
169 3300006237 Ga0097621_100430227 Ga0097621_1004302272 192
170 3300006358 Ga0068871_100031823 Ga0068871_1000318233 192
171 3300006931 Ga0097620_100468522 Ga0097620_1004685223 192
172 3300009094 Ga0111539_10692636 Ga0111539_106926362 192
173 3300009098 Ga0105245_10159249 Ga0105245_101592492 192
174 3300009101 Ga0105247_10097716 Ga0105247_100977162 192
175 3300009176 Ga0105242_10097873 Ga0105242_100978733 192
176 3300009177 Ga0105248_10393192 Ga0105248_103931923 192
177 3300009177 Ga0105248_10411793 Ga0105248_104117931 192
178 3300009177 Ga0105248_10597311 Ga0105248_105973112 192
179 3300013297 Ga0157378_10019428 Ga0157378_100194285 192
180 3300013306 Ga0163162_10374249 Ga0163162_103742492 192
181 3300013308 Ga0157375_10080404 Ga0157375_100804043 192
182 3300013308 Ga0157375_10443723 Ga0157375_104437233 192
183 3300014325 Ga0163163_11220184 Ga0163163_112201842 192
184 3300014325 Ga0163163_11304906 Ga0163163_113049061 192
185 3300014326 Ga0157380_10073032 Ga0157380_100730323 192
186 3300014968 Ga0157379_10340472 Ga0157379_103404722 192
187 3300014969 Ga0157376_10114077 Ga0157376_101140772 192
188 3300025258 Ga0209129_1001072 Ga0209129_10010729 192
189 3300025294 Ga0209025_1000432 Ga0209025_100043250 192
190 3300025303 Ga0209051_1001880 Ga0209051_100188010 192
191 3300025893 Ga0207682_10000382 Ga0207682_100003826 192
192 3300025901 Ga0207688_10134685 Ga0207688_101346852 192
193 3300025907 Ga0207645_10004537 Ga0207645_100045377 192
194 3300025908 Ga0207643_10022889 Ga0207643_100228893 192
195 3300025913 Ga0207695_10399770 Ga0207695_103997702 192
196 3300025918 Ga0207662_10049770 Ga0207662_100497702 192
197 3300025923 Ga0207681_10010912 Ga0207681_100109124 192
198 3300025923 Ga0207681_10071399 Ga0207681_100713993 192
199 3300025923 Ga0207681_10102773 Ga0207681_101027732 192
200 3300025926 Ga0207659_10582071 Ga0207659_105820711 192
201 3300025927 Ga0207687_10115032 Ga0207687_101150322 192
202 3300025934 Ga0207686_10193850 Ga0207686_101938502 192
203 3300025935 Ga0207709_10080881 Ga0207709_100808813 192
204 3300025936 Ga0207670_10221752 Ga0207670_102217521 192
205 3300025936 Ga0207670_10362796 Ga0207670_103627962 192
206 3300025937 Ga0207669_10002543 Ga0207669_100025436 192
207 3300025938 Ga0207704_11017236 Ga0207704_110172361 192
208 3300025940 Ga0207691_10055931 Ga0207691_100559315 192
209 3300025941 Ga0207711_10290821 Ga0207711_102908212 192
210 3300025941 Ga0207711_10325150 Ga0207711_103251502 192
211 3300025942 Ga0207689_10195432 Ga0207689_101954322 192
212 3300025960 Ga0207651_10029123 Ga0207651_100291233 192
213 3300025960 Ga0207651_10785371 Ga0207651_107853711 192
214 3300025981 Ga0207640_10388724 Ga0207640_103887242 192
215 3300025986 Ga0207658_10228086 Ga0207658_102280862 192
216 3300025986 Ga0207658_10606204 Ga0207658_106062042 192
217 3300026035 Ga0207703_10416869 Ga0207703_104168692 192
218 3300026075 Ga0207708_10244090 Ga0207708_102440902 192
219 3300026088 Ga0207641_10966895 Ga0207641_109668951 192
220 3300026089 Ga0207648_10015626 Ga0207648_100156264 192
221 3300026116 Ga0207674_10028891 Ga0207674_100288912 192
222 3300026121 Ga0207683_10020747 Ga0207683_100207475 192
223 3300026121 Ga0207683_10324636 Ga0207683_103246362 192
224 3300026121 Ga0207683_10492906 Ga0207683_104929062 192
225 3300028379 Ga0268266_10061575 Ga0268266_100615752 192
226 3300031548 Ga0307408_100009897 Ga0307408_1000098977 192
227 3300031616 Ga0307508_10122188 Ga0307508_101221883 192
228 3300031911 Ga0307412_10858724 Ga0307412_108587242 192
229 3300032126 Ga0307415_100685318 Ga0307415_1006853181 192
230 3300033179 Ga0307507_10073944 Ga0307507_100739443 192
231 3300045976 Ga0466967_0094767 Ga0466967_0094767_616_1212 192
232 3300046471 Ga0495650_0008143 Ga0495650_0008143_272_862 192
233 3300046474 Ga0495605_0082552 Ga0495605_0082552_788_1378 192
234 3300046537 Ga0495598_0008123 Ga0495598_0008123_939_1529 192
235 3300046539 Ga0495621_0021407 Ga0495621_0021407_1137_1727 192
236 3300046615 Ga0495656_0076937 Ga0495656_0076937_144_737 192
237 3300046674 Ga0495588_0476177 Ga0495588_0476177_27_617 192
238 3300047447 Ga0495685_056544 Ga0495685_056544_80_670 192
239 3300048091 Ga0495626_0002671 Ga0495626_0002671_930_1523 192
240 3300049588 Ga0501072_0000980 Ga0501072_0000980_2668_3258 192
241 3300049744 Ga0501083_0111255 Ga0501083_0111255_68_658 192
242 3300049744 Ga0501083_0636818 Ga0501083_0636818_69_659 192
243 3300049824 Ga0501045_0513342 Ga0501045_0513342_74_667 192
244 3300050493 nmdc:mga0k408_164479_c1 nmdc:mga0k408_164479_c1_51_644 192
245 3300050512 nmdc:mga0n895_543892_c1 nmdc:mga0n895_543892_c1_394_981 192
246 3300054114 Ga0501084_0354427 Ga0501084_0354427_67_657 192
247 3300060353 Ga0501082_0301212 Ga0501082_0301212_242_835 192
248 iso_pu_bacteria 2501025502 2501081030 192
249 iso_pu_bacteria 2510917013 2511091713 192
250 iso_pu_bacteria 2513237096 2513657826 192
251 iso_pu_bacteria 2513237137 2513861489 192
252 iso_pu_bacteria 2513237145 2513919824 192
253 iso_pu_bacteria 2517572143 2517895162 192
254 iso_pu_bacteria 2524023228 2524536290 192
255 iso_pu_bacteria 2643221569 2643860166 192
256 iso_pu_bacteria 2643221621 2644119994 192
257 iso_pu_bacteria 2667528175 2671121806 192
258 iso_pu_bacteria 2728368998 2728752229 192
259 iso_pu_bacteria 2738543012 2739243704 192
260 iso_pu_bacteria 2791355197 2793069117 192
261 iso_pu_bacteria 2885270888 2885273886 192
262 iso_pu_bacteria 2885374607 2885376491 192
263 iso_pu_bacteria 2903748898 2903750673 192
264 iso_pu_bacteria 2904541872 2904542158 192
265 iso_pu_bacteria 2904690495 2904698323 192
266 iso_pu_bacteria 2904699407 2904699998 192
267 iso_pu_bacteria 2906610324 2906611830 192
268 iso_pu_bacteria 2906635258 2906641048 192
269 iso_pu_bacteria 2906660503 2906665489 192
270 iso_pu_bacteria 2908756301 2908762924 192
271 iso_pu_bacteria 2922425934 2922427466 192
272 iso_pu_bacteria 2929160207 2929167443 192
273 iso_pu_bacteria 2935630451 2935637125 192
274 iso_pu_bacteria 2941507105 2941513788 192
275 iso_pu_bacteria 2941515067 2941521750 192
276 iso_pu_bacteria 2941523033 2941529680 192
277 iso_pu_bacteria 3005474847 3005477182 192
278 iso_pu_bacteria 8006973647 8006978467 192
279 iso_pu_bacteria 8019555841 8019560635 192
280 iso_pu_bacteria 8019565922 8019570720 192
281 iso_pu_bacteria 8056689827 8056691561 192
282 3300003659 JGI25404J52841_10005115 JGI25404J52841_100051152 193
283 3300003659 JGI25404J52841_10006721 JGI25404J52841_100067213 193
284 3300003659 JGI25404J52841_10011730 JGI25404J52841_100117302 193
285 3300005338 Ga0068868_100358742 Ga0068868_1003587421 193
286 3300005347 Ga0070668_100608193 Ga0070668_1006081931 193
287 3300005364 Ga0070673_100077132 Ga0070673_1000771322 193
288 3300005445 Ga0070708_100339816 Ga0070708_1003398162 193
289 3300005456 Ga0070678_100107211 Ga0070678_1001072112 193
290 3300005467 Ga0070706_100001696 Ga0070706_10000169614 193
291 3300005471 Ga0070698_100026347 Ga0070698_1000263474 193
292 3300005618 Ga0068864_100127751 Ga0068864_1001277512 193
293 3300005937 Ga0081455_10004636 Ga0081455_100046363 193
294 3300005937 Ga0081455_10020916 Ga0081455_100209165 193
295 3300005983 Ga0081540_1004587 Ga0081540_100458711 193
296 3300005983 Ga0081540_1025653 Ga0081540_10256535 193
297 3300005983 Ga0081540_1031606 Ga0081540_10316062 193
298 3300005983 Ga0081540_1064824 Ga0081540_10648242 193
299 3300006048 Ga0075363_100039008 Ga0075363_1000390083 193
300 3300006051 Ga0075364_10000521 Ga0075364_1000052113 193
301 3300006173 Ga0070716_100231530 Ga0070716_1002315302 193
302 3300006177 Ga0075362_10004185 Ga0075362_100041856 193
303 3300006195 Ga0075366_10008335 Ga0075366_100083354 193
304 3300006195 Ga0075366_10024268 Ga0075366_100242682 193
305 3300006195 Ga0075366_10101778 Ga0075366_101017783 193
306 3300006237 Ga0097621_100373161 Ga0097621_1003731612 193
307 3300006353 Ga0075370_10008840 Ga0075370_100088406 193
308 3300006871 Ga0075434_100885008 Ga0075434_1008850082 193
309 3300025910 Ga0207684_10001749 Ga0207684_1000174914 193
310 3300025922 Ga0207646_10077368 Ga0207646_100773682 193
311 3300025960 Ga0207651_10033973 Ga0207651_100339732 193
312 3300026023 Ga0207677_10543296 Ga0207677_105432962 193
313 3300026035 Ga0207703_10736389 Ga0207703_107363892 193
314 3300026095 Ga0207676_10105634 Ga0207676_101056342 193
315 3300031548 Ga0307408_100816641 Ga0307408_1008166412 193
316 3300031730 Ga0307516_10070237 Ga0307516_100702372 193
317 3300046471 Ga0495650_0020467 Ga0495650_0020467_1487_2083 193
318 3300048917 Ga0496114_0271380 Ga0496114_0271380_230_826 193
319 3300049575 Ga0501039_0229305 Ga0501039_0229305_272_862 193
320 3300050489 nmdc:mga03683_64866_c1 nmdc:mga03683_64866_c1_714_1310 193
321 3300050490 nmdc:mga03n38_187252_c1 nmdc:mga03n38_187252_c1_464_1054 193
322 3300050493 nmdc:mga0k408_80734_c1 nmdc:mga0k408_80734_c1_46_642 193
323 3300050496 nmdc:mga07m45_9626_c1 nmdc:mga07m45_9626_c1_2962_3558 193
324 3300050507 nmdc:mga05p37_305676_c1 nmdc:mga05p37_305676_c1_295_891 193
325 3300050512 nmdc:mga0n895_209856_c1 nmdc:mga0n895_209856_c1_1290_1877 193
326 3300050513 nmdc:mga0rr50_481794_c1 nmdc:mga0rr50_481794_c1_22_609 193
327 3300053080 Ga0500635_0085252 Ga0500635_0085252_140_736 193
328 3300053088 Ga0500644_0003496 Ga0500644_0003496_1610_2206 193
329 3300053108 Ga0500562_001385 Ga0500562_001385_345_941 193
330 3300053109 Ga0500569_036810 Ga0500569_036810_669_1265 193
331 iso_pu_bacteria 2643221733 2644729872 193
332 iso_pu_bacteria 2917699015 2917705674 193
333 3300005344 Ga0070661_100210586 Ga0070661_1002105862 194
334 3300005434 Ga0070709_10164174 Ga0070709_101641742 194
335 3300005435 Ga0070714_100025074 Ga0070714_1000250745 194
336 3300005436 Ga0070713_100141794 Ga0070713_1001417942 194
337 3300005436 Ga0070713_100768958 Ga0070713_1007689582 194
338 3300005437 Ga0070710_10539375 Ga0070710_105393752 194
339 3300005543 Ga0070672_100213922 Ga0070672_1002139223 194
340 3300005548 Ga0070665_101027716 Ga0070665_1010277162 194
341 3300005563 Ga0068855_100223814 Ga0068855_1002238143 194
342 3300005577 Ga0068857_100111626 Ga0068857_1001116263 194
343 3300005614 Ga0068856_100184679 Ga0068856_1001846793 194
344 3300006038 Ga0075365_10012820 Ga0075365_100128203 194
345 3300006048 Ga0075363_100005959 Ga0075363_1000059594 194
346 3300006051 Ga0075364_10001007 Ga0075364_100010073 194
347 3300006058 Ga0075432_10054035 Ga0075432_100540352 194
348 3300006058 Ga0075432_10256760 Ga0075432_102567601 194
349 3300006177 Ga0075362_10046148 Ga0075362_100461483 194
350 3300006186 Ga0075369_10034089 Ga0075369_100340892 194
351 3300006195 Ga0075366_10065815 Ga0075366_100658151 194
352 3300006195 Ga0075366_10131781 Ga0075366_101317811 194
353 3300006353 Ga0075370_10008628 Ga0075370_100086283 194
354 3300006914 Ga0075436_100488983 Ga0075436_1004889832 194
355 3300006941 Ga0099825_1047979 Ga0099825_10479792 194
356 3300006942 Ga0099824_1004050 Ga0099824_10040509 194
357 3300006943 Ga0099822_1000838 Ga0099822_100083819 194
358 3300009093 Ga0105240_10201140 Ga0105240_102011403 194
359 3300009545 Ga0105237_10026227 Ga0105237_100262274 194
360 3300009551 Ga0105238_10647933 Ga0105238_106479331 194
361 3300013104 Ga0157370_10010674 Ga0157370_100106743 194
362 3300013104 Ga0157370_10103245 Ga0157370_101032453 194
363 3300013105 Ga0157369_10130823 Ga0157369_101308233 194
364 3300020082 Ga0206353_10735147 Ga0206353_107351472 194
365 3300025291 Ga0209675_1029475 Ga0209675_10294752 194
366 3300025303 Ga0209051_1013359 Ga0209051_10133592 194
367 3300025321 Ga0207656_10249042 Ga0207656_102490422 194
368 3300025898 Ga0207692_10134426 Ga0207692_101344262 194
369 3300025914 Ga0207671_10212210 Ga0207671_102122102 194
370 3300025924 Ga0207694_10102695 Ga0207694_101026955 194
371 3300025926 Ga0207659_10387775 Ga0207659_103877752 194
372 3300025928 Ga0207700_10015666 Ga0207700_100156665 194
373 3300025928 Ga0207700_10651458 Ga0207700_106514581 194
374 3300025929 Ga0207664_10141687 Ga0207664_101416872 194
375 3300025940 Ga0207691_10055076 Ga0207691_100550765 194
376 3300025960 Ga0207651_10817305 Ga0207651_108173052 194
377 3300026041 Ga0207639_10073041 Ga0207639_100730412 194
378 3300026116 Ga0207674_10775829 Ga0207674_107758291 194
379 3300027357 Ga0209589_1000007 Ga0209589_1000007201 194
380 3300027361 Ga0209489_100008 Ga0209489_100008201 194
381 3300027363 Ga0209700_100009 Ga0209700_100009201 194
382 3300027907 Ga0207428_10149883 Ga0207428_101498833 194
383 3300033442 Ga0315911_1000007 Ga0315911_1000007149 194
384 3300035086 Ga0373934_0249200 Ga0373934_0249200_56_655 194
385 3300035692 Ga0373935_0401229 Ga0373935_0401229_340_939 194
386 3300036401 Ga0373937_0058954 Ga0373937_0058954_975_1574 194
387 3300037418 Ga0395900_0168333 Ga0395900_0168333_1068_1661 194
388 3300037466 Ga0395898_0274127 Ga0395898_0274127_227_820 194
389 3300039438 Ga0436360_0251041 Ga0436360_0251041_276_860 194
390 3300041512 Ga0451853_1495030 Ga0451853_1495030_10317_10916 194
391 3300046457 Ga0495590_0044585 Ga0495590_0044585_40_639 194
392 3300046558 Ga0495633_0002829 Ga0495633_0002829_1614_2225 194
393 3300046660 Ga0495625_0113577 Ga0495625_0113577_89_682 194
394 3300046810 Ga0495660_0066028 Ga0495660_0066028_826_1425 194
395 3300047318 Ga0495636_0002142 Ga0495636_0002142_4130_4735 194
396 3300048906 Ga0496103_0424747 Ga0496103_0424747_180_776 194
397 3300048908 Ga0496105_0489775 Ga0496105_0489775_86_709 194
398 3300048911 Ga0496108_0349077 Ga0496108_0349077_240_863 194
399 3300048917 Ga0496114_0269582 Ga0496114_0269582_572_1195 194
400 3300048924 Ga0496121_0034085 Ga0496121_0034085_1267_1860 194
401 3300048924 Ga0496121_0040873 Ga0496121_0040873_406_1005 194
402 3300048924 Ga0496121_0068058 Ga0496121_0068058_2064_2657 194
403 3300048924 Ga0496121_0108695 Ga0496121_0108695_485_1078 194
404 3300048929 Ga0496126_0031802 Ga0496126_0031802_858_1451 194
405 3300048929 Ga0496126_0085695 Ga0496126_0085695_2172_2765 194
406 3300049581 Ga0501047_0172843 Ga0501047_0172843_929_1534 194
407 3300049581 Ga0501047_0332511 Ga0501047_0332511_696_1292 194
408 3300049823 Ga0501044_0101349 Ga0501044_0101349_1505_2110 194
409 3300050489 nmdc:mga03683_133221_c1 nmdc:mga03683_133221_c1_249_848 194
410 3300050490 nmdc:mga03n38_10883_c1 nmdc:mga03n38_10883_c1_2302_2901 194
411 3300050491 nmdc:mga00v17_97197_c1 nmdc:mga00v17_97197_c1_950_1549 194
412 3300050492 nmdc:mga0yw44_4500_c1 nmdc:mga0yw44_4500_c1_755_1354 194
413 3300050496 nmdc:mga07m45_43444_c1 nmdc:mga07m45_43444_c1_1162_1767 194
414 3300050514 nmdc:mga08x19_84623_c2 nmdc:mga08x19_84623_c2_127_726 194
415 3300050516 nmdc:mga0sz30_263700_c1 nmdc:mga0sz30_263700_c1_69_674 194
416 iso_pu_bacteria 2511231004 2511253439 194
417 iso_pu_bacteria 2511231012 2511304909 194
418 iso_pu_bacteria 2511231015 2511321771 194
419 iso_pu_bacteria 2511231017 2511333784 194
420 iso_pu_bacteria 2511231020 2511348987 194
421 iso_pu_bacteria 2511231021 2511358901 194
422 iso_pu_bacteria 2511231022 2511364442 194
423 iso_pu_bacteria 2600254931 2600367572 194
424 iso_pu_bacteria 2602042107 2603857415 194
425 iso_pu_bacteria 2643221565 2643843375 194
426 iso_pu_bacteria 2690316117 2692314982 194
427 iso_pu_bacteria 2738543015 2739256962 194
428 iso_pu_bacteria 2808606445 2809215350 194
429 iso_pu_bacteria 2847417321 2847419960 194
430 iso_pu_bacteria 2857524615 2857526795 194
431 iso_pu_bacteria 2893066018 2893069958 194
432 iso_pu_bacteria 2913036834 2913040589 194
433 iso_pu_bacteria 2919073203 2919077694 194
434 iso_pu_bacteria 2931396565 2931401255 194
435 iso_pu_bacteria 2939636861 2939639189 194
436 iso_pu_bacteria 3007803356 3007806933 194
437 iso_pu_bacteria 3007855910 3007856538 194
438 iso_pu_bacteria 643348564 643604357 194
439 iso_pu_bacteria 8054503363 8054507194 194
440 iso_pu_bacteria 8056137416 8056139974 194
441 3300005345 Ga0070692_10395283 Ga0070692_103952831 195
442 3300005457 Ga0070662_100366473 Ga0070662_1003664732 195
443 3300005841 Ga0068863_100789709 Ga0068863_1007897092 195
444 3300005842 Ga0068858_100148467 Ga0068858_1001484672 195
445 3300005843 Ga0068860_100002010 Ga0068860_1000020105 195
446 3300006038 Ga0075365_10008449 Ga0075365_100084492 195
447 3300006038 Ga0075365_10051253 Ga0075365_100512531 195
448 3300006038 Ga0075365_10470835 Ga0075365_104708352 195
449 3300006048 Ga0075363_100150935 Ga0075363_1001509351 195
450 3300006058 Ga0075432_10118629 Ga0075432_101186292 195
451 3300006847 Ga0075431_100237759 Ga0075431_1002377592 195
452 3300009545 Ga0105237_10063278 Ga0105237_100632784 195
453 3300013296 Ga0157374_10849957 Ga0157374_108499572 195
454 3300021377 Ga0213874_10001796 Ga0213874_100017965 195
455 3300021384 Ga0213876_10008528 Ga0213876_100085284 195
456 3300021388 Ga0213875_10006049 Ga0213875_100060493 195
457 3300025900 Ga0207710_10048610 Ga0207710_100486101 195
458 3300025914 Ga0207671_10019532 Ga0207671_100195325 195
459 3300025933 Ga0207706_10336488 Ga0207706_103364882 195
460 3300026088 Ga0207641_10461088 Ga0207641_104610882 195
461 3300027907 Ga0207428_10500371 Ga0207428_105003711 195
462 3300028381 Ga0268264_10000403 Ga0268264_1000040354 195
463 3300028381 Ga0268264_10000429 Ga0268264_1000042923 195
464 3300031548 Ga0307408_100040524 Ga0307408_1000405243 195
465 3300032004 Ga0307414_10738111 Ga0307414_107381112 195
466 3300037853 Ga0436364_0017649 Ga0436364_0017649_1908_2507 195
467 3300037853 Ga0436364_0607526 Ga0436364_0607526_192_803 195
468 3300039437 Ga0436365_0247948 Ga0436365_0247948_8243_8842 195
469 3300039437 Ga0436365_1912359 Ga0436365_1912359_468_1082 195
470 3300039450 Ga0436363_0106692 Ga0436363_0106692_8212_8823 195
471 3300039450 Ga0436363_0710564 Ga0436363_0710564_1601_2215 195
472 3300044684 Ga0466966_0043244 Ga0466966_0043244_430_1035 195
473 3300044693 Ga0466961_0307696 Ga0466961_0307696_241_846 195
474 3300044765 Ga0466970_0104087 Ga0466970_0104087_645_1250 195
475 3300044842 Ga0466957_0045017 Ga0466957_0045017_739_1344 195
476 3300044901 Ga0466960_0032713 Ga0466960_0032713_1483_2088 195
477 3300045049 Ga0466959_0140759 Ga0466959_0140759_448_1053 195
478 3300045836 Ga0466958_0048891 Ga0466958_0048891_153_758 195
479 3300045836 Ga0466958_0356370 Ga0466958_0356370_211_831 195
480 3300045976 Ga0466967_0094486 Ga0466967_0094486_1989_2609 195
481 3300046531 Ga0495665_0011202 Ga0495665_0011202_2620_3234 195
482 3300046684 Ga0495669_0000022 Ga0495669_0000022_94493_95089 195
483 3300046684 Ga0495669_0000576 Ga0495669_0000576_4474_5070 195
484 3300047320 Ga0495672_0194306 Ga0495672_0194306_223_819 195
485 3300047673 Ga0495593_0054980 Ga0495593_0054980_1110_1724 195
486 3300048905 Ga0496102_0344646 Ga0496102_0344646_790_1386 195
487 3300048924 Ga0496121_0338216 Ga0496121_0338216_105_701 195
488 3300048929 Ga0496126_0104389 Ga0496126_0104389_1075_1671 195
489 3300049574 Ga0501038_0383047 Ga0501038_0383047_125_736 195
490 3300049577 Ga0501041_0186625 Ga0501041_0186625_314_910 195
491 3300049581 Ga0501047_0747653 Ga0501047_0747653_74_685 195
492 3300049592 Ga0501076_0054908 Ga0501076_0054908_2168_2764 195
493 3300049743 Ga0501081_0092147 Ga0501081_0092147_563_1159 195
494 3300049822 Ga0501035_0058359 Ga0501035_0058359_391_1002 195
495 3300049823 Ga0501044_0018701 Ga0501044_0018701_5696_6307 195
496 3300050490 nmdc:mga03n38_246124_c1 nmdc:mga03n38_246124_c1_333_926 195
497 3300050494 nmdc:mga06z11_20687_c1 nmdc:mga06z11_20687_c1_1280_1873 195
498 3300050494 nmdc:mga06z11_339634_c1 nmdc:mga06z11_339634_c1_270_863 195
499 3300050510 nmdc:mga06r32_529118_c1 nmdc:mga06r32_529118_c1_221_820 195
500 3300053125 Ga0500618_001190 Ga0500618_001190_17_631 195
501 3300005545 Ga0070695_100603225 Ga0070695_1006032252 196
502 3300005841 Ga0068863_100162888 Ga0068863_1001628881 196
503 3300013306 Ga0163162_10103461 Ga0163162_101034614 196
504 3300037312 Ga0395899_0012525 Ga0395899_0012525_2686_3285 196
505 3300037312 Ga0395899_0244942 Ga0395899_0244942_400_999 196
506 3300037418 Ga0395900_0061125 Ga0395900_0061125_1956_2555 196
507 3300037418 Ga0395900_0302761 Ga0395900_0302761_91_690 196
508 3300038443 Ga0395901_0351714 Ga0395901_0351714_315_914 196
509 3300050491 nmdc:mga00v17_2321_c1 nmdc:mga00v17_2321_c1_2672_3277 196
510 3300050491 nmdc:mga00v17_36690_c2 nmdc:mga00v17_36690_c2_211_816 196
511 3300005338 Ga0068868_100820002 Ga0068868_1008200022 197
512 3300039437 Ga0436365_0615596 Ga0436365_0615596_501_1100 197
513 3300046472 Ga0495580_0002934 Ga0495580_0002934_2551_3162 197
514 3300046499 Ga0495594_0013066 Ga0495594_0013066_282_893 197
515 3300046526 Ga0495666_0002052 Ga0495666_0002052_3823_4434 197
516 3300046531 Ga0495665_0058750 Ga0495665_0058750_1039_1650 197
517 3300046690 Ga0495624_0173755 Ga0495624_0173755_614_1225 197
518 3300047317 Ga0495604_0012438 Ga0495604_0012438_4452_5063 197
519 3300048915 Ga0496112_0368077 Ga0496112_0368077_122_733 197
520 3300048927 Ga0496124_0041675 Ga0496124_0041675_1370_1984 197
521 3300048928 Ga0496125_0060589 Ga0496125_0060589_839_1453 197
522 2124908027 MRS2a_Contig_802 MRS2a_00659050 198
523 3300005288 Ga0065714_10032856 Ga0065714_100328561 198
524 3300005288 Ga0065714_10073987 Ga0065714_100739872 198
525 3300005288 Ga0065714_10075886 Ga0065714_100758862 198
526 3300005288 Ga0065714_10133304 Ga0065714_101333042 198
527 3300005288 Ga0065714_10145153 Ga0065714_101451532 198
528 3300005289 Ga0065704_10266369 Ga0065704_102663692 198
529 3300006051 Ga0075364_10033900 Ga0075364_100339002 198
530 3300006051 Ga0075364_10106916 Ga0075364_101069162 198
531 3300006051 Ga0075364_10579238 Ga0075364_105792382 198
532 3300006058 Ga0075432_10000692 Ga0075432_100006923 198
533 3300006058 Ga0075432_10055723 Ga0075432_100557232 198
534 3300006058 Ga0075432_10125886 Ga0075432_101258862 198
535 3300006177 Ga0075362_10013135 Ga0075362_100131353 198
536 3300006177 Ga0075362_10166408 Ga0075362_101664082 198
537 3300006353 Ga0075370_10061355 Ga0075370_100613551 198
538 3300006846 Ga0075430_100322430 Ga0075430_1003224302 198
539 3300006914 Ga0075436_100241275 Ga0075436_1002412752 198
540 3300009011 Ga0105251_10005081 Ga0105251_100050817 198
541 3300009036 Ga0105244_10004844 Ga0105244_100048446 198
542 3300009036 Ga0105244_10008013 Ga0105244_100080132 198
543 3300009036 Ga0105244_10385900 Ga0105244_103859001 198
544 3300009092 Ga0105250_10009214 Ga0105250_100092142 198
545 3300009092 Ga0105250_10011333 Ga0105250_100113331 198
546 3300009092 Ga0105250_10090525 Ga0105250_100905252 198
547 3300009092 Ga0105250_10144120 Ga0105250_101441202 198
548 3300009092 Ga0105250_10221277 Ga0105250_102212772 198
549 3300009101 Ga0105247_10068052 Ga0105247_100680523 198
550 3300009553 Ga0105249_10610120 Ga0105249_106101202 198
551 3300010375 Ga0105239_10193698 Ga0105239_101936982 198
552 3300011119 Ga0105246_10015011 Ga0105246_100150114 198
553 3300013100 Ga0157373_10007217 Ga0157373_100072177 198
554 3300013100 Ga0157373_10007637 Ga0157373_100076376 198
555 3300013104 Ga0157370_10012653 Ga0157370_100126539 198
556 3300013104 Ga0157370_10391672 Ga0157370_103916722 198
557 3300013105 Ga0157369_10087235 Ga0157369_100872353 198
558 3300013306 Ga0163162_10458776 Ga0163162_104587762 198
559 3300013306 Ga0163162_10778671 Ga0163162_107786712 198
560 3300014497 Ga0182008_10003201 Ga0182008_1000320110 198
561 3300014497 Ga0182008_10018577 Ga0182008_100185774 198
562 3300014497 Ga0182008_10036097 Ga0182008_100360972 198
563 3300014497 Ga0182008_10149717 Ga0182008_101497172 198
564 3300014968 Ga0157379_10364488 Ga0157379_103644882 198
565 3300015261 Ga0182006_1006091 Ga0182006_10060914 198
566 3300015262 Ga0182007_10002571 Ga0182007_100025716 198
567 3300015262 Ga0182007_10006498 Ga0182007_100064986 198
568 3300017792 Ga0163161_10003570 Ga0163161_100035708 198
569 3300017792 Ga0163161_10009160 Ga0163161_100091604 198
570 3300022739 Ga0228711_1000090 Ga0228711_100009019 198
571 3300025256 Ga0209759_1008336 Ga0209759_10083362 198
572 3300025295 Ga0209564_1020708 Ga0209564_10207083 198
573 3300025298 Ga0209050_1001665 Ga0209050_10016655 198
574 3300025303 Ga0209051_1009683 Ga0209051_10096834 198
575 3300025711 Ga0207696_1000006 Ga0207696_1000006218 198
576 3300025711 Ga0207696_1021860 Ga0207696_10218603 198
577 3300025728 Ga0207655_1000077 Ga0207655_1000077130 198
578 3300025728 Ga0207655_1008254 Ga0207655_10082543 198
579 3300025728 Ga0207655_1017632 Ga0207655_10176324 198
580 3300025728 Ga0207655_1027069 Ga0207655_10270692 198
581 3300025735 Ga0207713_1000724 Ga0207713_100072428 198
582 3300025735 Ga0207713_1014369 Ga0207713_10143693 198
583 3300025735 Ga0207713_1014477 Ga0207713_10144773 198
584 3300025735 Ga0207713_1043701 Ga0207713_10437011 198
585 3300025735 Ga0207713_1062936 Ga0207713_10629362 198
586 3300025935 Ga0207709_10072479 Ga0207709_100724793 198
587 3300027907 Ga0207428_10505261 Ga0207428_105052611 198
588 3300028381 Ga0268264_11288066 Ga0268264_112880662 198
589 3300031344 Ga0265316_10196533 Ga0265316_101965332 198
590 3300031901 Ga0307406_10482218 Ga0307406_104822182 198
591 3300031911 Ga0307412_10021171 Ga0307412_100211712 198
592 3300031995 Ga0307409_100207361 Ga0307409_1002073612 198
593 3300032005 Ga0307411_10748053 Ga0307411_107480532 198
594 3300035695 Ga0373927_0025122 Ga0373927_0025122_935_1546 198
595 3300037068 Ga0373925_0019721 Ga0373925_0019721_3291_3902 198
596 3300038443 Ga0395901_0118581 Ga0395901_0118581_299_910 198
597 3300041405 Ga0439438_000163 Ga0439438_000163_3300_3896 198
598 3300041405 Ga0439438_000737 Ga0439438_000737_13599_14195 198
599 3300041405 Ga0439438_013856 Ga0439438_013856_38_634 198
600 3300041407 Ga0439447_000211 Ga0439447_000211_6842_7438 198
601 3300041407 Ga0439447_086358 Ga0439447_086358_83_679 198
602 3300041411 Ga0439466_0018776 Ga0439466_0018776_925_1521 198
603 3300041411 Ga0439466_0050089 Ga0439466_0050089_490_1086 198
604 3300042006 Ga0439432_023075 Ga0439432_023075_1281_1877 198
605 3300042009 Ga0439451_000757 Ga0439451_000757_2786_3382 198
606 3300042009 Ga0439451_042068 Ga0439451_042068_229_825 198
607 3300042010 Ga0439452_001610 Ga0439452_001610_2867_3463 198
608 3300042013 Ga0439456_001175 Ga0439456_001175_3839_4435 198
609 3300042013 Ga0439456_004550 Ga0439456_004550_645_1241 198
610 3300042013 Ga0439456_063682 Ga0439456_063682_132_728 198
611 3300042115 Ga0450911_009912 Ga0450911_009912_405_1001 198
612 3300042122 Ga0450920_022032 Ga0450920_022032_514_1110 198
613 3300042137 Ga0450902_009128 Ga0450902_009128_454_1050 198
614 3300042138 Ga0450903_000724 Ga0450903_000724_2648_3244 198
615 3300042138 Ga0450903_007618 Ga0450903_007618_91_687 198
616 3300042138 Ga0450903_016007 Ga0450903_016007_414_1010 198
617 3300042142 Ga0450905_006389 Ga0450905_006389_868_1464 198
618 3300042142 Ga0450905_025767 Ga0450905_025767_186_782 198
619 3300042145 Ga0450906_021269 Ga0450906_021269_400_996 198
620 3300042146 Ga0450907_000283 Ga0450907_000283_2895_3491 198
621 3300042184 Ga0450908_000101 Ga0450908_000101_3028_3624 198
622 3300042461 Ga0439460_0003018 Ga0439460_0003018_2932_3528 198
623 3300044735 Ga0466968_0000008 Ga0466968_0000008_36031_36642 198
624 3300046452 Ga0495617_000633 Ga0495617_000633_2828_3424 198
625 3300046452 Ga0495617_003137 Ga0495617_003137_487_1083 198
626 3300046452 Ga0495617_033296 Ga0495617_033296_251_847 198
627 3300046453 Ga0495627_001773 Ga0495627_001773_3120_3716 198
628 3300046453 Ga0495627_026356 Ga0495627_026356_171_767 198
629 3300046455 Ga0495603_0010415 Ga0495603_0010415_228_824 198
630 3300046455 Ga0495603_0092043 Ga0495603_0092043_210_806 198
631 3300046457 Ga0495590_0014969 Ga0495590_0014969_1969_2565 198
632 3300046457 Ga0495590_0027762 Ga0495590_0027762_966_1562 198
633 3300046458 Ga0495591_000730 Ga0495591_000730_19169_19765 198
634 3300046458 Ga0495591_001059 Ga0495591_001059_8319_8915 198
635 3300046460 Ga0495638_0011540 Ga0495638_0011540_44_640 198
636 3300046460 Ga0495638_0016359 Ga0495638_0016359_3280_3876 198
637 3300046460 Ga0495638_0043614 Ga0495638_0043614_1743_2339 198
638 3300046460 Ga0495638_0082168 Ga0495638_0082168_104_700 198
639 3300046460 Ga0495638_0109477 Ga0495638_0109477_373_969 198
640 3300046460 Ga0495638_0397002 Ga0495638_0397002_30_626 198
641 3300046463 Ga0495653_0001150 Ga0495653_0001150_4549_5145 198
642 3300046471 Ga0495650_0001328 Ga0495650_0001328_23726_24322 198
643 3300046471 Ga0495650_0002139 Ga0495650_0002139_2980_3576 198
644 3300046474 Ga0495605_0001099 Ga0495605_0001099_16584_17180 198
645 3300046474 Ga0495605_0001937 Ga0495605_0001937_11994_12590 198
646 3300046474 Ga0495605_0002177 Ga0495605_0002177_11281_11877 198
647 3300046474 Ga0495605_0016277 Ga0495605_0016277_43_639 198
648 3300046474 Ga0495605_0034203 Ga0495605_0034203_458_1054 198
649 3300046491 Ga0495584_0000851 Ga0495584_0000851_3344_3940 198
650 3300046491 Ga0495584_0023748 Ga0495584_0023748_205_801 198
651 3300046491 Ga0495584_0037424 Ga0495584_0037424_396_992 198
652 3300046491 Ga0495584_0113452 Ga0495584_0113452_606_1202 198
653 3300046492 Ga0495585_0010531 Ga0495585_0010531_631_1227 198
654 3300046499 Ga0495594_0007401 Ga0495594_0007401_4958_5554 198
655 3300046500 Ga0495596_0000421 Ga0495596_0000421_6597_7193 198
656 3300046501 Ga0495607_0063801 Ga0495607_0063801_554_1150 198
657 3300046501 Ga0495607_0188944 Ga0495607_0188944_259_855 198
658 3300046506 Ga0495583_0000172 Ga0495583_0000172_3116_3712 198
659 3300046506 Ga0495583_0011494 Ga0495583_0011494_2782_3378 198
660 3300046506 Ga0495583_0015244 Ga0495583_0015244_3064_3660 198
661 3300046506 Ga0495583_0052429 Ga0495583_0052429_1056_1652 198
662 3300046507 Ga0495606_0001019 Ga0495606_0001019_36039_36635 198
663 3300046512 Ga0495610_0009130 Ga0495610_0009130_428_1024 198
664 3300046512 Ga0495610_0113762 Ga0495610_0113762_284_880 198
665 3300046513 Ga0495616_0000456 Ga0495616_0000456_25102_25698 198
666 3300046513 Ga0495616_0006807 Ga0495616_0006807_2500_3096 198
667 3300046513 Ga0495616_0092756 Ga0495616_0092756_789_1385 198
668 3300046515 Ga0495620_0000006 Ga0495620_0000006_201096_201692 198
669 3300046515 Ga0495620_0001273 Ga0495620_0001273_2833_3429 198
670 3300046515 Ga0495620_0004743 Ga0495620_0004743_6590_7186 198
671 3300046517 Ga0495630_0020504 Ga0495630_0020504_3853_4449 198
672 3300046518 Ga0495631_0066030 Ga0495631_0066030_494_1090 198
673 3300046518 Ga0495631_0260185 Ga0495631_0260185_20_616 198
674 3300046519 Ga0495632_0000031 Ga0495632_0000031_484_1080 198
675 3300046519 Ga0495632_0000170 Ga0495632_0000170_30317_30913 198
676 3300046519 Ga0495632_0001021 Ga0495632_0001021_2727_3323 198
677 3300046519 Ga0495632_0002096 Ga0495632_0002096_11999_12595 198
678 3300046520 Ga0495637_0000799 Ga0495637_0000799_814_1410 198
679 3300046520 Ga0495637_0001764 Ga0495637_0001764_4082_4678 198
680 3300046520 Ga0495637_0009093 Ga0495637_0009093_2842_3438 198
681 3300046520 Ga0495637_0043837 Ga0495637_0043837_1058_1654 198
682 3300046522 Ga0495643_0012198 Ga0495643_0012198_631_1227 198
683 3300046522 Ga0495643_0013461 Ga0495643_0013461_3926_4522 198
684 3300046522 Ga0495643_0022047 Ga0495643_0022047_221_817 198
685 3300046522 Ga0495643_0129090 Ga0495643_0129090_44_640 198
686 3300046523 Ga0495644_0210516 Ga0495644_0210516_104_700 198
687 3300046524 Ga0495648_0000267 Ga0495648_0000267_6859_7455 198
688 3300046524 Ga0495648_0014286 Ga0495648_0014286_452_1048 198
689 3300046524 Ga0495648_0015925 Ga0495648_0015925_2420_3016 198
690 3300046524 Ga0495648_0032837 Ga0495648_0032837_1007_1603 198
691 3300046526 Ga0495666_0040601 Ga0495666_0040601_1522_2118 198
692 3300046528 Ga0495642_0000584 Ga0495642_0000584_14666_15262 198
693 3300046528 Ga0495642_0000977 Ga0495642_0000977_11971_12567 198
694 3300046530 Ga0495654_0010877 Ga0495654_0010877_910_1506 198
695 3300046530 Ga0495654_0061793 Ga0495654_0061793_769_1365 198
696 3300046530 Ga0495654_0099023 Ga0495654_0099023_166_762 198
697 3300046530 Ga0495654_0124773 Ga0495654_0124773_486_1082 198
698 3300046536 Ga0495587_0000835 Ga0495587_0000835_15217_15813 198
699 3300046538 Ga0495609_0000552 Ga0495609_0000552_3010_3606 198
700 3300046538 Ga0495609_0001596 Ga0495609_0001596_6396_6992 198
701 3300046538 Ga0495609_0016775 Ga0495609_0016775_178_774 198
702 3300046538 Ga0495609_0030749 Ga0495609_0030749_1464_2060 198
703 3300046542 Ga0495597_0004922 Ga0495597_0004922_1784_2380 198
704 3300046542 Ga0495597_0021913 Ga0495597_0021913_2329_2925 198
705 3300046542 Ga0495597_0078768 Ga0495597_0078768_374_970 198
706 3300046557 Ga0495622_0013456 Ga0495622_0013456_2202_2798 198
707 3300046558 Ga0495633_0042079 Ga0495633_0042079_261_857 198
708 3300046558 Ga0495633_0140577 Ga0495633_0140577_369_965 198
709 3300046615 Ga0495656_0014112 Ga0495656_0014112_1951_2547 198
710 3300046616 Ga0495668_0001425 Ga0495668_0001425_19860_20456 198
711 3300046642 Ga0495634_0000347 Ga0495634_0000347_22366_22962 198
712 3300046660 Ga0495625_0005230 Ga0495625_0005230_4030_4626 198
713 3300046660 Ga0495625_0010607 Ga0495625_0010607_6479_7075 198
714 3300046660 Ga0495625_0089038 Ga0495625_0089038_1105_1701 198
715 3300046660 Ga0495625_0156972 Ga0495625_0156972_351_947 198
716 3300046663 Ga0495635_0000402 Ga0495635_0000402_5049_5645 198
717 3300046664 Ga0495659_0000252 Ga0495659_0000252_3056_3652 198
718 3300046664 Ga0495659_0002938 Ga0495659_0002938_488_1084 198
719 3300046664 Ga0495659_0146539 Ga0495659_0146539_60_656 198
720 3300046665 Ga0495661_0036598 Ga0495661_0036598_544_1140 198
721 3300046665 Ga0495661_0109816 Ga0495661_0109816_727_1323 198
722 3300046665 Ga0495661_0116931 Ga0495661_0116931_602_1198 198
723 3300046665 Ga0495661_0156942 Ga0495661_0156942_590_1186 198
724 3300046674 Ga0495588_0000444 Ga0495588_0000444_2755_3351 198
725 3300046680 Ga0495646_0000541 Ga0495646_0000541_15217_15813 198
726 3300046684 Ga0495669_0006562 Ga0495669_0006562_4189_4785 198
727 3300046684 Ga0495669_0155276 Ga0495669_0155276_80_676 198
728 3300046691 Ga0495670_0001231 Ga0495670_0001231_2820_3416 198
729 3300046691 Ga0495670_0004594 Ga0495670_0004594_110_706 198
730 3300046691 Ga0495670_0092196 Ga0495670_0092196_202_798 198
731 3300046691 Ga0495670_0176837 Ga0495670_0176837_79_675 198
732 3300046692 Ga0495671_0002464 Ga0495671_0002464_10708_11304 198
733 3300046692 Ga0495671_0002792 Ga0495671_0002792_8239_8835 198
734 3300046694 Ga0495649_0000106 Ga0495649_0000106_3019_3615 198
735 3300046694 Ga0495649_0000811 Ga0495649_0000811_23995_24591 198
736 3300046694 Ga0495649_0031264 Ga0495649_0031264_2072_2668 198
737 3300046794 Ga0495589_0008767 Ga0495589_0008767_39_635 198
738 3300046794 Ga0495589_0015375 Ga0495589_0015375_3052_3648 198
739 3300046794 Ga0495589_0024430 Ga0495589_0024430_169_765 198
740 3300046810 Ga0495660_0013968 Ga0495660_0013968_4009_4605 198
741 3300046810 Ga0495660_0017097 Ga0495660_0017097_2316_2912 198
742 3300046810 Ga0495660_0022090 Ga0495660_0022090_2626_3222 198
743 3300046810 Ga0495660_0127284 Ga0495660_0127284_80_676 198
744 3300046810 Ga0495660_0127579 Ga0495660_0127579_604_1200 198
745 3300046810 Ga0495660_0281446 Ga0495660_0281446_51_647 198
746 3300047317 Ga0495604_0094408 Ga0495604_0094408_225_821 198
747 3300047318 Ga0495636_0000436 Ga0495636_0000436_11999_12595 198
748 3300047319 Ga0495674_0076560 Ga0495674_0076560_1279_1875 198
749 3300047320 Ga0495672_0000357 Ga0495672_0000357_55208_55804 198
750 3300047320 Ga0495672_0000987 Ga0495672_0000987_2836_3432 198
751 3300047320 Ga0495672_0003208 Ga0495672_0003208_10763_11359 198
752 3300047320 Ga0495672_0005169 Ga0495672_0005169_487_1083 198
753 3300047320 Ga0495672_0141779 Ga0495672_0141779_488_1084 198
754 3300047320 Ga0495672_0161133 Ga0495672_0161133_387_983 198
755 3300047323 Ga0495683_0005131 Ga0495683_0005131_345_941 198
756 3300047323 Ga0495683_0005677 Ga0495683_0005677_597_1193 198
757 3300047323 Ga0495683_0057323 Ga0495683_0057323_476_1072 198
758 3300047323 Ga0495683_0113173 Ga0495683_0113173_67_663 198
759 3300047323 Ga0495683_0196426 Ga0495683_0196426_180_776 198
760 3300047443 Ga0495687_000159 Ga0495687_000159_57206_57802 198
761 3300047443 Ga0495687_000343 Ga0495687_000343_55936_56532 198
762 3300047443 Ga0495687_002486 Ga0495687_002486_2791_3387 198
763 3300047445 Ga0495677_0000308 Ga0495677_0000308_2765_3361 198
764 3300047446 Ga0495679_025105 Ga0495679_025105_345_941 198
765 3300047447 Ga0495685_054055 Ga0495685_054055_38_634 198
766 3300047469 Ga0495673_0000142 Ga0495673_0000142_19975_20571 198
767 3300047469 Ga0495673_0001971 Ga0495673_0001971_2723_3319 198
768 3300047469 Ga0495673_0013732 Ga0495673_0013732_2712_3308 198
769 3300047470 Ga0495681_0011182 Ga0495681_0011182_4474_5070 198
770 3300047470 Ga0495681_0013602 Ga0495681_0013602_3615_4211 198
771 3300047470 Ga0495681_0068702 Ga0495681_0068702_303_899 198
772 3300047470 Ga0495681_0219752 Ga0495681_0219752_144_740 198
773 3300047673 Ga0495593_0000536 Ga0495593_0000536_4994_5590 198
774 3300048091 Ga0495626_0002800 Ga0495626_0002800_6453_7049 198
775 3300048091 Ga0495626_0011624 Ga0495626_0011624_3911_4507 198
776 3300048091 Ga0495626_0014962 Ga0495626_0014962_2977_3573 198
777 3300048091 Ga0495626_0021804 Ga0495626_0021804_483_1079 198
778 3300048905 Ga0496102_0000444 Ga0496102_0000444_22053_22649 198
779 3300048906 Ga0496103_0000290 Ga0496103_0000290_21557_22153 198
780 3300048906 Ga0496103_0067436 Ga0496103_0067436_1237_1848 198
781 3300048909 Ga0496106_0001400 Ga0496106_0001400_14635_15246 198
782 3300048909 Ga0496106_0040227 Ga0496106_0040227_2443_3039 198
783 3300048909 Ga0496106_0095899 Ga0496106_0095899_427_1023 198
784 3300048910 Ga0496107_0390987 Ga0496107_0390987_109_705 198
785 3300048913 Ga0496110_0048556 Ga0496110_0048556_2103_2699 198
786 3300048917 Ga0496114_0015450 Ga0496114_0015450_357_953 198
787 3300048917 Ga0496114_0076715 Ga0496114_0076715_1920_2516 198
788 3300048918 Ga0496115_0018008 Ga0496115_0018008_349_945 198
789 3300048919 Ga0496116_0000231 Ga0496116_0000231_3068_3664 198
790 3300048919 Ga0496116_0012086 Ga0496116_0012086_3292_3903 198
791 3300048919 Ga0496116_0021642 Ga0496116_0021642_3827_4423 198
792 3300048920 Ga0496117_0000460 Ga0496117_0000460_66734_67330 198
793 3300048920 Ga0496117_0005335 Ga0496117_0005335_12319_12915 198
794 3300048920 Ga0496117_0069886 Ga0496117_0069886_957_1568 198
795 3300048920 Ga0496117_0155803 Ga0496117_0155803_464_1060 198
796 3300048920 Ga0496117_0169612 Ga0496117_0169612_220_816 198
797 3300048921 Ga0496118_0000106 Ga0496118_0000106_17334_17930 198
798 3300048921 Ga0496118_0002522 Ga0496118_0002522_3242_3853 198
799 3300048921 Ga0496118_0004391 Ga0496118_0004391_651_1247 198
800 3300048921 Ga0496118_0036942 Ga0496118_0036942_724_1320 198
801 3300048921 Ga0496118_0042526 Ga0496118_0042526_604_1200 198
802 3300048921 Ga0496118_0131345 Ga0496118_0131345_814_1410 198
803 3300048921 Ga0496118_0214010 Ga0496118_0214010_120_716 198
804 3300048922 Ga0496119_0024932 Ga0496119_0024932_2876_3472 198
805 3300048922 Ga0496119_0057100 Ga0496119_0057100_776_1387 198
806 3300048922 Ga0496119_0145051 Ga0496119_0145051_386_982 198
807 3300048924 Ga0496121_0000602 Ga0496121_0000602_38861_39472 198
808 3300048924 Ga0496121_0002550 Ga0496121_0002550_19436_20032 198
809 3300048924 Ga0496121_0046322 Ga0496121_0046322_2961_3557 198
810 3300048924 Ga0496121_0058950 Ga0496121_0058950_788_1384 198
811 3300048924 Ga0496121_0207410 Ga0496121_0207410_39_635 198
812 3300048924 Ga0496121_0241898 Ga0496121_0241898_151_747 198
813 3300048925 Ga0496122_0003924 Ga0496122_0003924_15359_15955 198
814 3300048925 Ga0496122_0028198 Ga0496122_0028198_3724_4320 198
815 3300048925 Ga0496122_0052736 Ga0496122_0052736_544_1140 198
816 3300048925 Ga0496122_0244818 Ga0496122_0244818_255_851 198
817 3300048925 Ga0496122_0296592 Ga0496122_0296592_226_822 198
818 3300048926 Ga0496123_0001070 Ga0496123_0001070_21845_22441 198
819 3300048926 Ga0496123_0151128 Ga0496123_0151128_372_968 198
820 3300048926 Ga0496123_0184946 Ga0496123_0184946_279_875 198
821 3300048927 Ga0496124_0002300 Ga0496124_0002300_24475_25086 198
822 3300048927 Ga0496124_0007825 Ga0496124_0007825_2823_3419 198
823 3300048927 Ga0496124_0053031 Ga0496124_0053031_2448_3044 198
824 3300048927 Ga0496124_0087639 Ga0496124_0087639_237_833 198
825 3300048927 Ga0496124_0096438 Ga0496124_0096438_359_955 198
826 3300048927 Ga0496124_0178078 Ga0496124_0178078_851_1447 198
827 3300048928 Ga0496125_0000038 Ga0496125_0000038_79880_80476 198
828 3300048928 Ga0496125_0015470 Ga0496125_0015470_2192_2788 198
829 3300048928 Ga0496125_0033974 Ga0496125_0033974_434_1030 198
830 3300048928 Ga0496125_0043559 Ga0496125_0043559_2573_3169 198
831 3300048928 Ga0496125_0053328 Ga0496125_0053328_108_719 198
832 3300048928 Ga0496125_0212054 Ga0496125_0212054_448_1044 198
833 3300048929 Ga0496126_0019278 Ga0496126_0019278_1504_2100 198
834 3300048929 Ga0496126_0029405 Ga0496126_0029405_3242_3838 198
835 3300048929 Ga0496126_0048088 Ga0496126_0048088_2909_3520 198
836 3300048929 Ga0496126_0555464 Ga0496126_0555464_269_865 198
837 3300049459 Ga0495678_004472 Ga0495678_004472_156_752 198
838 3300049459 Ga0495678_008649 Ga0495678_008649_3622_4218 198
839 3300049459 Ga0495678_037128 Ga0495678_037128_156_752 198
840 3300049459 Ga0495678_042992 Ga0495678_042992_365_961 198
841 3300049459 Ga0495678_080193 Ga0495678_080193_431_1027 198
842 3300049460 Ga0495682_0000057 Ga0495682_0000057_98349_98945 198
843 3300049460 Ga0495682_0000497 Ga0495682_0000497_23453_24049 198
844 3300049460 Ga0495682_0000755 Ga0495682_0000755_19724_20320 198
845 3300049460 Ga0495682_0013167 Ga0495682_0013167_39_635 198
846 3300049460 Ga0495682_0022002 Ga0495682_0022002_1539_2135 198
847 3300050489 nmdc:mga03683_65817_c1 nmdc:mga03683_65817_c1_462_1058 198
848 3300050491 nmdc:mga00v17_190318_c1 nmdc:mga00v17_190318_c1_303_899 198
849 3300050491 nmdc:mga00v17_230353_c1 nmdc:mga00v17_230353_c1_252_848 198
850 3300050491 nmdc:mga00v17_445192_c1 nmdc:mga00v17_445192_c1_58_654 198
851 3300050492 nmdc:mga0yw44_140905_c1 nmdc:mga0yw44_140905_c1_175_771 198
852 3300050496 nmdc:mga07m45_123815_c1 nmdc:mga07m45_123815_c1_460_1056 198
853 3300053087 Ga0500643_044372 Ga0500643_044372_507_1103 198
854 3300053088 Ga0500644_0008007 Ga0500644_0008007_862_1458 198
855 3300053089 Ga0500581_063378 Ga0500581_063378_855_1451 198
856 3300053093 Ga0500651_0103858 Ga0500651_0103858_793_1389 198
857 3300053094 Ga0500566_0000214 Ga0500566_0000214_32_628 198
858 3300053098 Ga0500650_0030296 Ga0500650_0030296_582_1178 198
859 3300053104 Ga0500556_0000216 Ga0500556_0000216_12938_13534 198
860 3300053109 Ga0500569_006309 Ga0500569_006309_1640_2236 198
861 3300053122 Ga0500608_065151 Ga0500608_065151_499_1095 198
862 3300053130 Ga0500642_0000012 Ga0500642_0000012_69865_70461 198
863 3300053130 Ga0500642_0308788 Ga0500642_0308788_17_613 198
864 3300053131 Ga0500652_000403 Ga0500652_000403_4991_5587 198
865 3300053134 Ga0500658_0022293 Ga0500658_0022293_1613_2209 198
866 3300053135 Ga0500659_0001844 Ga0500659_0001844_427_1023 198
867 3300053136 Ga0500559_0000167 Ga0500559_0000167_32103_32699 198
868 3300053139 Ga0500568_0001627 Ga0500568_0001627_3604_4200 198
869 3300053145 Ga0500586_000481 Ga0500586_000481_6986_7582 198
870 3300053151 Ga0500604_0005154 Ga0500604_0005154_1659_2255 198
871 3300053153 Ga0500616_0000515 Ga0500616_0000515_18235_18831 198
872 3300053156 Ga0500622_0002295 Ga0500622_0002295_3432_4028 198
873 3300053158 Ga0500627_0075634 Ga0500627_0075634_853_1449 198
874 3300053177 Ga0500636_0009790 Ga0500636_0009790_355_951 198
875 3300053730 Ga0500645_068054 Ga0500645_068054_291_887 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

41

175

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iht-assembly1.cif.gz_B carboxyethylarginine synthase from streptomyces clavuligerus: semet structure 0.832 2 171
4q9d-assembly1.cif.gz_A-2 x-ray structure of a putative thiamin diphosphate-dependent enzyme isolated from mycobacterium smegmatis 0.8233 10 171
1upa-assembly1.cif.gz_C carboxyethylarginine synthase from streptomyces clavuligerus (semet structure) 0.8215 5 172
3eya-assembly3.cif.gz_K structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from escherichia coli 0.8188 11 172
1upc-assembly1.cif.gz_C carboxyethylarginine synthase from streptomyces clavuligerus 0.8186 5 171
ID Description Score Start End Superfamily
af_P58416_5_175_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9421 12 182 3.40.50.970
af_P58416_5_175_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9315 12 182 3.40.50.970
af_A4I3N7_199_405_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8606 4 186 3.40.50.970
af_Q57957_74_243_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8478 61 170 3.40.50.970
af_Q4D595_238_443_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8449 2 186 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A536SBB7-F1-model_v4 Aldehyde dehydrogenase 0.9989 9 108 GO:0016831
GO:0030976
GO:0044281
AF-A0A5E7MMF2-F1-model_v4 deleted 0.9974 1 194
AF-A0A7Y8C5T8-F1-model_v4 Aldehyde dehydrogenase 0.9973 1 198 GO:0016831
GO:0030976
GO:0044281
AF-A0A7H5R5M6-F1-model_v4 Aldehyde dehydrogenase 0.9967 1 198 GO:0016831
GO:0030976
GO:0044281
AF-A0A0F4XSL0-F1-model_v4 Aldehyde dehydrogenase 0.9956 1 198 GO:0016831
GO:0030976
GO:0044281

Feature Viewer

pLDDT pTM Quality
92.04 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map