F484209
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 872 | 390 | 841 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300002704|JGI25155J39150_1001042|JGI25155J39150_10010422 |
| Length | 288 |
| Sequence | MADQAAHAADSGKEAQEPRQSKFGRLLLTGAGGGLGKVLRPRLAAFADVLRVSDLEAALTGEPAAHEEVMPCNLADRAAMDALIAGCDAIVHLGGVSVERPFEEILEANIKGVFHVYEAARRHGVKRVVFASSNHVTGFYRQDEKIDVRDLRRPDGYYGLSKSYGEDMAQFNFDRYGIETVSIRIGWSFPEPKDRRSLASWLSYDDLTELLRCCLFTPNVGHTVVYGMSDNPSTWWSNRYAAHLGFQARDSSEAFRAKIEAQPMPAADDPVRVYQGGVFTATGPFDPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 6 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 7 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 8 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 9 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 10 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 11 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 12 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 13 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 14 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 15 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 16 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 17 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 18 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 19 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 20 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 21 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 22 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 23 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 24 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 25 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 26 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 27 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 28 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 29 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 30 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 31 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 32 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 33 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 34 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 35 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 36 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 37 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 38 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 39 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 42 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 43 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 44 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 62 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 68 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 87 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 92 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 96 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 98 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 99 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 100 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 101 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 102 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 103 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 104 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 105 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 106 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 112 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 113 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 114 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 115 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 116 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 153 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 240 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 241 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 242 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 243 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 244 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 245 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 246 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 247 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 248 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 249 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 254 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 255 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 256 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 257 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 258 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 259 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 271 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 272 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 273 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 278 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 279 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 280 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 281 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 282 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 283 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 284 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 285 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 288 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 289 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 290 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 291 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 292 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 293 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 338 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 339 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 340 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 341 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 345 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 353 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 354 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 360 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 361 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 362 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 368 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 370 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 371 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 372 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 373 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 374 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 375 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 376 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 377 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 378 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 379 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 380 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 382 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 385 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 386 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 388 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 389 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 390 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.33 |
| Metatranscriptomes | 0 |
| Isolates | 3.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 19.27 |
| Nodule | 0.46 |
| Rhizoplane | 1.95 |
| Rhizosphere | 68.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000123 | 3300002704 | Bacteria | 37730 |
| 2 | JGI25155J39150_1001042 | 3300002704 | Bacteria | 2929 |
| 3 | JGI25156J39149_1000052 | 3300002705 | Bacteria | 89046 |
| 4 | JGI25162J39368_1000414 | 3300002737 | Bacteria | 34857 |
| 5 | JGI25154J39366_1000081 | 3300002738 | Bacteria | 89046 |
| 6 | JGI25154J39366_1000128 | 3300002738 | Bacteria | 59551 |
| 7 | JGI25157J39369_1000006 | 3300002741 | Bacteria | 226861 |
| 8 | JGI25152J39213_1002063 | 3300002773 | Bacteria | 7909 |
| 9 | JGI25150J39212_1007965 | 3300002774 | Bacteria | 2099 |
| 10 | JGI25150J39212_1008331 | 3300002774 | Bacteria | 2033 |
| 11 | JGI25159J45721_1005943 | 3300002987 | Bacteria | 3743 |
| 12 | JGI25159J45721_1010857 | 3300002987 | Bacteria | 2281 |
| 13 | JGI25151J46595_10007771 | 3300003187 | Bacteria | 5217 |
| 14 | JGI25151J46595_10033260 | 3300003187 | Bacteria | 1988 |
| 15 | JGI25165J46597_1000135 | 3300003214 | Bacteria | 122924 |
| 16 | JGI25153J46596_10011901 | 3300003215 | Bacteria | 3809 |
| 17 | JGI25153J46596_10016520 | 3300003215 | Bacteria | 2950 |
| 18 | rootH1_10020400 | 3300003316 | Bacteria | 6751 |
| 19 | rootH1_10062309 | 3300003316 | Bacteria | 4463 |
| 20 | rootH1_10062309 | 3300003323 | Unclassified | 2756 |
| 21 | JGI25160J50197_1000071 | 3300003354 | Bacteria | 108301 |
| 22 | JGI25161J50226_1000144 | 3300003374 | Bacteria | 49457 |
| 23 | Ga0055538_1000055 | 3300003751 | Bacteria | 122924 |
| 24 | Ga0055539_1000080 | 3300003752 | Bacteria | 122924 |
| 25 | Ga0055533_1000086 | 3300003756 | Bacteria | 122924 |
| 26 | Ga0055525_1000114 | 3300003759 | Bacteria | 122924 |
| 27 | Ga0055535_1000891 | 3300003761 | Bacteria | 20502 |
| 28 | Ga0055529_1000622 | 3300003763 | Bacteria | 26539 |
| 29 | Ga0055526_1008751 | 3300003771 | Bacteria | 4991 |
| 30 | Ga0055537_1000689 | 3300003773 | Bacteria | 17610 |
| 31 | Ga0055537_1016026 | 3300003773 | Bacteria | 1286 |
| 32 | Ga0055524_1000006 | 3300003775 | Bacteria | 324702 |
| 33 | Ga0055524_1000033 | 3300003775 | Bacteria | 180833 |
| 34 | Ga0055536_1025617 | 3300003781 | Bacteria | 1675 |
| 35 | Ga0055534_1000850 | 3300003784 | Bacteria | 14043 |
| 36 | Ga0055528_1000432 | 3300003790 | Bacteria | 33611 |
| 37 | Ga0055530_10001172 | 3300003791 | Bacteria | 20267 |
| 38 | Ga0055530_10002040 | 3300003791 | Bacteria | 13623 |
| 39 | Ga0055540_1000005 | 3300003792 | Bacteria | 378126 |
| 40 | Ga0055540_1000007 | 3300003792 | Bacteria | 318178 |
| 41 | Ga0055540_1007509 | 3300003792 | Bacteria | 4097 |
| 42 | Ga0055531_10001249 | 3300003794 | Bacteria | 19299 |
| 43 | Ga0055531_10004316 | 3300003794 | Bacteria | 8709 |
| 44 | Ga0055531_10005581 | 3300003794 | Bacteria | 7338 |
| 45 | Ga0055541_1000057 | 3300003841 | Bacteria | 122924 |
| 46 | Ga0055543_1000162 | 3300004625 | Bacteria | 55480 |
| 47 | Ga0065165_1003473 | 3300005262 | Bacteria | 11008 |
| 48 | Ga0065165_1036109 | 3300005262 | Bacteria | 1511 |
| 49 | Ga0070658_10061636 | 3300005327 | Bacteria | 3056 |
| 50 | Ga0070658_10141954 | 3300005327 | Bacteria | 2007 |
| 51 | Ga0070676_10006595 | 3300005328 | Bacteria | 6207 |
| 52 | Ga0070676_10021803 | 3300005328 | Bacteria | 3587 |
| 53 | Ga0070676_10035514 | 3300005328 | Bacteria | 2868 |
| 54 | Ga0070676_10066798 | 3300005328 | Bacteria | 2149 |
| 55 | Ga0070690_100001452 | 3300005330 | Bacteria | 12372 |
| 56 | Ga0070690_100022429 | 3300005330 | Bacteria | 3863 |
| 57 | Ga0070690_100122522 | 3300005330 | Bacteria | 1747 |
| 58 | Ga0070670_100003877 | 3300005331 | Bacteria | 12476 |
| 59 | Ga0070670_100006300 | 3300005331 | Bacteria | 10047 |
| 60 | Ga0070670_100029278 | 3300005331 | Bacteria | 4739 |
| 61 | Ga0070670_100037863 | 3300005331 | Bacteria | 4149 |
| 62 | Ga0070670_100161566 | 3300005331 | Bacteria | 1941 |
| 63 | Ga0070670_100219464 | 3300005331 | Bacteria | 1654 |
| 64 | Ga0070670_100346801 | 3300005331 | Bacteria | 1304 |
| 65 | Ga0070670_100365812 | 3300005331 | Bacteria | 1269 |
| 66 | Ga0070677_10001476 | 3300005333 | Bacteria | 7436 |
| 67 | Ga0070677_10004019 | 3300005333 | Bacteria | 4776 |
| 68 | Ga0070677_10006747 | 3300005333 | Bacteria | 3821 |
| 69 | Ga0070677_10009993 | 3300005333 | Bacteria | 3232 |
| 70 | Ga0068869_100007843 | 3300005334 | Bacteria | 6851 |
| 71 | Ga0068869_100009960 | 3300005334 | Bacteria | 6178 |
| 72 | Ga0068869_100109806 | 3300005334 | Bacteria | 2097 |
| 73 | Ga0068869_100382916 | 3300005334 | Bacteria | 1153 |
| 74 | Ga0070666_10001342 | 3300005335 | Bacteria | 14927 |
| 75 | Ga0070666_10029664 | 3300005335 | Bacteria | 3598 |
| 76 | Ga0070666_10104785 | 3300005335 | Bacteria | 1953 |
| 77 | Ga0070682_100050395 | 3300005337 | Bacteria | 2599 |
| 78 | Ga0068868_100000930 | 3300005338 | Bacteria | 19942 |
| 79 | Ga0068868_100059254 | 3300005338 | Bacteria | 3028 |
| 80 | Ga0068868_100141609 | 3300005338 | Bacteria | 1974 |
| 81 | Ga0068868_100143353 | 3300005338 | Bacteria | 1963 |
| 82 | Ga0070689_100026477 | 3300005340 | Bacteria | 4367 |
| 83 | Ga0070687_100026010 | 3300005343 | Bacteria | 2813 |
| 84 | Ga0070661_100000421 | 3300005344 | Bacteria | 32488 |
| 85 | Ga0070661_100020513 | 3300005344 | Bacteria | 4714 |
| 86 | Ga0070661_100067019 | 3300005344 | Bacteria | 2638 |
| 87 | Ga0070661_100150333 | 3300005344 | Bacteria | 1760 |
| 88 | Ga0070661_100168852 | 3300005344 | Bacteria | 1660 |
| 89 | Ga0070668_100063241 | 3300005347 | Bacteria | 2868 |
| 90 | Ga0070669_100008965 | 3300005353 | Bacteria | 7140 |
| 91 | Ga0070669_100254237 | 3300005353 | Bacteria | 1400 |
| 92 | Ga0070675_100000926 | 3300005354 | Bacteria | 20887 |
| 93 | Ga0070675_100006716 | 3300005354 | Bacteria | 8846 |
| 94 | Ga0070675_100023645 | 3300005354 | Bacteria | 4915 |
| 95 | Ga0070675_100082173 | 3300005354 | Bacteria | 2687 |
| 96 | Ga0070675_100219449 | 3300005354 | Bacteria | 1655 |
| 97 | Ga0070671_100005287 | 3300005355 | Bacteria | 10298 |
| 98 | Ga0070671_100006545 | 3300005355 | Bacteria | 9314 |
| 99 | Ga0070671_100008975 | 3300005355 | Bacteria | 8023 |
| 100 | Ga0070671_100119488 | 3300005355 | Bacteria | 2217 |
| 101 | Ga0070671_100169798 | 3300005355 | Bacteria | 1845 |
| 102 | Ga0070671_100268378 | 3300005355 | Bacteria | 1450 |
| 103 | Ga0070671_100336060 | 3300005355 | Bacteria | 1288 |
| 104 | Ga0070674_100012835 | 3300005356 | Bacteria | 5157 |
| 105 | Ga0070674_100014454 | 3300005356 | Bacteria | 4907 |
| 106 | Ga0070674_100031292 | 3300005356 | Bacteria | 3525 |
| 107 | Ga0070674_100123469 | 3300005356 | Bacteria | 1920 |
| 108 | Ga0070673_100031264 | 3300005364 | Bacteria | 3993 |
| 109 | Ga0070673_100054845 | 3300005364 | Bacteria | 3138 |
| 110 | Ga0070659_100001131 | 3300005366 | Bacteria | 19448 |
| 111 | Ga0070659_100021789 | 3300005366 | Bacteria | 4885 |
| 112 | Ga0070667_100011038 | 3300005367 | Bacteria | 7472 |
| 113 | Ga0070667_100017549 | 3300005367 | Bacteria | 5932 |
| 114 | Ga0070667_100063167 | 3300005367 | Bacteria | 3137 |
| 115 | Ga0070667_100254418 | 3300005367 | Bacteria | 1571 |
| 116 | Ga0070701_10067747 | 3300005438 | Bacteria | 1900 |
| 117 | Ga0070700_100322159 | 3300005441 | Bacteria | 1136 |
| 118 | Ga0070678_100013269 | 3300005456 | Bacteria | 5158 |
| 119 | Ga0070678_100038573 | 3300005456 | Bacteria | 3364 |
| 120 | Ga0070678_100050929 | 3300005456 | Bacteria | 2998 |
| 121 | Ga0070678_100129140 | 3300005456 | Bacteria | 2005 |
| 122 | Ga0070678_100226481 | 3300005456 | Bacteria | 1557 |
| 123 | Ga0070678_100229716 | 3300005456 | Bacteria | 1546 |
| 124 | Ga0070678_100284977 | 3300005456 | Bacteria | 1398 |
| 125 | Ga0070678_100350956 | 3300005456 | Bacteria | 1268 |
| 126 | Ga0070662_100025220 | 3300005457 | Bacteria | 4103 |
| 127 | Ga0070662_100047086 | 3300005457 | Bacteria | 3100 |
| 128 | Ga0070662_100065813 | 3300005457 | Bacteria | 2658 |
| 129 | Ga0070662_100076490 | 3300005457 | Bacteria | 2481 |
| 130 | Ga0068867_100000048 | 3300005459 | Bacteria | 73813 |
| 131 | Ga0068867_100001383 | 3300005459 | Bacteria | 16772 |
| 132 | Ga0068867_100002855 | 3300005459 | Bacteria | 12149 |
| 133 | Ga0068867_100004608 | 3300005459 | Bacteria | 9701 |
| 134 | Ga0068867_100007763 | 3300005459 | Bacteria | 7585 |
| 135 | Ga0068867_100024081 | 3300005459 | Bacteria | 4362 |
| 136 | Ga0068867_100068350 | 3300005459 | Bacteria | 2651 |
| 137 | Ga0068867_100112679 | 3300005459 | Bacteria | 2092 |
| 138 | Ga0068867_100190352 | 3300005459 | Bacteria | 1637 |
| 139 | Ga0070685_10286535 | 3300005466 | Bacteria | 1105 |
| 140 | Ga0070706_100002704 | 3300005467 | Bacteria | 17739 |
| 141 | Ga0070699_100233632 | 3300005518 | Bacteria | 1640 |
| 142 | Ga0070684_100004660 | 3300005535 | Bacteria | 10467 |
| 143 | Ga0070684_100527755 | 3300005535 | Bacteria | 1094 |
| 144 | Ga0068853_100037028 | 3300005539 | Bacteria | 4150 |
| 145 | Ga0068853_100053921 | 3300005539 | Bacteria | 3464 |
| 146 | Ga0068853_100118152 | 3300005539 | Bacteria | 2363 |
| 147 | Ga0068853_100347362 | 3300005539 | Bacteria | 1379 |
| 148 | Ga0070672_100016710 | 3300005543 | Bacteria | 5260 |
| 149 | Ga0070672_100026178 | 3300005543 | Bacteria | 4336 |
| 150 | Ga0070672_100051192 | 3300005543 | Bacteria | 3219 |
| 151 | Ga0070672_100068603 | 3300005543 | Bacteria | 2813 |
| 152 | Ga0070672_100100057 | 3300005543 | Bacteria | 2351 |
| 153 | Ga0070672_100112023 | 3300005543 | Bacteria | 2225 |
| 154 | Ga0070672_100158352 | 3300005543 | Bacteria | 1877 |
| 155 | Ga0070672_100180274 | 3300005543 | Bacteria | 1760 |
| 156 | Ga0070672_100183062 | 3300005543 | Bacteria | 1746 |
| 157 | Ga0070672_100199760 | 3300005543 | Bacteria | 1672 |
| 158 | Ga0070672_100369935 | 3300005543 | Bacteria | 1224 |
| 159 | Ga0070693_100077521 | 3300005547 | Bacteria | 1972 |
| 160 | Ga0070693_100161165 | 3300005547 | Bacteria | 1429 |
| 161 | Ga0070665_100016102 | 3300005548 | Bacteria | 7503 |
| 162 | Ga0070665_100200321 | 3300005548 | Bacteria | 1997 |
| 163 | Ga0070665_100278976 | 3300005548 | Bacteria | 1673 |
| 164 | Ga0070665_100426083 | 3300005548 | Bacteria | 1336 |
| 165 | Ga0068855_100044323 | 3300005563 | Bacteria | 5264 |
| 166 | Ga0070664_100001426 | 3300005564 | Bacteria | 19072 |
| 167 | Ga0070664_100050396 | 3300005564 | Bacteria | 3523 |
| 168 | Ga0070664_100078785 | 3300005564 | Bacteria | 2834 |
| 169 | Ga0070664_100105483 | 3300005564 | Bacteria | 2455 |
| 170 | Ga0070664_100120375 | 3300005564 | Bacteria | 2298 |
| 171 | Ga0070664_100147680 | 3300005564 | Bacteria | 2074 |
| 172 | Ga0070664_100163631 | 3300005564 | Bacteria | 1970 |
| 173 | Ga0070664_100289543 | 3300005564 | Bacteria | 1478 |
| 174 | Ga0068857_100119625 | 3300005577 | Bacteria | 2371 |
| 175 | Ga0068857_100237252 | 3300005577 | Bacteria | 1669 |
| 176 | Ga0068857_100438830 | 3300005577 | Bacteria | 1219 |
| 177 | Ga0068854_100018851 | 3300005578 | Bacteria | 4639 |
| 178 | Ga0068854_100019957 | 3300005578 | Bacteria | 4525 |
| 179 | Ga0068854_100115693 | 3300005578 | Bacteria | 2029 |
| 180 | Ga0068856_100008227 | 3300005614 | Bacteria | 10167 |
| 181 | Ga0068856_100047733 | 3300005614 | Bacteria | 4219 |
| 182 | Ga0068856_100055782 | 3300005614 | Bacteria | 3899 |
| 183 | Ga0068856_100166397 | 3300005614 | Bacteria | 2216 |
| 184 | Ga0068852_100045508 | 3300005616 | Bacteria | 3733 |
| 185 | Ga0068852_100052239 | 3300005616 | Bacteria | 3512 |
| 186 | Ga0068852_100063558 | 3300005616 | Bacteria | 3214 |
| 187 | Ga0068852_100089038 | 3300005616 | Bacteria | 2758 |
| 188 | Ga0068852_100113517 | 3300005616 | Bacteria | 2467 |
| 189 | Ga0068852_100255769 | 3300005616 | Bacteria | 1679 |
| 190 | Ga0068852_100270354 | 3300005616 | Bacteria | 1635 |
| 191 | Ga0068859_100001157 | 3300005617 | Bacteria | 26939 |
| 192 | Ga0068859_100166879 | 3300005617 | Bacteria | 2281 |
| 193 | Ga0068864_100043931 | 3300005618 | Bacteria | 3827 |
| 194 | Ga0068864_100120199 | 3300005618 | Bacteria | 2348 |
| 195 | Ga0068864_100228811 | 3300005618 | Bacteria | 1719 |
| 196 | Ga0068866_10016531 | 3300005718 | Bacteria | 3300 |
| 197 | Ga0068866_10197080 | 3300005718 | Bacteria | 1201 |
| 198 | Ga0068861_100013043 | 3300005719 | Bacteria | 5811 |
| 199 | Ga0068861_100021750 | 3300005719 | Bacteria | 4612 |
| 200 | Ga0068861_100038148 | 3300005719 | Bacteria | 3575 |
| 201 | Ga0068851_10009512 | 3300005834 | Bacteria | 4522 |
| 202 | Ga0068851_10023882 | 3300005834 | Bacteria | 2990 |
| 203 | Ga0068851_10027772 | 3300005834 | Bacteria | 2791 |
| 204 | Ga0068870_10016501 | 3300005840 | Bacteria | 3530 |
| 205 | Ga0068870_10041145 | 3300005840 | Bacteria | 2400 |
| 206 | Ga0068870_10199416 | 3300005840 | Bacteria | 1213 |
| 207 | Ga0068863_100008961 | 3300005841 | Bacteria | 9770 |
| 208 | Ga0068863_100036313 | 3300005841 | Bacteria | 4694 |
| 209 | Ga0068863_100072562 | 3300005841 | Bacteria | 3257 |
| 210 | Ga0068863_100216288 | 3300005841 | Bacteria | 1845 |
| 211 | Ga0068858_100001292 | 3300005842 | Bacteria | 25859 |
| 212 | Ga0068858_100024788 | 3300005842 | Bacteria | 5586 |
| 213 | Ga0068858_100035096 | 3300005842 | Bacteria | 4651 |
| 214 | Ga0068858_100062309 | 3300005842 | Bacteria | 3448 |
| 215 | Ga0068858_100378133 | 3300005842 | Bacteria | 1359 |
| 216 | Ga0068860_100001127 | 3300005843 | Bacteria | 29390 |
| 217 | Ga0068860_100003662 | 3300005843 | Bacteria | 15820 |
| 218 | Ga0068860_100089173 | 3300005843 | Bacteria | 2936 |
| 219 | Ga0068860_100101804 | 3300005843 | Bacteria | 2740 |
| 220 | Ga0068860_100313647 | 3300005843 | Bacteria | 1538 |
| 221 | Ga0068862_100008423 | 3300005844 | Bacteria | 8534 |
| 222 | Ga0068862_100028683 | 3300005844 | Bacteria | 4687 |
| 223 | Ga0075365_10018586 | 3300006038 | Bacteria | 4276 |
| 224 | Ga0075368_10025717 | 3300006042 | Bacteria | 2259 |
| 225 | Ga0075363_100196934 | 3300006048 | Bacteria | 1150 |
| 226 | Ga0075432_10008161 | 3300006058 | Bacteria | 3570 |
| 227 | Ga0075362_10106075 | 3300006177 | Bacteria | 1318 |
| 228 | Ga0075367_10137791 | 3300006178 | Bacteria | 1510 |
| 229 | Ga0075367_10274220 | 3300006178 | Bacteria | 1060 |
| 230 | Ga0075366_10000654 | 3300006195 | Bacteria | 16309 |
| 231 | Ga0075366_10001569 | 3300006195 | Bacteria | 11425 |
| 232 | Ga0075366_10003793 | 3300006195 | Bacteria | 8040 |
| 233 | Ga0075366_10004637 | 3300006195 | Bacteria | 7387 |
| 234 | Ga0075366_10035988 | 3300006195 | Bacteria | 2918 |
| 235 | Ga0075366_10061848 | 3300006195 | Bacteria | 2226 |
| 236 | Ga0075366_10067831 | 3300006195 | Bacteria | 2123 |
| 237 | Ga0075366_10077136 | 3300006195 | Bacteria | 1989 |
| 238 | Ga0075366_10168042 | 3300006195 | Bacteria | 1330 |
| 239 | Ga0097621_100004797 | 3300006237 | Bacteria | 9464 |
| 240 | Ga0097621_100010187 | 3300006237 | Bacteria | 6863 |
| 241 | Ga0097621_100012909 | 3300006237 | Bacteria | 6208 |
| 242 | Ga0097621_100092078 | 3300006237 | Bacteria | 2538 |
| 243 | Ga0097621_100171084 | 3300006237 | Bacteria | 1872 |
| 244 | Ga0097621_100227161 | 3300006237 | Bacteria | 1629 |
| 245 | Ga0075370_10000414 | 3300006353 | Bacteria | 15762 |
| 246 | Ga0075370_10009474 | 3300006353 | Bacteria | 5059 |
| 247 | Ga0075370_10010350 | 3300006353 | Bacteria | 4874 |
| 248 | Ga0068871_100008231 | 3300006358 | Bacteria | 7494 |
| 249 | Ga0068871_100021423 | 3300006358 | Bacteria | 4967 |
| 250 | Ga0068871_100022718 | 3300006358 | Bacteria | 4840 |
| 251 | Ga0068871_100249243 | 3300006358 | Bacteria | 1546 |
| 252 | Ga0068865_100049806 | 3300006881 | Bacteria | 2890 |
| 253 | Ga0068865_100296794 | 3300006881 | Bacteria | 1292 |
| 254 | Ga0097620_100001157 | 3300006931 | Bacteria | 26939 |
| 255 | Ga0097620_100166881 | 3300006931 | Bacteria | 2281 |
| 256 | Ga0079104_1000009 | 3300006946 | Bacteria | 367015 |
| 257 | Ga0079104_1023974 | 3300006946 | Bacteria | 1614 |
| 258 | Ga0105240_10007990 | 3300009093 | Bacteria | 15247 |
| 259 | Ga0105240_10105835 | 3300009093 | Bacteria | 3414 |
| 260 | Ga0105245_10018033 | 3300009098 | Bacteria | 6166 |
| 261 | Ga0105245_10077730 | 3300009098 | Bacteria | 3026 |
| 262 | Ga0105245_10187891 | 3300009098 | Bacteria | 1977 |
| 263 | Ga0114129_10052547 | 3300009147 | Bacteria | 5719 |
| 264 | Ga0105243_10002356 | 3300009148 | Bacteria | 15815 |
| 265 | Ga0105243_10035260 | 3300009148 | Bacteria | 3878 |
| 266 | Ga0105243_10047878 | 3300009148 | Bacteria | 3368 |
| 267 | Ga0105243_10161102 | 3300009148 | Bacteria | 1934 |
| 268 | Ga0105243_10232486 | 3300009148 | Bacteria | 1636 |
| 269 | Ga0105243_10321976 | 3300009148 | Bacteria | 1409 |
| 270 | Ga0105241_10152463 | 3300009174 | Bacteria | 1892 |
| 271 | Ga0105241_10333168 | 3300009174 | Bacteria | 1312 |
| 272 | Ga0105242_10077752 | 3300009176 | Bacteria | 2768 |
| 273 | Ga0105248_10024871 | 3300009177 | Bacteria | 6656 |
| 274 | Ga0105248_10107672 | 3300009177 | Bacteria | 3143 |
| 275 | Ga0105248_10243677 | 3300009177 | Bacteria | 2023 |
| 276 | Ga0105237_10003295 | 3300009545 | Bacteria | 19281 |
| 277 | Ga0105237_10007089 | 3300009545 | Bacteria | 12323 |
| 278 | Ga0105237_10034334 | 3300009545 | Bacteria | 5137 |
| 279 | Ga0105238_10003365 | 3300009551 | Bacteria | 15955 |
| 280 | Ga0105238_10020203 | 3300009551 | Bacteria | 6779 |
| 281 | Ga0105238_10084345 | 3300009551 | Bacteria | 3167 |
| 282 | Ga0105238_10114737 | 3300009551 | Bacteria | 2673 |
| 283 | Ga0105249_10020909 | 3300009553 | Bacteria | 5852 |
| 284 | Ga0105249_10021079 | 3300009553 | Bacteria | 5832 |
| 285 | Ga0105249_10039647 | 3300009553 | Bacteria | 4277 |
| 286 | Ga0105239_10003389 | 3300010375 | Bacteria | 19552 |
| 287 | Ga0105246_10071672 | 3300011119 | Bacteria | 2440 |
| 288 | Ga0105246_10341246 | 3300011119 | Bacteria | 1224 |
| 289 | Ga0157371_10047043 | 3300013102 | Bacteria | 3066 |
| 290 | Ga0157370_10290950 | 3300013104 | Bacteria | 1509 |
| 291 | Ga0157369_10030192 | 3300013105 | Bacteria | 5979 |
| 292 | Ga0157374_10027813 | 3300013296 | Bacteria | 5105 |
| 293 | Ga0157374_10077836 | 3300013296 | Bacteria | 3140 |
| 294 | Ga0157374_10189723 | 3300013296 | Bacteria | 2010 |
| 295 | Ga0157378_10009787 | 3300013297 | Bacteria | 8356 |
| 296 | Ga0157378_10092187 | 3300013297 | Bacteria | 2756 |
| 297 | Ga0157378_10179808 | 3300013297 | Bacteria | 1989 |
| 298 | Ga0157378_10397212 | 3300013297 | Bacteria | 1358 |
| 299 | Ga0163162_10005175 | 3300013306 | Bacteria | 12577 |
| 300 | Ga0163162_10039622 | 3300013306 | Bacteria | 4709 |
| 301 | Ga0157372_10020531 | 3300013307 | Bacteria | 7127 |
| 302 | Ga0157375_10009940 | 3300013308 | Bacteria | 8369 |
| 303 | Ga0157375_10020576 | 3300013308 | Bacteria | 6031 |
| 304 | Ga0157375_10025372 | 3300013308 | Bacteria | 5506 |
| 305 | Ga0157375_10028162 | 3300013308 | Bacteria | 5261 |
| 306 | Ga0157375_10036459 | 3300013308 | Bacteria | 4705 |
| 307 | Ga0157375_10045990 | 3300013308 | Bacteria | 4252 |
| 308 | Ga0157375_10076855 | 3300013308 | Bacteria | 3367 |
| 309 | Ga0157375_10154757 | 3300013308 | Bacteria | 2431 |
| 310 | Ga0163163_10002538 | 3300014325 | Bacteria | 15454 |
| 311 | Ga0157380_10001789 | 3300014326 | Bacteria | 14180 |
| 312 | Ga0157380_10047723 | 3300014326 | Bacteria | 3369 |
| 313 | Ga0157380_10071376 | 3300014326 | Bacteria | 2809 |
| 314 | Ga0157380_10071794 | 3300014326 | Bacteria | 2801 |
| 315 | Ga0157380_10076095 | 3300014326 | Bacteria | 2730 |
| 316 | Ga0157380_10409599 | 3300014326 | Bacteria | 1289 |
| 317 | Ga0157377_10000056 | 3300014745 | Bacteria | 87608 |
| 318 | Ga0157377_10072267 | 3300014745 | Bacteria | 1996 |
| 319 | Ga0157379_10013243 | 3300014968 | Bacteria | 7223 |
| 320 | Ga0157379_10020433 | 3300014968 | Bacteria | 5855 |
| 321 | Ga0157379_10025235 | 3300014968 | Bacteria | 5278 |
| 322 | Ga0157379_10130102 | 3300014968 | Bacteria | 2265 |
| 323 | Ga0157379_10135880 | 3300014968 | Bacteria | 2215 |
| 324 | Ga0157376_10014590 | 3300014969 | Bacteria | 5903 |
| 325 | Ga0157376_10021252 | 3300014969 | Bacteria | 5040 |
| 326 | Ga0157376_10051769 | 3300014969 | Bacteria | 3411 |
| 327 | Ga0182006_1015134 | 3300015261 | Bacteria | 3311 |
| 328 | Ga0182005_1000541 | 3300015265 | Bacteria | 19062 |
| 329 | Ga0163161_10033652 | 3300017792 | Bacteria | 3662 |
| 330 | Ga0163161_10113786 | 3300017792 | Bacteria | 2026 |
| 331 | Ga0163161_10162904 | 3300017792 | Bacteria | 1701 |
| 332 | Ga0163161_10343620 | 3300017792 | Bacteria | 1184 |
| 333 | Ga0213876_10052025 | 3300021384 | Bacteria | 2165 |
| 334 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 335 | Ga0209435_100034 | 3300025206 | Bacteria | 144486 |
| 336 | Ga0209435_100115 | 3300025206 | Bacteria | 30475 |
| 337 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 338 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 339 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 340 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 341 | Ga0207427_100570 | 3300025231 | Bacteria | 18553 |
| 342 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 343 | Ga0209258_100342 | 3300025242 | Bacteria | 68390 |
| 344 | Ga0207425_1001772 | 3300025245 | Bacteria | 8404 |
| 345 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 346 | Ga0209646_1000155 | 3300025246 | Bacteria | 95204 |
| 347 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 348 | Ga0209026_1000769 | 3300025250 | Bacteria | 17972 |
| 349 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 350 | Ga0209677_104403 | 3300025253 | Bacteria | 4079 |
| 351 | Ga0209148_1004217 | 3300025254 | Bacteria | 3604 |
| 352 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 353 | Ga0209759_1000375 | 3300025256 | Bacteria | 55963 |
| 354 | Ga0209759_1004950 | 3300025256 | Bacteria | 4815 |
| 355 | Ga0209759_1005146 | 3300025256 | Bacteria | 4661 |
| 356 | Ga0209759_1014038 | 3300025256 | Bacteria | 2138 |
| 357 | Ga0209129_1000062 | 3300025258 | Bacteria | 240655 |
| 358 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 359 | Ga0209565_1000124 | 3300025263 | Bacteria | 110789 |
| 360 | Ga0209565_1000910 | 3300025263 | Bacteria | 15931 |
| 361 | Ga0209565_1005822 | 3300025263 | Bacteria | 3537 |
| 362 | Ga0209455_1000511 | 3300025272 | Bacteria | 27782 |
| 363 | Ga0209673_1000043 | 3300025273 | Bacteria | 291503 |
| 364 | Ga0209673_1010877 | 3300025273 | Bacteria | 3799 |
| 365 | Ga0209673_1058334 | 3300025273 | Bacteria | 978 |
| 366 | Ga0209130_1000060 | 3300025284 | Bacteria | 201501 |
| 367 | Ga0209130_1000114 | 3300025284 | Bacteria | 130381 |
| 368 | Ga0209675_1000269 | 3300025291 | Bacteria | 49713 |
| 369 | Ga0209675_1009012 | 3300025291 | Bacteria | 3579 |
| 370 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 371 | Ga0209025_1004701 | 3300025294 | Bacteria | 11654 |
| 372 | Ga0209025_1007436 | 3300025294 | Bacteria | 8167 |
| 373 | Ga0209025_1025947 | 3300025294 | Bacteria | 2961 |
| 374 | Ga0209564_1000176 | 3300025295 | Bacteria | 152363 |
| 375 | Ga0209564_1000268 | 3300025295 | Bacteria | 109101 |
| 376 | Ga0209564_1002616 | 3300025295 | Bacteria | 13766 |
| 377 | Ga0209564_1007511 | 3300025295 | Bacteria | 5616 |
| 378 | Ga0209758_1000378 | 3300025297 | Bacteria | 77514 |
| 379 | Ga0209758_1000517 | 3300025297 | Bacteria | 61999 |
| 380 | Ga0209758_1025948 | 3300025297 | Bacteria | 2554 |
| 381 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 382 | Ga0209050_1000118 | 3300025298 | Bacteria | 202586 |
| 383 | Ga0209050_1000243 | 3300025298 | Bacteria | 117715 |
| 384 | Ga0209050_1002216 | 3300025298 | Bacteria | 17437 |
| 385 | Ga0209050_1002992 | 3300025298 | Bacteria | 13147 |
| 386 | Ga0209050_1016204 | 3300025298 | Bacteria | 3067 |
| 387 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 388 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 389 | Ga0209256_1021803 | 3300025299 | Bacteria | 1956 |
| 390 | Ga0207426_1000308 | 3300025302 | Bacteria | 96061 |
| 391 | Ga0207426_1002574 | 3300025302 | Bacteria | 11305 |
| 392 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 393 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 394 | Ga0209051_1000853 | 3300025303 | Bacteria | 31106 |
| 395 | Ga0209051_1044684 | 3300025303 | Bacteria | 1541 |
| 396 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 397 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 398 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 399 | Ga0209257_1000044 | 3300025304 | Bacteria | 486709 |
| 400 | Ga0209257_1024509 | 3300025304 | Bacteria | 2087 |
| 401 | Ga0209257_1035649 | 3300025304 | Bacteria | 1537 |
| 402 | Ga0207697_10007005 | 3300025315 | Bacteria | 5053 |
| 403 | Ga0207697_10093659 | 3300025315 | Bacteria | 1275 |
| 404 | Ga0207697_10098244 | 3300025315 | Bacteria | 1246 |
| 405 | Ga0207682_10000706 | 3300025893 | Bacteria | 15485 |
| 406 | Ga0207682_10007480 | 3300025893 | Bacteria | 4349 |
| 407 | Ga0207682_10009359 | 3300025893 | Bacteria | 3868 |
| 408 | Ga0207682_10012804 | 3300025893 | Bacteria | 3272 |
| 409 | Ga0207642_10098719 | 3300025899 | Bacteria | 1461 |
| 410 | Ga0207688_10200887 | 3300025901 | Bacteria | 1195 |
| 411 | Ga0207680_10005283 | 3300025903 | Bacteria | 6164 |
| 412 | Ga0207680_10026030 | 3300025903 | Bacteria | 3236 |
| 413 | Ga0207680_10080108 | 3300025903 | Bacteria | 2050 |
| 414 | Ga0207680_10085564 | 3300025903 | Bacteria | 1992 |
| 415 | Ga0207645_10000932 | 3300025907 | Bacteria | 24250 |
| 416 | Ga0207645_10016574 | 3300025907 | Bacteria | 4875 |
| 417 | Ga0207645_10032773 | 3300025907 | Bacteria | 3340 |
| 418 | Ga0207645_10075710 | 3300025907 | Bacteria | 2154 |
| 419 | Ga0207645_10114838 | 3300025907 | Bacteria | 1745 |
| 420 | Ga0207643_10044753 | 3300025908 | Bacteria | 2499 |
| 421 | Ga0207705_10191138 | 3300025909 | Bacteria | 1548 |
| 422 | Ga0207684_10006839 | 3300025910 | Bacteria | 10329 |
| 423 | Ga0207654_10184247 | 3300025911 | Bacteria | 1364 |
| 424 | Ga0207695_10099229 | 3300025913 | Bacteria | 2910 |
| 425 | Ga0207695_10318048 | 3300025913 | Bacteria | 1446 |
| 426 | Ga0207671_10002336 | 3300025914 | Bacteria | 20461 |
| 427 | Ga0207671_10005664 | 3300025914 | Bacteria | 11427 |
| 428 | Ga0207671_10050729 | 3300025914 | Bacteria | 3073 |
| 429 | Ga0207662_10093519 | 3300025918 | Bacteria | 1852 |
| 430 | Ga0207657_10009129 | 3300025919 | Bacteria | 10006 |
| 431 | Ga0207657_10045289 | 3300025919 | Bacteria | 3863 |
| 432 | Ga0207649_10000751 | 3300025920 | Bacteria | 21186 |
| 433 | Ga0207649_10287549 | 3300025920 | Bacteria | 1197 |
| 434 | Ga0207681_10005730 | 3300025923 | Bacteria | 7618 |
| 435 | Ga0207681_10069573 | 3300025923 | Bacteria | 2448 |
| 436 | Ga0207681_10070963 | 3300025923 | Bacteria | 2428 |
| 437 | Ga0207681_10098776 | 3300025923 | Bacteria | 2101 |
| 438 | Ga0207681_10321395 | 3300025923 | Bacteria | 1231 |
| 439 | Ga0207694_10072469 | 3300025924 | Bacteria | 2693 |
| 440 | Ga0207650_10002868 | 3300025925 | Bacteria | 11906 |
| 441 | Ga0207650_10054584 | 3300025925 | Bacteria | 2964 |
| 442 | Ga0207650_10073437 | 3300025925 | Bacteria | 2576 |
| 443 | Ga0207650_10173189 | 3300025925 | Bacteria | 1716 |
| 444 | Ga0207650_10210795 | 3300025925 | Bacteria | 1560 |
| 445 | Ga0207650_10300768 | 3300025925 | Bacteria | 1310 |
| 446 | Ga0207659_10001257 | 3300025926 | Bacteria | 15167 |
| 447 | Ga0207659_10013518 | 3300025926 | Bacteria | 5232 |
| 448 | Ga0207659_10015146 | 3300025926 | Bacteria | 4989 |
| 449 | Ga0207659_10028703 | 3300025926 | Bacteria | 3783 |
| 450 | Ga0207659_10036528 | 3300025926 | Bacteria | 3404 |
| 451 | Ga0207659_10044324 | 3300025926 | Bacteria | 3129 |
| 452 | Ga0207659_10142958 | 3300025926 | Bacteria | 1859 |
| 453 | Ga0207687_10102244 | 3300025927 | Bacteria | 2111 |
| 454 | Ga0207644_10000042 | 3300025931 | Bacteria | 112685 |
| 455 | Ga0207644_10006910 | 3300025931 | Bacteria | 7392 |
| 456 | Ga0207644_10007260 | 3300025931 | Bacteria | 7212 |
| 457 | Ga0207644_10088580 | 3300025931 | Bacteria | 2302 |
| 458 | Ga0207644_10153838 | 3300025931 | Bacteria | 1782 |
| 459 | Ga0207644_10358606 | 3300025931 | Bacteria | 1185 |
| 460 | Ga0207690_10000481 | 3300025932 | Bacteria | 25729 |
| 461 | Ga0207690_10018234 | 3300025932 | Bacteria | 4303 |
| 462 | Ga0207690_10170216 | 3300025932 | Bacteria | 1631 |
| 463 | Ga0207706_10017151 | 3300025933 | Bacteria | 6530 |
| 464 | Ga0207706_10020343 | 3300025933 | Bacteria | 5965 |
| 465 | Ga0207706_10066467 | 3300025933 | Bacteria | 3173 |
| 466 | Ga0207706_10067288 | 3300025933 | Bacteria | 3152 |
| 467 | Ga0207706_10099056 | 3300025933 | Bacteria | 2564 |
| 468 | Ga0207706_10201758 | 3300025933 | Bacteria | 1744 |
| 469 | Ga0207709_10002673 | 3300025935 | Bacteria | 11055 |
| 470 | Ga0207709_10115691 | 3300025935 | Bacteria | 1802 |
| 471 | Ga0207709_10119377 | 3300025935 | Bacteria | 1778 |
| 472 | Ga0207669_10013145 | 3300025937 | Bacteria | 4100 |
| 473 | Ga0207669_10133926 | 3300025937 | Bacteria | 1708 |
| 474 | Ga0207669_10370037 | 3300025937 | Bacteria | 1113 |
| 475 | Ga0207704_10195320 | 3300025938 | Bacteria | 1476 |
| 476 | Ga0207691_10000318 | 3300025940 | Bacteria | 47853 |
| 477 | Ga0207691_10017977 | 3300025940 | Bacteria | 6696 |
| 478 | Ga0207691_10027795 | 3300025940 | Bacteria | 5301 |
| 479 | Ga0207691_10036077 | 3300025940 | Bacteria | 4582 |
| 480 | Ga0207691_10037444 | 3300025940 | Bacteria | 4492 |
| 481 | Ga0207691_10045199 | 3300025940 | Bacteria | 4049 |
| 482 | Ga0207691_10047603 | 3300025940 | Bacteria | 3934 |
| 483 | Ga0207691_10074299 | 3300025940 | Bacteria | 3066 |
| 484 | Ga0207691_10084554 | 3300025940 | Bacteria | 2848 |
| 485 | Ga0207711_10004017 | 3300025941 | Bacteria | 12629 |
| 486 | Ga0207711_10010123 | 3300025941 | Bacteria | 7835 |
| 487 | Ga0207711_10014423 | 3300025941 | Bacteria | 6563 |
| 488 | Ga0207711_10101817 | 3300025941 | Bacteria | 2542 |
| 489 | Ga0207689_10013142 | 3300025942 | Bacteria | 7065 |
| 490 | Ga0207689_10058064 | 3300025942 | Bacteria | 3182 |
| 491 | Ga0207689_10060170 | 3300025942 | Bacteria | 3123 |
| 492 | Ga0207661_10037817 | 3300025944 | Bacteria | 3777 |
| 493 | Ga0207679_10000501 | 3300025945 | Bacteria | 26940 |
| 494 | Ga0207679_10046009 | 3300025945 | Bacteria | 3160 |
| 495 | Ga0207679_10072585 | 3300025945 | Bacteria | 2600 |
| 496 | Ga0207679_10335360 | 3300025945 | Bacteria | 1314 |
| 497 | Ga0207679_10444667 | 3300025945 | Bacteria | 1148 |
| 498 | Ga0207667_10046590 | 3300025949 | Bacteria | 4591 |
| 499 | Ga0207667_10497322 | 3300025949 | Bacteria | 1237 |
| 500 | Ga0207651_10000364 | 3300025960 | Bacteria | 19183 |
| 501 | Ga0207651_10006026 | 3300025960 | Bacteria | 6292 |
| 502 | Ga0207651_10041858 | 3300025960 | Bacteria | 3044 |
| 503 | Ga0207651_10046578 | 3300025960 | Bacteria | 2917 |
| 504 | Ga0207651_10054979 | 3300025960 | Bacteria | 2731 |
| 505 | Ga0207712_10041521 | 3300025961 | Bacteria | 3162 |
| 506 | Ga0207712_10194330 | 3300025961 | Bacteria | 1604 |
| 507 | Ga0207668_10012084 | 3300025972 | Bacteria | 5273 |
| 508 | Ga0207668_10012507 | 3300025972 | Bacteria | 5197 |
| 509 | Ga0207640_10013763 | 3300025981 | Bacteria | 4645 |
| 510 | Ga0207658_10002924 | 3300025986 | Bacteria | 12231 |
| 511 | Ga0207658_10004551 | 3300025986 | Bacteria | 9620 |
| 512 | Ga0207658_10005021 | 3300025986 | Bacteria | 9118 |
| 513 | Ga0207658_10072003 | 3300025986 | Bacteria | 2619 |
| 514 | Ga0207658_10077603 | 3300025986 | Bacteria | 2535 |
| 515 | Ga0207658_10288563 | 3300025986 | Bacteria | 1409 |
| 516 | Ga0207677_10013173 | 3300026023 | Bacteria | 4782 |
| 517 | Ga0207677_10083998 | 3300026023 | Bacteria | 2294 |
| 518 | Ga0207677_10084366 | 3300026023 | Bacteria | 2290 |
| 519 | Ga0207677_10133083 | 3300026023 | Bacteria | 1891 |
| 520 | Ga0207677_10593200 | 3300026023 | Bacteria | 971 |
| 521 | Ga0207703_10001647 | 3300026035 | Bacteria | 20096 |
| 522 | Ga0207703_10010862 | 3300026035 | Bacteria | 7100 |
| 523 | Ga0207703_10081473 | 3300026035 | Bacteria | 2698 |
| 524 | Ga0207703_10352718 | 3300026035 | Bacteria | 1355 |
| 525 | Ga0207639_10046131 | 3300026041 | Bacteria | 3286 |
| 526 | Ga0207639_10071881 | 3300026041 | Bacteria | 2708 |
| 527 | Ga0207639_10151636 | 3300026041 | Bacteria | 1942 |
| 528 | Ga0207678_10013097 | 3300026067 | Bacteria | 7275 |
| 529 | Ga0207678_10303781 | 3300026067 | Bacteria | 1371 |
| 530 | Ga0207708_10022289 | 3300026075 | Bacteria | 4782 |
| 531 | Ga0207702_10002308 | 3300026078 | Bacteria | 18242 |
| 532 | Ga0207702_10116578 | 3300026078 | Bacteria | 2383 |
| 533 | Ga0207702_10198726 | 3300026078 | Bacteria | 1857 |
| 534 | Ga0207641_10005423 | 3300026088 | Bacteria | 10888 |
| 535 | Ga0207641_10007604 | 3300026088 | Bacteria | 9011 |
| 536 | Ga0207641_10012523 | 3300026088 | Bacteria | 6952 |
| 537 | Ga0207641_10031474 | 3300026088 | Bacteria | 4401 |
| 538 | Ga0207641_10162836 | 3300026088 | Bacteria | 2029 |
| 539 | Ga0207641_10170410 | 3300026088 | Bacteria | 1986 |
| 540 | Ga0207648_10000492 | 3300026089 | Bacteria | 44104 |
| 541 | Ga0207648_10002026 | 3300026089 | Bacteria | 22125 |
| 542 | Ga0207648_10006568 | 3300026089 | Bacteria | 11552 |
| 543 | Ga0207648_10020730 | 3300026089 | Bacteria | 5917 |
| 544 | Ga0207648_10041853 | 3300026089 | Bacteria | 4023 |
| 545 | Ga0207648_10043392 | 3300026089 | Bacteria | 3947 |
| 546 | Ga0207648_10080809 | 3300026089 | Bacteria | 2836 |
| 547 | Ga0207648_10177524 | 3300026089 | Bacteria | 1884 |
| 548 | Ga0207676_10001498 | 3300026095 | Bacteria | 17239 |
| 549 | Ga0207676_10017299 | 3300026095 | Bacteria | 5226 |
| 550 | Ga0207676_10021790 | 3300026095 | Bacteria | 4705 |
| 551 | Ga0207676_10227678 | 3300026095 | Bacteria | 1664 |
| 552 | Ga0207674_10049675 | 3300026116 | Bacteria | 4288 |
| 553 | Ga0207674_10063382 | 3300026116 | Bacteria | 3731 |
| 554 | Ga0207674_10106917 | 3300026116 | Bacteria | 2775 |
| 555 | Ga0207674_10384556 | 3300026116 | Bacteria | 1357 |
| 556 | Ga0207675_100008838 | 3300026118 | Bacteria | 9453 |
| 557 | Ga0207675_100011212 | 3300026118 | Bacteria | 8394 |
| 558 | Ga0207675_100074019 | 3300026118 | Bacteria | 3187 |
| 559 | Ga0207675_100404798 | 3300026118 | Bacteria | 1345 |
| 560 | Ga0207683_10010653 | 3300026121 | Bacteria | 7837 |
| 561 | Ga0207683_10016734 | 3300026121 | Bacteria | 6241 |
| 562 | Ga0207683_10033147 | 3300026121 | Bacteria | 4486 |
| 563 | Ga0207683_10038389 | 3300026121 | Bacteria | 4174 |
| 564 | Ga0207683_10049633 | 3300026121 | Bacteria | 3675 |
| 565 | Ga0207683_10050334 | 3300026121 | Bacteria | 3649 |
| 566 | Ga0207683_10058883 | 3300026121 | Bacteria | 3373 |
| 567 | Ga0207683_10111670 | 3300026121 | Bacteria | 2448 |
| 568 | Ga0207683_10299106 | 3300026121 | Bacteria | 1472 |
| 569 | Ga0207698_10025392 | 3300026142 | Bacteria | 4174 |
| 570 | Ga0207698_10028570 | 3300026142 | Bacteria | 3979 |
| 571 | Ga0207698_10073233 | 3300026142 | Bacteria | 2727 |
| 572 | Ga0207698_10073649 | 3300026142 | Bacteria | 2720 |
| 573 | Ga0207698_10074629 | 3300026142 | Bacteria | 2706 |
| 574 | Ga0207698_10142792 | 3300026142 | Bacteria | 2065 |
| 575 | Ga0207698_10230582 | 3300026142 | Bacteria | 1681 |
| 576 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 577 | Ga0209974_10013298 | 3300027876 | Bacteria | 2742 |
| 578 | Ga0207428_10215834 | 3300027907 | Bacteria | 1440 |
| 579 | Ga0268266_10092747 | 3300028379 | Bacteria | 2650 |
| 580 | Ga0268265_10045405 | 3300028380 | Bacteria | 3278 |
| 581 | Ga0268265_10054590 | 3300028380 | Bacteria | 3033 |
| 582 | Ga0268265_10068611 | 3300028380 | Bacteria | 2750 |
| 583 | Ga0268264_10001710 | 3300028381 | Bacteria | 20233 |
| 584 | Ga0268264_10018493 | 3300028381 | Bacteria | 5699 |
| 585 | Ga0268264_10105160 | 3300028381 | Bacteria | 2462 |
| 586 | Ga0268264_10305606 | 3300028381 | Bacteria | 1499 |
| 587 | Ga0268264_10726154 | 3300028381 | Bacteria | 988 |
| 588 | Ga0307517_10000228 | 3300028786 | Bacteria | 94852 |
| 589 | Ga0307517_10053504 | 3300028786 | Bacteria | 4018 |
| 590 | Ga0307517_10205333 | 3300028786 | Bacteria | 1224 |
| 591 | Ga0307515_10000458 | 3300028794 | Bacteria | 97523 |
| 592 | Ga0307515_10004357 | 3300028794 | Bacteria | 29345 |
| 593 | Ga0307515_10020859 | 3300028794 | Bacteria | 11649 |
| 594 | Ga0307515_10036443 | 3300028794 | Bacteria | 7956 |
| 595 | Ga0307515_10038277 | 3300028794 | Bacteria | 7679 |
| 596 | Ga0307515_10397660 | 3300028794 | Bacteria | 1004 |
| 597 | Ga0307512_10059122 | 3300030522 | Bacteria | 2978 |
| 598 | Ga0307512_10121533 | 3300030522 | Bacteria | 1675 |
| 599 | Ga0307512_10170525 | 3300030522 | Bacteria | 1249 |
| 600 | Ga0316181_1181538 | 3300030744 | Bacteria | 1482 |
| 601 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 602 | Ga0307513_10000094 | 3300031456 | Bacteria | 127685 |
| 603 | Ga0307513_10001393 | 3300031456 | Bacteria | 34808 |
| 604 | Ga0307513_10006563 | 3300031456 | Bacteria | 15193 |
| 605 | Ga0307513_10030687 | 3300031456 | Bacteria | 6102 |
| 606 | Ga0307513_10032666 | 3300031456 | Bacteria | 5865 |
| 607 | Ga0307513_10135388 | 3300031456 | Bacteria | 2400 |
| 608 | Ga0307509_10000426 | 3300031507 | Bacteria | 70899 |
| 609 | Ga0307408_100000288 | 3300031548 | Bacteria | 49765 |
| 610 | Ga0307408_100016115 | 3300031548 | Bacteria | 4984 |
| 611 | Ga0307408_100088275 | 3300031548 | Bacteria | 2335 |
| 612 | Ga0307408_100140129 | 3300031548 | Bacteria | 1897 |
| 613 | Ga0307508_10000040 | 3300031616 | Bacteria | 149333 |
| 614 | Ga0307508_10003969 | 3300031616 | Bacteria | 14667 |
| 615 | Ga0307514_10011867 | 3300031649 | Bacteria | 7248 |
| 616 | Ga0307514_10014681 | 3300031649 | Bacteria | 6479 |
| 617 | Ga0307514_10070063 | 3300031649 | Bacteria | 2635 |
| 618 | Ga0307516_10000460 | 3300031730 | Bacteria | 53821 |
| 619 | Ga0307516_10001446 | 3300031730 | Bacteria | 32808 |
| 620 | Ga0307516_10012998 | 3300031730 | Bacteria | 8919 |
| 621 | Ga0307516_10020589 | 3300031730 | Bacteria | 6812 |
| 622 | Ga0307516_10022952 | 3300031730 | Bacteria | 6403 |
| 623 | Ga0307516_10161191 | 3300031730 | Bacteria | 1992 |
| 624 | Ga0307516_10237526 | 3300031730 | Bacteria | 1523 |
| 625 | Ga0307516_10353488 | 3300031730 | Bacteria | 1135 |
| 626 | Ga0307405_10290392 | 3300031731 | Bacteria | 1235 |
| 627 | Ga0307413_10040120 | 3300031824 | Bacteria | 2729 |
| 628 | Ga0307413_10314011 | 3300031824 | Bacteria | 1194 |
| 629 | Ga0307406_10001222 | 3300031901 | Bacteria | 14379 |
| 630 | Ga0307406_10006272 | 3300031901 | Bacteria | 6553 |
| 631 | Ga0307406_10022081 | 3300031901 | Bacteria | 3773 |
| 632 | Ga0307412_10034844 | 3300031911 | Bacteria | 3211 |
| 633 | Ga0307412_10123600 | 3300031911 | Bacteria | 1867 |
| 634 | Ga0307409_100012808 | 3300031995 | Bacteria | 5362 |
| 635 | Ga0307409_100306137 | 3300031995 | Bacteria | 1481 |
| 636 | Ga0307416_100009118 | 3300032002 | Bacteria | 6466 |
| 637 | Ga0307416_100020199 | 3300032002 | Bacteria | 4746 |
| 638 | Ga0307416_100127951 | 3300032002 | Bacteria | 2279 |
| 639 | Ga0307414_10209979 | 3300032004 | Bacteria | 1590 |
| 640 | Ga0307411_10239000 | 3300032005 | Bacteria | 1421 |
| 641 | Ga0307411_10395953 | 3300032005 | Bacteria | 1140 |
| 642 | Ga0307415_100000538 | 3300032126 | Bacteria | 16532 |
| 643 | Ga0307510_10000109 | 3300033180 | Bacteria | 65353 |
| 644 | Ga0307510_10167982 | 3300033180 | Bacteria | 1778 |
| 645 | Ga0307510_10251031 | 3300033180 | Bacteria | 1257 |
| 646 | Ga0373930_0056600 | 3300034816 | Bacteria | 867 |
| 647 | Ga0373943_0041563 | 3300035170 | Bacteria | 2224 |
| 648 | Ga0373931_0000491 | 3300035691 | Bacteria | 16121 |
| 649 | Ga0373931_0011931 | 3300035691 | Bacteria | 4204 |
| 650 | Ga0373935_0200366 | 3300035692 | Bacteria | 1379 |
| 651 | Ga0373937_0206953 | 3300036401 | Bacteria | 1845 |
| 652 | Ga0373925_0023538 | 3300037068 | Bacteria | 4494 |
| 653 | Ga0373925_0061260 | 3300037068 | Bacteria | 2826 |
| 654 | Ga0395899_0016249 | 3300037312 | Bacteria | 5673 |
| 655 | Ga0395900_0004795 | 3300037418 | Bacteria | 14248 |
| 656 | Ga0395898_0008778 | 3300037466 | Bacteria | 10652 |
| 657 | Ga0395898_0396716 | 3300037466 | Bacteria | 1315 |
| 658 | Ga0395905_0010964 | 3300037471 | Bacteria | 8772 |
| 659 | Ga0395905_0031340 | 3300037471 | Bacteria | 5005 |
| 660 | Ga0395905_0122445 | 3300037471 | Bacteria | 2445 |
| 661 | Ga0395905_0261614 | 3300037471 | Bacteria | 1615 |
| 662 | Ga0395901_0320256 | 3300038443 | Bacteria | 1604 |
| 663 | Ga0436365_1021472 | 3300039437 | Bacteria | 4110 |
| 664 | Ga0436363_0446142 | 3300039450 | Bacteria | 1817 |
| 665 | Ga0439436_0062788 | 3300041404 | Bacteria | 1038 |
| 666 | Ga0451793_0083691 | 3300041452 | Bacteria | 1235 |
| 667 | Ga0451793_1251237 | 3300041452 | Bacteria | 1350 |
| 668 | Ga0451795_0141978 | 3300041456 | Bacteria | 2099 |
| 669 | Ga0451802_1322629 | 3300041460 | Bacteria | 1046 |
| 670 | Ga0451804_0097481 | 3300041463 | Bacteria | 1968 |
| 671 | Ga0451845_0950226 | 3300041501 | Bacteria | 1661 |
| 672 | Ga0451853_0207789 | 3300041512 | Bacteria | 1180 |
| 673 | Ga0451853_2068177 | 3300041512 | Bacteria | 3154 |
| 674 | Ga0439449_0029115 | 3300042007 | Bacteria | 2058 |
| 675 | Ga0450906_002330 | 3300042145 | Bacteria | 4161 |
| 676 | Ga0450909_009266 | 3300042185 | Bacteria | 1437 |
| 677 | Ga0439464_0019340 | 3300042439 | Bacteria | 1859 |
| 678 | Ga0450918_000096 | 3300042531 | Bacteria | 18894 |
| 679 | Ga0451577_0106204 | 3300042876 | Bacteria | 2510 |
| 680 | Ga0451577_0125429 | 3300042876 | Bacteria | 2301 |
| 681 | Ga0451577_0137658 | 3300042876 | Bacteria | 2193 |
| 682 | Ga0466969_0016680 | 3300044656 | Bacteria | 3841 |
| 683 | Ga0466965_0005472 | 3300044683 | Bacteria | 5726 |
| 684 | Ga0466965_0007760 | 3300044683 | Bacteria | 4939 |
| 685 | Ga0466966_0002799 | 3300044684 | Bacteria | 11467 |
| 686 | Ga0466961_0054732 | 3300044693 | Bacteria | 2544 |
| 687 | Ga0466961_0064566 | 3300044693 | Bacteria | 2326 |
| 688 | Ga0466961_0090729 | 3300044693 | Bacteria | 1929 |
| 689 | Ga0466963_0004270 | 3300044694 | Bacteria | 8290 |
| 690 | Ga0466963_0049304 | 3300044694 | Bacteria | 2785 |
| 691 | Ga0466964_0007355 | 3300044706 | Bacteria | 4117 |
| 692 | Ga0453684_0030595 | 3300044712 | Bacteria | 7600 |
| 693 | Ga0466971_0007914 | 3300044719 | Bacteria | 4629 |
| 694 | Ga0466971_0008150 | 3300044719 | Bacteria | 4568 |
| 695 | Ga0466971_0011994 | 3300044719 | Bacteria | 3796 |
| 696 | Ga0466968_0009338 | 3300044735 | Bacteria | 3771 |
| 697 | Ga0466968_0064515 | 3300044735 | Bacteria | 1584 |
| 698 | Ga0466957_0004305 | 3300044842 | Bacteria | 7901 |
| 699 | Ga0466957_0023494 | 3300044842 | Bacteria | 3644 |
| 700 | Ga0466959_0004285 | 3300045049 | Bacteria | 9516 |
| 701 | Ga0466959_0233439 | 3300045049 | Bacteria | 1272 |
| 702 | Ga0451576_0006080 | 3300045051 | Bacteria | 14882 |
| 703 | Ga0451576_0015848 | 3300045051 | Bacteria | 8336 |
| 704 | Ga0451576_0738451 | 3300045051 | Bacteria | 1034 |
| 705 | Ga0466958_0006879 | 3300045836 | Bacteria | 6218 |
| 706 | Ga0466967_0047961 | 3300045976 | Bacteria | 3727 |
| 707 | Ga0466967_0564764 | 3300045976 | Bacteria | 1121 |
| 708 | Ga0495590_0001358 | 3300046457 | Bacteria | 10646 |
| 709 | Ga0495590_0003934 | 3300046457 | Bacteria | 6041 |
| 710 | Ga0495638_0067412 | 3300046460 | Bacteria | 2198 |
| 711 | Ga0495651_0217798 | 3300046462 | Bacteria | 1323 |
| 712 | Ga0495653_0052358 | 3300046463 | Bacteria | 3128 |
| 713 | Ga0495639_0004493 | 3300046475 | Bacteria | 5981 |
| 714 | Ga0495606_0213550 | 3300046507 | Bacteria | 1091 |
| 715 | Ga0495608_0009282 | 3300046511 | Bacteria | 6877 |
| 716 | Ga0495610_0025940 | 3300046512 | Bacteria | 3136 |
| 717 | Ga0495610_0032346 | 3300046512 | Bacteria | 2718 |
| 718 | Ga0495618_0131615 | 3300046514 | Bacteria | 1600 |
| 719 | Ga0495620_0047397 | 3300046515 | Bacteria | 1850 |
| 720 | Ga0495620_0055463 | 3300046515 | Bacteria | 1670 |
| 721 | Ga0495628_0033268 | 3300046516 | Bacteria | 4156 |
| 722 | Ga0495632_0012595 | 3300046519 | Bacteria | 4871 |
| 723 | Ga0495632_0015796 | 3300046519 | Bacteria | 4220 |
| 724 | Ga0495643_0024642 | 3300046522 | Bacteria | 3411 |
| 725 | Ga0495654_0006531 | 3300046530 | Bacteria | 6611 |
| 726 | Ga0495586_0222037 | 3300046535 | Bacteria | 1074 |
| 727 | Ga0495598_0038421 | 3300046537 | Bacteria | 1386 |
| 728 | Ga0495621_0014745 | 3300046539 | Bacteria | 2480 |
| 729 | Ga0495645_0058781 | 3300046543 | Bacteria | 2789 |
| 730 | Ga0495622_0030748 | 3300046557 | Bacteria | 2510 |
| 731 | Ga0495668_0025704 | 3300046616 | Bacteria | 3344 |
| 732 | Ga0495625_0008288 | 3300046660 | Bacteria | 8882 |
| 733 | Ga0495625_0044809 | 3300046660 | Bacteria | 3201 |
| 734 | Ga0495625_0058675 | 3300046660 | Bacteria | 2734 |
| 735 | Ga0495625_0060922 | 3300046660 | Bacteria | 2672 |
| 736 | Ga0495635_0015601 | 3300046663 | Bacteria | 5309 |
| 737 | Ga0495599_0007092 | 3300046678 | Bacteria | 6784 |
| 738 | Ga0495623_0113673 | 3300046679 | Bacteria | 1638 |
| 739 | Ga0495646_0020960 | 3300046680 | Bacteria | 4133 |
| 740 | Ga0495647_0034445 | 3300046681 | Bacteria | 1896 |
| 741 | Ga0495658_0061800 | 3300046683 | Bacteria | 2152 |
| 742 | Ga0495671_0048442 | 3300046692 | Bacteria | 2120 |
| 743 | Ga0495671_0061709 | 3300046692 | Bacteria | 1849 |
| 744 | Ga0495649_0007205 | 3300046694 | Bacteria | 6820 |
| 745 | Ga0495600_0006804 | 3300046809 | Bacteria | 6971 |
| 746 | Ga0495660_0004975 | 3300046810 | Bacteria | 7999 |
| 747 | Ga0495660_0085796 | 3300046810 | Bacteria | 1644 |
| 748 | Ga0495604_0082818 | 3300047317 | Bacteria | 2398 |
| 749 | Ga0495687_000330 | 3300047443 | Bacteria | 60838 |
| 750 | Ga0495687_010702 | 3300047443 | Bacteria | 5005 |
| 751 | Ga0495687_010712 | 3300047443 | Bacteria | 5002 |
| 752 | Ga0495686_0001339 | 3300047472 | Bacteria | 27571 |
| 753 | Ga0495593_0115921 | 3300047673 | Bacteria | 1365 |
| 754 | Ga0495626_0029363 | 3300048091 | Bacteria | 2662 |
| 755 | Ga0496100_0056009 | 3300048903 | Bacteria | 2578 |
| 756 | Ga0496101_0276550 | 3300048904 | Bacteria | 1312 |
| 757 | Ga0496102_0013220 | 3300048905 | Bacteria | 7144 |
| 758 | Ga0496102_0314520 | 3300048905 | Bacteria | 1475 |
| 759 | Ga0496103_0095754 | 3300048906 | Bacteria | 1876 |
| 760 | Ga0496104_0009568 | 3300048907 | Bacteria | 8628 |
| 761 | Ga0496105_0024505 | 3300048908 | Bacteria | 4903 |
| 762 | Ga0496106_0002439 | 3300048909 | Bacteria | 13854 |
| 763 | Ga0496106_0095037 | 3300048909 | Bacteria | 2305 |
| 764 | Ga0496108_0029986 | 3300048911 | Bacteria | 4508 |
| 765 | Ga0496114_0001104 | 3300048917 | Bacteria | 20372 |
| 766 | Ga0496114_0086473 | 3300048917 | Bacteria | 2657 |
| 767 | Ga0496121_0019081 | 3300048924 | Bacteria | 6878 |
| 768 | Ga0496121_0260646 | 3300048924 | Bacteria | 1197 |
| 769 | Ga0501298_003130 | 3300049521 | Bacteria | 2552 |
| 770 | Ga0501038_0055025 | 3300049574 | Bacteria | 3420 |
| 771 | Ga0501042_0420896 | 3300049578 | Bacteria | 968 |
| 772 | Ga0501043_0000075 | 3300049579 | Bacteria | 86156 |
| 773 | Ga0501046_0000195 | 3300049580 | Bacteria | 62300 |
| 774 | Ga0501047_0000145 | 3300049581 | Bacteria | 86319 |
| 775 | Ga0501048_0003268 | 3300049582 | Bacteria | 12345 |
| 776 | Ga0501252_001117 | 3300049682 | Bacteria | 2384 |
| 777 | Ga0501262_000604 | 3300049759 | Bacteria | 4231 |
| 778 | Ga0501265_000800 | 3300049762 | Bacteria | 3462 |
| 779 | Ga0501035_0014603 | 3300049822 | Bacteria | 7249 |
| 780 | Ga0501044_0016149 | 3300049823 | Bacteria | 8025 |
| 781 | Ga0501044_0126233 | 3300049823 | Bacteria | 2556 |
| 782 | Ga0501045_0000705 | 3300049824 | Bacteria | 21244 |
| 783 | nmdc:mga03683_142028_c1 | 3300050489 | Bacteria | 1080 |
| 784 | nmdc:mga03683_89997_c1 | 3300050489 | Bacteria | 1337 |
| 785 | nmdc:mga03n38_55236_c1 | 3300050490 | Bacteria | 1788 |
| 786 | nmdc:mga00v17_184574_c1 | 3300050491 | Bacteria | 1346 |
| 787 | nmdc:mga0k408_1110_c1 | 3300050493 | Bacteria | 14744 |
| 788 | nmdc:mga0k408_1324_c1 | 3300050493 | Bacteria | 13382 |
| 789 | nmdc:mga0k408_133098_c1 | 3300050493 | Bacteria | 1476 |
| 790 | nmdc:mga0k408_153219_c1 | 3300050493 | Bacteria | 996 |
| 791 | nmdc:mga0k408_20845_c1 | 3300050493 | Bacteria | 3678 |
| 792 | nmdc:mga0k408_231687_c1 | 3300050493 | Bacteria | 1102 |
| 793 | nmdc:mga0k408_260504_c1 | 3300050493 | Bacteria | 1035 |
| 794 | nmdc:mga0k408_2870_c2 | 3300050493 | Bacteria | 2153 |
| 795 | nmdc:mga0k408_3826_c1 | 3300050493 | Bacteria | 7982 |
| 796 | nmdc:mga0k408_41858_c1 | 3300050493 | Bacteria | 2638 |
| 797 | nmdc:mga0k408_4731_c1 | 3300050493 | Bacteria | 7210 |
| 798 | nmdc:mga0k408_54342_c1 | 3300050493 | Bacteria | 2321 |
| 799 | nmdc:mga0k408_8116_c1 | 3300050493 | Bacteria | 5627 |
| 800 | nmdc:mga0k408_96600_c1 | 3300050493 | Bacteria | 1739 |
| 801 | nmdc:mga0k408_9794_c1 | 3300050493 | Bacteria | 5174 |
| 802 | nmdc:mga06z11_37018_c1 | 3300050494 | Bacteria | 2414 |
| 803 | nmdc:mga07m45_122534_c1 | 3300050496 | Bacteria | 1502 |
| 804 | nmdc:mga07m45_12663_c1 | 3300050496 | Bacteria | 4462 |
| 805 | nmdc:mga07m45_1430_c1 | 3300050496 | Bacteria | 10947 |
| 806 | nmdc:mga07m45_46844_c1 | 3300050496 | Bacteria | 2430 |
| 807 | nmdc:mga07m45_630_c1 | 3300050496 | Bacteria | 14978 |
| 808 | nmdc:mga07m45_93107_c1 | 3300050496 | Bacteria | 1728 |
| 809 | nmdc:mga08y16_380860_c1 | 3300050511 | Bacteria | 1446 |
| 810 | nmdc:mga0a205_389312_c1 | 3300050515 | Bacteria | 1258 |
| 811 | Ga0495601_0120521 | 3300053077 | Bacteria | 1703 |
| 812 | Ga0500578_0003366 | 3300053086 | Bacteria | 12051 |
| 813 | Ga0500578_0044897 | 3300053086 | Bacteria | 2836 |
| 814 | Ga0500578_0057270 | 3300053086 | Bacteria | 2492 |
| 815 | Ga0500644_0026585 | 3300053088 | Bacteria | 1792 |
| 816 | Ga0500583_0071088 | 3300053092 | Bacteria | 1664 |
| 817 | Ga0500651_0007902 | 3300053093 | Bacteria | 6222 |
| 818 | Ga0500651_0017641 | 3300053093 | Bacteria | 4409 |
| 819 | Ga0500641_0098199 | 3300053096 | Bacteria | 1255 |
| 820 | Ga0500562_006072 | 3300053108 | Bacteria | 3041 |
| 821 | Ga0500592_010134 | 3300053116 | Bacteria | 1501 |
| 822 | Ga0500593_003969 | 3300053117 | Bacteria | 5672 |
| 823 | Ga0500594_0002948 | 3300053118 | Bacteria | 3718 |
| 824 | Ga0500594_0066153 | 3300053118 | Bacteria | 1053 |
| 825 | Ga0500628_013444 | 3300053129 | Bacteria | 1528 |
| 826 | Ga0500642_0094420 | 3300053130 | Bacteria | 1385 |
| 827 | Ga0500652_000521 | 3300053131 | Bacteria | 13564 |
| 828 | Ga0500559_0001509 | 3300053136 | Bacteria | 13100 |
| 829 | Ga0500568_0015935 | 3300053139 | Bacteria | 3353 |
| 830 | Ga0500574_000842 | 3300053141 | Bacteria | 4171 |
| 831 | Ga0500604_0051911 | 3300053151 | Bacteria | 1267 |
| 832 | Ga0500616_0050109 | 3300053153 | Bacteria | 2206 |
| 833 | Ga0500622_0001293 | 3300053156 | Bacteria | 20363 |
| 834 | Ga0500570_087793 | 3300053724 | Bacteria | 1369 |
| 835 | Ga0500645_001182 | 3300053730 | Bacteria | 13909 |
| 836 | Ga0500645_002947 | 3300053730 | Bacteria | 7230 |
| 837 | Ga0500645_012277 | 3300053730 | Bacteria | 2770 |
| 838 | Ga0500645_014969 | 3300053730 | Bacteria | 2464 |
| 839 | Ga0500587_000635 | 3300053739 | Bacteria | 4434 |
| 840 | Ga0500587_007104 | 3300053739 | Bacteria | 1466 |
| 841 | Ga0466962_0012516 | 3300061719 | Bacteria | 4078 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025918 | Ga0207662_10093519 | Ga0207662_100935192 | 232 |
| 2 | 3300005328 | Ga0070676_10006595 | Ga0070676_100065952 | 245 |
| 3 | 3300005330 | Ga0070690_100022429 | Ga0070690_1000224292 | 245 |
| 4 | 3300005333 | Ga0070677_10006747 | Ga0070677_100067474 | 245 |
| 5 | 3300005334 | Ga0068869_100009960 | Ga0068869_1000099602 | 245 |
| 6 | 3300005335 | Ga0070666_10001342 | Ga0070666_100013422 | 245 |
| 7 | 3300005338 | Ga0068868_100141609 | Ga0068868_1001416092 | 245 |
| 8 | 3300005343 | Ga0070687_100026010 | Ga0070687_1000260102 | 245 |
| 9 | 3300005347 | Ga0070668_100063241 | Ga0070668_1000632412 | 245 |
| 10 | 3300005353 | Ga0070669_100008965 | Ga0070669_1000089653 | 245 |
| 11 | 3300005354 | Ga0070675_100219449 | Ga0070675_1002194492 | 245 |
| 12 | 3300005356 | Ga0070674_100014454 | Ga0070674_1000144544 | 245 |
| 13 | 3300005367 | Ga0070667_100017549 | Ga0070667_1000175492 | 245 |
| 14 | 3300005438 | Ga0070701_10067747 | Ga0070701_100677472 | 245 |
| 15 | 3300005441 | Ga0070700_100322159 | Ga0070700_1003221591 | 245 |
| 16 | 3300005456 | Ga0070678_100038573 | Ga0070678_1000385734 | 245 |
| 17 | 3300005457 | Ga0070662_100025220 | Ga0070662_1000252203 | 245 |
| 18 | 3300005459 | Ga0068867_100002855 | Ga0068867_10000285513 | 245 |
| 19 | 3300005543 | Ga0070672_100016710 | Ga0070672_1000167106 | 245 |
| 20 | 3300005616 | Ga0068852_100063558 | Ga0068852_1000635582 | 245 |
| 21 | 3300005617 | Ga0068859_100166879 | Ga0068859_1001668792 | 245 |
| 22 | 3300005618 | Ga0068864_100120199 | Ga0068864_1001201992 | 245 |
| 23 | 3300005718 | Ga0068866_10016531 | Ga0068866_100165312 | 245 |
| 24 | 3300005719 | Ga0068861_100013043 | Ga0068861_1000130432 | 245 |
| 25 | 3300005841 | Ga0068863_100036313 | Ga0068863_1000363134 | 245 |
| 26 | 3300005842 | Ga0068858_100024788 | Ga0068858_1000247886 | 245 |
| 27 | 3300005843 | Ga0068860_100001127 | Ga0068860_1000011274 | 245 |
| 28 | 3300006931 | Ga0097620_100166881 | Ga0097620_1001668812 | 245 |
| 29 | 3300009148 | Ga0105243_10161102 | Ga0105243_101611022 | 245 |
| 30 | 3300009553 | Ga0105249_10021079 | Ga0105249_100210792 | 245 |
| 31 | 3300013297 | Ga0157378_10179808 | Ga0157378_101798082 | 245 |
| 32 | 3300013306 | Ga0163162_10039622 | Ga0163162_100396224 | 245 |
| 33 | 3300013308 | Ga0157375_10025372 | Ga0157375_100253726 | 245 |
| 34 | 3300014326 | Ga0157380_10001789 | Ga0157380_1000178914 | 245 |
| 35 | 3300014968 | Ga0157379_10020433 | Ga0157379_100204336 | 245 |
| 36 | 3300017792 | Ga0163161_10033652 | Ga0163161_100336523 | 245 |
| 37 | 3300025315 | Ga0207697_10093659 | Ga0207697_100936592 | 245 |
| 38 | 3300025893 | Ga0207682_10012804 | Ga0207682_100128042 | 245 |
| 39 | 3300025903 | Ga0207680_10026030 | Ga0207680_100260302 | 245 |
| 40 | 3300025907 | Ga0207645_10000932 | Ga0207645_1000093222 | 245 |
| 41 | 3300025923 | Ga0207681_10005730 | Ga0207681_100057303 | 245 |
| 42 | 3300025926 | Ga0207659_10036528 | Ga0207659_100365282 | 245 |
| 43 | 3300025933 | Ga0207706_10099056 | Ga0207706_100990562 | 245 |
| 44 | 3300025937 | Ga0207669_10013145 | Ga0207669_100131453 | 245 |
| 45 | 3300025940 | Ga0207691_10036077 | Ga0207691_100360776 | 245 |
| 46 | 3300025942 | Ga0207689_10013142 | Ga0207689_100131422 | 245 |
| 47 | 3300025961 | Ga0207712_10194330 | Ga0207712_101943302 | 245 |
| 48 | 3300025972 | Ga0207668_10012507 | Ga0207668_100125075 | 245 |
| 49 | 3300025986 | Ga0207658_10005021 | Ga0207658_100050218 | 245 |
| 50 | 3300026023 | Ga0207677_10013173 | Ga0207677_100131732 | 245 |
| 51 | 3300026035 | Ga0207703_10010862 | Ga0207703_100108625 | 245 |
| 52 | 3300026075 | Ga0207708_10022289 | Ga0207708_100222895 | 245 |
| 53 | 3300026088 | Ga0207641_10005423 | Ga0207641_100054235 | 245 |
| 54 | 3300026089 | Ga0207648_10080809 | Ga0207648_100808092 | 245 |
| 55 | 3300026095 | Ga0207676_10227678 | Ga0207676_102276782 | 245 |
| 56 | 3300026118 | Ga0207675_100011212 | Ga0207675_1000112125 | 245 |
| 57 | 3300026121 | Ga0207683_10038389 | Ga0207683_100383895 | 245 |
| 58 | 3300026142 | Ga0207698_10073649 | Ga0207698_100736492 | 245 |
| 59 | 3300028381 | Ga0268264_10001710 | Ga0268264_100017102 | 245 |
| 60 | 3300050511 | nmdc:mga08y16_380860_c1 | nmdc:mga08y16_380860_c1_359_1240 | 245 |
| 61 | 3300005548 | Ga0070665_100016102 | Ga0070665_1000161024 | 253 |
| 62 | 3300042876 | Ga0451577_0106204 | Ga0451577_0106204_449_1285 | 254 |
| 63 | 3300002737 | JGI25162J39368_1000414 | JGI25162J39368_100041428 | 255 |
| 64 | 3300003214 | JGI25165J46597_1000135 | JGI25165J46597_10001352 | 255 |
| 65 | 3300003751 | Ga0055538_1000055 | Ga0055538_10000552 | 255 |
| 66 | 3300003752 | Ga0055539_1000080 | Ga0055539_1000080102 | 255 |
| 67 | 3300003756 | Ga0055533_1000086 | Ga0055533_1000086102 | 255 |
| 68 | 3300003759 | Ga0055525_1000114 | Ga0055525_10001142 | 255 |
| 69 | 3300003841 | Ga0055541_1000057 | Ga0055541_1000057102 | 255 |
| 70 | 3300025224 | Ga0209784_100010 | Ga0209784_100010169 | 255 |
| 71 | 3300025225 | Ga0209566_100008 | Ga0209566_100008169 | 255 |
| 72 | 3300025226 | Ga0209674_100019 | Ga0209674_100019169 | 255 |
| 73 | 3300025230 | Ga0209563_100021 | Ga0209563_100021169 | 255 |
| 74 | 3300025231 | Ga0207427_100570 | Ga0207427_10057016 | 255 |
| 75 | 3300025233 | Ga0209437_100019 | Ga0209437_100019169 | 255 |
| 76 | 3300025253 | Ga0209677_100011 | Ga0209677_100011169 | 255 |
| 77 | 3300025261 | Ga0209233_1000025 | Ga0209233_1000025169 | 255 |
| 78 | 3300034816 | Ga0373930_0056600 | Ga0373930_0056600_13_834 | 255 |
| 79 | 3300005333 | Ga0070677_10009993 | Ga0070677_100099933 | 257 |
| 80 | 3300005344 | Ga0070661_100067019 | Ga0070661_1000670193 | 257 |
| 81 | 3300005457 | Ga0070662_100047086 | Ga0070662_1000470864 | 257 |
| 82 | 3300005547 | Ga0070693_100077521 | Ga0070693_1000775212 | 257 |
| 83 | 3300005564 | Ga0070664_100289543 | Ga0070664_1002895432 | 257 |
| 84 | 3300005578 | Ga0068854_100018851 | Ga0068854_1000188514 | 257 |
| 85 | 3300005616 | Ga0068852_100255769 | Ga0068852_1002557692 | 257 |
| 86 | 3300025933 | Ga0207706_10020343 | Ga0207706_100203435 | 257 |
| 87 | 3300025945 | Ga0207679_10335360 | Ga0207679_103353602 | 257 |
| 88 | 3300025981 | Ga0207640_10013763 | Ga0207640_100137633 | 257 |
| 89 | 3300050493 | nmdc:mga0k408_231687_c1 | nmdc:mga0k408_231687_c1_274_1071 | 257 |
| 90 | 3300031730 | Ga0307516_10000460 | Ga0307516_100004602 | 258 |
| 91 | 3300046475 | Ga0495639_0004493 | Ga0495639_0004493_4220_5026 | 258 |
| 92 | 3300026035 | Ga0207703_10352718 | Ga0207703_103527182 | 259 |
| 93 | 3300053086 | Ga0500578_0044897 | Ga0500578_0044897_257_1036 | 259 |
| 94 | 3300053739 | Ga0500587_007104 | Ga0500587_007104_373_1152 | 259 |
| 95 | 3300037466 | Ga0395898_0396716 | Ga0395898_0396716_436_1233 | 261 |
| 96 | 3300030744 | Ga0316181_1181538 | Ga0316181_11815381 | 262 |
| 97 | 3300031548 | Ga0307408_100140129 | Ga0307408_1001401291 | 262 |
| 98 | 3300031731 | Ga0307405_10290392 | Ga0307405_102903922 | 262 |
| 99 | 3300031911 | Ga0307412_10123600 | Ga0307412_101236002 | 262 |
| 100 | iso_pu_bacteria | 2842854478 | 2842857764 | 262 |
| 101 | iso_pu_bacteria | 2917832318 | 2917836477 | 262 |
| 102 | iso_pu_bacteria | 2919125081 | 2919126497 | 262 |
| 103 | iso_pu_bacteria | 2984504281 | 2984506853 | 262 |
| 104 | iso_pu_bacteria | 8016728285 | 8016731100 | 262 |
| 105 | iso_pu_bacteria | 8056143049 | 8056145425 | 262 |
| 106 | 3300003316 | rootH1_10020400 | rootH1_100204007 | 263 |
| 107 | 3300003761 | Ga0055535_1000891 | Ga0055535_10008912 | 263 |
| 108 | 3300003763 | Ga0055529_1000622 | Ga0055529_100062224 | 263 |
| 109 | 3300005328 | Ga0070676_10066798 | Ga0070676_100667982 | 263 |
| 110 | 3300005330 | Ga0070690_100001452 | Ga0070690_1000014528 | 263 |
| 111 | 3300005334 | Ga0068869_100007843 | Ga0068869_1000078433 | 263 |
| 112 | 3300005334 | Ga0068869_100109806 | Ga0068869_1001098062 | 263 |
| 113 | 3300005356 | Ga0070674_100123469 | Ga0070674_1001234692 | 263 |
| 114 | 3300005456 | Ga0070678_100129140 | Ga0070678_1001291402 | 263 |
| 115 | 3300005459 | Ga0068867_100001383 | Ga0068867_10000138311 | 263 |
| 116 | 3300005543 | Ga0070672_100180274 | Ga0070672_1001802742 | 263 |
| 117 | 3300005719 | Ga0068861_100021750 | Ga0068861_1000217504 | 263 |
| 118 | 3300005843 | Ga0068860_100003662 | Ga0068860_1000036626 | 263 |
| 119 | 3300005844 | Ga0068862_100008423 | Ga0068862_1000084237 | 263 |
| 120 | 3300006881 | Ga0068865_100049806 | Ga0068865_1000498062 | 263 |
| 121 | 3300009147 | Ga0114129_10052547 | Ga0114129_100525472 | 263 |
| 122 | 3300009553 | Ga0105249_10020909 | Ga0105249_100209094 | 263 |
| 123 | 3300011119 | Ga0105246_10071672 | Ga0105246_100716722 | 263 |
| 124 | 3300013297 | Ga0157378_10009787 | Ga0157378_100097873 | 263 |
| 125 | 3300013297 | Ga0157378_10092187 | Ga0157378_100921872 | 263 |
| 126 | 3300013306 | Ga0163162_10005175 | Ga0163162_1000517510 | 263 |
| 127 | 3300013308 | Ga0157375_10009940 | Ga0157375_100099407 | 263 |
| 128 | 3300014968 | Ga0157379_10025235 | Ga0157379_100252352 | 263 |
| 129 | 3300025242 | Ga0209258_100342 | Ga0209258_1003423 | 263 |
| 130 | 3300025254 | Ga0209148_1004217 | Ga0209148_10042172 | 263 |
| 131 | 3300025256 | Ga0209759_1014038 | Ga0209759_10140382 | 263 |
| 132 | 3300025272 | Ga0209455_1000511 | Ga0209455_10005113 | 263 |
| 133 | 3300025923 | Ga0207681_10070963 | Ga0207681_100709632 | 263 |
| 134 | 3300025937 | Ga0207669_10133926 | Ga0207669_101339262 | 263 |
| 135 | 3300025940 | Ga0207691_10047603 | Ga0207691_100476032 | 263 |
| 136 | 3300025942 | Ga0207689_10058064 | Ga0207689_100580643 | 263 |
| 137 | 3300026089 | Ga0207648_10002026 | Ga0207648_100020267 | 263 |
| 138 | 3300026118 | Ga0207675_100008838 | Ga0207675_1000088384 | 263 |
| 139 | 3300026121 | Ga0207683_10111670 | Ga0207683_101116702 | 263 |
| 140 | 3300028380 | Ga0268265_10045405 | Ga0268265_100454053 | 263 |
| 141 | 3300028381 | Ga0268264_10018493 | Ga0268264_100184932 | 263 |
| 142 | 3300032005 | Ga0307411_10395953 | Ga0307411_103959531 | 263 |
| 143 | 3300035170 | Ga0373943_0041563 | Ga0373943_0041563_1075_1872 | 263 |
| 144 | 3300037068 | Ga0373925_0061260 | Ga0373925_0061260_1447_2244 | 263 |
| 145 | 3300041404 | Ga0439436_0062788 | Ga0439436_0062788_43_867 | 263 |
| 146 | 3300042145 | Ga0450906_002330 | Ga0450906_002330_3309_4133 | 263 |
| 147 | 3300042185 | Ga0450909_009266 | Ga0450909_009266_323_1147 | 263 |
| 148 | 3300046681 | Ga0495647_0034445 | Ga0495647_0034445_535_1332 | 263 |
| 149 | 3300005327 | Ga0070658_10061636 | Ga0070658_100616363 | 264 |
| 150 | 3300005328 | Ga0070676_10035514 | Ga0070676_100355142 | 264 |
| 151 | 3300005331 | Ga0070670_100003877 | Ga0070670_10000387710 | 264 |
| 152 | 3300005333 | Ga0070677_10001476 | Ga0070677_100014766 | 264 |
| 153 | 3300005338 | Ga0068868_100143353 | Ga0068868_1001433532 | 264 |
| 154 | 3300005353 | Ga0070669_100254237 | Ga0070669_1002542371 | 264 |
| 155 | 3300005354 | Ga0070675_100006716 | Ga0070675_1000067163 | 264 |
| 156 | 3300005355 | Ga0070671_100006545 | Ga0070671_1000065455 | 264 |
| 157 | 3300005356 | Ga0070674_100012835 | Ga0070674_1000128354 | 264 |
| 158 | 3300005356 | Ga0070674_100031292 | Ga0070674_1000312923 | 264 |
| 159 | 3300005456 | Ga0070678_100050929 | Ga0070678_1000509294 | 264 |
| 160 | 3300005456 | Ga0070678_100350956 | Ga0070678_1003509562 | 264 |
| 161 | 3300005459 | Ga0068867_100004608 | Ga0068867_1000046083 | 264 |
| 162 | 3300005459 | Ga0068867_100024081 | Ga0068867_1000240812 | 264 |
| 163 | 3300005459 | Ga0068867_100190352 | Ga0068867_1001903521 | 264 |
| 164 | 3300005543 | Ga0070672_100026178 | Ga0070672_1000261784 | 264 |
| 165 | 3300005548 | Ga0070665_100200321 | Ga0070665_1002003212 | 264 |
| 166 | 3300005563 | Ga0068855_100044323 | Ga0068855_1000443232 | 264 |
| 167 | 3300005564 | Ga0070664_100120375 | Ga0070664_1001203753 | 264 |
| 168 | 3300005614 | Ga0068856_100047733 | Ga0068856_1000477333 | 264 |
| 169 | 3300005614 | Ga0068856_100166397 | Ga0068856_1001663973 | 264 |
| 170 | 3300005718 | Ga0068866_10197080 | Ga0068866_101970802 | 264 |
| 171 | 3300005834 | Ga0068851_10027772 | Ga0068851_100277723 | 264 |
| 172 | 3300005840 | Ga0068870_10041145 | Ga0068870_100411453 | 264 |
| 173 | 3300005843 | Ga0068860_100101804 | Ga0068860_1001018042 | 264 |
| 174 | 3300005844 | Ga0068862_100028683 | Ga0068862_1000286834 | 264 |
| 175 | 3300006195 | Ga0075366_10035988 | Ga0075366_100359882 | 264 |
| 176 | 3300006237 | Ga0097621_100092078 | Ga0097621_1000920781 | 264 |
| 177 | 3300006358 | Ga0068871_100021423 | Ga0068871_1000214232 | 264 |
| 178 | 3300009148 | Ga0105243_10035260 | Ga0105243_100352604 | 264 |
| 179 | 3300009148 | Ga0105243_10321976 | Ga0105243_103219761 | 264 |
| 180 | 3300009551 | Ga0105238_10084345 | Ga0105238_100843451 | 264 |
| 181 | 3300013297 | Ga0157378_10397212 | Ga0157378_103972122 | 264 |
| 182 | 3300013308 | Ga0157375_10020576 | Ga0157375_100205765 | 264 |
| 183 | 3300013308 | Ga0157375_10028162 | Ga0157375_100281626 | 264 |
| 184 | 3300014968 | Ga0157379_10130102 | Ga0157379_101301022 | 264 |
| 185 | 3300017792 | Ga0163161_10343620 | Ga0163161_103436202 | 264 |
| 186 | 3300025253 | Ga0209677_104403 | Ga0209677_1044033 | 264 |
| 187 | 3300025256 | Ga0209759_1004950 | Ga0209759_10049503 | 264 |
| 188 | 3300025256 | Ga0209759_1005146 | Ga0209759_10051463 | 264 |
| 189 | 3300025315 | Ga0207697_10007005 | Ga0207697_100070055 | 264 |
| 190 | 3300025893 | Ga0207682_10000706 | Ga0207682_1000070610 | 264 |
| 191 | 3300025899 | Ga0207642_10098719 | Ga0207642_100987192 | 264 |
| 192 | 3300025907 | Ga0207645_10032773 | Ga0207645_100327734 | 264 |
| 193 | 3300025919 | Ga0207657_10009129 | Ga0207657_100091296 | 264 |
| 194 | 3300025925 | Ga0207650_10054584 | Ga0207650_100545843 | 264 |
| 195 | 3300025926 | Ga0207659_10028703 | Ga0207659_100287035 | 264 |
| 196 | 3300025926 | Ga0207659_10142958 | Ga0207659_101429582 | 264 |
| 197 | 3300025931 | Ga0207644_10007260 | Ga0207644_100072601 | 264 |
| 198 | 3300025932 | Ga0207690_10018234 | Ga0207690_100182343 | 264 |
| 199 | 3300025932 | Ga0207690_10170216 | Ga0207690_101702162 | 264 |
| 200 | 3300025935 | Ga0207709_10119377 | Ga0207709_101193772 | 264 |
| 201 | 3300025938 | Ga0207704_10195320 | Ga0207704_101953202 | 264 |
| 202 | 3300025940 | Ga0207691_10000318 | Ga0207691_1000031819 | 264 |
| 203 | 3300025945 | Ga0207679_10072585 | Ga0207679_100725852 | 264 |
| 204 | 3300025945 | Ga0207679_10444667 | Ga0207679_104446672 | 264 |
| 205 | 3300025949 | Ga0207667_10046590 | Ga0207667_100465903 | 264 |
| 206 | 3300025949 | Ga0207667_10497322 | Ga0207667_104973222 | 264 |
| 207 | 3300025960 | Ga0207651_10006026 | Ga0207651_100060261 | 264 |
| 208 | 3300025986 | Ga0207658_10288563 | Ga0207658_102885631 | 264 |
| 209 | 3300026023 | Ga0207677_10593200 | Ga0207677_105932001 | 264 |
| 210 | 3300026067 | Ga0207678_10303781 | Ga0207678_103037812 | 264 |
| 211 | 3300026078 | Ga0207702_10198726 | Ga0207702_101987262 | 264 |
| 212 | 3300026088 | Ga0207641_10031474 | Ga0207641_100314745 | 264 |
| 213 | 3300026089 | Ga0207648_10020730 | Ga0207648_100207304 | 264 |
| 214 | 3300026089 | Ga0207648_10041853 | Ga0207648_100418535 | 264 |
| 215 | 3300026089 | Ga0207648_10043392 | Ga0207648_100433924 | 264 |
| 216 | 3300026118 | Ga0207675_100404798 | Ga0207675_1004047982 | 264 |
| 217 | 3300026121 | Ga0207683_10010653 | Ga0207683_100106538 | 264 |
| 218 | 3300026121 | Ga0207683_10016734 | Ga0207683_100167344 | 264 |
| 219 | 3300028379 | Ga0268266_10092747 | Ga0268266_100927473 | 264 |
| 220 | 3300028380 | Ga0268265_10054590 | Ga0268265_100545902 | 264 |
| 221 | 3300028381 | Ga0268264_10726154 | Ga0268264_107261541 | 264 |
| 222 | 3300031730 | Ga0307516_10020589 | Ga0307516_100205893 | 264 |
| 223 | 3300031824 | Ga0307413_10040120 | Ga0307413_100401203 | 264 |
| 224 | 3300031901 | Ga0307406_10006272 | Ga0307406_100062722 | 264 |
| 225 | 3300032002 | Ga0307416_100020199 | Ga0307416_1000201993 | 264 |
| 226 | 3300035691 | Ga0373931_0011931 | Ga0373931_0011931_657_1475 | 264 |
| 227 | 3300044683 | Ga0466965_0005472 | Ga0466965_0005472_1172_1990 | 264 |
| 228 | 3300044684 | Ga0466966_0002799 | Ga0466966_0002799_6123_6941 | 264 |
| 229 | 3300044693 | Ga0466961_0054732 | Ga0466961_0054732_260_1078 | 264 |
| 230 | 3300044694 | Ga0466963_0049304 | Ga0466963_0049304_1912_2730 | 264 |
| 231 | 3300044706 | Ga0466964_0007355 | Ga0466964_0007355_1083_1901 | 264 |
| 232 | 3300044719 | Ga0466971_0011994 | Ga0466971_0011994_354_1172 | 264 |
| 233 | 3300044735 | Ga0466968_0009338 | Ga0466968_0009338_2423_3241 | 264 |
| 234 | 3300044842 | Ga0466957_0023494 | Ga0466957_0023494_956_1774 | 264 |
| 235 | 3300045049 | Ga0466959_0004285 | Ga0466959_0004285_7819_8637 | 264 |
| 236 | 3300045836 | Ga0466958_0006879 | Ga0466958_0006879_859_1677 | 264 |
| 237 | 3300045976 | Ga0466967_0047961 | Ga0466967_0047961_2682_3500 | 264 |
| 238 | 3300005327 | Ga0070658_10141954 | Ga0070658_101419543 | 265 |
| 239 | 3300005333 | Ga0070677_10004019 | Ga0070677_100040194 | 265 |
| 240 | 3300005337 | Ga0070682_100050395 | Ga0070682_1000503952 | 265 |
| 241 | 3300005355 | Ga0070671_100005287 | Ga0070671_1000052876 | 265 |
| 242 | 3300005364 | Ga0070673_100031264 | Ga0070673_1000312643 | 265 |
| 243 | 3300005466 | Ga0070685_10286535 | Ga0070685_102865351 | 265 |
| 244 | 3300005535 | Ga0070684_100527755 | Ga0070684_1005277551 | 265 |
| 245 | 3300005539 | Ga0068853_100347362 | Ga0068853_1003473622 | 265 |
| 246 | 3300005543 | Ga0070672_100068603 | Ga0070672_1000686032 | 265 |
| 247 | 3300005543 | Ga0070672_100158352 | Ga0070672_1001583523 | 265 |
| 248 | 3300005564 | Ga0070664_100078785 | Ga0070664_1000787853 | 265 |
| 249 | 3300005614 | Ga0068856_100055782 | Ga0068856_1000557824 | 265 |
| 250 | 3300005618 | Ga0068864_100228811 | Ga0068864_1002288112 | 265 |
| 251 | 3300005841 | Ga0068863_100008961 | Ga0068863_1000089615 | 265 |
| 252 | 3300005842 | Ga0068858_100062309 | Ga0068858_1000623094 | 265 |
| 253 | 3300005843 | Ga0068860_100313647 | Ga0068860_1003136472 | 265 |
| 254 | 3300006237 | Ga0097621_100010187 | Ga0097621_1000101878 | 265 |
| 255 | 3300006237 | Ga0097621_100012909 | Ga0097621_1000129095 | 265 |
| 256 | 3300006358 | Ga0068871_100022718 | Ga0068871_1000227185 | 265 |
| 257 | 3300009098 | Ga0105245_10018033 | Ga0105245_100180334 | 265 |
| 258 | 3300009177 | Ga0105248_10024871 | Ga0105248_100248715 | 265 |
| 259 | 3300009551 | Ga0105238_10114737 | Ga0105238_101147372 | 265 |
| 260 | 3300013308 | Ga0157375_10045990 | Ga0157375_100459902 | 265 |
| 261 | 3300014745 | Ga0157377_10072267 | Ga0157377_100722672 | 265 |
| 262 | 3300014969 | Ga0157376_10051769 | Ga0157376_100517694 | 265 |
| 263 | 3300017792 | Ga0163161_10113786 | Ga0163161_101137862 | 265 |
| 264 | 3300025315 | Ga0207697_10098244 | Ga0207697_100982441 | 265 |
| 265 | 3300025893 | Ga0207682_10009359 | Ga0207682_100093593 | 265 |
| 266 | 3300025920 | Ga0207649_10287549 | Ga0207649_102875491 | 265 |
| 267 | 3300025925 | Ga0207650_10173189 | Ga0207650_101731891 | 265 |
| 268 | 3300025926 | Ga0207659_10044324 | Ga0207659_100443244 | 265 |
| 269 | 3300025927 | Ga0207687_10102244 | Ga0207687_101022442 | 265 |
| 270 | 3300025931 | Ga0207644_10000042 | Ga0207644_1000004258 | 265 |
| 271 | 3300025940 | Ga0207691_10074299 | Ga0207691_100742992 | 265 |
| 272 | 3300025940 | Ga0207691_10084554 | Ga0207691_100845543 | 265 |
| 273 | 3300025941 | Ga0207711_10004017 | Ga0207711_100040175 | 265 |
| 274 | 3300025941 | Ga0207711_10014423 | Ga0207711_100144233 | 265 |
| 275 | 3300025945 | Ga0207679_10046009 | Ga0207679_100460093 | 265 |
| 276 | 3300025960 | Ga0207651_10054979 | Ga0207651_100549793 | 265 |
| 277 | 3300026078 | Ga0207702_10116578 | Ga0207702_101165782 | 265 |
| 278 | 3300026088 | Ga0207641_10007604 | Ga0207641_100076044 | 265 |
| 279 | 3300026088 | Ga0207641_10162836 | Ga0207641_101628362 | 265 |
| 280 | 3300026142 | Ga0207698_10074629 | Ga0207698_100746292 | 265 |
| 281 | 3300028381 | Ga0268264_10305606 | Ga0268264_103056062 | 265 |
| 282 | 3300028794 | Ga0307515_10397660 | Ga0307515_103976601 | 265 |
| 283 | 3300035691 | Ga0373931_0000491 | Ga0373931_0000491_10289_11116 | 265 |
| 284 | 3300048903 | Ga0496100_0056009 | Ga0496100_0056009_1090_1917 | 265 |
| 285 | 3300048905 | Ga0496102_0013220 | Ga0496102_0013220_4731_5558 | 265 |
| 286 | 3300048906 | Ga0496103_0095754 | Ga0496103_0095754_181_1008 | 265 |
| 287 | 3300048909 | Ga0496106_0002439 | Ga0496106_0002439_3071_3898 | 265 |
| 288 | 3300048917 | Ga0496114_0086473 | Ga0496114_0086473_69_938 | 265 |
| 289 | 3300050515 | nmdc:mga0a205_389312_c1 | nmdc:mga0a205_389312_c1_213_1040 | 265 |
| 290 | iso_pu_bacteria | 2511231002 | 2511244827 | 265 |
| 291 | iso_pu_bacteria | 2919704043 | 2919706540 | 265 |
| 292 | 3300005335 | Ga0070666_10104785 | Ga0070666_101047852 | 266 |
| 293 | 3300005344 | Ga0070661_100020513 | Ga0070661_1000205135 | 266 |
| 294 | 3300005366 | Ga0070659_100021789 | Ga0070659_1000217892 | 266 |
| 295 | 3300005535 | Ga0070684_100004660 | Ga0070684_1000046608 | 266 |
| 296 | 3300005543 | Ga0070672_100051192 | Ga0070672_1000511923 | 266 |
| 297 | 3300005564 | Ga0070664_100050396 | Ga0070664_1000503962 | 266 |
| 298 | 3300005577 | Ga0068857_100237252 | Ga0068857_1002372521 | 266 |
| 299 | 3300005577 | Ga0068857_100438830 | Ga0068857_1004388302 | 266 |
| 300 | 3300005578 | Ga0068854_100019957 | Ga0068854_1000199574 | 266 |
| 301 | 3300005614 | Ga0068856_100008227 | Ga0068856_1000082275 | 266 |
| 302 | 3300005616 | Ga0068852_100052239 | Ga0068852_1000522392 | 266 |
| 303 | 3300005834 | Ga0068851_10023882 | Ga0068851_100238822 | 266 |
| 304 | 3300005842 | Ga0068858_100035096 | Ga0068858_1000350964 | 266 |
| 305 | 3300005843 | Ga0068860_100089173 | Ga0068860_1000891732 | 266 |
| 306 | 3300009093 | Ga0105240_10105835 | Ga0105240_101058352 | 266 |
| 307 | 3300009174 | Ga0105241_10152463 | Ga0105241_101524632 | 266 |
| 308 | 3300009177 | Ga0105248_10243677 | Ga0105248_102436772 | 266 |
| 309 | 3300009551 | Ga0105238_10020203 | Ga0105238_100202035 | 266 |
| 310 | 3300013102 | Ga0157371_10047043 | Ga0157371_100470432 | 266 |
| 311 | 3300013104 | Ga0157370_10290950 | Ga0157370_102909502 | 266 |
| 312 | 3300013105 | Ga0157369_10030192 | Ga0157369_100301928 | 266 |
| 313 | 3300013307 | Ga0157372_10020531 | Ga0157372_100205314 | 266 |
| 314 | 3300013308 | Ga0157375_10036459 | Ga0157375_100364592 | 266 |
| 315 | 3300014326 | Ga0157380_10076095 | Ga0157380_100760954 | 266 |
| 316 | 3300014968 | Ga0157379_10135880 | Ga0157379_101358802 | 266 |
| 317 | 3300015265 | Ga0182005_1000541 | Ga0182005_100054114 | 266 |
| 318 | 3300021384 | Ga0213876_10052025 | Ga0213876_100520253 | 266 |
| 319 | 3300025903 | Ga0207680_10080108 | Ga0207680_100801082 | 266 |
| 320 | 3300025909 | Ga0207705_10191138 | Ga0207705_101911381 | 266 |
| 321 | 3300025911 | Ga0207654_10184247 | Ga0207654_101842472 | 266 |
| 322 | 3300025913 | Ga0207695_10318048 | Ga0207695_103180482 | 266 |
| 323 | 3300025919 | Ga0207657_10045289 | Ga0207657_100452894 | 266 |
| 324 | 3300025924 | Ga0207694_10072469 | Ga0207694_100724694 | 266 |
| 325 | 3300025933 | Ga0207706_10201758 | Ga0207706_102017582 | 266 |
| 326 | 3300025940 | Ga0207691_10027795 | Ga0207691_100277954 | 266 |
| 327 | 3300025944 | Ga0207661_10037817 | Ga0207661_100378171 | 266 |
| 328 | 3300026035 | Ga0207703_10081473 | Ga0207703_100814732 | 266 |
| 329 | 3300026041 | Ga0207639_10046131 | Ga0207639_100461312 | 266 |
| 330 | 3300026041 | Ga0207639_10151636 | Ga0207639_101516362 | 266 |
| 331 | 3300026078 | Ga0207702_10002308 | Ga0207702_1000230819 | 266 |
| 332 | 3300026088 | Ga0207641_10012523 | Ga0207641_100125235 | 266 |
| 333 | 3300026116 | Ga0207674_10049675 | Ga0207674_100496755 | 266 |
| 334 | 3300026116 | Ga0207674_10063382 | Ga0207674_100633821 | 266 |
| 335 | 3300026142 | Ga0207698_10025392 | Ga0207698_100253925 | 266 |
| 336 | 3300030522 | Ga0307512_10170525 | Ga0307512_101705252 | 266 |
| 337 | 3300031730 | Ga0307516_10353488 | Ga0307516_103534882 | 266 |
| 338 | 3300033180 | Ga0307510_10167982 | Ga0307510_101679822 | 266 |
| 339 | 3300039437 | Ga0436365_1021472 | Ga0436365_1021472_1482_2315 | 266 |
| 340 | 3300039450 | Ga0436363_0446142 | Ga0436363_0446142_250_1074 | 266 |
| 341 | 3300046462 | Ga0495651_0217798 | Ga0495651_0217798_382_1221 | 266 |
| 342 | 3300046463 | Ga0495653_0052358 | Ga0495653_0052358_558_1397 | 266 |
| 343 | 3300046511 | Ga0495608_0009282 | Ga0495608_0009282_847_1686 | 266 |
| 344 | 3300046514 | Ga0495618_0131615 | Ga0495618_0131615_719_1558 | 266 |
| 345 | 3300046516 | Ga0495628_0033268 | Ga0495628_0033268_2763_3602 | 266 |
| 346 | 3300046557 | Ga0495622_0030748 | Ga0495622_0030748_529_1368 | 266 |
| 347 | 3300046663 | Ga0495635_0015601 | Ga0495635_0015601_1710_2549 | 266 |
| 348 | 3300046678 | Ga0495599_0007092 | Ga0495599_0007092_4477_5316 | 266 |
| 349 | 3300046679 | Ga0495623_0113673 | Ga0495623_0113673_454_1293 | 266 |
| 350 | 3300046680 | Ga0495646_0020960 | Ga0495646_0020960_1372_2211 | 266 |
| 351 | 3300046683 | Ga0495658_0061800 | Ga0495658_0061800_877_1716 | 266 |
| 352 | 3300046809 | Ga0495600_0006804 | Ga0495600_0006804_4539_5378 | 266 |
| 353 | 3300047317 | Ga0495604_0082818 | Ga0495604_0082818_1147_1986 | 266 |
| 354 | 3300048911 | Ga0496108_0029986 | Ga0496108_0029986_3579_4409 | 266 |
| 355 | 3300053077 | Ga0495601_0120521 | Ga0495601_0120521_315_1154 | 266 |
| 356 | 3300053141 | Ga0500574_000842 | Ga0500574_000842_1306_2145 | 266 |
| 357 | iso_pu_bacteria | 2818991436 | 2819541922 | 266 |
| 358 | 3300002773 | JGI25152J39213_1002063 | JGI25152J39213_10020631 | 267 |
| 359 | 3300002774 | JGI25150J39212_1007965 | JGI25150J39212_10079651 | 267 |
| 360 | 3300003215 | JGI25153J46596_10011901 | JGI25153J46596_100119013 | 267 |
| 361 | 3300003215 | JGI25153J46596_10016520 | JGI25153J46596_100165203 | 267 |
| 362 | 3300003316 | rootH1_10062309 | rootH1_100623092 | 267 |
| 363 | 3300003771 | Ga0055526_1008751 | Ga0055526_10087513 | 267 |
| 364 | 3300003775 | Ga0055524_1000033 | Ga0055524_100003324 | 267 |
| 365 | 3300003791 | Ga0055530_10002040 | Ga0055530_100020402 | 267 |
| 366 | 3300003792 | Ga0055540_1000007 | Ga0055540_100000740 | 267 |
| 367 | 3300003792 | Ga0055540_1007509 | Ga0055540_10075094 | 267 |
| 368 | 3300003794 | Ga0055531_10001249 | Ga0055531_100012495 | 267 |
| 369 | 3300003794 | Ga0055531_10004316 | Ga0055531_100043165 | 267 |
| 370 | 3300005262 | Ga0065165_1003473 | Ga0065165_10034739 | 267 |
| 371 | 3300005262 | Ga0065165_1036109 | Ga0065165_10361092 | 267 |
| 372 | 3300005328 | Ga0070676_10021803 | Ga0070676_100218033 | 267 |
| 373 | 3300005331 | Ga0070670_100161566 | Ga0070670_1001615662 | 267 |
| 374 | 3300005331 | Ga0070670_100219464 | Ga0070670_1002194642 | 267 |
| 375 | 3300005331 | Ga0070670_100365812 | Ga0070670_1003658121 | 267 |
| 376 | 3300005334 | Ga0068869_100382916 | Ga0068869_1003829161 | 267 |
| 377 | 3300005338 | Ga0068868_100059254 | Ga0068868_1000592542 | 267 |
| 378 | 3300005344 | Ga0070661_100000421 | Ga0070661_10000042114 | 267 |
| 379 | 3300005344 | Ga0070661_100150333 | Ga0070661_1001503332 | 267 |
| 380 | 3300005344 | Ga0070661_100168852 | Ga0070661_1001688521 | 267 |
| 381 | 3300005355 | Ga0070671_100008975 | Ga0070671_10000897510 | 267 |
| 382 | 3300005364 | Ga0070673_100054845 | Ga0070673_1000548452 | 267 |
| 383 | 3300005366 | Ga0070659_100001131 | Ga0070659_1000011319 | 267 |
| 384 | 3300005367 | Ga0070667_100063167 | Ga0070667_1000631672 | 267 |
| 385 | 3300005367 | Ga0070667_100254418 | Ga0070667_1002544182 | 267 |
| 386 | 3300005456 | Ga0070678_100226481 | Ga0070678_1002264812 | 267 |
| 387 | 3300005457 | Ga0070662_100076490 | Ga0070662_1000764902 | 267 |
| 388 | 3300005459 | Ga0068867_100000048 | Ga0068867_10000004810 | 267 |
| 389 | 3300005459 | Ga0068867_100007763 | Ga0068867_1000077636 | 267 |
| 390 | 3300005459 | Ga0068867_100112679 | Ga0068867_1001126792 | 267 |
| 391 | 3300005467 | Ga0070706_100002704 | Ga0070706_1000027046 | 267 |
| 392 | 3300005539 | Ga0068853_100037028 | Ga0068853_1000370282 | 267 |
| 393 | 3300005539 | Ga0068853_100118152 | Ga0068853_1001181522 | 267 |
| 394 | 3300005543 | Ga0070672_100100057 | Ga0070672_1001000572 | 267 |
| 395 | 3300005543 | Ga0070672_100369935 | Ga0070672_1003699351 | 267 |
| 396 | 3300005547 | Ga0070693_100161165 | Ga0070693_1001611652 | 267 |
| 397 | 3300005564 | Ga0070664_100001426 | Ga0070664_1000014268 | 267 |
| 398 | 3300005564 | Ga0070664_100163631 | Ga0070664_1001636312 | 267 |
| 399 | 3300005577 | Ga0068857_100119625 | Ga0068857_1001196253 | 267 |
| 400 | 3300005578 | Ga0068854_100115693 | Ga0068854_1001156932 | 267 |
| 401 | 3300005616 | Ga0068852_100045508 | Ga0068852_1000455083 | 267 |
| 402 | 3300005616 | Ga0068852_100089038 | Ga0068852_1000890382 | 267 |
| 403 | 3300005616 | Ga0068852_100113517 | Ga0068852_1001135173 | 267 |
| 404 | 3300005834 | Ga0068851_10009512 | Ga0068851_100095123 | 267 |
| 405 | 3300005840 | Ga0068870_10016501 | Ga0068870_100165012 | 267 |
| 406 | 3300005841 | Ga0068863_100072562 | Ga0068863_1000725623 | 267 |
| 407 | 3300005841 | Ga0068863_100216288 | Ga0068863_1002162882 | 267 |
| 408 | 3300005842 | Ga0068858_100378133 | Ga0068858_1003781332 | 267 |
| 409 | 3300006038 | Ga0075365_10018586 | Ga0075365_100185862 | 267 |
| 410 | 3300006048 | Ga0075363_100196934 | Ga0075363_1001969342 | 267 |
| 411 | 3300006177 | Ga0075362_10106075 | Ga0075362_101060751 | 267 |
| 412 | 3300006178 | Ga0075367_10137791 | Ga0075367_101377912 | 267 |
| 413 | 3300006178 | Ga0075367_10274220 | Ga0075367_102742201 | 267 |
| 414 | 3300006195 | Ga0075366_10000654 | Ga0075366_100006545 | 267 |
| 415 | 3300006195 | Ga0075366_10001569 | Ga0075366_100015696 | 267 |
| 416 | 3300006195 | Ga0075366_10003793 | Ga0075366_100037933 | 267 |
| 417 | 3300006195 | Ga0075366_10004637 | Ga0075366_100046375 | 267 |
| 418 | 3300006195 | Ga0075366_10061848 | Ga0075366_100618483 | 267 |
| 419 | 3300006195 | Ga0075366_10168042 | Ga0075366_101680422 | 267 |
| 420 | 3300006353 | Ga0075370_10000414 | Ga0075370_100004145 | 267 |
| 421 | 3300006353 | Ga0075370_10009474 | Ga0075370_100094745 | 267 |
| 422 | 3300006353 | Ga0075370_10010350 | Ga0075370_100103505 | 267 |
| 423 | 3300006946 | Ga0079104_1000009 | Ga0079104_1000009240 | 267 |
| 424 | 3300009098 | Ga0105245_10077730 | Ga0105245_100777304 | 267 |
| 425 | 3300009098 | Ga0105245_10187891 | Ga0105245_101878912 | 267 |
| 426 | 3300009148 | Ga0105243_10002356 | Ga0105243_100023567 | 267 |
| 427 | 3300009148 | Ga0105243_10232486 | Ga0105243_102324862 | 267 |
| 428 | 3300009174 | Ga0105241_10333168 | Ga0105241_103331682 | 267 |
| 429 | 3300009545 | Ga0105237_10003295 | Ga0105237_100032955 | 267 |
| 430 | 3300009545 | Ga0105237_10007089 | Ga0105237_100070892 | 267 |
| 431 | 3300011119 | Ga0105246_10341246 | Ga0105246_103412461 | 267 |
| 432 | 3300013296 | Ga0157374_10027813 | Ga0157374_100278132 | 267 |
| 433 | 3300013296 | Ga0157374_10077836 | Ga0157374_100778363 | 267 |
| 434 | 3300014326 | Ga0157380_10409599 | Ga0157380_104095991 | 267 |
| 435 | 3300014745 | Ga0157377_10000056 | Ga0157377_1000005674 | 267 |
| 436 | 3300014968 | Ga0157379_10013243 | Ga0157379_100132436 | 267 |
| 437 | 3300025206 | Ga0209435_100034 | Ga0209435_10003489 | 267 |
| 438 | 3300025245 | Ga0207425_1001772 | Ga0207425_10017727 | 267 |
| 439 | 3300025258 | Ga0209129_1000062 | Ga0209129_1000062184 | 267 |
| 440 | 3300025263 | Ga0209565_1005822 | Ga0209565_10058222 | 267 |
| 441 | 3300025273 | Ga0209673_1010877 | Ga0209673_10108772 | 267 |
| 442 | 3300025273 | Ga0209673_1058334 | Ga0209673_10583341 | 267 |
| 443 | 3300025291 | Ga0209675_1009012 | Ga0209675_10090122 | 267 |
| 444 | 3300025295 | Ga0209564_1000176 | Ga0209564_1000176104 | 267 |
| 445 | 3300025297 | Ga0209758_1000378 | Ga0209758_100037817 | 267 |
| 446 | 3300025297 | Ga0209758_1000517 | Ga0209758_100051717 | 267 |
| 447 | 3300025298 | Ga0209050_1000118 | Ga0209050_10001189 | 267 |
| 448 | 3300025298 | Ga0209050_1000243 | Ga0209050_10002434 | 267 |
| 449 | 3300025298 | Ga0209050_1016204 | Ga0209050_10162042 | 267 |
| 450 | 3300025299 | Ga0209256_1000019 | Ga0209256_1000019301 | 267 |
| 451 | 3300025299 | Ga0209256_1021803 | Ga0209256_10218032 | 267 |
| 452 | 3300025303 | Ga0209051_1000004 | Ga0209051_100000493 | 267 |
| 453 | 3300025303 | Ga0209051_1000853 | Ga0209051_100085315 | 267 |
| 454 | 3300025303 | Ga0209051_1044684 | Ga0209051_10446842 | 267 |
| 455 | 3300025304 | Ga0209257_1000022 | Ga0209257_100002215 | 267 |
| 456 | 3300025304 | Ga0209257_1000038 | Ga0209257_1000038227 | 267 |
| 457 | 3300025304 | Ga0209257_1000044 | Ga0209257_1000044333 | 267 |
| 458 | 3300025304 | Ga0209257_1024509 | Ga0209257_10245092 | 267 |
| 459 | 3300025907 | Ga0207645_10016574 | Ga0207645_100165743 | 267 |
| 460 | 3300025908 | Ga0207643_10044753 | Ga0207643_100447532 | 267 |
| 461 | 3300025910 | Ga0207684_10006839 | Ga0207684_100068396 | 267 |
| 462 | 3300025913 | Ga0207695_10099229 | Ga0207695_100992292 | 267 |
| 463 | 3300025914 | Ga0207671_10005664 | Ga0207671_1000566410 | 267 |
| 464 | 3300025914 | Ga0207671_10050729 | Ga0207671_100507292 | 267 |
| 465 | 3300025920 | Ga0207649_10000751 | Ga0207649_1000075111 | 267 |
| 466 | 3300025923 | Ga0207681_10321395 | Ga0207681_103213951 | 267 |
| 467 | 3300025925 | Ga0207650_10073437 | Ga0207650_100734372 | 267 |
| 468 | 3300025925 | Ga0207650_10210795 | Ga0207650_102107952 | 267 |
| 469 | 3300025931 | Ga0207644_10006910 | Ga0207644_100069106 | 267 |
| 470 | 3300025931 | Ga0207644_10358606 | Ga0207644_103586062 | 267 |
| 471 | 3300025932 | Ga0207690_10000481 | Ga0207690_100004814 | 267 |
| 472 | 3300025933 | Ga0207706_10017151 | Ga0207706_100171514 | 267 |
| 473 | 3300025935 | Ga0207709_10002673 | Ga0207709_1000267310 | 267 |
| 474 | 3300025940 | Ga0207691_10017977 | Ga0207691_100179773 | 267 |
| 475 | 3300025940 | Ga0207691_10045199 | Ga0207691_100451994 | 267 |
| 476 | 3300025942 | Ga0207689_10060170 | Ga0207689_100601703 | 267 |
| 477 | 3300025945 | Ga0207679_10000501 | Ga0207679_100005019 | 267 |
| 478 | 3300025960 | Ga0207651_10046578 | Ga0207651_100465783 | 267 |
| 479 | 3300025986 | Ga0207658_10004551 | Ga0207658_100045515 | 267 |
| 480 | 3300025986 | Ga0207658_10072003 | Ga0207658_100720032 | 267 |
| 481 | 3300026023 | Ga0207677_10083998 | Ga0207677_100839982 | 267 |
| 482 | 3300026023 | Ga0207677_10084366 | Ga0207677_100843662 | 267 |
| 483 | 3300026067 | Ga0207678_10013097 | Ga0207678_100130976 | 267 |
| 484 | 3300026088 | Ga0207641_10170410 | Ga0207641_101704102 | 267 |
| 485 | 3300026089 | Ga0207648_10000492 | Ga0207648_1000049210 | 267 |
| 486 | 3300026089 | Ga0207648_10006568 | Ga0207648_100065682 | 267 |
| 487 | 3300026089 | Ga0207648_10177524 | Ga0207648_101775241 | 267 |
| 488 | 3300026095 | Ga0207676_10021790 | Ga0207676_100217901 | 267 |
| 489 | 3300026116 | Ga0207674_10106917 | Ga0207674_101069172 | 267 |
| 490 | 3300026116 | Ga0207674_10384556 | Ga0207674_103845561 | 267 |
| 491 | 3300026121 | Ga0207683_10050334 | Ga0207683_100503343 | 267 |
| 492 | 3300026121 | Ga0207683_10058883 | Ga0207683_100588832 | 267 |
| 493 | 3300026142 | Ga0207698_10073233 | Ga0207698_100732333 | 267 |
| 494 | 3300026142 | Ga0207698_10230582 | Ga0207698_102305822 | 267 |
| 495 | 3300027111 | Ga0209281_1000023 | Ga0209281_1000023147 | 267 |
| 496 | 3300027876 | Ga0209974_10013298 | Ga0209974_100132982 | 267 |
| 497 | 3300028381 | Ga0268264_10105160 | Ga0268264_101051602 | 267 |
| 498 | 3300028786 | Ga0307517_10000228 | Ga0307517_1000022844 | 267 |
| 499 | 3300028786 | Ga0307517_10053504 | Ga0307517_100535043 | 267 |
| 500 | 3300028786 | Ga0307517_10205333 | Ga0307517_102053332 | 267 |
| 501 | 3300028794 | Ga0307515_10004357 | Ga0307515_1000435718 | 267 |
| 502 | 3300028794 | Ga0307515_10020859 | Ga0307515_100208598 | 267 |
| 503 | 3300028794 | Ga0307515_10036443 | Ga0307515_100364435 | 267 |
| 504 | 3300030522 | Ga0307512_10059122 | Ga0307512_100591222 | 267 |
| 505 | 3300030522 | Ga0307512_10121533 | Ga0307512_101215332 | 267 |
| 506 | 3300031456 | Ga0307513_10006563 | Ga0307513_100065637 | 267 |
| 507 | 3300031456 | Ga0307513_10030687 | Ga0307513_100306877 | 267 |
| 508 | 3300031456 | Ga0307513_10032666 | Ga0307513_100326662 | 267 |
| 509 | 3300031507 | Ga0307509_10000426 | Ga0307509_1000042643 | 267 |
| 510 | 3300031548 | Ga0307408_100000288 | Ga0307408_10000028831 | 267 |
| 511 | 3300031548 | Ga0307408_100088275 | Ga0307408_1000882753 | 267 |
| 512 | 3300031616 | Ga0307508_10000040 | Ga0307508_10000040123 | 267 |
| 513 | 3300031616 | Ga0307508_10003969 | Ga0307508_100039695 | 267 |
| 514 | 3300031649 | Ga0307514_10011867 | Ga0307514_100118679 | 267 |
| 515 | 3300031649 | Ga0307514_10070063 | Ga0307514_100700632 | 267 |
| 516 | 3300031730 | Ga0307516_10001446 | Ga0307516_100014467 | 267 |
| 517 | 3300031730 | Ga0307516_10012998 | Ga0307516_100129986 | 267 |
| 518 | 3300031730 | Ga0307516_10161191 | Ga0307516_101611912 | 267 |
| 519 | 3300031730 | Ga0307516_10237526 | Ga0307516_102375261 | 267 |
| 520 | 3300031901 | Ga0307406_10001222 | Ga0307406_1000122212 | 267 |
| 521 | 3300031911 | Ga0307412_10034844 | Ga0307412_100348441 | 267 |
| 522 | 3300031995 | Ga0307409_100306137 | Ga0307409_1003061372 | 267 |
| 523 | 3300032002 | Ga0307416_100127951 | Ga0307416_1001279512 | 267 |
| 524 | 3300032005 | Ga0307411_10239000 | Ga0307411_102390001 | 267 |
| 525 | 3300033180 | Ga0307510_10000109 | Ga0307510_1000010910 | 267 |
| 526 | 3300033180 | Ga0307510_10251031 | Ga0307510_102510312 | 267 |
| 527 | 3300036401 | Ga0373937_0206953 | Ga0373937_0206953_637_1461 | 267 |
| 528 | 3300037068 | Ga0373925_0023538 | Ga0373925_0023538_1936_2760 | 267 |
| 529 | 3300037471 | Ga0395905_0122445 | Ga0395905_0122445_396_1250 | 267 |
| 530 | 3300038443 | Ga0395901_0320256 | Ga0395901_0320256_714_1532 | 267 |
| 531 | 3300041452 | Ga0451793_0083691 | Ga0451793_0083691_306_1124 | 267 |
| 532 | 3300041452 | Ga0451793_1251237 | Ga0451793_1251237_393_1229 | 267 |
| 533 | 3300041456 | Ga0451795_0141978 | Ga0451795_0141978_917_1744 | 267 |
| 534 | 3300041460 | Ga0451802_1322629 | Ga0451802_1322629_173_991 | 267 |
| 535 | 3300041463 | Ga0451804_0097481 | Ga0451804_0097481_469_1296 | 267 |
| 536 | 3300041501 | Ga0451845_0950226 | Ga0451845_0950226_338_1156 | 267 |
| 537 | 3300041512 | Ga0451853_2068177 | Ga0451853_2068177_569_1396 | 267 |
| 538 | 3300042439 | Ga0439464_0019340 | Ga0439464_0019340_230_1048 | 267 |
| 539 | 3300042531 | Ga0450918_000096 | Ga0450918_000096_17611_18465 | 267 |
| 540 | 3300042876 | Ga0451577_0125429 | Ga0451577_0125429_893_1714 | 267 |
| 541 | 3300042876 | Ga0451577_0137658 | Ga0451577_0137658_1056_1874 | 267 |
| 542 | 3300044712 | Ga0453684_0030595 | Ga0453684_0030595_6493_7371 | 267 |
| 543 | 3300045051 | Ga0451576_0015848 | Ga0451576_0015848_5243_6076 | 267 |
| 544 | 3300045051 | Ga0451576_0738451 | Ga0451576_0738451_49_867 | 267 |
| 545 | 3300045976 | Ga0466967_0564764 | Ga0466967_0564764_29_847 | 267 |
| 546 | 3300046460 | Ga0495638_0067412 | Ga0495638_0067412_519_1346 | 267 |
| 547 | 3300046507 | Ga0495606_0213550 | Ga0495606_0213550_122_949 | 267 |
| 548 | 3300046512 | Ga0495610_0025940 | Ga0495610_0025940_287_1120 | 267 |
| 549 | 3300046512 | Ga0495610_0032346 | Ga0495610_0032346_1162_1980 | 267 |
| 550 | 3300046515 | Ga0495620_0047397 | Ga0495620_0047397_363_1181 | 267 |
| 551 | 3300046515 | Ga0495620_0055463 | Ga0495620_0055463_625_1452 | 267 |
| 552 | 3300046519 | Ga0495632_0012595 | Ga0495632_0012595_889_1707 | 267 |
| 553 | 3300046519 | Ga0495632_0015796 | Ga0495632_0015796_1333_2160 | 267 |
| 554 | 3300046522 | Ga0495643_0024642 | Ga0495643_0024642_2083_2901 | 267 |
| 555 | 3300046535 | Ga0495586_0222037 | Ga0495586_0222037_99_971 | 267 |
| 556 | 3300046543 | Ga0495645_0058781 | Ga0495645_0058781_20_898 | 267 |
| 557 | 3300046616 | Ga0495668_0025704 | Ga0495668_0025704_1765_2598 | 267 |
| 558 | 3300046660 | Ga0495625_0008288 | Ga0495625_0008288_4816_5634 | 267 |
| 559 | 3300046660 | Ga0495625_0044809 | Ga0495625_0044809_10_843 | 267 |
| 560 | 3300046660 | Ga0495625_0058675 | Ga0495625_0058675_220_1047 | 267 |
| 561 | 3300046660 | Ga0495625_0060922 | Ga0495625_0060922_783_1592 | 267 |
| 562 | 3300046692 | Ga0495671_0048442 | Ga0495671_0048442_671_1489 | 267 |
| 563 | 3300046692 | Ga0495671_0061709 | Ga0495671_0061709_450_1283 | 267 |
| 564 | 3300046694 | Ga0495649_0007205 | Ga0495649_0007205_4858_5691 | 267 |
| 565 | 3300046810 | Ga0495660_0004975 | Ga0495660_0004975_5858_6691 | 267 |
| 566 | 3300047443 | Ga0495687_000330 | Ga0495687_000330_15501_16334 | 267 |
| 567 | 3300047443 | Ga0495687_010702 | Ga0495687_010702_3001_3834 | 267 |
| 568 | 3300047443 | Ga0495687_010712 | Ga0495687_010712_3001_3834 | 267 |
| 569 | 3300047472 | Ga0495686_0001339 | Ga0495686_0001339_7262_8092 | 267 |
| 570 | 3300047673 | Ga0495593_0115921 | Ga0495593_0115921_18_839 | 267 |
| 571 | 3300048091 | Ga0495626_0029363 | Ga0495626_0029363_332_1165 | 267 |
| 572 | 3300048904 | Ga0496101_0276550 | Ga0496101_0276550_104_925 | 267 |
| 573 | 3300048905 | Ga0496102_0314520 | Ga0496102_0314520_216_1034 | 267 |
| 574 | 3300048909 | Ga0496106_0095037 | Ga0496106_0095037_1189_2010 | 267 |
| 575 | 3300048917 | Ga0496114_0001104 | Ga0496114_0001104_18352_19170 | 267 |
| 576 | 3300048924 | Ga0496121_0260646 | Ga0496121_0260646_197_1018 | 267 |
| 577 | 3300049521 | Ga0501298_003130 | Ga0501298_003130_993_1826 | 267 |
| 578 | 3300049578 | Ga0501042_0420896 | Ga0501042_0420896_28_846 | 267 |
| 579 | 3300049579 | Ga0501043_0000075 | Ga0501043_0000075_56450_57271 | 267 |
| 580 | 3300049580 | Ga0501046_0000195 | Ga0501046_0000195_28951_29772 | 267 |
| 581 | 3300049581 | Ga0501047_0000145 | Ga0501047_0000145_56450_57271 | 267 |
| 582 | 3300049582 | Ga0501048_0003268 | Ga0501048_0003268_2715_3536 | 267 |
| 583 | 3300049682 | Ga0501252_001117 | Ga0501252_001117_354_1172 | 267 |
| 584 | 3300049759 | Ga0501262_000604 | Ga0501262_000604_100_933 | 267 |
| 585 | 3300049762 | Ga0501265_000800 | Ga0501265_000800_2217_3050 | 267 |
| 586 | 3300049823 | Ga0501044_0126233 | Ga0501044_0126233_1140_1961 | 267 |
| 587 | 3300049824 | Ga0501045_0000705 | Ga0501045_0000705_15100_15921 | 267 |
| 588 | 3300050489 | nmdc:mga03683_142028_c1 | nmdc:mga03683_142028_c1_117_944 | 267 |
| 589 | 3300050489 | nmdc:mga03683_89997_c1 | nmdc:mga03683_89997_c1_130_963 | 267 |
| 590 | 3300050490 | nmdc:mga03n38_55236_c1 | nmdc:mga03n38_55236_c1_446_1273 | 267 |
| 591 | 3300050491 | nmdc:mga00v17_184574_c1 | nmdc:mga00v17_184574_c1_321_1154 | 267 |
| 592 | 3300050493 | nmdc:mga0k408_1324_c1 | nmdc:mga0k408_1324_c1_10402_11235 | 267 |
| 593 | 3300050493 | nmdc:mga0k408_153219_c1 | nmdc:mga0k408_153219_c1_146_979 | 267 |
| 594 | 3300050493 | nmdc:mga0k408_260504_c1 | nmdc:mga0k408_260504_c1_42_869 | 267 |
| 595 | 3300050493 | nmdc:mga0k408_3826_c1 | nmdc:mga0k408_3826_c1_2675_3508 | 267 |
| 596 | 3300050493 | nmdc:mga0k408_41858_c1 | nmdc:mga0k408_41858_c1_768_1595 | 267 |
| 597 | 3300050493 | nmdc:mga0k408_4731_c1 | nmdc:mga0k408_4731_c1_6017_6838 | 267 |
| 598 | 3300050493 | nmdc:mga0k408_54342_c1 | nmdc:mga0k408_54342_c1_942_1781 | 267 |
| 599 | 3300050493 | nmdc:mga0k408_8116_c1 | nmdc:mga0k408_8116_c1_1435_2268 | 267 |
| 600 | 3300050493 | nmdc:mga0k408_96600_c1 | nmdc:mga0k408_96600_c1_501_1322 | 267 |
| 601 | 3300050493 | nmdc:mga0k408_9794_c1 | nmdc:mga0k408_9794_c1_2066_2896 | 267 |
| 602 | 3300050494 | nmdc:mga06z11_37018_c1 | nmdc:mga06z11_37018_c1_936_1769 | 267 |
| 603 | 3300050496 | nmdc:mga07m45_12663_c1 | nmdc:mga07m45_12663_c1_1421_2248 | 267 |
| 604 | 3300050496 | nmdc:mga07m45_1430_c1 | nmdc:mga07m45_1430_c1_3649_4482 | 267 |
| 605 | 3300050496 | nmdc:mga07m45_46844_c1 | nmdc:mga07m45_46844_c1_340_1176 | 267 |
| 606 | 3300050496 | nmdc:mga07m45_630_c1 | nmdc:mga07m45_630_c1_1505_2338 | 267 |
| 607 | 3300050496 | nmdc:mga07m45_93107_c1 | nmdc:mga07m45_93107_c1_501_1334 | 267 |
| 608 | 3300053086 | Ga0500578_0003366 | Ga0500578_0003366_1514_2341 | 267 |
| 609 | 3300053086 | Ga0500578_0057270 | Ga0500578_0057270_1096_1932 | 267 |
| 610 | 3300053092 | Ga0500583_0071088 | Ga0500583_0071088_378_1205 | 267 |
| 611 | 3300053093 | Ga0500651_0007902 | Ga0500651_0007902_261_1088 | 267 |
| 612 | 3300053116 | Ga0500592_010134 | Ga0500592_010134_90_917 | 267 |
| 613 | 3300053118 | Ga0500594_0002948 | Ga0500594_0002948_1890_2711 | 267 |
| 614 | 3300053118 | Ga0500594_0066153 | Ga0500594_0066153_158_985 | 267 |
| 615 | 3300053130 | Ga0500642_0094420 | Ga0500642_0094420_415_1251 | 267 |
| 616 | 3300053131 | Ga0500652_000521 | Ga0500652_000521_9774_10601 | 267 |
| 617 | 3300053136 | Ga0500559_0001509 | Ga0500559_0001509_6181_7002 | 267 |
| 618 | 3300053139 | Ga0500568_0015935 | Ga0500568_0015935_51_884 | 267 |
| 619 | 3300053151 | Ga0500604_0051911 | Ga0500604_0051911_314_1141 | 267 |
| 620 | 3300053156 | Ga0500622_0001293 | Ga0500622_0001293_9894_10721 | 267 |
| 621 | 3300053724 | Ga0500570_087793 | Ga0500570_087793_366_1193 | 267 |
| 622 | 3300053730 | Ga0500645_002947 | Ga0500645_002947_2583_3419 | 267 |
| 623 | 3300053739 | Ga0500587_000635 | Ga0500587_000635_2480_3298 | 267 |
| 624 | iso_pu_bacteria | 2547132374 | 2548497741 | 267 |
| 625 | iso_pu_bacteria | 2585428057 | 2587728019 | 267 |
| 626 | iso_pu_bacteria | 2585428058 | 2587731083 | 267 |
| 627 | iso_pu_bacteria | 2585428062 | 2587760282 | 267 |
| 628 | iso_pu_bacteria | 2588253510 | 2588289835 | 267 |
| 629 | iso_pu_bacteria | 2643221570 | 2643867205 | 267 |
| 630 | iso_pu_bacteria | 2643221592 | 2643972366 | 267 |
| 631 | iso_pu_bacteria | 2643221596 | 2643990127 | 267 |
| 632 | iso_pu_bacteria | 2643221609 | 2644059346 | 267 |
| 633 | iso_pu_bacteria | 2643221611 | 2644075615 | 267 |
| 634 | iso_pu_bacteria | 2643221625 | 2644141523 | 267 |
| 635 | iso_pu_bacteria | 2643221644 | 2644245233 | 267 |
| 636 | iso_pu_bacteria | 2643221648 | 2644275706 | 267 |
| 637 | iso_pu_bacteria | 2643221652 | 2644295611 | 267 |
| 638 | iso_pu_bacteria | 2643221717 | 2644645149 | 267 |
| 639 | iso_pu_bacteria | 2738543012 | 2739240844 | 267 |
| 640 | iso_pu_bacteria | 2816332133 | 2816472082 | 267 |
| 641 | iso_pu_bacteria | 2881101125 | 2881101514 | 267 |
| 642 | iso_pu_bacteria | 2885266251 | 2885269105 | 267 |
| 643 | iso_pu_bacteria | 2904479285 | 2904483350 | 267 |
| 644 | iso_pu_bacteria | 2990710928 | 2990711157 | 267 |
| 645 | 3300002704 | JGI25155J39150_1001042 | JGI25155J39150_10010422 | 268 |
| 646 | 3300002738 | JGI25154J39366_1000128 | JGI25154J39366_100012825 | 268 |
| 647 | 3300005330 | Ga0070690_100122522 | Ga0070690_1001225222 | 268 |
| 648 | 3300005331 | Ga0070670_100006300 | Ga0070670_1000063005 | 268 |
| 649 | 3300005331 | Ga0070670_100029278 | Ga0070670_1000292783 | 268 |
| 650 | 3300005331 | Ga0070670_100037863 | Ga0070670_1000378633 | 268 |
| 651 | 3300005331 | Ga0070670_100346801 | Ga0070670_1003468011 | 268 |
| 652 | 3300005335 | Ga0070666_10029664 | Ga0070666_100296642 | 268 |
| 653 | 3300005338 | Ga0068868_100000930 | Ga0068868_1000009303 | 268 |
| 654 | 3300005340 | Ga0070689_100026477 | Ga0070689_1000264773 | 268 |
| 655 | 3300005354 | Ga0070675_100000926 | Ga0070675_10000092618 | 268 |
| 656 | 3300005354 | Ga0070675_100023645 | Ga0070675_1000236452 | 268 |
| 657 | 3300005354 | Ga0070675_100082173 | Ga0070675_1000821732 | 268 |
| 658 | 3300005355 | Ga0070671_100119488 | Ga0070671_1001194882 | 268 |
| 659 | 3300005355 | Ga0070671_100169798 | Ga0070671_1001697981 | 268 |
| 660 | 3300005355 | Ga0070671_100268378 | Ga0070671_1002683782 | 268 |
| 661 | 3300005355 | Ga0070671_100336060 | Ga0070671_1003360601 | 268 |
| 662 | 3300005367 | Ga0070667_100011038 | Ga0070667_1000110388 | 268 |
| 663 | 3300005456 | Ga0070678_100013269 | Ga0070678_1000132695 | 268 |
| 664 | 3300005456 | Ga0070678_100229716 | Ga0070678_1002297162 | 268 |
| 665 | 3300005456 | Ga0070678_100284977 | Ga0070678_1002849771 | 268 |
| 666 | 3300005457 | Ga0070662_100065813 | Ga0070662_1000658132 | 268 |
| 667 | 3300005459 | Ga0068867_100068350 | Ga0068867_1000683502 | 268 |
| 668 | 3300005539 | Ga0068853_100053921 | Ga0068853_1000539212 | 268 |
| 669 | 3300005543 | Ga0070672_100112023 | Ga0070672_1001120231 | 268 |
| 670 | 3300005543 | Ga0070672_100183062 | Ga0070672_1001830622 | 268 |
| 671 | 3300005543 | Ga0070672_100199760 | Ga0070672_1001997602 | 268 |
| 672 | 3300005548 | Ga0070665_100278976 | Ga0070665_1002789762 | 268 |
| 673 | 3300005548 | Ga0070665_100426083 | Ga0070665_1004260832 | 268 |
| 674 | 3300005564 | Ga0070664_100105483 | Ga0070664_1001054833 | 268 |
| 675 | 3300005564 | Ga0070664_100147680 | Ga0070664_1001476802 | 268 |
| 676 | 3300005616 | Ga0068852_100270354 | Ga0068852_1002703542 | 268 |
| 677 | 3300005617 | Ga0068859_100001157 | Ga0068859_1000011573 | 268 |
| 678 | 3300005618 | Ga0068864_100043931 | Ga0068864_1000439314 | 268 |
| 679 | 3300005719 | Ga0068861_100038148 | Ga0068861_1000381483 | 268 |
| 680 | 3300005840 | Ga0068870_10199416 | Ga0068870_101994162 | 268 |
| 681 | 3300005842 | Ga0068858_100001292 | Ga0068858_10000129218 | 268 |
| 682 | 3300006042 | Ga0075368_10025717 | Ga0075368_100257172 | 268 |
| 683 | 3300006237 | Ga0097621_100004797 | Ga0097621_1000047972 | 268 |
| 684 | 3300006237 | Ga0097621_100171084 | Ga0097621_1001710842 | 268 |
| 685 | 3300006237 | Ga0097621_100227161 | Ga0097621_1002271612 | 268 |
| 686 | 3300006358 | Ga0068871_100008231 | Ga0068871_1000082317 | 268 |
| 687 | 3300006358 | Ga0068871_100249243 | Ga0068871_1002492432 | 268 |
| 688 | 3300006881 | Ga0068865_100296794 | Ga0068865_1002967942 | 268 |
| 689 | 3300006931 | Ga0097620_100001157 | Ga0097620_1000011573 | 268 |
| 690 | 3300009093 | Ga0105240_10007990 | Ga0105240_100079904 | 268 |
| 691 | 3300009148 | Ga0105243_10047878 | Ga0105243_100478782 | 268 |
| 692 | 3300009176 | Ga0105242_10077752 | Ga0105242_100777521 | 268 |
| 693 | 3300009177 | Ga0105248_10107672 | Ga0105248_101076724 | 268 |
| 694 | 3300009545 | Ga0105237_10034334 | Ga0105237_100343344 | 268 |
| 695 | 3300009551 | Ga0105238_10003365 | Ga0105238_100033659 | 268 |
| 696 | 3300009553 | Ga0105249_10039647 | Ga0105249_100396473 | 268 |
| 697 | 3300010375 | Ga0105239_10003389 | Ga0105239_100033892 | 268 |
| 698 | 3300013296 | Ga0157374_10189723 | Ga0157374_101897232 | 268 |
| 699 | 3300013308 | Ga0157375_10076855 | Ga0157375_100768554 | 268 |
| 700 | 3300013308 | Ga0157375_10154757 | Ga0157375_101547573 | 268 |
| 701 | 3300014325 | Ga0163163_10002538 | Ga0163163_1000253814 | 268 |
| 702 | 3300014326 | Ga0157380_10047723 | Ga0157380_100477233 | 268 |
| 703 | 3300014326 | Ga0157380_10071376 | Ga0157380_100713762 | 268 |
| 704 | 3300014326 | Ga0157380_10071794 | Ga0157380_100717942 | 268 |
| 705 | 3300014969 | Ga0157376_10014590 | Ga0157376_100145903 | 268 |
| 706 | 3300014969 | Ga0157376_10021252 | Ga0157376_100212524 | 268 |
| 707 | 3300015261 | Ga0182006_1015134 | Ga0182006_10151343 | 268 |
| 708 | 3300017792 | Ga0163161_10162904 | Ga0163161_101629042 | 268 |
| 709 | 3300025206 | Ga0209435_100115 | Ga0209435_1001155 | 268 |
| 710 | 3300025246 | Ga0209646_1000155 | Ga0209646_100015550 | 268 |
| 711 | 3300025250 | Ga0209026_1000769 | Ga0209026_100076917 | 268 |
| 712 | 3300025256 | Ga0209759_1000375 | Ga0209759_100037539 | 268 |
| 713 | 3300025893 | Ga0207682_10007480 | Ga0207682_100074805 | 268 |
| 714 | 3300025901 | Ga0207688_10200887 | Ga0207688_102008871 | 268 |
| 715 | 3300025903 | Ga0207680_10005283 | Ga0207680_100052836 | 268 |
| 716 | 3300025903 | Ga0207680_10085564 | Ga0207680_100855642 | 268 |
| 717 | 3300025907 | Ga0207645_10075710 | Ga0207645_100757102 | 268 |
| 718 | 3300025907 | Ga0207645_10114838 | Ga0207645_101148382 | 268 |
| 719 | 3300025914 | Ga0207671_10002336 | Ga0207671_100023362 | 268 |
| 720 | 3300025923 | Ga0207681_10069573 | Ga0207681_100695732 | 268 |
| 721 | 3300025923 | Ga0207681_10098776 | Ga0207681_100987763 | 268 |
| 722 | 3300025925 | Ga0207650_10002868 | Ga0207650_100028689 | 268 |
| 723 | 3300025925 | Ga0207650_10300768 | Ga0207650_103007681 | 268 |
| 724 | 3300025926 | Ga0207659_10001257 | Ga0207659_100012574 | 268 |
| 725 | 3300025926 | Ga0207659_10013518 | Ga0207659_100135185 | 268 |
| 726 | 3300025926 | Ga0207659_10015146 | Ga0207659_100151462 | 268 |
| 727 | 3300025931 | Ga0207644_10088580 | Ga0207644_100885803 | 268 |
| 728 | 3300025931 | Ga0207644_10153838 | Ga0207644_101538382 | 268 |
| 729 | 3300025933 | Ga0207706_10066467 | Ga0207706_100664673 | 268 |
| 730 | 3300025933 | Ga0207706_10067288 | Ga0207706_100672883 | 268 |
| 731 | 3300025935 | Ga0207709_10115691 | Ga0207709_101156912 | 268 |
| 732 | 3300025937 | Ga0207669_10370037 | Ga0207669_103700371 | 268 |
| 733 | 3300025940 | Ga0207691_10037444 | Ga0207691_100374444 | 268 |
| 734 | 3300025941 | Ga0207711_10010123 | Ga0207711_100101231 | 268 |
| 735 | 3300025941 | Ga0207711_10101817 | Ga0207711_101018173 | 268 |
| 736 | 3300025960 | Ga0207651_10000364 | Ga0207651_100003641 | 268 |
| 737 | 3300025960 | Ga0207651_10041858 | Ga0207651_100418582 | 268 |
| 738 | 3300025961 | Ga0207712_10041521 | Ga0207712_100415213 | 268 |
| 739 | 3300025972 | Ga0207668_10012084 | Ga0207668_100120846 | 268 |
| 740 | 3300025986 | Ga0207658_10002924 | Ga0207658_1000292412 | 268 |
| 741 | 3300025986 | Ga0207658_10077603 | Ga0207658_100776032 | 268 |
| 742 | 3300026023 | Ga0207677_10133083 | Ga0207677_101330832 | 268 |
| 743 | 3300026035 | Ga0207703_10001647 | Ga0207703_1000164718 | 268 |
| 744 | 3300026041 | Ga0207639_10071881 | Ga0207639_100718812 | 268 |
| 745 | 3300026095 | Ga0207676_10001498 | Ga0207676_100014982 | 268 |
| 746 | 3300026095 | Ga0207676_10017299 | Ga0207676_100172995 | 268 |
| 747 | 3300026118 | Ga0207675_100074019 | Ga0207675_1000740192 | 268 |
| 748 | 3300026121 | Ga0207683_10033147 | Ga0207683_100331473 | 268 |
| 749 | 3300026121 | Ga0207683_10049633 | Ga0207683_100496333 | 268 |
| 750 | 3300026121 | Ga0207683_10299106 | Ga0207683_102991062 | 268 |
| 751 | 3300026142 | Ga0207698_10028570 | Ga0207698_100285703 | 268 |
| 752 | 3300026142 | Ga0207698_10142792 | Ga0207698_101427923 | 268 |
| 753 | 3300028380 | Ga0268265_10068611 | Ga0268265_100686113 | 268 |
| 754 | 3300028794 | Ga0307515_10038277 | Ga0307515_100382775 | 268 |
| 755 | 3300031456 | Ga0307513_10135388 | Ga0307513_101353882 | 268 |
| 756 | 3300031730 | Ga0307516_10022952 | Ga0307516_100229525 | 268 |
| 757 | 3300031995 | Ga0307409_100012808 | Ga0307409_1000128086 | 268 |
| 758 | 3300032002 | Ga0307416_100009118 | Ga0307416_1000091187 | 268 |
| 759 | 3300032004 | Ga0307414_10209979 | Ga0307414_102099792 | 268 |
| 760 | 3300032126 | Ga0307415_100000538 | Ga0307415_10000053812 | 268 |
| 761 | 3300035692 | Ga0373935_0200366 | Ga0373935_0200366_22_897 | 268 |
| 762 | 3300037312 | Ga0395899_0016249 | Ga0395899_0016249_117_947 | 268 |
| 763 | 3300037418 | Ga0395900_0004795 | Ga0395900_0004795_5685_6515 | 268 |
| 764 | 3300037466 | Ga0395898_0008778 | Ga0395898_0008778_6370_7200 | 268 |
| 765 | 3300037471 | Ga0395905_0010964 | Ga0395905_0010964_4426_5253 | 268 |
| 766 | 3300037471 | Ga0395905_0031340 | Ga0395905_0031340_2019_2849 | 268 |
| 767 | 3300037471 | Ga0395905_0261614 | Ga0395905_0261614_162_989 | 268 |
| 768 | 3300042007 | Ga0439449_0029115 | Ga0439449_0029115_564_1436 | 268 |
| 769 | 3300044656 | Ga0466969_0016680 | Ga0466969_0016680_1601_2470 | 268 |
| 770 | 3300044683 | Ga0466965_0007760 | Ga0466965_0007760_744_1613 | 268 |
| 771 | 3300044693 | Ga0466961_0064566 | Ga0466961_0064566_945_1829 | 268 |
| 772 | 3300044693 | Ga0466961_0090729 | Ga0466961_0090729_75_944 | 268 |
| 773 | 3300044694 | Ga0466963_0004270 | Ga0466963_0004270_375_1244 | 268 |
| 774 | 3300044719 | Ga0466971_0007914 | Ga0466971_0007914_210_1079 | 268 |
| 775 | 3300044719 | Ga0466971_0008150 | Ga0466971_0008150_392_1219 | 268 |
| 776 | 3300044735 | Ga0466968_0064515 | Ga0466968_0064515_221_1090 | 268 |
| 777 | 3300044842 | Ga0466957_0004305 | Ga0466957_0004305_5384_6253 | 268 |
| 778 | 3300045049 | Ga0466959_0233439 | Ga0466959_0233439_368_1237 | 268 |
| 779 | 3300045051 | Ga0451576_0006080 | Ga0451576_0006080_2739_3566 | 268 |
| 780 | 3300046457 | Ga0495590_0001358 | Ga0495590_0001358_1168_1995 | 268 |
| 781 | 3300046457 | Ga0495590_0003934 | Ga0495590_0003934_3108_3935 | 268 |
| 782 | 3300046537 | Ga0495598_0038421 | Ga0495598_0038421_376_1257 | 268 |
| 783 | 3300046539 | Ga0495621_0014745 | Ga0495621_0014745_1531_2364 | 268 |
| 784 | 3300046810 | Ga0495660_0085796 | Ga0495660_0085796_532_1359 | 268 |
| 785 | 3300048907 | Ga0496104_0009568 | Ga0496104_0009568_4277_5110 | 268 |
| 786 | 3300048908 | Ga0496105_0024505 | Ga0496105_0024505_42_875 | 268 |
| 787 | 3300048924 | Ga0496121_0019081 | Ga0496121_0019081_1622_2491 | 268 |
| 788 | 3300050493 | nmdc:mga0k408_1110_c1 | nmdc:mga0k408_1110_c1_11545_12378 | 268 |
| 789 | 3300050493 | nmdc:mga0k408_20845_c1 | nmdc:mga0k408_20845_c1_1804_2649 | 268 |
| 790 | 3300053108 | Ga0500562_006072 | Ga0500562_006072_683_1489 | 268 |
| 791 | 3300053153 | Ga0500616_0050109 | Ga0500616_0050109_584_1390 | 268 |
| 792 | 3300061719 | Ga0466962_0012516 | Ga0466962_0012516_2495_3364 | 268 |
| 793 | iso_pu_bacteria | 2511231003 | 2511250395 | 268 |
| 794 | iso_pu_bacteria | 2904479285 | 2904483818 | 268 |
| 795 | 3300002704 | JGI25155J39150_1000123 | JGI25155J39150_100012323 | 269 |
| 796 | 3300002705 | JGI25156J39149_1000052 | JGI25156J39149_100005251 | 269 |
| 797 | 3300002738 | JGI25154J39366_1000081 | JGI25154J39366_100008115 | 269 |
| 798 | 3300002741 | JGI25157J39369_1000006 | JGI25157J39369_1000006146 | 269 |
| 799 | 3300002774 | JGI25150J39212_1008331 | JGI25150J39212_10083312 | 269 |
| 800 | 3300002987 | JGI25159J45721_1005943 | JGI25159J45721_10059433 | 269 |
| 801 | 3300002987 | JGI25159J45721_1010857 | JGI25159J45721_10108572 | 269 |
| 802 | 3300003187 | JGI25151J46595_10007771 | JGI25151J46595_100077716 | 269 |
| 803 | 3300003187 | JGI25151J46595_10033260 | JGI25151J46595_100332602 | 269 |
| 804 | 3300003354 | JGI25160J50197_1000071 | JGI25160J50197_100007196 | 269 |
| 805 | 3300003374 | JGI25161J50226_1000144 | JGI25161J50226_10001445 | 269 |
| 806 | 3300003773 | Ga0055537_1000689 | Ga0055537_10006893 | 269 |
| 807 | 3300003773 | Ga0055537_1016026 | Ga0055537_10160261 | 269 |
| 808 | 3300003775 | Ga0055524_1000006 | Ga0055524_1000006150 | 269 |
| 809 | 3300003781 | Ga0055536_1025617 | Ga0055536_10256171 | 269 |
| 810 | 3300003784 | Ga0055534_1000850 | Ga0055534_100085013 | 269 |
| 811 | 3300003790 | Ga0055528_1000432 | Ga0055528_100043217 | 269 |
| 812 | 3300003791 | Ga0055530_10001172 | Ga0055530_1000117214 | 269 |
| 813 | 3300003792 | Ga0055540_1000005 | Ga0055540_1000005164 | 269 |
| 814 | 3300003794 | Ga0055531_10005581 | Ga0055531_100055812 | 269 |
| 815 | 3300004625 | Ga0055543_1000162 | Ga0055543_100016225 | 269 |
| 816 | 3300005518 | Ga0070699_100233632 | Ga0070699_1002336322 | 269 |
| 817 | 3300006058 | Ga0075432_10008161 | Ga0075432_100081614 | 269 |
| 818 | 3300006195 | Ga0075366_10067831 | Ga0075366_100678312 | 269 |
| 819 | 3300006195 | Ga0075366_10077136 | Ga0075366_100771362 | 269 |
| 820 | 3300006946 | Ga0079104_1023974 | Ga0079104_10239742 | 269 |
| 821 | 3300025206 | Ga0209435_100001 | Ga0209435_100001101 | 269 |
| 822 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001470 | 269 |
| 823 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003101 | 269 |
| 824 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001101 | 269 |
| 825 | 3300025263 | Ga0209565_1000124 | Ga0209565_100012479 | 269 |
| 826 | 3300025263 | Ga0209565_1000910 | Ga0209565_10009108 | 269 |
| 827 | 3300025273 | Ga0209673_1000043 | Ga0209673_1000043238 | 269 |
| 828 | 3300025284 | Ga0209130_1000060 | Ga0209130_100006034 | 269 |
| 829 | 3300025284 | Ga0209130_1000114 | Ga0209130_100011465 | 269 |
| 830 | 3300025291 | Ga0209675_1000269 | Ga0209675_100026934 | 269 |
| 831 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007533 | 269 |
| 832 | 3300025294 | Ga0209025_1004701 | Ga0209025_10047013 | 269 |
| 833 | 3300025294 | Ga0209025_1007436 | Ga0209025_10074363 | 269 |
| 834 | 3300025294 | Ga0209025_1025947 | Ga0209025_10259473 | 269 |
| 835 | 3300025295 | Ga0209564_1000268 | Ga0209564_100026879 | 269 |
| 836 | 3300025295 | Ga0209564_1002616 | Ga0209564_100261613 | 269 |
| 837 | 3300025295 | Ga0209564_1007511 | Ga0209564_10075116 | 269 |
| 838 | 3300025297 | Ga0209758_1025948 | Ga0209758_10259482 | 269 |
| 839 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003975 | 269 |
| 840 | 3300025298 | Ga0209050_1002216 | Ga0209050_10022162 | 269 |
| 841 | 3300025298 | Ga0209050_1002992 | Ga0209050_100299210 | 269 |
| 842 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001981 | 269 |
| 843 | 3300025302 | Ga0207426_1000308 | Ga0207426_100030847 | 269 |
| 844 | 3300025302 | Ga0207426_1002574 | Ga0207426_10025742 | 269 |
| 845 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003975 | 269 |
| 846 | 3300025304 | Ga0209257_1000020 | Ga0209257_1000020533 | 269 |
| 847 | 3300025304 | Ga0209257_1035649 | Ga0209257_10356492 | 269 |
| 848 | 3300027907 | Ga0207428_10215834 | Ga0207428_102158342 | 269 |
| 849 | 3300028794 | Ga0307515_10000458 | Ga0307515_1000045836 | 269 |
| 850 | 3300031456 | Ga0307513_10000006 | Ga0307513_10000006283 | 269 |
| 851 | 3300031456 | Ga0307513_10000094 | Ga0307513_1000009427 | 269 |
| 852 | 3300031456 | Ga0307513_10001393 | Ga0307513_1000139319 | 269 |
| 853 | 3300031548 | Ga0307408_100016115 | Ga0307408_1000161153 | 269 |
| 854 | 3300031649 | Ga0307514_10014681 | Ga0307514_100146816 | 269 |
| 855 | 3300031824 | Ga0307413_10314011 | Ga0307413_103140111 | 269 |
| 856 | 3300031901 | Ga0307406_10022081 | Ga0307406_100220812 | 269 |
| 857 | 3300041512 | Ga0451853_0207789 | Ga0451853_0207789_123_962 | 269 |
| 858 | 3300046530 | Ga0495654_0006531 | Ga0495654_0006531_3158_3967 | 269 |
| 859 | 3300049574 | Ga0501038_0055025 | Ga0501038_0055025_364_1173 | 269 |
| 860 | 3300049822 | Ga0501035_0014603 | Ga0501035_0014603_4774_5583 | 269 |
| 861 | 3300049823 | Ga0501044_0016149 | Ga0501044_0016149_3202_4011 | 269 |
| 862 | 3300050493 | nmdc:mga0k408_133098_c1 | nmdc:mga0k408_133098_c1_462_1271 | 269 |
| 863 | 3300050493 | nmdc:mga0k408_2870_c2 | nmdc:mga0k408_2870_c2_352_1161 | 269 |
| 864 | 3300050496 | nmdc:mga07m45_122534_c1 | nmdc:mga07m45_122534_c1_212_1021 | 269 |
| 865 | 3300053088 | Ga0500644_0026585 | Ga0500644_0026585_457_1266 | 269 |
| 866 | 3300053093 | Ga0500651_0017641 | Ga0500651_0017641_1549_2358 | 269 |
| 867 | 3300053096 | Ga0500641_0098199 | Ga0500641_0098199_192_1001 | 269 |
| 868 | 3300053117 | Ga0500593_003969 | Ga0500593_003969_1847_2656 | 269 |
| 869 | 3300053129 | Ga0500628_013444 | Ga0500628_013444_442_1251 | 269 |
| 870 | 3300053730 | Ga0500645_001182 | Ga0500645_001182_12434_13243 | 269 |
| 871 | 3300053730 | Ga0500645_012277 | Ga0500645_012277_1194_2003 | 269 |
| 872 | 3300053730 | Ga0500645_014969 | Ga0500645_014969_428_1237 | 269 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ay3-assembly2.cif.gz_D | crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens | 0.9899 | 5 | 265 |
| 6mfh-assembly1.cif.gz_A | mutated uronate dehydrogenase | 0.9898 | 5 | 265 |
| 3rfx-assembly1.cif.gz_A | crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with nad | 0.9784 | 7 | 269 |
| 3rft-assembly1.cif.gz_A | crystal structure of uronate dehydrogenase from agrobacterium tumefaciens | 0.9774 | 7 | 269 |
| 3ay3-assembly2.cif.gz_D | crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens | 0.9678 | 5 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rftA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9872 | 7 | 231 | 3.40.50.720 |
| 3rftA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9701 | 7 | 231 | 3.40.50.720 |
| 4id9A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8887 | 9 | 231 | 3.40.50.720 |
| 4id9A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8808 | 9 | 231 | 3.40.50.720 |
| af_Q4DUZ8_1_205_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8789 | 8 | 165 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N2TDF1-F1-model_v4 | NAD-dependent dehydratase | 1 | 3 | 267 |
|
| AF-A0A2N2TDF1-F1-model_v4 | NAD-dependent dehydratase | 0.9962 | 3 | 267 |
|
| AF-A0A4V1TD39-F1-model_v4 | deleted | 0.9959 | 7 | 183 |
|
| AF-A0A529XPF8-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.995 | 139 | 265 |
|
| AF-A0A530A7Q5-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9937 | 90 | 254 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar