F484209

General Info

Members Datasets Scaffolds Average Seq Length
872 390 841 275

Family's Representative Sequence

Representative Sequence 3300002704|JGI25155J39150_1001042|JGI25155J39150_10010422
Length 288
Sequence MADQAAHAADSGKEAQEPRQSKFGRLLLTGAGGGLGKVLRPRLAAFADVLRVSDLEAALTGEPAAHEEVMPCNLADRAAMDALIAGCDAIVHLGGVSVERPFEEILEANIKGVFHVYEAARRHGVKRVVFASSNHVTGFYRQDEKIDVRDLRRPDGYYGLSKSYGEDMAQFNFDRYGIETVSIRIGWSFPEPKDRRSLASWLSYDDLTELLRCCLFTPNVGHTVVYGMSDNPSTWWSNRYAAHLGFQARDSSEAFRAKIEAQPMPAADDPVRVYQGGVFTATGPFDPQ

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
10 2643221596 Acidovorax sp. Root70 Isolate Unclassified
11 2643221609 Acidovorax sp. Root217 Isolate Unclassified
12 2643221611 Acidovorax sp. Root219 Isolate Unclassified
13 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
14 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
15 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
16 2643221652 Acidovorax sp. Root402 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2738543012 Acidovorax sp. CF301 Isolate Unclassified
19 2816332133 Acidovorax radicis 2721A Isolate Unclassified
20 2818991436 Collimonas arenae 515 Isolate Unclassified
21 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
22 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
23 2885266251 Ralstonia sp. SET104 Isolate Nodule
24 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
25 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
26 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
27 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
28 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
29 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
30 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
31 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
36 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
37 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
38 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
39 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
42 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
43 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
44 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
45 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
46 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
47 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
48 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
49 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
50 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
51 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
52 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
53 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
54 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
55 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
58 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
59 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
60 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
63 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
64 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
67 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
68 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
75 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
76 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
77 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
88 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
89 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
93 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
98 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
99 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
100 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
101 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
102 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
103 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
104 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
105 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
106 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
113 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
150 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
154 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
163 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
164 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
240 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
241 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
242 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
243 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
244 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
247 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
248 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
249 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
250 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
257 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
272 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
273 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
274 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
275 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
276 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
277 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
278 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
279 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
280 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
281 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
282 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
283 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
291 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
292 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
293 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
300 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
307 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
308 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
309 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
315 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
316 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
317 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
322 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
323 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
327 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
353 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
354 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
359 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
360 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
361 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
362 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
367 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
368 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
369 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
370 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
371 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
372 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
373 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
374 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
375 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
376 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
377 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
378 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
379 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
380 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
381 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
385 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
386 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
387 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
388 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
389 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
390 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.33
Metatranscriptomes 0
Isolates 3.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 19.27
Nodule 0.46
Rhizoplane 1.95
Rhizosphere 68.81
Stem 0
Stem Tuber 0
Unclassified 9.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000123 3300002704 Bacteria 37730
2 JGI25155J39150_1001042 3300002704 Bacteria 2929
3 JGI25156J39149_1000052 3300002705 Bacteria 89046
4 JGI25162J39368_1000414 3300002737 Bacteria 34857
5 JGI25154J39366_1000081 3300002738 Bacteria 89046
6 JGI25154J39366_1000128 3300002738 Bacteria 59551
7 JGI25157J39369_1000006 3300002741 Bacteria 226861
8 JGI25152J39213_1002063 3300002773 Bacteria 7909
9 JGI25150J39212_1007965 3300002774 Bacteria 2099
10 JGI25150J39212_1008331 3300002774 Bacteria 2033
11 JGI25159J45721_1005943 3300002987 Bacteria 3743
12 JGI25159J45721_1010857 3300002987 Bacteria 2281
13 JGI25151J46595_10007771 3300003187 Bacteria 5217
14 JGI25151J46595_10033260 3300003187 Bacteria 1988
15 JGI25165J46597_1000135 3300003214 Bacteria 122924
16 JGI25153J46596_10011901 3300003215 Bacteria 3809
17 JGI25153J46596_10016520 3300003215 Bacteria 2950
18 rootH1_10020400 3300003316 Bacteria 6751
19 rootH1_10062309 3300003316 Bacteria 4463
20 rootH1_10062309 3300003323 Unclassified 2756
21 JGI25160J50197_1000071 3300003354 Bacteria 108301
22 JGI25161J50226_1000144 3300003374 Bacteria 49457
23 Ga0055538_1000055 3300003751 Bacteria 122924
24 Ga0055539_1000080 3300003752 Bacteria 122924
25 Ga0055533_1000086 3300003756 Bacteria 122924
26 Ga0055525_1000114 3300003759 Bacteria 122924
27 Ga0055535_1000891 3300003761 Bacteria 20502
28 Ga0055529_1000622 3300003763 Bacteria 26539
29 Ga0055526_1008751 3300003771 Bacteria 4991
30 Ga0055537_1000689 3300003773 Bacteria 17610
31 Ga0055537_1016026 3300003773 Bacteria 1286
32 Ga0055524_1000006 3300003775 Bacteria 324702
33 Ga0055524_1000033 3300003775 Bacteria 180833
34 Ga0055536_1025617 3300003781 Bacteria 1675
35 Ga0055534_1000850 3300003784 Bacteria 14043
36 Ga0055528_1000432 3300003790 Bacteria 33611
37 Ga0055530_10001172 3300003791 Bacteria 20267
38 Ga0055530_10002040 3300003791 Bacteria 13623
39 Ga0055540_1000005 3300003792 Bacteria 378126
40 Ga0055540_1000007 3300003792 Bacteria 318178
41 Ga0055540_1007509 3300003792 Bacteria 4097
42 Ga0055531_10001249 3300003794 Bacteria 19299
43 Ga0055531_10004316 3300003794 Bacteria 8709
44 Ga0055531_10005581 3300003794 Bacteria 7338
45 Ga0055541_1000057 3300003841 Bacteria 122924
46 Ga0055543_1000162 3300004625 Bacteria 55480
47 Ga0065165_1003473 3300005262 Bacteria 11008
48 Ga0065165_1036109 3300005262 Bacteria 1511
49 Ga0070658_10061636 3300005327 Bacteria 3056
50 Ga0070658_10141954 3300005327 Bacteria 2007
51 Ga0070676_10006595 3300005328 Bacteria 6207
52 Ga0070676_10021803 3300005328 Bacteria 3587
53 Ga0070676_10035514 3300005328 Bacteria 2868
54 Ga0070676_10066798 3300005328 Bacteria 2149
55 Ga0070690_100001452 3300005330 Bacteria 12372
56 Ga0070690_100022429 3300005330 Bacteria 3863
57 Ga0070690_100122522 3300005330 Bacteria 1747
58 Ga0070670_100003877 3300005331 Bacteria 12476
59 Ga0070670_100006300 3300005331 Bacteria 10047
60 Ga0070670_100029278 3300005331 Bacteria 4739
61 Ga0070670_100037863 3300005331 Bacteria 4149
62 Ga0070670_100161566 3300005331 Bacteria 1941
63 Ga0070670_100219464 3300005331 Bacteria 1654
64 Ga0070670_100346801 3300005331 Bacteria 1304
65 Ga0070670_100365812 3300005331 Bacteria 1269
66 Ga0070677_10001476 3300005333 Bacteria 7436
67 Ga0070677_10004019 3300005333 Bacteria 4776
68 Ga0070677_10006747 3300005333 Bacteria 3821
69 Ga0070677_10009993 3300005333 Bacteria 3232
70 Ga0068869_100007843 3300005334 Bacteria 6851
71 Ga0068869_100009960 3300005334 Bacteria 6178
72 Ga0068869_100109806 3300005334 Bacteria 2097
73 Ga0068869_100382916 3300005334 Bacteria 1153
74 Ga0070666_10001342 3300005335 Bacteria 14927
75 Ga0070666_10029664 3300005335 Bacteria 3598
76 Ga0070666_10104785 3300005335 Bacteria 1953
77 Ga0070682_100050395 3300005337 Bacteria 2599
78 Ga0068868_100000930 3300005338 Bacteria 19942
79 Ga0068868_100059254 3300005338 Bacteria 3028
80 Ga0068868_100141609 3300005338 Bacteria 1974
81 Ga0068868_100143353 3300005338 Bacteria 1963
82 Ga0070689_100026477 3300005340 Bacteria 4367
83 Ga0070687_100026010 3300005343 Bacteria 2813
84 Ga0070661_100000421 3300005344 Bacteria 32488
85 Ga0070661_100020513 3300005344 Bacteria 4714
86 Ga0070661_100067019 3300005344 Bacteria 2638
87 Ga0070661_100150333 3300005344 Bacteria 1760
88 Ga0070661_100168852 3300005344 Bacteria 1660
89 Ga0070668_100063241 3300005347 Bacteria 2868
90 Ga0070669_100008965 3300005353 Bacteria 7140
91 Ga0070669_100254237 3300005353 Bacteria 1400
92 Ga0070675_100000926 3300005354 Bacteria 20887
93 Ga0070675_100006716 3300005354 Bacteria 8846
94 Ga0070675_100023645 3300005354 Bacteria 4915
95 Ga0070675_100082173 3300005354 Bacteria 2687
96 Ga0070675_100219449 3300005354 Bacteria 1655
97 Ga0070671_100005287 3300005355 Bacteria 10298
98 Ga0070671_100006545 3300005355 Bacteria 9314
99 Ga0070671_100008975 3300005355 Bacteria 8023
100 Ga0070671_100119488 3300005355 Bacteria 2217
101 Ga0070671_100169798 3300005355 Bacteria 1845
102 Ga0070671_100268378 3300005355 Bacteria 1450
103 Ga0070671_100336060 3300005355 Bacteria 1288
104 Ga0070674_100012835 3300005356 Bacteria 5157
105 Ga0070674_100014454 3300005356 Bacteria 4907
106 Ga0070674_100031292 3300005356 Bacteria 3525
107 Ga0070674_100123469 3300005356 Bacteria 1920
108 Ga0070673_100031264 3300005364 Bacteria 3993
109 Ga0070673_100054845 3300005364 Bacteria 3138
110 Ga0070659_100001131 3300005366 Bacteria 19448
111 Ga0070659_100021789 3300005366 Bacteria 4885
112 Ga0070667_100011038 3300005367 Bacteria 7472
113 Ga0070667_100017549 3300005367 Bacteria 5932
114 Ga0070667_100063167 3300005367 Bacteria 3137
115 Ga0070667_100254418 3300005367 Bacteria 1571
116 Ga0070701_10067747 3300005438 Bacteria 1900
117 Ga0070700_100322159 3300005441 Bacteria 1136
118 Ga0070678_100013269 3300005456 Bacteria 5158
119 Ga0070678_100038573 3300005456 Bacteria 3364
120 Ga0070678_100050929 3300005456 Bacteria 2998
121 Ga0070678_100129140 3300005456 Bacteria 2005
122 Ga0070678_100226481 3300005456 Bacteria 1557
123 Ga0070678_100229716 3300005456 Bacteria 1546
124 Ga0070678_100284977 3300005456 Bacteria 1398
125 Ga0070678_100350956 3300005456 Bacteria 1268
126 Ga0070662_100025220 3300005457 Bacteria 4103
127 Ga0070662_100047086 3300005457 Bacteria 3100
128 Ga0070662_100065813 3300005457 Bacteria 2658
129 Ga0070662_100076490 3300005457 Bacteria 2481
130 Ga0068867_100000048 3300005459 Bacteria 73813
131 Ga0068867_100001383 3300005459 Bacteria 16772
132 Ga0068867_100002855 3300005459 Bacteria 12149
133 Ga0068867_100004608 3300005459 Bacteria 9701
134 Ga0068867_100007763 3300005459 Bacteria 7585
135 Ga0068867_100024081 3300005459 Bacteria 4362
136 Ga0068867_100068350 3300005459 Bacteria 2651
137 Ga0068867_100112679 3300005459 Bacteria 2092
138 Ga0068867_100190352 3300005459 Bacteria 1637
139 Ga0070685_10286535 3300005466 Bacteria 1105
140 Ga0070706_100002704 3300005467 Bacteria 17739
141 Ga0070699_100233632 3300005518 Bacteria 1640
142 Ga0070684_100004660 3300005535 Bacteria 10467
143 Ga0070684_100527755 3300005535 Bacteria 1094
144 Ga0068853_100037028 3300005539 Bacteria 4150
145 Ga0068853_100053921 3300005539 Bacteria 3464
146 Ga0068853_100118152 3300005539 Bacteria 2363
147 Ga0068853_100347362 3300005539 Bacteria 1379
148 Ga0070672_100016710 3300005543 Bacteria 5260
149 Ga0070672_100026178 3300005543 Bacteria 4336
150 Ga0070672_100051192 3300005543 Bacteria 3219
151 Ga0070672_100068603 3300005543 Bacteria 2813
152 Ga0070672_100100057 3300005543 Bacteria 2351
153 Ga0070672_100112023 3300005543 Bacteria 2225
154 Ga0070672_100158352 3300005543 Bacteria 1877
155 Ga0070672_100180274 3300005543 Bacteria 1760
156 Ga0070672_100183062 3300005543 Bacteria 1746
157 Ga0070672_100199760 3300005543 Bacteria 1672
158 Ga0070672_100369935 3300005543 Bacteria 1224
159 Ga0070693_100077521 3300005547 Bacteria 1972
160 Ga0070693_100161165 3300005547 Bacteria 1429
161 Ga0070665_100016102 3300005548 Bacteria 7503
162 Ga0070665_100200321 3300005548 Bacteria 1997
163 Ga0070665_100278976 3300005548 Bacteria 1673
164 Ga0070665_100426083 3300005548 Bacteria 1336
165 Ga0068855_100044323 3300005563 Bacteria 5264
166 Ga0070664_100001426 3300005564 Bacteria 19072
167 Ga0070664_100050396 3300005564 Bacteria 3523
168 Ga0070664_100078785 3300005564 Bacteria 2834
169 Ga0070664_100105483 3300005564 Bacteria 2455
170 Ga0070664_100120375 3300005564 Bacteria 2298
171 Ga0070664_100147680 3300005564 Bacteria 2074
172 Ga0070664_100163631 3300005564 Bacteria 1970
173 Ga0070664_100289543 3300005564 Bacteria 1478
174 Ga0068857_100119625 3300005577 Bacteria 2371
175 Ga0068857_100237252 3300005577 Bacteria 1669
176 Ga0068857_100438830 3300005577 Bacteria 1219
177 Ga0068854_100018851 3300005578 Bacteria 4639
178 Ga0068854_100019957 3300005578 Bacteria 4525
179 Ga0068854_100115693 3300005578 Bacteria 2029
180 Ga0068856_100008227 3300005614 Bacteria 10167
181 Ga0068856_100047733 3300005614 Bacteria 4219
182 Ga0068856_100055782 3300005614 Bacteria 3899
183 Ga0068856_100166397 3300005614 Bacteria 2216
184 Ga0068852_100045508 3300005616 Bacteria 3733
185 Ga0068852_100052239 3300005616 Bacteria 3512
186 Ga0068852_100063558 3300005616 Bacteria 3214
187 Ga0068852_100089038 3300005616 Bacteria 2758
188 Ga0068852_100113517 3300005616 Bacteria 2467
189 Ga0068852_100255769 3300005616 Bacteria 1679
190 Ga0068852_100270354 3300005616 Bacteria 1635
191 Ga0068859_100001157 3300005617 Bacteria 26939
192 Ga0068859_100166879 3300005617 Bacteria 2281
193 Ga0068864_100043931 3300005618 Bacteria 3827
194 Ga0068864_100120199 3300005618 Bacteria 2348
195 Ga0068864_100228811 3300005618 Bacteria 1719
196 Ga0068866_10016531 3300005718 Bacteria 3300
197 Ga0068866_10197080 3300005718 Bacteria 1201
198 Ga0068861_100013043 3300005719 Bacteria 5811
199 Ga0068861_100021750 3300005719 Bacteria 4612
200 Ga0068861_100038148 3300005719 Bacteria 3575
201 Ga0068851_10009512 3300005834 Bacteria 4522
202 Ga0068851_10023882 3300005834 Bacteria 2990
203 Ga0068851_10027772 3300005834 Bacteria 2791
204 Ga0068870_10016501 3300005840 Bacteria 3530
205 Ga0068870_10041145 3300005840 Bacteria 2400
206 Ga0068870_10199416 3300005840 Bacteria 1213
207 Ga0068863_100008961 3300005841 Bacteria 9770
208 Ga0068863_100036313 3300005841 Bacteria 4694
209 Ga0068863_100072562 3300005841 Bacteria 3257
210 Ga0068863_100216288 3300005841 Bacteria 1845
211 Ga0068858_100001292 3300005842 Bacteria 25859
212 Ga0068858_100024788 3300005842 Bacteria 5586
213 Ga0068858_100035096 3300005842 Bacteria 4651
214 Ga0068858_100062309 3300005842 Bacteria 3448
215 Ga0068858_100378133 3300005842 Bacteria 1359
216 Ga0068860_100001127 3300005843 Bacteria 29390
217 Ga0068860_100003662 3300005843 Bacteria 15820
218 Ga0068860_100089173 3300005843 Bacteria 2936
219 Ga0068860_100101804 3300005843 Bacteria 2740
220 Ga0068860_100313647 3300005843 Bacteria 1538
221 Ga0068862_100008423 3300005844 Bacteria 8534
222 Ga0068862_100028683 3300005844 Bacteria 4687
223 Ga0075365_10018586 3300006038 Bacteria 4276
224 Ga0075368_10025717 3300006042 Bacteria 2259
225 Ga0075363_100196934 3300006048 Bacteria 1150
226 Ga0075432_10008161 3300006058 Bacteria 3570
227 Ga0075362_10106075 3300006177 Bacteria 1318
228 Ga0075367_10137791 3300006178 Bacteria 1510
229 Ga0075367_10274220 3300006178 Bacteria 1060
230 Ga0075366_10000654 3300006195 Bacteria 16309
231 Ga0075366_10001569 3300006195 Bacteria 11425
232 Ga0075366_10003793 3300006195 Bacteria 8040
233 Ga0075366_10004637 3300006195 Bacteria 7387
234 Ga0075366_10035988 3300006195 Bacteria 2918
235 Ga0075366_10061848 3300006195 Bacteria 2226
236 Ga0075366_10067831 3300006195 Bacteria 2123
237 Ga0075366_10077136 3300006195 Bacteria 1989
238 Ga0075366_10168042 3300006195 Bacteria 1330
239 Ga0097621_100004797 3300006237 Bacteria 9464
240 Ga0097621_100010187 3300006237 Bacteria 6863
241 Ga0097621_100012909 3300006237 Bacteria 6208
242 Ga0097621_100092078 3300006237 Bacteria 2538
243 Ga0097621_100171084 3300006237 Bacteria 1872
244 Ga0097621_100227161 3300006237 Bacteria 1629
245 Ga0075370_10000414 3300006353 Bacteria 15762
246 Ga0075370_10009474 3300006353 Bacteria 5059
247 Ga0075370_10010350 3300006353 Bacteria 4874
248 Ga0068871_100008231 3300006358 Bacteria 7494
249 Ga0068871_100021423 3300006358 Bacteria 4967
250 Ga0068871_100022718 3300006358 Bacteria 4840
251 Ga0068871_100249243 3300006358 Bacteria 1546
252 Ga0068865_100049806 3300006881 Bacteria 2890
253 Ga0068865_100296794 3300006881 Bacteria 1292
254 Ga0097620_100001157 3300006931 Bacteria 26939
255 Ga0097620_100166881 3300006931 Bacteria 2281
256 Ga0079104_1000009 3300006946 Bacteria 367015
257 Ga0079104_1023974 3300006946 Bacteria 1614
258 Ga0105240_10007990 3300009093 Bacteria 15247
259 Ga0105240_10105835 3300009093 Bacteria 3414
260 Ga0105245_10018033 3300009098 Bacteria 6166
261 Ga0105245_10077730 3300009098 Bacteria 3026
262 Ga0105245_10187891 3300009098 Bacteria 1977
263 Ga0114129_10052547 3300009147 Bacteria 5719
264 Ga0105243_10002356 3300009148 Bacteria 15815
265 Ga0105243_10035260 3300009148 Bacteria 3878
266 Ga0105243_10047878 3300009148 Bacteria 3368
267 Ga0105243_10161102 3300009148 Bacteria 1934
268 Ga0105243_10232486 3300009148 Bacteria 1636
269 Ga0105243_10321976 3300009148 Bacteria 1409
270 Ga0105241_10152463 3300009174 Bacteria 1892
271 Ga0105241_10333168 3300009174 Bacteria 1312
272 Ga0105242_10077752 3300009176 Bacteria 2768
273 Ga0105248_10024871 3300009177 Bacteria 6656
274 Ga0105248_10107672 3300009177 Bacteria 3143
275 Ga0105248_10243677 3300009177 Bacteria 2023
276 Ga0105237_10003295 3300009545 Bacteria 19281
277 Ga0105237_10007089 3300009545 Bacteria 12323
278 Ga0105237_10034334 3300009545 Bacteria 5137
279 Ga0105238_10003365 3300009551 Bacteria 15955
280 Ga0105238_10020203 3300009551 Bacteria 6779
281 Ga0105238_10084345 3300009551 Bacteria 3167
282 Ga0105238_10114737 3300009551 Bacteria 2673
283 Ga0105249_10020909 3300009553 Bacteria 5852
284 Ga0105249_10021079 3300009553 Bacteria 5832
285 Ga0105249_10039647 3300009553 Bacteria 4277
286 Ga0105239_10003389 3300010375 Bacteria 19552
287 Ga0105246_10071672 3300011119 Bacteria 2440
288 Ga0105246_10341246 3300011119 Bacteria 1224
289 Ga0157371_10047043 3300013102 Bacteria 3066
290 Ga0157370_10290950 3300013104 Bacteria 1509
291 Ga0157369_10030192 3300013105 Bacteria 5979
292 Ga0157374_10027813 3300013296 Bacteria 5105
293 Ga0157374_10077836 3300013296 Bacteria 3140
294 Ga0157374_10189723 3300013296 Bacteria 2010
295 Ga0157378_10009787 3300013297 Bacteria 8356
296 Ga0157378_10092187 3300013297 Bacteria 2756
297 Ga0157378_10179808 3300013297 Bacteria 1989
298 Ga0157378_10397212 3300013297 Bacteria 1358
299 Ga0163162_10005175 3300013306 Bacteria 12577
300 Ga0163162_10039622 3300013306 Bacteria 4709
301 Ga0157372_10020531 3300013307 Bacteria 7127
302 Ga0157375_10009940 3300013308 Bacteria 8369
303 Ga0157375_10020576 3300013308 Bacteria 6031
304 Ga0157375_10025372 3300013308 Bacteria 5506
305 Ga0157375_10028162 3300013308 Bacteria 5261
306 Ga0157375_10036459 3300013308 Bacteria 4705
307 Ga0157375_10045990 3300013308 Bacteria 4252
308 Ga0157375_10076855 3300013308 Bacteria 3367
309 Ga0157375_10154757 3300013308 Bacteria 2431
310 Ga0163163_10002538 3300014325 Bacteria 15454
311 Ga0157380_10001789 3300014326 Bacteria 14180
312 Ga0157380_10047723 3300014326 Bacteria 3369
313 Ga0157380_10071376 3300014326 Bacteria 2809
314 Ga0157380_10071794 3300014326 Bacteria 2801
315 Ga0157380_10076095 3300014326 Bacteria 2730
316 Ga0157380_10409599 3300014326 Bacteria 1289
317 Ga0157377_10000056 3300014745 Bacteria 87608
318 Ga0157377_10072267 3300014745 Bacteria 1996
319 Ga0157379_10013243 3300014968 Bacteria 7223
320 Ga0157379_10020433 3300014968 Bacteria 5855
321 Ga0157379_10025235 3300014968 Bacteria 5278
322 Ga0157379_10130102 3300014968 Bacteria 2265
323 Ga0157379_10135880 3300014968 Bacteria 2215
324 Ga0157376_10014590 3300014969 Bacteria 5903
325 Ga0157376_10021252 3300014969 Bacteria 5040
326 Ga0157376_10051769 3300014969 Bacteria 3411
327 Ga0182006_1015134 3300015261 Bacteria 3311
328 Ga0182005_1000541 3300015265 Bacteria 19062
329 Ga0163161_10033652 3300017792 Bacteria 3662
330 Ga0163161_10113786 3300017792 Bacteria 2026
331 Ga0163161_10162904 3300017792 Bacteria 1701
332 Ga0163161_10343620 3300017792 Bacteria 1184
333 Ga0213876_10052025 3300021384 Bacteria 2165
334 Ga0209435_100001 3300025206 Bacteria 1424171
335 Ga0209435_100034 3300025206 Bacteria 144486
336 Ga0209435_100115 3300025206 Bacteria 30475
337 Ga0209784_100010 3300025224 Bacteria 683664
338 Ga0209566_100008 3300025225 Bacteria 683664
339 Ga0209674_100019 3300025226 Bacteria 683664
340 Ga0209563_100021 3300025230 Bacteria 683764
341 Ga0207427_100570 3300025231 Bacteria 18553
342 Ga0209437_100019 3300025233 Bacteria 683764
343 Ga0209258_100342 3300025242 Bacteria 68390
344 Ga0207425_1001772 3300025245 Bacteria 8404
345 Ga0209646_1000001 3300025246 Bacteria 3092932
346 Ga0209646_1000155 3300025246 Bacteria 95204
347 Ga0209026_1000003 3300025250 Bacteria 1060571
348 Ga0209026_1000769 3300025250 Bacteria 17972
349 Ga0209677_100011 3300025253 Bacteria 683664
350 Ga0209677_104403 3300025253 Bacteria 4079
351 Ga0209148_1004217 3300025254 Bacteria 3604
352 Ga0209759_1000001 3300025256 Bacteria 2799452
353 Ga0209759_1000375 3300025256 Bacteria 55963
354 Ga0209759_1004950 3300025256 Bacteria 4815
355 Ga0209759_1005146 3300025256 Bacteria 4661
356 Ga0209759_1014038 3300025256 Bacteria 2138
357 Ga0209129_1000062 3300025258 Bacteria 240655
358 Ga0209233_1000025 3300025261 Bacteria 683764
359 Ga0209565_1000124 3300025263 Bacteria 110789
360 Ga0209565_1000910 3300025263 Bacteria 15931
361 Ga0209565_1005822 3300025263 Bacteria 3537
362 Ga0209455_1000511 3300025272 Bacteria 27782
363 Ga0209673_1000043 3300025273 Bacteria 291503
364 Ga0209673_1010877 3300025273 Bacteria 3799
365 Ga0209673_1058334 3300025273 Bacteria 978
366 Ga0209130_1000060 3300025284 Bacteria 201501
367 Ga0209130_1000114 3300025284 Bacteria 130381
368 Ga0209675_1000269 3300025291 Bacteria 49713
369 Ga0209675_1009012 3300025291 Bacteria 3579
370 Ga0209676_1000007 3300025292 Bacteria 1029371
371 Ga0209025_1004701 3300025294 Bacteria 11654
372 Ga0209025_1007436 3300025294 Bacteria 8167
373 Ga0209025_1025947 3300025294 Bacteria 2961
374 Ga0209564_1000176 3300025295 Bacteria 152363
375 Ga0209564_1000268 3300025295 Bacteria 109101
376 Ga0209564_1002616 3300025295 Bacteria 13766
377 Ga0209564_1007511 3300025295 Bacteria 5616
378 Ga0209758_1000378 3300025297 Bacteria 77514
379 Ga0209758_1000517 3300025297 Bacteria 61999
380 Ga0209758_1025948 3300025297 Bacteria 2554
381 Ga0209050_1000003 3300025298 Bacteria 1609245
382 Ga0209050_1000118 3300025298 Bacteria 202586
383 Ga0209050_1000243 3300025298 Bacteria 117715
384 Ga0209050_1002216 3300025298 Bacteria 17437
385 Ga0209050_1002992 3300025298 Bacteria 13147
386 Ga0209050_1016204 3300025298 Bacteria 3067
387 Ga0209256_1000001 3300025299 Bacteria 2166974
388 Ga0209256_1000019 3300025299 Bacteria 558627
389 Ga0209256_1021803 3300025299 Bacteria 1956
390 Ga0207426_1000308 3300025302 Bacteria 96061
391 Ga0207426_1002574 3300025302 Bacteria 11305
392 Ga0209051_1000003 3300025303 Bacteria 1609245
393 Ga0209051_1000004 3300025303 Bacteria 1155596
394 Ga0209051_1000853 3300025303 Bacteria 31106
395 Ga0209051_1044684 3300025303 Bacteria 1541
396 Ga0209257_1000020 3300025304 Bacteria 773356
397 Ga0209257_1000022 3300025304 Bacteria 765258
398 Ga0209257_1000038 3300025304 Bacteria 609032
399 Ga0209257_1000044 3300025304 Bacteria 486709
400 Ga0209257_1024509 3300025304 Bacteria 2087
401 Ga0209257_1035649 3300025304 Bacteria 1537
402 Ga0207697_10007005 3300025315 Bacteria 5053
403 Ga0207697_10093659 3300025315 Bacteria 1275
404 Ga0207697_10098244 3300025315 Bacteria 1246
405 Ga0207682_10000706 3300025893 Bacteria 15485
406 Ga0207682_10007480 3300025893 Bacteria 4349
407 Ga0207682_10009359 3300025893 Bacteria 3868
408 Ga0207682_10012804 3300025893 Bacteria 3272
409 Ga0207642_10098719 3300025899 Bacteria 1461
410 Ga0207688_10200887 3300025901 Bacteria 1195
411 Ga0207680_10005283 3300025903 Bacteria 6164
412 Ga0207680_10026030 3300025903 Bacteria 3236
413 Ga0207680_10080108 3300025903 Bacteria 2050
414 Ga0207680_10085564 3300025903 Bacteria 1992
415 Ga0207645_10000932 3300025907 Bacteria 24250
416 Ga0207645_10016574 3300025907 Bacteria 4875
417 Ga0207645_10032773 3300025907 Bacteria 3340
418 Ga0207645_10075710 3300025907 Bacteria 2154
419 Ga0207645_10114838 3300025907 Bacteria 1745
420 Ga0207643_10044753 3300025908 Bacteria 2499
421 Ga0207705_10191138 3300025909 Bacteria 1548
422 Ga0207684_10006839 3300025910 Bacteria 10329
423 Ga0207654_10184247 3300025911 Bacteria 1364
424 Ga0207695_10099229 3300025913 Bacteria 2910
425 Ga0207695_10318048 3300025913 Bacteria 1446
426 Ga0207671_10002336 3300025914 Bacteria 20461
427 Ga0207671_10005664 3300025914 Bacteria 11427
428 Ga0207671_10050729 3300025914 Bacteria 3073
429 Ga0207662_10093519 3300025918 Bacteria 1852
430 Ga0207657_10009129 3300025919 Bacteria 10006
431 Ga0207657_10045289 3300025919 Bacteria 3863
432 Ga0207649_10000751 3300025920 Bacteria 21186
433 Ga0207649_10287549 3300025920 Bacteria 1197
434 Ga0207681_10005730 3300025923 Bacteria 7618
435 Ga0207681_10069573 3300025923 Bacteria 2448
436 Ga0207681_10070963 3300025923 Bacteria 2428
437 Ga0207681_10098776 3300025923 Bacteria 2101
438 Ga0207681_10321395 3300025923 Bacteria 1231
439 Ga0207694_10072469 3300025924 Bacteria 2693
440 Ga0207650_10002868 3300025925 Bacteria 11906
441 Ga0207650_10054584 3300025925 Bacteria 2964
442 Ga0207650_10073437 3300025925 Bacteria 2576
443 Ga0207650_10173189 3300025925 Bacteria 1716
444 Ga0207650_10210795 3300025925 Bacteria 1560
445 Ga0207650_10300768 3300025925 Bacteria 1310
446 Ga0207659_10001257 3300025926 Bacteria 15167
447 Ga0207659_10013518 3300025926 Bacteria 5232
448 Ga0207659_10015146 3300025926 Bacteria 4989
449 Ga0207659_10028703 3300025926 Bacteria 3783
450 Ga0207659_10036528 3300025926 Bacteria 3404
451 Ga0207659_10044324 3300025926 Bacteria 3129
452 Ga0207659_10142958 3300025926 Bacteria 1859
453 Ga0207687_10102244 3300025927 Bacteria 2111
454 Ga0207644_10000042 3300025931 Bacteria 112685
455 Ga0207644_10006910 3300025931 Bacteria 7392
456 Ga0207644_10007260 3300025931 Bacteria 7212
457 Ga0207644_10088580 3300025931 Bacteria 2302
458 Ga0207644_10153838 3300025931 Bacteria 1782
459 Ga0207644_10358606 3300025931 Bacteria 1185
460 Ga0207690_10000481 3300025932 Bacteria 25729
461 Ga0207690_10018234 3300025932 Bacteria 4303
462 Ga0207690_10170216 3300025932 Bacteria 1631
463 Ga0207706_10017151 3300025933 Bacteria 6530
464 Ga0207706_10020343 3300025933 Bacteria 5965
465 Ga0207706_10066467 3300025933 Bacteria 3173
466 Ga0207706_10067288 3300025933 Bacteria 3152
467 Ga0207706_10099056 3300025933 Bacteria 2564
468 Ga0207706_10201758 3300025933 Bacteria 1744
469 Ga0207709_10002673 3300025935 Bacteria 11055
470 Ga0207709_10115691 3300025935 Bacteria 1802
471 Ga0207709_10119377 3300025935 Bacteria 1778
472 Ga0207669_10013145 3300025937 Bacteria 4100
473 Ga0207669_10133926 3300025937 Bacteria 1708
474 Ga0207669_10370037 3300025937 Bacteria 1113
475 Ga0207704_10195320 3300025938 Bacteria 1476
476 Ga0207691_10000318 3300025940 Bacteria 47853
477 Ga0207691_10017977 3300025940 Bacteria 6696
478 Ga0207691_10027795 3300025940 Bacteria 5301
479 Ga0207691_10036077 3300025940 Bacteria 4582
480 Ga0207691_10037444 3300025940 Bacteria 4492
481 Ga0207691_10045199 3300025940 Bacteria 4049
482 Ga0207691_10047603 3300025940 Bacteria 3934
483 Ga0207691_10074299 3300025940 Bacteria 3066
484 Ga0207691_10084554 3300025940 Bacteria 2848
485 Ga0207711_10004017 3300025941 Bacteria 12629
486 Ga0207711_10010123 3300025941 Bacteria 7835
487 Ga0207711_10014423 3300025941 Bacteria 6563
488 Ga0207711_10101817 3300025941 Bacteria 2542
489 Ga0207689_10013142 3300025942 Bacteria 7065
490 Ga0207689_10058064 3300025942 Bacteria 3182
491 Ga0207689_10060170 3300025942 Bacteria 3123
492 Ga0207661_10037817 3300025944 Bacteria 3777
493 Ga0207679_10000501 3300025945 Bacteria 26940
494 Ga0207679_10046009 3300025945 Bacteria 3160
495 Ga0207679_10072585 3300025945 Bacteria 2600
496 Ga0207679_10335360 3300025945 Bacteria 1314
497 Ga0207679_10444667 3300025945 Bacteria 1148
498 Ga0207667_10046590 3300025949 Bacteria 4591
499 Ga0207667_10497322 3300025949 Bacteria 1237
500 Ga0207651_10000364 3300025960 Bacteria 19183
501 Ga0207651_10006026 3300025960 Bacteria 6292
502 Ga0207651_10041858 3300025960 Bacteria 3044
503 Ga0207651_10046578 3300025960 Bacteria 2917
504 Ga0207651_10054979 3300025960 Bacteria 2731
505 Ga0207712_10041521 3300025961 Bacteria 3162
506 Ga0207712_10194330 3300025961 Bacteria 1604
507 Ga0207668_10012084 3300025972 Bacteria 5273
508 Ga0207668_10012507 3300025972 Bacteria 5197
509 Ga0207640_10013763 3300025981 Bacteria 4645
510 Ga0207658_10002924 3300025986 Bacteria 12231
511 Ga0207658_10004551 3300025986 Bacteria 9620
512 Ga0207658_10005021 3300025986 Bacteria 9118
513 Ga0207658_10072003 3300025986 Bacteria 2619
514 Ga0207658_10077603 3300025986 Bacteria 2535
515 Ga0207658_10288563 3300025986 Bacteria 1409
516 Ga0207677_10013173 3300026023 Bacteria 4782
517 Ga0207677_10083998 3300026023 Bacteria 2294
518 Ga0207677_10084366 3300026023 Bacteria 2290
519 Ga0207677_10133083 3300026023 Bacteria 1891
520 Ga0207677_10593200 3300026023 Bacteria 971
521 Ga0207703_10001647 3300026035 Bacteria 20096
522 Ga0207703_10010862 3300026035 Bacteria 7100
523 Ga0207703_10081473 3300026035 Bacteria 2698
524 Ga0207703_10352718 3300026035 Bacteria 1355
525 Ga0207639_10046131 3300026041 Bacteria 3286
526 Ga0207639_10071881 3300026041 Bacteria 2708
527 Ga0207639_10151636 3300026041 Bacteria 1942
528 Ga0207678_10013097 3300026067 Bacteria 7275
529 Ga0207678_10303781 3300026067 Bacteria 1371
530 Ga0207708_10022289 3300026075 Bacteria 4782
531 Ga0207702_10002308 3300026078 Bacteria 18242
532 Ga0207702_10116578 3300026078 Bacteria 2383
533 Ga0207702_10198726 3300026078 Bacteria 1857
534 Ga0207641_10005423 3300026088 Bacteria 10888
535 Ga0207641_10007604 3300026088 Bacteria 9011
536 Ga0207641_10012523 3300026088 Bacteria 6952
537 Ga0207641_10031474 3300026088 Bacteria 4401
538 Ga0207641_10162836 3300026088 Bacteria 2029
539 Ga0207641_10170410 3300026088 Bacteria 1986
540 Ga0207648_10000492 3300026089 Bacteria 44104
541 Ga0207648_10002026 3300026089 Bacteria 22125
542 Ga0207648_10006568 3300026089 Bacteria 11552
543 Ga0207648_10020730 3300026089 Bacteria 5917
544 Ga0207648_10041853 3300026089 Bacteria 4023
545 Ga0207648_10043392 3300026089 Bacteria 3947
546 Ga0207648_10080809 3300026089 Bacteria 2836
547 Ga0207648_10177524 3300026089 Bacteria 1884
548 Ga0207676_10001498 3300026095 Bacteria 17239
549 Ga0207676_10017299 3300026095 Bacteria 5226
550 Ga0207676_10021790 3300026095 Bacteria 4705
551 Ga0207676_10227678 3300026095 Bacteria 1664
552 Ga0207674_10049675 3300026116 Bacteria 4288
553 Ga0207674_10063382 3300026116 Bacteria 3731
554 Ga0207674_10106917 3300026116 Bacteria 2775
555 Ga0207674_10384556 3300026116 Bacteria 1357
556 Ga0207675_100008838 3300026118 Bacteria 9453
557 Ga0207675_100011212 3300026118 Bacteria 8394
558 Ga0207675_100074019 3300026118 Bacteria 3187
559 Ga0207675_100404798 3300026118 Bacteria 1345
560 Ga0207683_10010653 3300026121 Bacteria 7837
561 Ga0207683_10016734 3300026121 Bacteria 6241
562 Ga0207683_10033147 3300026121 Bacteria 4486
563 Ga0207683_10038389 3300026121 Bacteria 4174
564 Ga0207683_10049633 3300026121 Bacteria 3675
565 Ga0207683_10050334 3300026121 Bacteria 3649
566 Ga0207683_10058883 3300026121 Bacteria 3373
567 Ga0207683_10111670 3300026121 Bacteria 2448
568 Ga0207683_10299106 3300026121 Bacteria 1472
569 Ga0207698_10025392 3300026142 Bacteria 4174
570 Ga0207698_10028570 3300026142 Bacteria 3979
571 Ga0207698_10073233 3300026142 Bacteria 2727
572 Ga0207698_10073649 3300026142 Bacteria 2720
573 Ga0207698_10074629 3300026142 Bacteria 2706
574 Ga0207698_10142792 3300026142 Bacteria 2065
575 Ga0207698_10230582 3300026142 Bacteria 1681
576 Ga0209281_1000023 3300027111 Bacteria 519955
577 Ga0209974_10013298 3300027876 Bacteria 2742
578 Ga0207428_10215834 3300027907 Bacteria 1440
579 Ga0268266_10092747 3300028379 Bacteria 2650
580 Ga0268265_10045405 3300028380 Bacteria 3278
581 Ga0268265_10054590 3300028380 Bacteria 3033
582 Ga0268265_10068611 3300028380 Bacteria 2750
583 Ga0268264_10001710 3300028381 Bacteria 20233
584 Ga0268264_10018493 3300028381 Bacteria 5699
585 Ga0268264_10105160 3300028381 Bacteria 2462
586 Ga0268264_10305606 3300028381 Bacteria 1499
587 Ga0268264_10726154 3300028381 Bacteria 988
588 Ga0307517_10000228 3300028786 Bacteria 94852
589 Ga0307517_10053504 3300028786 Bacteria 4018
590 Ga0307517_10205333 3300028786 Bacteria 1224
591 Ga0307515_10000458 3300028794 Bacteria 97523
592 Ga0307515_10004357 3300028794 Bacteria 29345
593 Ga0307515_10020859 3300028794 Bacteria 11649
594 Ga0307515_10036443 3300028794 Bacteria 7956
595 Ga0307515_10038277 3300028794 Bacteria 7679
596 Ga0307515_10397660 3300028794 Bacteria 1004
597 Ga0307512_10059122 3300030522 Bacteria 2978
598 Ga0307512_10121533 3300030522 Bacteria 1675
599 Ga0307512_10170525 3300030522 Bacteria 1249
600 Ga0316181_1181538 3300030744 Bacteria 1482
601 Ga0307513_10000006 3300031456 Bacteria 470848
602 Ga0307513_10000094 3300031456 Bacteria 127685
603 Ga0307513_10001393 3300031456 Bacteria 34808
604 Ga0307513_10006563 3300031456 Bacteria 15193
605 Ga0307513_10030687 3300031456 Bacteria 6102
606 Ga0307513_10032666 3300031456 Bacteria 5865
607 Ga0307513_10135388 3300031456 Bacteria 2400
608 Ga0307509_10000426 3300031507 Bacteria 70899
609 Ga0307408_100000288 3300031548 Bacteria 49765
610 Ga0307408_100016115 3300031548 Bacteria 4984
611 Ga0307408_100088275 3300031548 Bacteria 2335
612 Ga0307408_100140129 3300031548 Bacteria 1897
613 Ga0307508_10000040 3300031616 Bacteria 149333
614 Ga0307508_10003969 3300031616 Bacteria 14667
615 Ga0307514_10011867 3300031649 Bacteria 7248
616 Ga0307514_10014681 3300031649 Bacteria 6479
617 Ga0307514_10070063 3300031649 Bacteria 2635
618 Ga0307516_10000460 3300031730 Bacteria 53821
619 Ga0307516_10001446 3300031730 Bacteria 32808
620 Ga0307516_10012998 3300031730 Bacteria 8919
621 Ga0307516_10020589 3300031730 Bacteria 6812
622 Ga0307516_10022952 3300031730 Bacteria 6403
623 Ga0307516_10161191 3300031730 Bacteria 1992
624 Ga0307516_10237526 3300031730 Bacteria 1523
625 Ga0307516_10353488 3300031730 Bacteria 1135
626 Ga0307405_10290392 3300031731 Bacteria 1235
627 Ga0307413_10040120 3300031824 Bacteria 2729
628 Ga0307413_10314011 3300031824 Bacteria 1194
629 Ga0307406_10001222 3300031901 Bacteria 14379
630 Ga0307406_10006272 3300031901 Bacteria 6553
631 Ga0307406_10022081 3300031901 Bacteria 3773
632 Ga0307412_10034844 3300031911 Bacteria 3211
633 Ga0307412_10123600 3300031911 Bacteria 1867
634 Ga0307409_100012808 3300031995 Bacteria 5362
635 Ga0307409_100306137 3300031995 Bacteria 1481
636 Ga0307416_100009118 3300032002 Bacteria 6466
637 Ga0307416_100020199 3300032002 Bacteria 4746
638 Ga0307416_100127951 3300032002 Bacteria 2279
639 Ga0307414_10209979 3300032004 Bacteria 1590
640 Ga0307411_10239000 3300032005 Bacteria 1421
641 Ga0307411_10395953 3300032005 Bacteria 1140
642 Ga0307415_100000538 3300032126 Bacteria 16532
643 Ga0307510_10000109 3300033180 Bacteria 65353
644 Ga0307510_10167982 3300033180 Bacteria 1778
645 Ga0307510_10251031 3300033180 Bacteria 1257
646 Ga0373930_0056600 3300034816 Bacteria 867
647 Ga0373943_0041563 3300035170 Bacteria 2224
648 Ga0373931_0000491 3300035691 Bacteria 16121
649 Ga0373931_0011931 3300035691 Bacteria 4204
650 Ga0373935_0200366 3300035692 Bacteria 1379
651 Ga0373937_0206953 3300036401 Bacteria 1845
652 Ga0373925_0023538 3300037068 Bacteria 4494
653 Ga0373925_0061260 3300037068 Bacteria 2826
654 Ga0395899_0016249 3300037312 Bacteria 5673
655 Ga0395900_0004795 3300037418 Bacteria 14248
656 Ga0395898_0008778 3300037466 Bacteria 10652
657 Ga0395898_0396716 3300037466 Bacteria 1315
658 Ga0395905_0010964 3300037471 Bacteria 8772
659 Ga0395905_0031340 3300037471 Bacteria 5005
660 Ga0395905_0122445 3300037471 Bacteria 2445
661 Ga0395905_0261614 3300037471 Bacteria 1615
662 Ga0395901_0320256 3300038443 Bacteria 1604
663 Ga0436365_1021472 3300039437 Bacteria 4110
664 Ga0436363_0446142 3300039450 Bacteria 1817
665 Ga0439436_0062788 3300041404 Bacteria 1038
666 Ga0451793_0083691 3300041452 Bacteria 1235
667 Ga0451793_1251237 3300041452 Bacteria 1350
668 Ga0451795_0141978 3300041456 Bacteria 2099
669 Ga0451802_1322629 3300041460 Bacteria 1046
670 Ga0451804_0097481 3300041463 Bacteria 1968
671 Ga0451845_0950226 3300041501 Bacteria 1661
672 Ga0451853_0207789 3300041512 Bacteria 1180
673 Ga0451853_2068177 3300041512 Bacteria 3154
674 Ga0439449_0029115 3300042007 Bacteria 2058
675 Ga0450906_002330 3300042145 Bacteria 4161
676 Ga0450909_009266 3300042185 Bacteria 1437
677 Ga0439464_0019340 3300042439 Bacteria 1859
678 Ga0450918_000096 3300042531 Bacteria 18894
679 Ga0451577_0106204 3300042876 Bacteria 2510
680 Ga0451577_0125429 3300042876 Bacteria 2301
681 Ga0451577_0137658 3300042876 Bacteria 2193
682 Ga0466969_0016680 3300044656 Bacteria 3841
683 Ga0466965_0005472 3300044683 Bacteria 5726
684 Ga0466965_0007760 3300044683 Bacteria 4939
685 Ga0466966_0002799 3300044684 Bacteria 11467
686 Ga0466961_0054732 3300044693 Bacteria 2544
687 Ga0466961_0064566 3300044693 Bacteria 2326
688 Ga0466961_0090729 3300044693 Bacteria 1929
689 Ga0466963_0004270 3300044694 Bacteria 8290
690 Ga0466963_0049304 3300044694 Bacteria 2785
691 Ga0466964_0007355 3300044706 Bacteria 4117
692 Ga0453684_0030595 3300044712 Bacteria 7600
693 Ga0466971_0007914 3300044719 Bacteria 4629
694 Ga0466971_0008150 3300044719 Bacteria 4568
695 Ga0466971_0011994 3300044719 Bacteria 3796
696 Ga0466968_0009338 3300044735 Bacteria 3771
697 Ga0466968_0064515 3300044735 Bacteria 1584
698 Ga0466957_0004305 3300044842 Bacteria 7901
699 Ga0466957_0023494 3300044842 Bacteria 3644
700 Ga0466959_0004285 3300045049 Bacteria 9516
701 Ga0466959_0233439 3300045049 Bacteria 1272
702 Ga0451576_0006080 3300045051 Bacteria 14882
703 Ga0451576_0015848 3300045051 Bacteria 8336
704 Ga0451576_0738451 3300045051 Bacteria 1034
705 Ga0466958_0006879 3300045836 Bacteria 6218
706 Ga0466967_0047961 3300045976 Bacteria 3727
707 Ga0466967_0564764 3300045976 Bacteria 1121
708 Ga0495590_0001358 3300046457 Bacteria 10646
709 Ga0495590_0003934 3300046457 Bacteria 6041
710 Ga0495638_0067412 3300046460 Bacteria 2198
711 Ga0495651_0217798 3300046462 Bacteria 1323
712 Ga0495653_0052358 3300046463 Bacteria 3128
713 Ga0495639_0004493 3300046475 Bacteria 5981
714 Ga0495606_0213550 3300046507 Bacteria 1091
715 Ga0495608_0009282 3300046511 Bacteria 6877
716 Ga0495610_0025940 3300046512 Bacteria 3136
717 Ga0495610_0032346 3300046512 Bacteria 2718
718 Ga0495618_0131615 3300046514 Bacteria 1600
719 Ga0495620_0047397 3300046515 Bacteria 1850
720 Ga0495620_0055463 3300046515 Bacteria 1670
721 Ga0495628_0033268 3300046516 Bacteria 4156
722 Ga0495632_0012595 3300046519 Bacteria 4871
723 Ga0495632_0015796 3300046519 Bacteria 4220
724 Ga0495643_0024642 3300046522 Bacteria 3411
725 Ga0495654_0006531 3300046530 Bacteria 6611
726 Ga0495586_0222037 3300046535 Bacteria 1074
727 Ga0495598_0038421 3300046537 Bacteria 1386
728 Ga0495621_0014745 3300046539 Bacteria 2480
729 Ga0495645_0058781 3300046543 Bacteria 2789
730 Ga0495622_0030748 3300046557 Bacteria 2510
731 Ga0495668_0025704 3300046616 Bacteria 3344
732 Ga0495625_0008288 3300046660 Bacteria 8882
733 Ga0495625_0044809 3300046660 Bacteria 3201
734 Ga0495625_0058675 3300046660 Bacteria 2734
735 Ga0495625_0060922 3300046660 Bacteria 2672
736 Ga0495635_0015601 3300046663 Bacteria 5309
737 Ga0495599_0007092 3300046678 Bacteria 6784
738 Ga0495623_0113673 3300046679 Bacteria 1638
739 Ga0495646_0020960 3300046680 Bacteria 4133
740 Ga0495647_0034445 3300046681 Bacteria 1896
741 Ga0495658_0061800 3300046683 Bacteria 2152
742 Ga0495671_0048442 3300046692 Bacteria 2120
743 Ga0495671_0061709 3300046692 Bacteria 1849
744 Ga0495649_0007205 3300046694 Bacteria 6820
745 Ga0495600_0006804 3300046809 Bacteria 6971
746 Ga0495660_0004975 3300046810 Bacteria 7999
747 Ga0495660_0085796 3300046810 Bacteria 1644
748 Ga0495604_0082818 3300047317 Bacteria 2398
749 Ga0495687_000330 3300047443 Bacteria 60838
750 Ga0495687_010702 3300047443 Bacteria 5005
751 Ga0495687_010712 3300047443 Bacteria 5002
752 Ga0495686_0001339 3300047472 Bacteria 27571
753 Ga0495593_0115921 3300047673 Bacteria 1365
754 Ga0495626_0029363 3300048091 Bacteria 2662
755 Ga0496100_0056009 3300048903 Bacteria 2578
756 Ga0496101_0276550 3300048904 Bacteria 1312
757 Ga0496102_0013220 3300048905 Bacteria 7144
758 Ga0496102_0314520 3300048905 Bacteria 1475
759 Ga0496103_0095754 3300048906 Bacteria 1876
760 Ga0496104_0009568 3300048907 Bacteria 8628
761 Ga0496105_0024505 3300048908 Bacteria 4903
762 Ga0496106_0002439 3300048909 Bacteria 13854
763 Ga0496106_0095037 3300048909 Bacteria 2305
764 Ga0496108_0029986 3300048911 Bacteria 4508
765 Ga0496114_0001104 3300048917 Bacteria 20372
766 Ga0496114_0086473 3300048917 Bacteria 2657
767 Ga0496121_0019081 3300048924 Bacteria 6878
768 Ga0496121_0260646 3300048924 Bacteria 1197
769 Ga0501298_003130 3300049521 Bacteria 2552
770 Ga0501038_0055025 3300049574 Bacteria 3420
771 Ga0501042_0420896 3300049578 Bacteria 968
772 Ga0501043_0000075 3300049579 Bacteria 86156
773 Ga0501046_0000195 3300049580 Bacteria 62300
774 Ga0501047_0000145 3300049581 Bacteria 86319
775 Ga0501048_0003268 3300049582 Bacteria 12345
776 Ga0501252_001117 3300049682 Bacteria 2384
777 Ga0501262_000604 3300049759 Bacteria 4231
778 Ga0501265_000800 3300049762 Bacteria 3462
779 Ga0501035_0014603 3300049822 Bacteria 7249
780 Ga0501044_0016149 3300049823 Bacteria 8025
781 Ga0501044_0126233 3300049823 Bacteria 2556
782 Ga0501045_0000705 3300049824 Bacteria 21244
783 nmdc:mga03683_142028_c1 3300050489 Bacteria 1080
784 nmdc:mga03683_89997_c1 3300050489 Bacteria 1337
785 nmdc:mga03n38_55236_c1 3300050490 Bacteria 1788
786 nmdc:mga00v17_184574_c1 3300050491 Bacteria 1346
787 nmdc:mga0k408_1110_c1 3300050493 Bacteria 14744
788 nmdc:mga0k408_1324_c1 3300050493 Bacteria 13382
789 nmdc:mga0k408_133098_c1 3300050493 Bacteria 1476
790 nmdc:mga0k408_153219_c1 3300050493 Bacteria 996
791 nmdc:mga0k408_20845_c1 3300050493 Bacteria 3678
792 nmdc:mga0k408_231687_c1 3300050493 Bacteria 1102
793 nmdc:mga0k408_260504_c1 3300050493 Bacteria 1035
794 nmdc:mga0k408_2870_c2 3300050493 Bacteria 2153
795 nmdc:mga0k408_3826_c1 3300050493 Bacteria 7982
796 nmdc:mga0k408_41858_c1 3300050493 Bacteria 2638
797 nmdc:mga0k408_4731_c1 3300050493 Bacteria 7210
798 nmdc:mga0k408_54342_c1 3300050493 Bacteria 2321
799 nmdc:mga0k408_8116_c1 3300050493 Bacteria 5627
800 nmdc:mga0k408_96600_c1 3300050493 Bacteria 1739
801 nmdc:mga0k408_9794_c1 3300050493 Bacteria 5174
802 nmdc:mga06z11_37018_c1 3300050494 Bacteria 2414
803 nmdc:mga07m45_122534_c1 3300050496 Bacteria 1502
804 nmdc:mga07m45_12663_c1 3300050496 Bacteria 4462
805 nmdc:mga07m45_1430_c1 3300050496 Bacteria 10947
806 nmdc:mga07m45_46844_c1 3300050496 Bacteria 2430
807 nmdc:mga07m45_630_c1 3300050496 Bacteria 14978
808 nmdc:mga07m45_93107_c1 3300050496 Bacteria 1728
809 nmdc:mga08y16_380860_c1 3300050511 Bacteria 1446
810 nmdc:mga0a205_389312_c1 3300050515 Bacteria 1258
811 Ga0495601_0120521 3300053077 Bacteria 1703
812 Ga0500578_0003366 3300053086 Bacteria 12051
813 Ga0500578_0044897 3300053086 Bacteria 2836
814 Ga0500578_0057270 3300053086 Bacteria 2492
815 Ga0500644_0026585 3300053088 Bacteria 1792
816 Ga0500583_0071088 3300053092 Bacteria 1664
817 Ga0500651_0007902 3300053093 Bacteria 6222
818 Ga0500651_0017641 3300053093 Bacteria 4409
819 Ga0500641_0098199 3300053096 Bacteria 1255
820 Ga0500562_006072 3300053108 Bacteria 3041
821 Ga0500592_010134 3300053116 Bacteria 1501
822 Ga0500593_003969 3300053117 Bacteria 5672
823 Ga0500594_0002948 3300053118 Bacteria 3718
824 Ga0500594_0066153 3300053118 Bacteria 1053
825 Ga0500628_013444 3300053129 Bacteria 1528
826 Ga0500642_0094420 3300053130 Bacteria 1385
827 Ga0500652_000521 3300053131 Bacteria 13564
828 Ga0500559_0001509 3300053136 Bacteria 13100
829 Ga0500568_0015935 3300053139 Bacteria 3353
830 Ga0500574_000842 3300053141 Bacteria 4171
831 Ga0500604_0051911 3300053151 Bacteria 1267
832 Ga0500616_0050109 3300053153 Bacteria 2206
833 Ga0500622_0001293 3300053156 Bacteria 20363
834 Ga0500570_087793 3300053724 Bacteria 1369
835 Ga0500645_001182 3300053730 Bacteria 13909
836 Ga0500645_002947 3300053730 Bacteria 7230
837 Ga0500645_012277 3300053730 Bacteria 2770
838 Ga0500645_014969 3300053730 Bacteria 2464
839 Ga0500587_000635 3300053739 Bacteria 4434
840 Ga0500587_007104 3300053739 Bacteria 1466
841 Ga0466962_0012516 3300061719 Bacteria 4078

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10093519 Ga0207662_100935192 232
2 3300005328 Ga0070676_10006595 Ga0070676_100065952 245
3 3300005330 Ga0070690_100022429 Ga0070690_1000224292 245
4 3300005333 Ga0070677_10006747 Ga0070677_100067474 245
5 3300005334 Ga0068869_100009960 Ga0068869_1000099602 245
6 3300005335 Ga0070666_10001342 Ga0070666_100013422 245
7 3300005338 Ga0068868_100141609 Ga0068868_1001416092 245
8 3300005343 Ga0070687_100026010 Ga0070687_1000260102 245
9 3300005347 Ga0070668_100063241 Ga0070668_1000632412 245
10 3300005353 Ga0070669_100008965 Ga0070669_1000089653 245
11 3300005354 Ga0070675_100219449 Ga0070675_1002194492 245
12 3300005356 Ga0070674_100014454 Ga0070674_1000144544 245
13 3300005367 Ga0070667_100017549 Ga0070667_1000175492 245
14 3300005438 Ga0070701_10067747 Ga0070701_100677472 245
15 3300005441 Ga0070700_100322159 Ga0070700_1003221591 245
16 3300005456 Ga0070678_100038573 Ga0070678_1000385734 245
17 3300005457 Ga0070662_100025220 Ga0070662_1000252203 245
18 3300005459 Ga0068867_100002855 Ga0068867_10000285513 245
19 3300005543 Ga0070672_100016710 Ga0070672_1000167106 245
20 3300005616 Ga0068852_100063558 Ga0068852_1000635582 245
21 3300005617 Ga0068859_100166879 Ga0068859_1001668792 245
22 3300005618 Ga0068864_100120199 Ga0068864_1001201992 245
23 3300005718 Ga0068866_10016531 Ga0068866_100165312 245
24 3300005719 Ga0068861_100013043 Ga0068861_1000130432 245
25 3300005841 Ga0068863_100036313 Ga0068863_1000363134 245
26 3300005842 Ga0068858_100024788 Ga0068858_1000247886 245
27 3300005843 Ga0068860_100001127 Ga0068860_1000011274 245
28 3300006931 Ga0097620_100166881 Ga0097620_1001668812 245
29 3300009148 Ga0105243_10161102 Ga0105243_101611022 245
30 3300009553 Ga0105249_10021079 Ga0105249_100210792 245
31 3300013297 Ga0157378_10179808 Ga0157378_101798082 245
32 3300013306 Ga0163162_10039622 Ga0163162_100396224 245
33 3300013308 Ga0157375_10025372 Ga0157375_100253726 245
34 3300014326 Ga0157380_10001789 Ga0157380_1000178914 245
35 3300014968 Ga0157379_10020433 Ga0157379_100204336 245
36 3300017792 Ga0163161_10033652 Ga0163161_100336523 245
37 3300025315 Ga0207697_10093659 Ga0207697_100936592 245
38 3300025893 Ga0207682_10012804 Ga0207682_100128042 245
39 3300025903 Ga0207680_10026030 Ga0207680_100260302 245
40 3300025907 Ga0207645_10000932 Ga0207645_1000093222 245
41 3300025923 Ga0207681_10005730 Ga0207681_100057303 245
42 3300025926 Ga0207659_10036528 Ga0207659_100365282 245
43 3300025933 Ga0207706_10099056 Ga0207706_100990562 245
44 3300025937 Ga0207669_10013145 Ga0207669_100131453 245
45 3300025940 Ga0207691_10036077 Ga0207691_100360776 245
46 3300025942 Ga0207689_10013142 Ga0207689_100131422 245
47 3300025961 Ga0207712_10194330 Ga0207712_101943302 245
48 3300025972 Ga0207668_10012507 Ga0207668_100125075 245
49 3300025986 Ga0207658_10005021 Ga0207658_100050218 245
50 3300026023 Ga0207677_10013173 Ga0207677_100131732 245
51 3300026035 Ga0207703_10010862 Ga0207703_100108625 245
52 3300026075 Ga0207708_10022289 Ga0207708_100222895 245
53 3300026088 Ga0207641_10005423 Ga0207641_100054235 245
54 3300026089 Ga0207648_10080809 Ga0207648_100808092 245
55 3300026095 Ga0207676_10227678 Ga0207676_102276782 245
56 3300026118 Ga0207675_100011212 Ga0207675_1000112125 245
57 3300026121 Ga0207683_10038389 Ga0207683_100383895 245
58 3300026142 Ga0207698_10073649 Ga0207698_100736492 245
59 3300028381 Ga0268264_10001710 Ga0268264_100017102 245
60 3300050511 nmdc:mga08y16_380860_c1 nmdc:mga08y16_380860_c1_359_1240 245
61 3300005548 Ga0070665_100016102 Ga0070665_1000161024 253
62 3300042876 Ga0451577_0106204 Ga0451577_0106204_449_1285 254
63 3300002737 JGI25162J39368_1000414 JGI25162J39368_100041428 255
64 3300003214 JGI25165J46597_1000135 JGI25165J46597_10001352 255
65 3300003751 Ga0055538_1000055 Ga0055538_10000552 255
66 3300003752 Ga0055539_1000080 Ga0055539_1000080102 255
67 3300003756 Ga0055533_1000086 Ga0055533_1000086102 255
68 3300003759 Ga0055525_1000114 Ga0055525_10001142 255
69 3300003841 Ga0055541_1000057 Ga0055541_1000057102 255
70 3300025224 Ga0209784_100010 Ga0209784_100010169 255
71 3300025225 Ga0209566_100008 Ga0209566_100008169 255
72 3300025226 Ga0209674_100019 Ga0209674_100019169 255
73 3300025230 Ga0209563_100021 Ga0209563_100021169 255
74 3300025231 Ga0207427_100570 Ga0207427_10057016 255
75 3300025233 Ga0209437_100019 Ga0209437_100019169 255
76 3300025253 Ga0209677_100011 Ga0209677_100011169 255
77 3300025261 Ga0209233_1000025 Ga0209233_1000025169 255
78 3300034816 Ga0373930_0056600 Ga0373930_0056600_13_834 255
79 3300005333 Ga0070677_10009993 Ga0070677_100099933 257
80 3300005344 Ga0070661_100067019 Ga0070661_1000670193 257
81 3300005457 Ga0070662_100047086 Ga0070662_1000470864 257
82 3300005547 Ga0070693_100077521 Ga0070693_1000775212 257
83 3300005564 Ga0070664_100289543 Ga0070664_1002895432 257
84 3300005578 Ga0068854_100018851 Ga0068854_1000188514 257
85 3300005616 Ga0068852_100255769 Ga0068852_1002557692 257
86 3300025933 Ga0207706_10020343 Ga0207706_100203435 257
87 3300025945 Ga0207679_10335360 Ga0207679_103353602 257
88 3300025981 Ga0207640_10013763 Ga0207640_100137633 257
89 3300050493 nmdc:mga0k408_231687_c1 nmdc:mga0k408_231687_c1_274_1071 257
90 3300031730 Ga0307516_10000460 Ga0307516_100004602 258
91 3300046475 Ga0495639_0004493 Ga0495639_0004493_4220_5026 258
92 3300026035 Ga0207703_10352718 Ga0207703_103527182 259
93 3300053086 Ga0500578_0044897 Ga0500578_0044897_257_1036 259
94 3300053739 Ga0500587_007104 Ga0500587_007104_373_1152 259
95 3300037466 Ga0395898_0396716 Ga0395898_0396716_436_1233 261
96 3300030744 Ga0316181_1181538 Ga0316181_11815381 262
97 3300031548 Ga0307408_100140129 Ga0307408_1001401291 262
98 3300031731 Ga0307405_10290392 Ga0307405_102903922 262
99 3300031911 Ga0307412_10123600 Ga0307412_101236002 262
100 iso_pu_bacteria 2842854478 2842857764 262
101 iso_pu_bacteria 2917832318 2917836477 262
102 iso_pu_bacteria 2919125081 2919126497 262
103 iso_pu_bacteria 2984504281 2984506853 262
104 iso_pu_bacteria 8016728285 8016731100 262
105 iso_pu_bacteria 8056143049 8056145425 262
106 3300003316 rootH1_10020400 rootH1_100204007 263
107 3300003761 Ga0055535_1000891 Ga0055535_10008912 263
108 3300003763 Ga0055529_1000622 Ga0055529_100062224 263
109 3300005328 Ga0070676_10066798 Ga0070676_100667982 263
110 3300005330 Ga0070690_100001452 Ga0070690_1000014528 263
111 3300005334 Ga0068869_100007843 Ga0068869_1000078433 263
112 3300005334 Ga0068869_100109806 Ga0068869_1001098062 263
113 3300005356 Ga0070674_100123469 Ga0070674_1001234692 263
114 3300005456 Ga0070678_100129140 Ga0070678_1001291402 263
115 3300005459 Ga0068867_100001383 Ga0068867_10000138311 263
116 3300005543 Ga0070672_100180274 Ga0070672_1001802742 263
117 3300005719 Ga0068861_100021750 Ga0068861_1000217504 263
118 3300005843 Ga0068860_100003662 Ga0068860_1000036626 263
119 3300005844 Ga0068862_100008423 Ga0068862_1000084237 263
120 3300006881 Ga0068865_100049806 Ga0068865_1000498062 263
121 3300009147 Ga0114129_10052547 Ga0114129_100525472 263
122 3300009553 Ga0105249_10020909 Ga0105249_100209094 263
123 3300011119 Ga0105246_10071672 Ga0105246_100716722 263
124 3300013297 Ga0157378_10009787 Ga0157378_100097873 263
125 3300013297 Ga0157378_10092187 Ga0157378_100921872 263
126 3300013306 Ga0163162_10005175 Ga0163162_1000517510 263
127 3300013308 Ga0157375_10009940 Ga0157375_100099407 263
128 3300014968 Ga0157379_10025235 Ga0157379_100252352 263
129 3300025242 Ga0209258_100342 Ga0209258_1003423 263
130 3300025254 Ga0209148_1004217 Ga0209148_10042172 263
131 3300025256 Ga0209759_1014038 Ga0209759_10140382 263
132 3300025272 Ga0209455_1000511 Ga0209455_10005113 263
133 3300025923 Ga0207681_10070963 Ga0207681_100709632 263
134 3300025937 Ga0207669_10133926 Ga0207669_101339262 263
135 3300025940 Ga0207691_10047603 Ga0207691_100476032 263
136 3300025942 Ga0207689_10058064 Ga0207689_100580643 263
137 3300026089 Ga0207648_10002026 Ga0207648_100020267 263
138 3300026118 Ga0207675_100008838 Ga0207675_1000088384 263
139 3300026121 Ga0207683_10111670 Ga0207683_101116702 263
140 3300028380 Ga0268265_10045405 Ga0268265_100454053 263
141 3300028381 Ga0268264_10018493 Ga0268264_100184932 263
142 3300032005 Ga0307411_10395953 Ga0307411_103959531 263
143 3300035170 Ga0373943_0041563 Ga0373943_0041563_1075_1872 263
144 3300037068 Ga0373925_0061260 Ga0373925_0061260_1447_2244 263
145 3300041404 Ga0439436_0062788 Ga0439436_0062788_43_867 263
146 3300042145 Ga0450906_002330 Ga0450906_002330_3309_4133 263
147 3300042185 Ga0450909_009266 Ga0450909_009266_323_1147 263
148 3300046681 Ga0495647_0034445 Ga0495647_0034445_535_1332 263
149 3300005327 Ga0070658_10061636 Ga0070658_100616363 264
150 3300005328 Ga0070676_10035514 Ga0070676_100355142 264
151 3300005331 Ga0070670_100003877 Ga0070670_10000387710 264
152 3300005333 Ga0070677_10001476 Ga0070677_100014766 264
153 3300005338 Ga0068868_100143353 Ga0068868_1001433532 264
154 3300005353 Ga0070669_100254237 Ga0070669_1002542371 264
155 3300005354 Ga0070675_100006716 Ga0070675_1000067163 264
156 3300005355 Ga0070671_100006545 Ga0070671_1000065455 264
157 3300005356 Ga0070674_100012835 Ga0070674_1000128354 264
158 3300005356 Ga0070674_100031292 Ga0070674_1000312923 264
159 3300005456 Ga0070678_100050929 Ga0070678_1000509294 264
160 3300005456 Ga0070678_100350956 Ga0070678_1003509562 264
161 3300005459 Ga0068867_100004608 Ga0068867_1000046083 264
162 3300005459 Ga0068867_100024081 Ga0068867_1000240812 264
163 3300005459 Ga0068867_100190352 Ga0068867_1001903521 264
164 3300005543 Ga0070672_100026178 Ga0070672_1000261784 264
165 3300005548 Ga0070665_100200321 Ga0070665_1002003212 264
166 3300005563 Ga0068855_100044323 Ga0068855_1000443232 264
167 3300005564 Ga0070664_100120375 Ga0070664_1001203753 264
168 3300005614 Ga0068856_100047733 Ga0068856_1000477333 264
169 3300005614 Ga0068856_100166397 Ga0068856_1001663973 264
170 3300005718 Ga0068866_10197080 Ga0068866_101970802 264
171 3300005834 Ga0068851_10027772 Ga0068851_100277723 264
172 3300005840 Ga0068870_10041145 Ga0068870_100411453 264
173 3300005843 Ga0068860_100101804 Ga0068860_1001018042 264
174 3300005844 Ga0068862_100028683 Ga0068862_1000286834 264
175 3300006195 Ga0075366_10035988 Ga0075366_100359882 264
176 3300006237 Ga0097621_100092078 Ga0097621_1000920781 264
177 3300006358 Ga0068871_100021423 Ga0068871_1000214232 264
178 3300009148 Ga0105243_10035260 Ga0105243_100352604 264
179 3300009148 Ga0105243_10321976 Ga0105243_103219761 264
180 3300009551 Ga0105238_10084345 Ga0105238_100843451 264
181 3300013297 Ga0157378_10397212 Ga0157378_103972122 264
182 3300013308 Ga0157375_10020576 Ga0157375_100205765 264
183 3300013308 Ga0157375_10028162 Ga0157375_100281626 264
184 3300014968 Ga0157379_10130102 Ga0157379_101301022 264
185 3300017792 Ga0163161_10343620 Ga0163161_103436202 264
186 3300025253 Ga0209677_104403 Ga0209677_1044033 264
187 3300025256 Ga0209759_1004950 Ga0209759_10049503 264
188 3300025256 Ga0209759_1005146 Ga0209759_10051463 264
189 3300025315 Ga0207697_10007005 Ga0207697_100070055 264
190 3300025893 Ga0207682_10000706 Ga0207682_1000070610 264
191 3300025899 Ga0207642_10098719 Ga0207642_100987192 264
192 3300025907 Ga0207645_10032773 Ga0207645_100327734 264
193 3300025919 Ga0207657_10009129 Ga0207657_100091296 264
194 3300025925 Ga0207650_10054584 Ga0207650_100545843 264
195 3300025926 Ga0207659_10028703 Ga0207659_100287035 264
196 3300025926 Ga0207659_10142958 Ga0207659_101429582 264
197 3300025931 Ga0207644_10007260 Ga0207644_100072601 264
198 3300025932 Ga0207690_10018234 Ga0207690_100182343 264
199 3300025932 Ga0207690_10170216 Ga0207690_101702162 264
200 3300025935 Ga0207709_10119377 Ga0207709_101193772 264
201 3300025938 Ga0207704_10195320 Ga0207704_101953202 264
202 3300025940 Ga0207691_10000318 Ga0207691_1000031819 264
203 3300025945 Ga0207679_10072585 Ga0207679_100725852 264
204 3300025945 Ga0207679_10444667 Ga0207679_104446672 264
205 3300025949 Ga0207667_10046590 Ga0207667_100465903 264
206 3300025949 Ga0207667_10497322 Ga0207667_104973222 264
207 3300025960 Ga0207651_10006026 Ga0207651_100060261 264
208 3300025986 Ga0207658_10288563 Ga0207658_102885631 264
209 3300026023 Ga0207677_10593200 Ga0207677_105932001 264
210 3300026067 Ga0207678_10303781 Ga0207678_103037812 264
211 3300026078 Ga0207702_10198726 Ga0207702_101987262 264
212 3300026088 Ga0207641_10031474 Ga0207641_100314745 264
213 3300026089 Ga0207648_10020730 Ga0207648_100207304 264
214 3300026089 Ga0207648_10041853 Ga0207648_100418535 264
215 3300026089 Ga0207648_10043392 Ga0207648_100433924 264
216 3300026118 Ga0207675_100404798 Ga0207675_1004047982 264
217 3300026121 Ga0207683_10010653 Ga0207683_100106538 264
218 3300026121 Ga0207683_10016734 Ga0207683_100167344 264
219 3300028379 Ga0268266_10092747 Ga0268266_100927473 264
220 3300028380 Ga0268265_10054590 Ga0268265_100545902 264
221 3300028381 Ga0268264_10726154 Ga0268264_107261541 264
222 3300031730 Ga0307516_10020589 Ga0307516_100205893 264
223 3300031824 Ga0307413_10040120 Ga0307413_100401203 264
224 3300031901 Ga0307406_10006272 Ga0307406_100062722 264
225 3300032002 Ga0307416_100020199 Ga0307416_1000201993 264
226 3300035691 Ga0373931_0011931 Ga0373931_0011931_657_1475 264
227 3300044683 Ga0466965_0005472 Ga0466965_0005472_1172_1990 264
228 3300044684 Ga0466966_0002799 Ga0466966_0002799_6123_6941 264
229 3300044693 Ga0466961_0054732 Ga0466961_0054732_260_1078 264
230 3300044694 Ga0466963_0049304 Ga0466963_0049304_1912_2730 264
231 3300044706 Ga0466964_0007355 Ga0466964_0007355_1083_1901 264
232 3300044719 Ga0466971_0011994 Ga0466971_0011994_354_1172 264
233 3300044735 Ga0466968_0009338 Ga0466968_0009338_2423_3241 264
234 3300044842 Ga0466957_0023494 Ga0466957_0023494_956_1774 264
235 3300045049 Ga0466959_0004285 Ga0466959_0004285_7819_8637 264
236 3300045836 Ga0466958_0006879 Ga0466958_0006879_859_1677 264
237 3300045976 Ga0466967_0047961 Ga0466967_0047961_2682_3500 264
238 3300005327 Ga0070658_10141954 Ga0070658_101419543 265
239 3300005333 Ga0070677_10004019 Ga0070677_100040194 265
240 3300005337 Ga0070682_100050395 Ga0070682_1000503952 265
241 3300005355 Ga0070671_100005287 Ga0070671_1000052876 265
242 3300005364 Ga0070673_100031264 Ga0070673_1000312643 265
243 3300005466 Ga0070685_10286535 Ga0070685_102865351 265
244 3300005535 Ga0070684_100527755 Ga0070684_1005277551 265
245 3300005539 Ga0068853_100347362 Ga0068853_1003473622 265
246 3300005543 Ga0070672_100068603 Ga0070672_1000686032 265
247 3300005543 Ga0070672_100158352 Ga0070672_1001583523 265
248 3300005564 Ga0070664_100078785 Ga0070664_1000787853 265
249 3300005614 Ga0068856_100055782 Ga0068856_1000557824 265
250 3300005618 Ga0068864_100228811 Ga0068864_1002288112 265
251 3300005841 Ga0068863_100008961 Ga0068863_1000089615 265
252 3300005842 Ga0068858_100062309 Ga0068858_1000623094 265
253 3300005843 Ga0068860_100313647 Ga0068860_1003136472 265
254 3300006237 Ga0097621_100010187 Ga0097621_1000101878 265
255 3300006237 Ga0097621_100012909 Ga0097621_1000129095 265
256 3300006358 Ga0068871_100022718 Ga0068871_1000227185 265
257 3300009098 Ga0105245_10018033 Ga0105245_100180334 265
258 3300009177 Ga0105248_10024871 Ga0105248_100248715 265
259 3300009551 Ga0105238_10114737 Ga0105238_101147372 265
260 3300013308 Ga0157375_10045990 Ga0157375_100459902 265
261 3300014745 Ga0157377_10072267 Ga0157377_100722672 265
262 3300014969 Ga0157376_10051769 Ga0157376_100517694 265
263 3300017792 Ga0163161_10113786 Ga0163161_101137862 265
264 3300025315 Ga0207697_10098244 Ga0207697_100982441 265
265 3300025893 Ga0207682_10009359 Ga0207682_100093593 265
266 3300025920 Ga0207649_10287549 Ga0207649_102875491 265
267 3300025925 Ga0207650_10173189 Ga0207650_101731891 265
268 3300025926 Ga0207659_10044324 Ga0207659_100443244 265
269 3300025927 Ga0207687_10102244 Ga0207687_101022442 265
270 3300025931 Ga0207644_10000042 Ga0207644_1000004258 265
271 3300025940 Ga0207691_10074299 Ga0207691_100742992 265
272 3300025940 Ga0207691_10084554 Ga0207691_100845543 265
273 3300025941 Ga0207711_10004017 Ga0207711_100040175 265
274 3300025941 Ga0207711_10014423 Ga0207711_100144233 265
275 3300025945 Ga0207679_10046009 Ga0207679_100460093 265
276 3300025960 Ga0207651_10054979 Ga0207651_100549793 265
277 3300026078 Ga0207702_10116578 Ga0207702_101165782 265
278 3300026088 Ga0207641_10007604 Ga0207641_100076044 265
279 3300026088 Ga0207641_10162836 Ga0207641_101628362 265
280 3300026142 Ga0207698_10074629 Ga0207698_100746292 265
281 3300028381 Ga0268264_10305606 Ga0268264_103056062 265
282 3300028794 Ga0307515_10397660 Ga0307515_103976601 265
283 3300035691 Ga0373931_0000491 Ga0373931_0000491_10289_11116 265
284 3300048903 Ga0496100_0056009 Ga0496100_0056009_1090_1917 265
285 3300048905 Ga0496102_0013220 Ga0496102_0013220_4731_5558 265
286 3300048906 Ga0496103_0095754 Ga0496103_0095754_181_1008 265
287 3300048909 Ga0496106_0002439 Ga0496106_0002439_3071_3898 265
288 3300048917 Ga0496114_0086473 Ga0496114_0086473_69_938 265
289 3300050515 nmdc:mga0a205_389312_c1 nmdc:mga0a205_389312_c1_213_1040 265
290 iso_pu_bacteria 2511231002 2511244827 265
291 iso_pu_bacteria 2919704043 2919706540 265
292 3300005335 Ga0070666_10104785 Ga0070666_101047852 266
293 3300005344 Ga0070661_100020513 Ga0070661_1000205135 266
294 3300005366 Ga0070659_100021789 Ga0070659_1000217892 266
295 3300005535 Ga0070684_100004660 Ga0070684_1000046608 266
296 3300005543 Ga0070672_100051192 Ga0070672_1000511923 266
297 3300005564 Ga0070664_100050396 Ga0070664_1000503962 266
298 3300005577 Ga0068857_100237252 Ga0068857_1002372521 266
299 3300005577 Ga0068857_100438830 Ga0068857_1004388302 266
300 3300005578 Ga0068854_100019957 Ga0068854_1000199574 266
301 3300005614 Ga0068856_100008227 Ga0068856_1000082275 266
302 3300005616 Ga0068852_100052239 Ga0068852_1000522392 266
303 3300005834 Ga0068851_10023882 Ga0068851_100238822 266
304 3300005842 Ga0068858_100035096 Ga0068858_1000350964 266
305 3300005843 Ga0068860_100089173 Ga0068860_1000891732 266
306 3300009093 Ga0105240_10105835 Ga0105240_101058352 266
307 3300009174 Ga0105241_10152463 Ga0105241_101524632 266
308 3300009177 Ga0105248_10243677 Ga0105248_102436772 266
309 3300009551 Ga0105238_10020203 Ga0105238_100202035 266
310 3300013102 Ga0157371_10047043 Ga0157371_100470432 266
311 3300013104 Ga0157370_10290950 Ga0157370_102909502 266
312 3300013105 Ga0157369_10030192 Ga0157369_100301928 266
313 3300013307 Ga0157372_10020531 Ga0157372_100205314 266
314 3300013308 Ga0157375_10036459 Ga0157375_100364592 266
315 3300014326 Ga0157380_10076095 Ga0157380_100760954 266
316 3300014968 Ga0157379_10135880 Ga0157379_101358802 266
317 3300015265 Ga0182005_1000541 Ga0182005_100054114 266
318 3300021384 Ga0213876_10052025 Ga0213876_100520253 266
319 3300025903 Ga0207680_10080108 Ga0207680_100801082 266
320 3300025909 Ga0207705_10191138 Ga0207705_101911381 266
321 3300025911 Ga0207654_10184247 Ga0207654_101842472 266
322 3300025913 Ga0207695_10318048 Ga0207695_103180482 266
323 3300025919 Ga0207657_10045289 Ga0207657_100452894 266
324 3300025924 Ga0207694_10072469 Ga0207694_100724694 266
325 3300025933 Ga0207706_10201758 Ga0207706_102017582 266
326 3300025940 Ga0207691_10027795 Ga0207691_100277954 266
327 3300025944 Ga0207661_10037817 Ga0207661_100378171 266
328 3300026035 Ga0207703_10081473 Ga0207703_100814732 266
329 3300026041 Ga0207639_10046131 Ga0207639_100461312 266
330 3300026041 Ga0207639_10151636 Ga0207639_101516362 266
331 3300026078 Ga0207702_10002308 Ga0207702_1000230819 266
332 3300026088 Ga0207641_10012523 Ga0207641_100125235 266
333 3300026116 Ga0207674_10049675 Ga0207674_100496755 266
334 3300026116 Ga0207674_10063382 Ga0207674_100633821 266
335 3300026142 Ga0207698_10025392 Ga0207698_100253925 266
336 3300030522 Ga0307512_10170525 Ga0307512_101705252 266
337 3300031730 Ga0307516_10353488 Ga0307516_103534882 266
338 3300033180 Ga0307510_10167982 Ga0307510_101679822 266
339 3300039437 Ga0436365_1021472 Ga0436365_1021472_1482_2315 266
340 3300039450 Ga0436363_0446142 Ga0436363_0446142_250_1074 266
341 3300046462 Ga0495651_0217798 Ga0495651_0217798_382_1221 266
342 3300046463 Ga0495653_0052358 Ga0495653_0052358_558_1397 266
343 3300046511 Ga0495608_0009282 Ga0495608_0009282_847_1686 266
344 3300046514 Ga0495618_0131615 Ga0495618_0131615_719_1558 266
345 3300046516 Ga0495628_0033268 Ga0495628_0033268_2763_3602 266
346 3300046557 Ga0495622_0030748 Ga0495622_0030748_529_1368 266
347 3300046663 Ga0495635_0015601 Ga0495635_0015601_1710_2549 266
348 3300046678 Ga0495599_0007092 Ga0495599_0007092_4477_5316 266
349 3300046679 Ga0495623_0113673 Ga0495623_0113673_454_1293 266
350 3300046680 Ga0495646_0020960 Ga0495646_0020960_1372_2211 266
351 3300046683 Ga0495658_0061800 Ga0495658_0061800_877_1716 266
352 3300046809 Ga0495600_0006804 Ga0495600_0006804_4539_5378 266
353 3300047317 Ga0495604_0082818 Ga0495604_0082818_1147_1986 266
354 3300048911 Ga0496108_0029986 Ga0496108_0029986_3579_4409 266
355 3300053077 Ga0495601_0120521 Ga0495601_0120521_315_1154 266
356 3300053141 Ga0500574_000842 Ga0500574_000842_1306_2145 266
357 iso_pu_bacteria 2818991436 2819541922 266
358 3300002773 JGI25152J39213_1002063 JGI25152J39213_10020631 267
359 3300002774 JGI25150J39212_1007965 JGI25150J39212_10079651 267
360 3300003215 JGI25153J46596_10011901 JGI25153J46596_100119013 267
361 3300003215 JGI25153J46596_10016520 JGI25153J46596_100165203 267
362 3300003316 rootH1_10062309 rootH1_100623092 267
363 3300003771 Ga0055526_1008751 Ga0055526_10087513 267
364 3300003775 Ga0055524_1000033 Ga0055524_100003324 267
365 3300003791 Ga0055530_10002040 Ga0055530_100020402 267
366 3300003792 Ga0055540_1000007 Ga0055540_100000740 267
367 3300003792 Ga0055540_1007509 Ga0055540_10075094 267
368 3300003794 Ga0055531_10001249 Ga0055531_100012495 267
369 3300003794 Ga0055531_10004316 Ga0055531_100043165 267
370 3300005262 Ga0065165_1003473 Ga0065165_10034739 267
371 3300005262 Ga0065165_1036109 Ga0065165_10361092 267
372 3300005328 Ga0070676_10021803 Ga0070676_100218033 267
373 3300005331 Ga0070670_100161566 Ga0070670_1001615662 267
374 3300005331 Ga0070670_100219464 Ga0070670_1002194642 267
375 3300005331 Ga0070670_100365812 Ga0070670_1003658121 267
376 3300005334 Ga0068869_100382916 Ga0068869_1003829161 267
377 3300005338 Ga0068868_100059254 Ga0068868_1000592542 267
378 3300005344 Ga0070661_100000421 Ga0070661_10000042114 267
379 3300005344 Ga0070661_100150333 Ga0070661_1001503332 267
380 3300005344 Ga0070661_100168852 Ga0070661_1001688521 267
381 3300005355 Ga0070671_100008975 Ga0070671_10000897510 267
382 3300005364 Ga0070673_100054845 Ga0070673_1000548452 267
383 3300005366 Ga0070659_100001131 Ga0070659_1000011319 267
384 3300005367 Ga0070667_100063167 Ga0070667_1000631672 267
385 3300005367 Ga0070667_100254418 Ga0070667_1002544182 267
386 3300005456 Ga0070678_100226481 Ga0070678_1002264812 267
387 3300005457 Ga0070662_100076490 Ga0070662_1000764902 267
388 3300005459 Ga0068867_100000048 Ga0068867_10000004810 267
389 3300005459 Ga0068867_100007763 Ga0068867_1000077636 267
390 3300005459 Ga0068867_100112679 Ga0068867_1001126792 267
391 3300005467 Ga0070706_100002704 Ga0070706_1000027046 267
392 3300005539 Ga0068853_100037028 Ga0068853_1000370282 267
393 3300005539 Ga0068853_100118152 Ga0068853_1001181522 267
394 3300005543 Ga0070672_100100057 Ga0070672_1001000572 267
395 3300005543 Ga0070672_100369935 Ga0070672_1003699351 267
396 3300005547 Ga0070693_100161165 Ga0070693_1001611652 267
397 3300005564 Ga0070664_100001426 Ga0070664_1000014268 267
398 3300005564 Ga0070664_100163631 Ga0070664_1001636312 267
399 3300005577 Ga0068857_100119625 Ga0068857_1001196253 267
400 3300005578 Ga0068854_100115693 Ga0068854_1001156932 267
401 3300005616 Ga0068852_100045508 Ga0068852_1000455083 267
402 3300005616 Ga0068852_100089038 Ga0068852_1000890382 267
403 3300005616 Ga0068852_100113517 Ga0068852_1001135173 267
404 3300005834 Ga0068851_10009512 Ga0068851_100095123 267
405 3300005840 Ga0068870_10016501 Ga0068870_100165012 267
406 3300005841 Ga0068863_100072562 Ga0068863_1000725623 267
407 3300005841 Ga0068863_100216288 Ga0068863_1002162882 267
408 3300005842 Ga0068858_100378133 Ga0068858_1003781332 267
409 3300006038 Ga0075365_10018586 Ga0075365_100185862 267
410 3300006048 Ga0075363_100196934 Ga0075363_1001969342 267
411 3300006177 Ga0075362_10106075 Ga0075362_101060751 267
412 3300006178 Ga0075367_10137791 Ga0075367_101377912 267
413 3300006178 Ga0075367_10274220 Ga0075367_102742201 267
414 3300006195 Ga0075366_10000654 Ga0075366_100006545 267
415 3300006195 Ga0075366_10001569 Ga0075366_100015696 267
416 3300006195 Ga0075366_10003793 Ga0075366_100037933 267
417 3300006195 Ga0075366_10004637 Ga0075366_100046375 267
418 3300006195 Ga0075366_10061848 Ga0075366_100618483 267
419 3300006195 Ga0075366_10168042 Ga0075366_101680422 267
420 3300006353 Ga0075370_10000414 Ga0075370_100004145 267
421 3300006353 Ga0075370_10009474 Ga0075370_100094745 267
422 3300006353 Ga0075370_10010350 Ga0075370_100103505 267
423 3300006946 Ga0079104_1000009 Ga0079104_1000009240 267
424 3300009098 Ga0105245_10077730 Ga0105245_100777304 267
425 3300009098 Ga0105245_10187891 Ga0105245_101878912 267
426 3300009148 Ga0105243_10002356 Ga0105243_100023567 267
427 3300009148 Ga0105243_10232486 Ga0105243_102324862 267
428 3300009174 Ga0105241_10333168 Ga0105241_103331682 267
429 3300009545 Ga0105237_10003295 Ga0105237_100032955 267
430 3300009545 Ga0105237_10007089 Ga0105237_100070892 267
431 3300011119 Ga0105246_10341246 Ga0105246_103412461 267
432 3300013296 Ga0157374_10027813 Ga0157374_100278132 267
433 3300013296 Ga0157374_10077836 Ga0157374_100778363 267
434 3300014326 Ga0157380_10409599 Ga0157380_104095991 267
435 3300014745 Ga0157377_10000056 Ga0157377_1000005674 267
436 3300014968 Ga0157379_10013243 Ga0157379_100132436 267
437 3300025206 Ga0209435_100034 Ga0209435_10003489 267
438 3300025245 Ga0207425_1001772 Ga0207425_10017727 267
439 3300025258 Ga0209129_1000062 Ga0209129_1000062184 267
440 3300025263 Ga0209565_1005822 Ga0209565_10058222 267
441 3300025273 Ga0209673_1010877 Ga0209673_10108772 267
442 3300025273 Ga0209673_1058334 Ga0209673_10583341 267
443 3300025291 Ga0209675_1009012 Ga0209675_10090122 267
444 3300025295 Ga0209564_1000176 Ga0209564_1000176104 267
445 3300025297 Ga0209758_1000378 Ga0209758_100037817 267
446 3300025297 Ga0209758_1000517 Ga0209758_100051717 267
447 3300025298 Ga0209050_1000118 Ga0209050_10001189 267
448 3300025298 Ga0209050_1000243 Ga0209050_10002434 267
449 3300025298 Ga0209050_1016204 Ga0209050_10162042 267
450 3300025299 Ga0209256_1000019 Ga0209256_1000019301 267
451 3300025299 Ga0209256_1021803 Ga0209256_10218032 267
452 3300025303 Ga0209051_1000004 Ga0209051_100000493 267
453 3300025303 Ga0209051_1000853 Ga0209051_100085315 267
454 3300025303 Ga0209051_1044684 Ga0209051_10446842 267
455 3300025304 Ga0209257_1000022 Ga0209257_100002215 267
456 3300025304 Ga0209257_1000038 Ga0209257_1000038227 267
457 3300025304 Ga0209257_1000044 Ga0209257_1000044333 267
458 3300025304 Ga0209257_1024509 Ga0209257_10245092 267
459 3300025907 Ga0207645_10016574 Ga0207645_100165743 267
460 3300025908 Ga0207643_10044753 Ga0207643_100447532 267
461 3300025910 Ga0207684_10006839 Ga0207684_100068396 267
462 3300025913 Ga0207695_10099229 Ga0207695_100992292 267
463 3300025914 Ga0207671_10005664 Ga0207671_1000566410 267
464 3300025914 Ga0207671_10050729 Ga0207671_100507292 267
465 3300025920 Ga0207649_10000751 Ga0207649_1000075111 267
466 3300025923 Ga0207681_10321395 Ga0207681_103213951 267
467 3300025925 Ga0207650_10073437 Ga0207650_100734372 267
468 3300025925 Ga0207650_10210795 Ga0207650_102107952 267
469 3300025931 Ga0207644_10006910 Ga0207644_100069106 267
470 3300025931 Ga0207644_10358606 Ga0207644_103586062 267
471 3300025932 Ga0207690_10000481 Ga0207690_100004814 267
472 3300025933 Ga0207706_10017151 Ga0207706_100171514 267
473 3300025935 Ga0207709_10002673 Ga0207709_1000267310 267
474 3300025940 Ga0207691_10017977 Ga0207691_100179773 267
475 3300025940 Ga0207691_10045199 Ga0207691_100451994 267
476 3300025942 Ga0207689_10060170 Ga0207689_100601703 267
477 3300025945 Ga0207679_10000501 Ga0207679_100005019 267
478 3300025960 Ga0207651_10046578 Ga0207651_100465783 267
479 3300025986 Ga0207658_10004551 Ga0207658_100045515 267
480 3300025986 Ga0207658_10072003 Ga0207658_100720032 267
481 3300026023 Ga0207677_10083998 Ga0207677_100839982 267
482 3300026023 Ga0207677_10084366 Ga0207677_100843662 267
483 3300026067 Ga0207678_10013097 Ga0207678_100130976 267
484 3300026088 Ga0207641_10170410 Ga0207641_101704102 267
485 3300026089 Ga0207648_10000492 Ga0207648_1000049210 267
486 3300026089 Ga0207648_10006568 Ga0207648_100065682 267
487 3300026089 Ga0207648_10177524 Ga0207648_101775241 267
488 3300026095 Ga0207676_10021790 Ga0207676_100217901 267
489 3300026116 Ga0207674_10106917 Ga0207674_101069172 267
490 3300026116 Ga0207674_10384556 Ga0207674_103845561 267
491 3300026121 Ga0207683_10050334 Ga0207683_100503343 267
492 3300026121 Ga0207683_10058883 Ga0207683_100588832 267
493 3300026142 Ga0207698_10073233 Ga0207698_100732333 267
494 3300026142 Ga0207698_10230582 Ga0207698_102305822 267
495 3300027111 Ga0209281_1000023 Ga0209281_1000023147 267
496 3300027876 Ga0209974_10013298 Ga0209974_100132982 267
497 3300028381 Ga0268264_10105160 Ga0268264_101051602 267
498 3300028786 Ga0307517_10000228 Ga0307517_1000022844 267
499 3300028786 Ga0307517_10053504 Ga0307517_100535043 267
500 3300028786 Ga0307517_10205333 Ga0307517_102053332 267
501 3300028794 Ga0307515_10004357 Ga0307515_1000435718 267
502 3300028794 Ga0307515_10020859 Ga0307515_100208598 267
503 3300028794 Ga0307515_10036443 Ga0307515_100364435 267
504 3300030522 Ga0307512_10059122 Ga0307512_100591222 267
505 3300030522 Ga0307512_10121533 Ga0307512_101215332 267
506 3300031456 Ga0307513_10006563 Ga0307513_100065637 267
507 3300031456 Ga0307513_10030687 Ga0307513_100306877 267
508 3300031456 Ga0307513_10032666 Ga0307513_100326662 267
509 3300031507 Ga0307509_10000426 Ga0307509_1000042643 267
510 3300031548 Ga0307408_100000288 Ga0307408_10000028831 267
511 3300031548 Ga0307408_100088275 Ga0307408_1000882753 267
512 3300031616 Ga0307508_10000040 Ga0307508_10000040123 267
513 3300031616 Ga0307508_10003969 Ga0307508_100039695 267
514 3300031649 Ga0307514_10011867 Ga0307514_100118679 267
515 3300031649 Ga0307514_10070063 Ga0307514_100700632 267
516 3300031730 Ga0307516_10001446 Ga0307516_100014467 267
517 3300031730 Ga0307516_10012998 Ga0307516_100129986 267
518 3300031730 Ga0307516_10161191 Ga0307516_101611912 267
519 3300031730 Ga0307516_10237526 Ga0307516_102375261 267
520 3300031901 Ga0307406_10001222 Ga0307406_1000122212 267
521 3300031911 Ga0307412_10034844 Ga0307412_100348441 267
522 3300031995 Ga0307409_100306137 Ga0307409_1003061372 267
523 3300032002 Ga0307416_100127951 Ga0307416_1001279512 267
524 3300032005 Ga0307411_10239000 Ga0307411_102390001 267
525 3300033180 Ga0307510_10000109 Ga0307510_1000010910 267
526 3300033180 Ga0307510_10251031 Ga0307510_102510312 267
527 3300036401 Ga0373937_0206953 Ga0373937_0206953_637_1461 267
528 3300037068 Ga0373925_0023538 Ga0373925_0023538_1936_2760 267
529 3300037471 Ga0395905_0122445 Ga0395905_0122445_396_1250 267
530 3300038443 Ga0395901_0320256 Ga0395901_0320256_714_1532 267
531 3300041452 Ga0451793_0083691 Ga0451793_0083691_306_1124 267
532 3300041452 Ga0451793_1251237 Ga0451793_1251237_393_1229 267
533 3300041456 Ga0451795_0141978 Ga0451795_0141978_917_1744 267
534 3300041460 Ga0451802_1322629 Ga0451802_1322629_173_991 267
535 3300041463 Ga0451804_0097481 Ga0451804_0097481_469_1296 267
536 3300041501 Ga0451845_0950226 Ga0451845_0950226_338_1156 267
537 3300041512 Ga0451853_2068177 Ga0451853_2068177_569_1396 267
538 3300042439 Ga0439464_0019340 Ga0439464_0019340_230_1048 267
539 3300042531 Ga0450918_000096 Ga0450918_000096_17611_18465 267
540 3300042876 Ga0451577_0125429 Ga0451577_0125429_893_1714 267
541 3300042876 Ga0451577_0137658 Ga0451577_0137658_1056_1874 267
542 3300044712 Ga0453684_0030595 Ga0453684_0030595_6493_7371 267
543 3300045051 Ga0451576_0015848 Ga0451576_0015848_5243_6076 267
544 3300045051 Ga0451576_0738451 Ga0451576_0738451_49_867 267
545 3300045976 Ga0466967_0564764 Ga0466967_0564764_29_847 267
546 3300046460 Ga0495638_0067412 Ga0495638_0067412_519_1346 267
547 3300046507 Ga0495606_0213550 Ga0495606_0213550_122_949 267
548 3300046512 Ga0495610_0025940 Ga0495610_0025940_287_1120 267
549 3300046512 Ga0495610_0032346 Ga0495610_0032346_1162_1980 267
550 3300046515 Ga0495620_0047397 Ga0495620_0047397_363_1181 267
551 3300046515 Ga0495620_0055463 Ga0495620_0055463_625_1452 267
552 3300046519 Ga0495632_0012595 Ga0495632_0012595_889_1707 267
553 3300046519 Ga0495632_0015796 Ga0495632_0015796_1333_2160 267
554 3300046522 Ga0495643_0024642 Ga0495643_0024642_2083_2901 267
555 3300046535 Ga0495586_0222037 Ga0495586_0222037_99_971 267
556 3300046543 Ga0495645_0058781 Ga0495645_0058781_20_898 267
557 3300046616 Ga0495668_0025704 Ga0495668_0025704_1765_2598 267
558 3300046660 Ga0495625_0008288 Ga0495625_0008288_4816_5634 267
559 3300046660 Ga0495625_0044809 Ga0495625_0044809_10_843 267
560 3300046660 Ga0495625_0058675 Ga0495625_0058675_220_1047 267
561 3300046660 Ga0495625_0060922 Ga0495625_0060922_783_1592 267
562 3300046692 Ga0495671_0048442 Ga0495671_0048442_671_1489 267
563 3300046692 Ga0495671_0061709 Ga0495671_0061709_450_1283 267
564 3300046694 Ga0495649_0007205 Ga0495649_0007205_4858_5691 267
565 3300046810 Ga0495660_0004975 Ga0495660_0004975_5858_6691 267
566 3300047443 Ga0495687_000330 Ga0495687_000330_15501_16334 267
567 3300047443 Ga0495687_010702 Ga0495687_010702_3001_3834 267
568 3300047443 Ga0495687_010712 Ga0495687_010712_3001_3834 267
569 3300047472 Ga0495686_0001339 Ga0495686_0001339_7262_8092 267
570 3300047673 Ga0495593_0115921 Ga0495593_0115921_18_839 267
571 3300048091 Ga0495626_0029363 Ga0495626_0029363_332_1165 267
572 3300048904 Ga0496101_0276550 Ga0496101_0276550_104_925 267
573 3300048905 Ga0496102_0314520 Ga0496102_0314520_216_1034 267
574 3300048909 Ga0496106_0095037 Ga0496106_0095037_1189_2010 267
575 3300048917 Ga0496114_0001104 Ga0496114_0001104_18352_19170 267
576 3300048924 Ga0496121_0260646 Ga0496121_0260646_197_1018 267
577 3300049521 Ga0501298_003130 Ga0501298_003130_993_1826 267
578 3300049578 Ga0501042_0420896 Ga0501042_0420896_28_846 267
579 3300049579 Ga0501043_0000075 Ga0501043_0000075_56450_57271 267
580 3300049580 Ga0501046_0000195 Ga0501046_0000195_28951_29772 267
581 3300049581 Ga0501047_0000145 Ga0501047_0000145_56450_57271 267
582 3300049582 Ga0501048_0003268 Ga0501048_0003268_2715_3536 267
583 3300049682 Ga0501252_001117 Ga0501252_001117_354_1172 267
584 3300049759 Ga0501262_000604 Ga0501262_000604_100_933 267
585 3300049762 Ga0501265_000800 Ga0501265_000800_2217_3050 267
586 3300049823 Ga0501044_0126233 Ga0501044_0126233_1140_1961 267
587 3300049824 Ga0501045_0000705 Ga0501045_0000705_15100_15921 267
588 3300050489 nmdc:mga03683_142028_c1 nmdc:mga03683_142028_c1_117_944 267
589 3300050489 nmdc:mga03683_89997_c1 nmdc:mga03683_89997_c1_130_963 267
590 3300050490 nmdc:mga03n38_55236_c1 nmdc:mga03n38_55236_c1_446_1273 267
591 3300050491 nmdc:mga00v17_184574_c1 nmdc:mga00v17_184574_c1_321_1154 267
592 3300050493 nmdc:mga0k408_1324_c1 nmdc:mga0k408_1324_c1_10402_11235 267
593 3300050493 nmdc:mga0k408_153219_c1 nmdc:mga0k408_153219_c1_146_979 267
594 3300050493 nmdc:mga0k408_260504_c1 nmdc:mga0k408_260504_c1_42_869 267
595 3300050493 nmdc:mga0k408_3826_c1 nmdc:mga0k408_3826_c1_2675_3508 267
596 3300050493 nmdc:mga0k408_41858_c1 nmdc:mga0k408_41858_c1_768_1595 267
597 3300050493 nmdc:mga0k408_4731_c1 nmdc:mga0k408_4731_c1_6017_6838 267
598 3300050493 nmdc:mga0k408_54342_c1 nmdc:mga0k408_54342_c1_942_1781 267
599 3300050493 nmdc:mga0k408_8116_c1 nmdc:mga0k408_8116_c1_1435_2268 267
600 3300050493 nmdc:mga0k408_96600_c1 nmdc:mga0k408_96600_c1_501_1322 267
601 3300050493 nmdc:mga0k408_9794_c1 nmdc:mga0k408_9794_c1_2066_2896 267
602 3300050494 nmdc:mga06z11_37018_c1 nmdc:mga06z11_37018_c1_936_1769 267
603 3300050496 nmdc:mga07m45_12663_c1 nmdc:mga07m45_12663_c1_1421_2248 267
604 3300050496 nmdc:mga07m45_1430_c1 nmdc:mga07m45_1430_c1_3649_4482 267
605 3300050496 nmdc:mga07m45_46844_c1 nmdc:mga07m45_46844_c1_340_1176 267
606 3300050496 nmdc:mga07m45_630_c1 nmdc:mga07m45_630_c1_1505_2338 267
607 3300050496 nmdc:mga07m45_93107_c1 nmdc:mga07m45_93107_c1_501_1334 267
608 3300053086 Ga0500578_0003366 Ga0500578_0003366_1514_2341 267
609 3300053086 Ga0500578_0057270 Ga0500578_0057270_1096_1932 267
610 3300053092 Ga0500583_0071088 Ga0500583_0071088_378_1205 267
611 3300053093 Ga0500651_0007902 Ga0500651_0007902_261_1088 267
612 3300053116 Ga0500592_010134 Ga0500592_010134_90_917 267
613 3300053118 Ga0500594_0002948 Ga0500594_0002948_1890_2711 267
614 3300053118 Ga0500594_0066153 Ga0500594_0066153_158_985 267
615 3300053130 Ga0500642_0094420 Ga0500642_0094420_415_1251 267
616 3300053131 Ga0500652_000521 Ga0500652_000521_9774_10601 267
617 3300053136 Ga0500559_0001509 Ga0500559_0001509_6181_7002 267
618 3300053139 Ga0500568_0015935 Ga0500568_0015935_51_884 267
619 3300053151 Ga0500604_0051911 Ga0500604_0051911_314_1141 267
620 3300053156 Ga0500622_0001293 Ga0500622_0001293_9894_10721 267
621 3300053724 Ga0500570_087793 Ga0500570_087793_366_1193 267
622 3300053730 Ga0500645_002947 Ga0500645_002947_2583_3419 267
623 3300053739 Ga0500587_000635 Ga0500587_000635_2480_3298 267
624 iso_pu_bacteria 2547132374 2548497741 267
625 iso_pu_bacteria 2585428057 2587728019 267
626 iso_pu_bacteria 2585428058 2587731083 267
627 iso_pu_bacteria 2585428062 2587760282 267
628 iso_pu_bacteria 2588253510 2588289835 267
629 iso_pu_bacteria 2643221570 2643867205 267
630 iso_pu_bacteria 2643221592 2643972366 267
631 iso_pu_bacteria 2643221596 2643990127 267
632 iso_pu_bacteria 2643221609 2644059346 267
633 iso_pu_bacteria 2643221611 2644075615 267
634 iso_pu_bacteria 2643221625 2644141523 267
635 iso_pu_bacteria 2643221644 2644245233 267
636 iso_pu_bacteria 2643221648 2644275706 267
637 iso_pu_bacteria 2643221652 2644295611 267
638 iso_pu_bacteria 2643221717 2644645149 267
639 iso_pu_bacteria 2738543012 2739240844 267
640 iso_pu_bacteria 2816332133 2816472082 267
641 iso_pu_bacteria 2881101125 2881101514 267
642 iso_pu_bacteria 2885266251 2885269105 267
643 iso_pu_bacteria 2904479285 2904483350 267
644 iso_pu_bacteria 2990710928 2990711157 267
645 3300002704 JGI25155J39150_1001042 JGI25155J39150_10010422 268
646 3300002738 JGI25154J39366_1000128 JGI25154J39366_100012825 268
647 3300005330 Ga0070690_100122522 Ga0070690_1001225222 268
648 3300005331 Ga0070670_100006300 Ga0070670_1000063005 268
649 3300005331 Ga0070670_100029278 Ga0070670_1000292783 268
650 3300005331 Ga0070670_100037863 Ga0070670_1000378633 268
651 3300005331 Ga0070670_100346801 Ga0070670_1003468011 268
652 3300005335 Ga0070666_10029664 Ga0070666_100296642 268
653 3300005338 Ga0068868_100000930 Ga0068868_1000009303 268
654 3300005340 Ga0070689_100026477 Ga0070689_1000264773 268
655 3300005354 Ga0070675_100000926 Ga0070675_10000092618 268
656 3300005354 Ga0070675_100023645 Ga0070675_1000236452 268
657 3300005354 Ga0070675_100082173 Ga0070675_1000821732 268
658 3300005355 Ga0070671_100119488 Ga0070671_1001194882 268
659 3300005355 Ga0070671_100169798 Ga0070671_1001697981 268
660 3300005355 Ga0070671_100268378 Ga0070671_1002683782 268
661 3300005355 Ga0070671_100336060 Ga0070671_1003360601 268
662 3300005367 Ga0070667_100011038 Ga0070667_1000110388 268
663 3300005456 Ga0070678_100013269 Ga0070678_1000132695 268
664 3300005456 Ga0070678_100229716 Ga0070678_1002297162 268
665 3300005456 Ga0070678_100284977 Ga0070678_1002849771 268
666 3300005457 Ga0070662_100065813 Ga0070662_1000658132 268
667 3300005459 Ga0068867_100068350 Ga0068867_1000683502 268
668 3300005539 Ga0068853_100053921 Ga0068853_1000539212 268
669 3300005543 Ga0070672_100112023 Ga0070672_1001120231 268
670 3300005543 Ga0070672_100183062 Ga0070672_1001830622 268
671 3300005543 Ga0070672_100199760 Ga0070672_1001997602 268
672 3300005548 Ga0070665_100278976 Ga0070665_1002789762 268
673 3300005548 Ga0070665_100426083 Ga0070665_1004260832 268
674 3300005564 Ga0070664_100105483 Ga0070664_1001054833 268
675 3300005564 Ga0070664_100147680 Ga0070664_1001476802 268
676 3300005616 Ga0068852_100270354 Ga0068852_1002703542 268
677 3300005617 Ga0068859_100001157 Ga0068859_1000011573 268
678 3300005618 Ga0068864_100043931 Ga0068864_1000439314 268
679 3300005719 Ga0068861_100038148 Ga0068861_1000381483 268
680 3300005840 Ga0068870_10199416 Ga0068870_101994162 268
681 3300005842 Ga0068858_100001292 Ga0068858_10000129218 268
682 3300006042 Ga0075368_10025717 Ga0075368_100257172 268
683 3300006237 Ga0097621_100004797 Ga0097621_1000047972 268
684 3300006237 Ga0097621_100171084 Ga0097621_1001710842 268
685 3300006237 Ga0097621_100227161 Ga0097621_1002271612 268
686 3300006358 Ga0068871_100008231 Ga0068871_1000082317 268
687 3300006358 Ga0068871_100249243 Ga0068871_1002492432 268
688 3300006881 Ga0068865_100296794 Ga0068865_1002967942 268
689 3300006931 Ga0097620_100001157 Ga0097620_1000011573 268
690 3300009093 Ga0105240_10007990 Ga0105240_100079904 268
691 3300009148 Ga0105243_10047878 Ga0105243_100478782 268
692 3300009176 Ga0105242_10077752 Ga0105242_100777521 268
693 3300009177 Ga0105248_10107672 Ga0105248_101076724 268
694 3300009545 Ga0105237_10034334 Ga0105237_100343344 268
695 3300009551 Ga0105238_10003365 Ga0105238_100033659 268
696 3300009553 Ga0105249_10039647 Ga0105249_100396473 268
697 3300010375 Ga0105239_10003389 Ga0105239_100033892 268
698 3300013296 Ga0157374_10189723 Ga0157374_101897232 268
699 3300013308 Ga0157375_10076855 Ga0157375_100768554 268
700 3300013308 Ga0157375_10154757 Ga0157375_101547573 268
701 3300014325 Ga0163163_10002538 Ga0163163_1000253814 268
702 3300014326 Ga0157380_10047723 Ga0157380_100477233 268
703 3300014326 Ga0157380_10071376 Ga0157380_100713762 268
704 3300014326 Ga0157380_10071794 Ga0157380_100717942 268
705 3300014969 Ga0157376_10014590 Ga0157376_100145903 268
706 3300014969 Ga0157376_10021252 Ga0157376_100212524 268
707 3300015261 Ga0182006_1015134 Ga0182006_10151343 268
708 3300017792 Ga0163161_10162904 Ga0163161_101629042 268
709 3300025206 Ga0209435_100115 Ga0209435_1001155 268
710 3300025246 Ga0209646_1000155 Ga0209646_100015550 268
711 3300025250 Ga0209026_1000769 Ga0209026_100076917 268
712 3300025256 Ga0209759_1000375 Ga0209759_100037539 268
713 3300025893 Ga0207682_10007480 Ga0207682_100074805 268
714 3300025901 Ga0207688_10200887 Ga0207688_102008871 268
715 3300025903 Ga0207680_10005283 Ga0207680_100052836 268
716 3300025903 Ga0207680_10085564 Ga0207680_100855642 268
717 3300025907 Ga0207645_10075710 Ga0207645_100757102 268
718 3300025907 Ga0207645_10114838 Ga0207645_101148382 268
719 3300025914 Ga0207671_10002336 Ga0207671_100023362 268
720 3300025923 Ga0207681_10069573 Ga0207681_100695732 268
721 3300025923 Ga0207681_10098776 Ga0207681_100987763 268
722 3300025925 Ga0207650_10002868 Ga0207650_100028689 268
723 3300025925 Ga0207650_10300768 Ga0207650_103007681 268
724 3300025926 Ga0207659_10001257 Ga0207659_100012574 268
725 3300025926 Ga0207659_10013518 Ga0207659_100135185 268
726 3300025926 Ga0207659_10015146 Ga0207659_100151462 268
727 3300025931 Ga0207644_10088580 Ga0207644_100885803 268
728 3300025931 Ga0207644_10153838 Ga0207644_101538382 268
729 3300025933 Ga0207706_10066467 Ga0207706_100664673 268
730 3300025933 Ga0207706_10067288 Ga0207706_100672883 268
731 3300025935 Ga0207709_10115691 Ga0207709_101156912 268
732 3300025937 Ga0207669_10370037 Ga0207669_103700371 268
733 3300025940 Ga0207691_10037444 Ga0207691_100374444 268
734 3300025941 Ga0207711_10010123 Ga0207711_100101231 268
735 3300025941 Ga0207711_10101817 Ga0207711_101018173 268
736 3300025960 Ga0207651_10000364 Ga0207651_100003641 268
737 3300025960 Ga0207651_10041858 Ga0207651_100418582 268
738 3300025961 Ga0207712_10041521 Ga0207712_100415213 268
739 3300025972 Ga0207668_10012084 Ga0207668_100120846 268
740 3300025986 Ga0207658_10002924 Ga0207658_1000292412 268
741 3300025986 Ga0207658_10077603 Ga0207658_100776032 268
742 3300026023 Ga0207677_10133083 Ga0207677_101330832 268
743 3300026035 Ga0207703_10001647 Ga0207703_1000164718 268
744 3300026041 Ga0207639_10071881 Ga0207639_100718812 268
745 3300026095 Ga0207676_10001498 Ga0207676_100014982 268
746 3300026095 Ga0207676_10017299 Ga0207676_100172995 268
747 3300026118 Ga0207675_100074019 Ga0207675_1000740192 268
748 3300026121 Ga0207683_10033147 Ga0207683_100331473 268
749 3300026121 Ga0207683_10049633 Ga0207683_100496333 268
750 3300026121 Ga0207683_10299106 Ga0207683_102991062 268
751 3300026142 Ga0207698_10028570 Ga0207698_100285703 268
752 3300026142 Ga0207698_10142792 Ga0207698_101427923 268
753 3300028380 Ga0268265_10068611 Ga0268265_100686113 268
754 3300028794 Ga0307515_10038277 Ga0307515_100382775 268
755 3300031456 Ga0307513_10135388 Ga0307513_101353882 268
756 3300031730 Ga0307516_10022952 Ga0307516_100229525 268
757 3300031995 Ga0307409_100012808 Ga0307409_1000128086 268
758 3300032002 Ga0307416_100009118 Ga0307416_1000091187 268
759 3300032004 Ga0307414_10209979 Ga0307414_102099792 268
760 3300032126 Ga0307415_100000538 Ga0307415_10000053812 268
761 3300035692 Ga0373935_0200366 Ga0373935_0200366_22_897 268
762 3300037312 Ga0395899_0016249 Ga0395899_0016249_117_947 268
763 3300037418 Ga0395900_0004795 Ga0395900_0004795_5685_6515 268
764 3300037466 Ga0395898_0008778 Ga0395898_0008778_6370_7200 268
765 3300037471 Ga0395905_0010964 Ga0395905_0010964_4426_5253 268
766 3300037471 Ga0395905_0031340 Ga0395905_0031340_2019_2849 268
767 3300037471 Ga0395905_0261614 Ga0395905_0261614_162_989 268
768 3300042007 Ga0439449_0029115 Ga0439449_0029115_564_1436 268
769 3300044656 Ga0466969_0016680 Ga0466969_0016680_1601_2470 268
770 3300044683 Ga0466965_0007760 Ga0466965_0007760_744_1613 268
771 3300044693 Ga0466961_0064566 Ga0466961_0064566_945_1829 268
772 3300044693 Ga0466961_0090729 Ga0466961_0090729_75_944 268
773 3300044694 Ga0466963_0004270 Ga0466963_0004270_375_1244 268
774 3300044719 Ga0466971_0007914 Ga0466971_0007914_210_1079 268
775 3300044719 Ga0466971_0008150 Ga0466971_0008150_392_1219 268
776 3300044735 Ga0466968_0064515 Ga0466968_0064515_221_1090 268
777 3300044842 Ga0466957_0004305 Ga0466957_0004305_5384_6253 268
778 3300045049 Ga0466959_0233439 Ga0466959_0233439_368_1237 268
779 3300045051 Ga0451576_0006080 Ga0451576_0006080_2739_3566 268
780 3300046457 Ga0495590_0001358 Ga0495590_0001358_1168_1995 268
781 3300046457 Ga0495590_0003934 Ga0495590_0003934_3108_3935 268
782 3300046537 Ga0495598_0038421 Ga0495598_0038421_376_1257 268
783 3300046539 Ga0495621_0014745 Ga0495621_0014745_1531_2364 268
784 3300046810 Ga0495660_0085796 Ga0495660_0085796_532_1359 268
785 3300048907 Ga0496104_0009568 Ga0496104_0009568_4277_5110 268
786 3300048908 Ga0496105_0024505 Ga0496105_0024505_42_875 268
787 3300048924 Ga0496121_0019081 Ga0496121_0019081_1622_2491 268
788 3300050493 nmdc:mga0k408_1110_c1 nmdc:mga0k408_1110_c1_11545_12378 268
789 3300050493 nmdc:mga0k408_20845_c1 nmdc:mga0k408_20845_c1_1804_2649 268
790 3300053108 Ga0500562_006072 Ga0500562_006072_683_1489 268
791 3300053153 Ga0500616_0050109 Ga0500616_0050109_584_1390 268
792 3300061719 Ga0466962_0012516 Ga0466962_0012516_2495_3364 268
793 iso_pu_bacteria 2511231003 2511250395 268
794 iso_pu_bacteria 2904479285 2904483818 268
795 3300002704 JGI25155J39150_1000123 JGI25155J39150_100012323 269
796 3300002705 JGI25156J39149_1000052 JGI25156J39149_100005251 269
797 3300002738 JGI25154J39366_1000081 JGI25154J39366_100008115 269
798 3300002741 JGI25157J39369_1000006 JGI25157J39369_1000006146 269
799 3300002774 JGI25150J39212_1008331 JGI25150J39212_10083312 269
800 3300002987 JGI25159J45721_1005943 JGI25159J45721_10059433 269
801 3300002987 JGI25159J45721_1010857 JGI25159J45721_10108572 269
802 3300003187 JGI25151J46595_10007771 JGI25151J46595_100077716 269
803 3300003187 JGI25151J46595_10033260 JGI25151J46595_100332602 269
804 3300003354 JGI25160J50197_1000071 JGI25160J50197_100007196 269
805 3300003374 JGI25161J50226_1000144 JGI25161J50226_10001445 269
806 3300003773 Ga0055537_1000689 Ga0055537_10006893 269
807 3300003773 Ga0055537_1016026 Ga0055537_10160261 269
808 3300003775 Ga0055524_1000006 Ga0055524_1000006150 269
809 3300003781 Ga0055536_1025617 Ga0055536_10256171 269
810 3300003784 Ga0055534_1000850 Ga0055534_100085013 269
811 3300003790 Ga0055528_1000432 Ga0055528_100043217 269
812 3300003791 Ga0055530_10001172 Ga0055530_1000117214 269
813 3300003792 Ga0055540_1000005 Ga0055540_1000005164 269
814 3300003794 Ga0055531_10005581 Ga0055531_100055812 269
815 3300004625 Ga0055543_1000162 Ga0055543_100016225 269
816 3300005518 Ga0070699_100233632 Ga0070699_1002336322 269
817 3300006058 Ga0075432_10008161 Ga0075432_100081614 269
818 3300006195 Ga0075366_10067831 Ga0075366_100678312 269
819 3300006195 Ga0075366_10077136 Ga0075366_100771362 269
820 3300006946 Ga0079104_1023974 Ga0079104_10239742 269
821 3300025206 Ga0209435_100001 Ga0209435_100001101 269
822 3300025246 Ga0209646_1000001 Ga0209646_1000001470 269
823 3300025250 Ga0209026_1000003 Ga0209026_1000003101 269
824 3300025256 Ga0209759_1000001 Ga0209759_1000001101 269
825 3300025263 Ga0209565_1000124 Ga0209565_100012479 269
826 3300025263 Ga0209565_1000910 Ga0209565_10009108 269
827 3300025273 Ga0209673_1000043 Ga0209673_1000043238 269
828 3300025284 Ga0209130_1000060 Ga0209130_100006034 269
829 3300025284 Ga0209130_1000114 Ga0209130_100011465 269
830 3300025291 Ga0209675_1000269 Ga0209675_100026934 269
831 3300025292 Ga0209676_1000007 Ga0209676_1000007533 269
832 3300025294 Ga0209025_1004701 Ga0209025_10047013 269
833 3300025294 Ga0209025_1007436 Ga0209025_10074363 269
834 3300025294 Ga0209025_1025947 Ga0209025_10259473 269
835 3300025295 Ga0209564_1000268 Ga0209564_100026879 269
836 3300025295 Ga0209564_1002616 Ga0209564_100261613 269
837 3300025295 Ga0209564_1007511 Ga0209564_10075116 269
838 3300025297 Ga0209758_1025948 Ga0209758_10259482 269
839 3300025298 Ga0209050_1000003 Ga0209050_1000003975 269
840 3300025298 Ga0209050_1002216 Ga0209050_10022162 269
841 3300025298 Ga0209050_1002992 Ga0209050_100299210 269
842 3300025299 Ga0209256_1000001 Ga0209256_1000001981 269
843 3300025302 Ga0207426_1000308 Ga0207426_100030847 269
844 3300025302 Ga0207426_1002574 Ga0207426_10025742 269
845 3300025303 Ga0209051_1000003 Ga0209051_1000003975 269
846 3300025304 Ga0209257_1000020 Ga0209257_1000020533 269
847 3300025304 Ga0209257_1035649 Ga0209257_10356492 269
848 3300027907 Ga0207428_10215834 Ga0207428_102158342 269
849 3300028794 Ga0307515_10000458 Ga0307515_1000045836 269
850 3300031456 Ga0307513_10000006 Ga0307513_10000006283 269
851 3300031456 Ga0307513_10000094 Ga0307513_1000009427 269
852 3300031456 Ga0307513_10001393 Ga0307513_1000139319 269
853 3300031548 Ga0307408_100016115 Ga0307408_1000161153 269
854 3300031649 Ga0307514_10014681 Ga0307514_100146816 269
855 3300031824 Ga0307413_10314011 Ga0307413_103140111 269
856 3300031901 Ga0307406_10022081 Ga0307406_100220812 269
857 3300041512 Ga0451853_0207789 Ga0451853_0207789_123_962 269
858 3300046530 Ga0495654_0006531 Ga0495654_0006531_3158_3967 269
859 3300049574 Ga0501038_0055025 Ga0501038_0055025_364_1173 269
860 3300049822 Ga0501035_0014603 Ga0501035_0014603_4774_5583 269
861 3300049823 Ga0501044_0016149 Ga0501044_0016149_3202_4011 269
862 3300050493 nmdc:mga0k408_133098_c1 nmdc:mga0k408_133098_c1_462_1271 269
863 3300050493 nmdc:mga0k408_2870_c2 nmdc:mga0k408_2870_c2_352_1161 269
864 3300050496 nmdc:mga07m45_122534_c1 nmdc:mga07m45_122534_c1_212_1021 269
865 3300053088 Ga0500644_0026585 Ga0500644_0026585_457_1266 269
866 3300053093 Ga0500651_0017641 Ga0500651_0017641_1549_2358 269
867 3300053096 Ga0500641_0098199 Ga0500641_0098199_192_1001 269
868 3300053117 Ga0500593_003969 Ga0500593_003969_1847_2656 269
869 3300053129 Ga0500628_013444 Ga0500628_013444_442_1251 269
870 3300053730 Ga0500645_001182 Ga0500645_001182_12434_13243 269
871 3300053730 Ga0500645_012277 Ga0500645_012277_1194_2003 269
872 3300053730 Ga0500645_014969 Ga0500645_014969_428_1237 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

26

200

0.89

PF07993

NAD_binding_4

Male sterility protein

74

219

0.87

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

30

192

0.86

PF04321

RmlD_sub_bind

RmlD substrate binding domain

24

200

0.84

PF13460

NAD_binding_10

NAD(P)H-binding

30

170

0.81

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

27

176

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ay3-assembly2.cif.gz_D crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens 0.9899 5 265
6mfh-assembly1.cif.gz_A mutated uronate dehydrogenase 0.9898 5 265
3rfx-assembly1.cif.gz_A crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with nad 0.9784 7 269
3rft-assembly1.cif.gz_A crystal structure of uronate dehydrogenase from agrobacterium tumefaciens 0.9774 7 269
3ay3-assembly2.cif.gz_D crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens 0.9678 5 265
ID Description Score Start End Superfamily
3rftA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9872 7 231 3.40.50.720
3rftA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9701 7 231 3.40.50.720
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8887 9 231 3.40.50.720
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8808 9 231 3.40.50.720
af_Q4DUZ8_1_205_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8789 8 165 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2N2TDF1-F1-model_v4 NAD-dependent dehydratase 1 3 267
AF-A0A2N2TDF1-F1-model_v4 NAD-dependent dehydratase 0.9962 3 267
AF-A0A4V1TD39-F1-model_v4 deleted 0.9959 7 183
AF-A0A529XPF8-F1-model_v4 NAD(P)-dependent oxidoreductase 0.995 139 265
AF-A0A530A7Q5-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9937 90 254

Feature Viewer

pLDDT pTM Quality
96.3 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map