F484204
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 416 | 1744 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0046679|Ga0501035_0046679_2914_3705 |
| Length | 263 |
| Sequence | VIAHPFPRPHHLRVTLDLKLGRGRTIDGMTITEQRTQTYGYSDLPGLMGLMTGDEKHGPAATSTLDVLWVLYDRVLRVGPDSADAPGRDRFLLSKGHGPMAYYAVLAAKGFLPADWLPGFSSYDSPLGHHPDRTLVPGVEIGSGSLGHGLPIAVGTALGLRAQGLHDPAVWTLIGDAELDEGSNHEAIAFAGPAGLDRLHTVVVDNSSASYARPGGIAARFEAAGWAARTVDGRDHDALYAAFTAPHPGRPHVVVARVEPKNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 84 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 131 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 132 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 134 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 135 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 136 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 137 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 138 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 139 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 140 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 141 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 142 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 143 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 147 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 148 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 149 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 152 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 156 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 157 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 159 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 161 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 171 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 172 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 173 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 177 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 178 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 179 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 180 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 181 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 182 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 183 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 184 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 185 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 186 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 187 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 196 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 297 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 342 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 343 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 344 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 345 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 347 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 349 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 350 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 351 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 352 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 353 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 354 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 355 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 356 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 357 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 358 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 359 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 360 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 361 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 362 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 363 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 364 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 365 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 366 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 367 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 368 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 369 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 370 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 371 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 372 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 373 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 374 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 375 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 376 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 377 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 378 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 379 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 380 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 381 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 382 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 383 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 384 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 385 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 386 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 387 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 388 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 389 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 390 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 391 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 392 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 393 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 394 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 395 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 396 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 397 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 398 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 399 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 400 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 401 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 402 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 403 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 404 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 405 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 406 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 407 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 408 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 409 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 410 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 411 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 412 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 413 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 414 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 415 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 416 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.39 |
| Metatranscriptomes | 0.8 |
| Isolates | 7.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.92 |
| Nodule | 0.34 |
| Rhizoplane | 3.67 |
| Rhizosphere | 86.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501035_0046679 | 3300049822 | Bacteria | 3896 |
| 2 | rootH1_10041079 | 3300003316 | Bacteria | 2974 |
| 3 | rootH1_10041079 | 3300003323 | Bacteria | 7321 |
| 4 | rootH2_10014028 | 3300003320 | Bacteria | 5668 |
| 5 | rootH2_10125902 | 3300003320 | Bacteria | 2570 |
| 6 | rootH1_10000628 | 3300003323 | Bacteria | 10860 |
| 7 | rootH1_10039347 | 3300003316 | Bacteria | 17782 |
| 8 | rootH1_10039347 | 3300003323 | Bacteria | 1765 |
| 9 | rootH1_10093147 | 3300003323 | Bacteria | 2461 |
| 10 | JGI25160J50197_1017047 | 3300003354 | Bacteria | 2317 |
| 11 | JGI25407J50210_10007407 | 3300003373 | Bacteria | 2748 |
| 12 | Ga0070658_10127072 | 3300005327 | Bacteria | 2122 |
| 13 | Ga0070683_100078557 | 3300005329 | Bacteria | 3087 |
| 14 | Ga0070683_100098482 | 3300005329 | Bacteria | 2752 |
| 15 | Ga0070683_100415034 | 3300005329 | Bacteria | 1284 |
| 16 | Ga0068868_100220600 | 3300005338 | Bacteria | 1587 |
| 17 | Ga0070660_100085794 | 3300005339 | Bacteria | 2477 |
| 18 | Ga0070660_100277059 | 3300005339 | Bacteria | 1372 |
| 19 | Ga0070661_100156503 | 3300005344 | Bacteria | 1724 |
| 20 | Ga0070661_100231090 | 3300005344 | Bacteria | 1421 |
| 21 | Ga0070661_100252855 | 3300005344 | Bacteria | 1360 |
| 22 | Ga0070661_100350152 | 3300005344 | Bacteria | 1159 |
| 23 | Ga0070692_10061483 | 3300005345 | Bacteria | 1980 |
| 24 | Ga0070692_10151247 | 3300005345 | Bacteria | 1322 |
| 25 | Ga0070668_100000654 | 3300005347 | Bacteria | 23449 |
| 26 | Ga0070675_100510288 | 3300005354 | Bacteria | 1084 |
| 27 | Ga0070674_100287931 | 3300005356 | Bacteria | 1305 |
| 28 | Ga0070659_100575541 | 3300005366 | Bacteria | 966 |
| 29 | Ga0070709_10020372 | 3300005434 | Bacteria | 3847 |
| 30 | Ga0070709_10061975 | 3300005434 | Bacteria | 2383 |
| 31 | Ga0070709_10088572 | 3300005434 | Bacteria | 2036 |
| 32 | Ga0070709_10443303 | 3300005434 | Bacteria | 977 |
| 33 | Ga0070709_10570442 | 3300005434 | Bacteria | 868 |
| 34 | Ga0070714_100003898 | 3300005435 | Bacteria | 11212 |
| 35 | Ga0070714_100004647 | 3300005435 | Bacteria | 10363 |
| 36 | Ga0070714_100004987 | 3300005435 | Bacteria | 10091 |
| 37 | Ga0070714_100046062 | 3300005435 | Bacteria | 3698 |
| 38 | Ga0070714_100097787 | 3300005435 | Bacteria | 2581 |
| 39 | Ga0070714_100297154 | 3300005435 | Bacteria | 1504 |
| 40 | Ga0070714_100411550 | 3300005435 | Bacteria | 1280 |
| 41 | Ga0070714_100648059 | 3300005435 | Bacteria | 1017 |
| 42 | Ga0070714_101164355 | 3300005435 | Bacteria | 752 |
| 43 | Ga0070713_100010129 | 3300005436 | Bacteria | 6798 |
| 44 | Ga0070713_100017234 | 3300005436 | Bacteria | 5457 |
| 45 | Ga0070713_100291471 | 3300005436 | Bacteria | 1500 |
| 46 | Ga0070710_10000044 | 3300005437 | Bacteria | 58112 |
| 47 | Ga0070710_10000818 | 3300005437 | Bacteria | 14979 |
| 48 | Ga0070710_10026061 | 3300005437 | Bacteria | 3102 |
| 49 | Ga0070711_100007336 | 3300005439 | Bacteria | 6709 |
| 50 | Ga0070711_100198319 | 3300005439 | Bacteria | 1547 |
| 51 | Ga0070711_100471871 | 3300005439 | Bacteria | 1030 |
| 52 | Ga0070705_100273482 | 3300005440 | Bacteria | 1197 |
| 53 | Ga0070705_100517345 | 3300005440 | Bacteria | 909 |
| 54 | Ga0070694_100024596 | 3300005444 | Bacteria | 3888 |
| 55 | Ga0070694_100146697 | 3300005444 | Bacteria | 1719 |
| 56 | Ga0070708_100022119 | 3300005445 | Bacteria | 5389 |
| 57 | Ga0070708_100203359 | 3300005445 | Bacteria | 1854 |
| 58 | Ga0070663_100000249 | 3300005455 | Bacteria | 27248 |
| 59 | Ga0070663_100109548 | 3300005455 | Bacteria | 2073 |
| 60 | Ga0070678_100221563 | 3300005456 | Bacteria | 1573 |
| 61 | Ga0070678_100386459 | 3300005456 | Bacteria | 1212 |
| 62 | Ga0070678_100499511 | 3300005456 | Bacteria | 1073 |
| 63 | Ga0070681_10012815 | 3300005458 | Bacteria | 8322 |
| 64 | Ga0070681_10075300 | 3300005458 | Bacteria | 3335 |
| 65 | Ga0070681_10235076 | 3300005458 | Bacteria | 1747 |
| 66 | Ga0070681_10398382 | 3300005458 | Bacteria | 1288 |
| 67 | Ga0070685_10476091 | 3300005466 | Bacteria | 879 |
| 68 | Ga0070706_100007732 | 3300005467 | Bacteria | 10053 |
| 69 | Ga0070707_100007169 | 3300005468 | Bacteria | 10338 |
| 70 | Ga0070707_100042733 | 3300005468 | Bacteria | 4339 |
| 71 | Ga0070707_100124832 | 3300005468 | Bacteria | 2500 |
| 72 | Ga0070698_100003266 | 3300005471 | Bacteria | 17815 |
| 73 | Ga0070699_100374721 | 3300005518 | Bacteria | 1284 |
| 74 | Ga0070699_100402406 | 3300005518 | Bacteria | 1238 |
| 75 | Ga0070679_100029541 | 3300005530 | Bacteria | 5409 |
| 76 | Ga0070679_100060535 | 3300005530 | Bacteria | 3773 |
| 77 | Ga0070679_100173536 | 3300005530 | Bacteria | 2128 |
| 78 | Ga0070679_100270356 | 3300005530 | Bacteria | 1654 |
| 79 | Ga0070684_100179038 | 3300005535 | Bacteria | 1927 |
| 80 | Ga0070697_100017778 | 3300005536 | Bacteria | 5599 |
| 81 | Ga0068853_100149931 | 3300005539 | Bacteria | 2099 |
| 82 | Ga0068853_100271296 | 3300005539 | Bacteria | 1562 |
| 83 | Ga0070686_100150353 | 3300005544 | Bacteria | 1630 |
| 84 | Ga0070686_100193517 | 3300005544 | Bacteria | 1453 |
| 85 | Ga0070686_100255985 | 3300005544 | Bacteria | 1281 |
| 86 | Ga0070665_100001537 | 3300005548 | Bacteria | 26667 |
| 87 | Ga0070665_100058138 | 3300005548 | Bacteria | 3877 |
| 88 | Ga0070704_100007703 | 3300005549 | Bacteria | 6418 |
| 89 | Ga0068855_100039742 | 3300005563 | Bacteria | 5585 |
| 90 | Ga0068857_100073213 | 3300005577 | Bacteria | 3052 |
| 91 | Ga0068854_100101835 | 3300005578 | Bacteria | 2154 |
| 92 | Ga0068854_100114116 | 3300005578 | Bacteria | 2042 |
| 93 | Ga0068854_100143513 | 3300005578 | Bacteria | 1834 |
| 94 | Ga0068854_100216504 | 3300005578 | Bacteria | 1513 |
| 95 | Ga0068854_100436146 | 3300005578 | Bacteria | 1091 |
| 96 | Ga0068856_100024430 | 3300005614 | Bacteria | 5883 |
| 97 | Ga0068856_100145850 | 3300005614 | Bacteria | 2374 |
| 98 | Ga0068856_100163980 | 3300005614 | Bacteria | 2233 |
| 99 | Ga0068856_100201100 | 3300005614 | Bacteria | 2007 |
| 100 | Ga0068856_100529393 | 3300005614 | Bacteria | 1200 |
| 101 | Ga0070702_100125197 | 3300005615 | Bacteria | 1615 |
| 102 | Ga0068863_100253152 | 3300005841 | Bacteria | 1701 |
| 103 | Ga0068863_100358061 | 3300005841 | Bacteria | 1422 |
| 104 | Ga0081455_10000155 | 3300005937 | Bacteria | 82490 |
| 105 | Ga0081455_10012770 | 3300005937 | Bacteria | 8351 |
| 106 | Ga0081455_10061058 | 3300005937 | Bacteria | 3174 |
| 107 | Ga0081455_10108634 | 3300005937 | Bacteria | 2209 |
| 108 | Ga0081455_10181745 | 3300005937 | Bacteria | 1591 |
| 109 | Ga0081538_10000092 | 3300005981 | Bacteria | 87123 |
| 110 | Ga0081540_1011819 | 3300005983 | Bacteria | 5800 |
| 111 | Ga0070717_10191264 | 3300006028 | Bacteria | 1788 |
| 112 | Ga0070717_10274218 | 3300006028 | Bacteria | 1494 |
| 113 | Ga0070717_10405128 | 3300006028 | Bacteria | 1226 |
| 114 | Ga0070715_10000604 | 3300006163 | Bacteria | 9491 |
| 115 | Ga0070715_10067979 | 3300006163 | Bacteria | 1583 |
| 116 | Ga0070715_10250047 | 3300006163 | Bacteria | 926 |
| 117 | Ga0070716_100014234 | 3300006173 | Bacteria | 4072 |
| 118 | Ga0070716_100135036 | 3300006173 | Bacteria | 1565 |
| 119 | Ga0070712_100001324 | 3300006175 | Bacteria | 15011 |
| 120 | Ga0070712_100170326 | 3300006175 | Bacteria | 1689 |
| 121 | Ga0097621_100026603 | 3300006237 | Bacteria | 4541 |
| 122 | Ga0068871_100549039 | 3300006358 | Bacteria | 1046 |
| 123 | Ga0075428_100105427 | 3300006844 | Bacteria | 3074 |
| 124 | Ga0075430_100021727 | 3300006846 | Bacteria | 5454 |
| 125 | Ga0075431_100001884 | 3300006847 | Bacteria | 19894 |
| 126 | Ga0075431_100167210 | 3300006847 | Bacteria | 2260 |
| 127 | Ga0075434_100080611 | 3300006871 | Bacteria | 3252 |
| 128 | Ga0075434_100086392 | 3300006871 | Bacteria | 3136 |
| 129 | Ga0075434_100587729 | 3300006871 | Bacteria | 1133 |
| 130 | Ga0075429_100045340 | 3300006880 | Bacteria | 3825 |
| 131 | Ga0075435_100026088 | 3300007076 | Bacteria | 4555 |
| 132 | Ga0075435_100037406 | 3300007076 | Bacteria | 3864 |
| 133 | Ga0075435_100277727 | 3300007076 | Bacteria | 1430 |
| 134 | Ga0105250_10136370 | 3300009092 | Bacteria | 1015 |
| 135 | Ga0105240_10296540 | 3300009093 | Bacteria | 1851 |
| 136 | Ga0105240_10430336 | 3300009093 | Bacteria | 1481 |
| 137 | Ga0111539_10041947 | 3300009094 | Bacteria | 5498 |
| 138 | Ga0105245_10066020 | 3300009098 | Bacteria | 3274 |
| 139 | Ga0105245_10329610 | 3300009098 | Bacteria | 1506 |
| 140 | Ga0114129_10020245 | 3300009147 | Bacteria | 9469 |
| 141 | Ga0114129_10037757 | 3300009147 | Bacteria | 6818 |
| 142 | Ga0105243_10076132 | 3300009148 | Bacteria | 2725 |
| 143 | Ga0105237_10138217 | 3300009545 | Bacteria | 2431 |
| 144 | Ga0105237_10378399 | 3300009545 | Bacteria | 1420 |
| 145 | Ga0105238_10047445 | 3300009551 | Bacteria | 4330 |
| 146 | Ga0105238_10201226 | 3300009551 | Bacteria | 1967 |
| 147 | Ga0105249_10004292 | 3300009553 | Bacteria | 12323 |
| 148 | Ga0105249_10252720 | 3300009553 | Bacteria | 1748 |
| 149 | Ga0105239_10048937 | 3300010375 | Bacteria | 4634 |
| 150 | Ga0105239_10767357 | 3300010375 | Bacteria | 1104 |
| 151 | Ga0105239_11177322 | 3300010375 | Bacteria | 883 |
| 152 | Ga0105246_10457669 | 3300011119 | Bacteria | 1074 |
| 153 | Ga0157371_10328289 | 3300013102 | Bacteria | 1111 |
| 154 | Ga0157370_10025062 | 3300013104 | Bacteria | 5904 |
| 155 | Ga0157370_10155952 | 3300013104 | Bacteria | 2124 |
| 156 | Ga0157370_10325871 | 3300013104 | Bacteria | 1416 |
| 157 | Ga0157369_10065615 | 3300013105 | Bacteria | 3906 |
| 158 | Ga0157369_10232162 | 3300013105 | Bacteria | 1929 |
| 159 | Ga0157369_10311976 | 3300013105 | Bacteria | 1635 |
| 160 | Ga0157369_10404040 | 3300013105 | Bacteria | 1417 |
| 161 | Ga0157369_10482019 | 3300013105 | Bacteria | 1284 |
| 162 | Ga0157374_10017252 | 3300013296 | Bacteria | 6355 |
| 163 | Ga0157374_10054840 | 3300013296 | Bacteria | 3719 |
| 164 | Ga0157374_10482444 | 3300013296 | Bacteria | 1243 |
| 165 | Ga0163162_10144977 | 3300013306 | Bacteria | 2490 |
| 166 | Ga0163162_11237451 | 3300013306 | Bacteria | 848 |
| 167 | Ga0157372_10153346 | 3300013307 | Bacteria | 2660 |
| 168 | Ga0157372_10160400 | 3300013307 | Bacteria | 2599 |
| 169 | Ga0157372_10592947 | 3300013307 | Bacteria | 1292 |
| 170 | Ga0157372_10695616 | 3300013307 | Bacteria | 1183 |
| 171 | Ga0157372_10733129 | 3300013307 | Bacteria | 1149 |
| 172 | Ga0157372_10760570 | 3300013307 | Bacteria | 1126 |
| 173 | Ga0157379_10008723 | 3300014968 | Bacteria | 8835 |
| 174 | Ga0157376_10138658 | 3300014969 | Bacteria | 2179 |
| 175 | Ga0206356_10181501 | 3300020070 | Bacteria | 928 |
| 176 | Ga0206356_11179862 | 3300020070 | Bacteria | 2627 |
| 177 | Ga0206350_11409316 | 3300020080 | Bacteria | 1538 |
| 178 | Ga0206353_11671143 | 3300020082 | Bacteria | 1706 |
| 179 | Ga0206353_11785731 | 3300020082 | Bacteria | 890 |
| 180 | Ga0213875_10028304 | 3300021388 | Bacteria | 2663 |
| 181 | Ga0224712_10046583 | 3300022467 | Bacteria | 1665 |
| 182 | Ga0224712_10118669 | 3300022467 | Bacteria | 1143 |
| 183 | Ga0207692_10000357 | 3300025898 | Bacteria | 15729 |
| 184 | Ga0207692_10001795 | 3300025898 | Bacteria | 8137 |
| 185 | Ga0207692_10054028 | 3300025898 | Bacteria | 2049 |
| 186 | Ga0207692_10129548 | 3300025898 | Bacteria | 1423 |
| 187 | Ga0207688_10017141 | 3300025901 | Bacteria | 3936 |
| 188 | Ga0207647_10157646 | 3300025904 | Bacteria | 1325 |
| 189 | Ga0207685_10000722 | 3300025905 | Bacteria | 5998 |
| 190 | Ga0207685_10026039 | 3300025905 | Bacteria | 2028 |
| 191 | Ga0207699_10001097 | 3300025906 | Bacteria | 12779 |
| 192 | Ga0207699_10022227 | 3300025906 | Bacteria | 3433 |
| 193 | Ga0207699_10044847 | 3300025906 | Bacteria | 2576 |
| 194 | Ga0207699_10107805 | 3300025906 | Bacteria | 1780 |
| 195 | Ga0207699_10443580 | 3300025906 | Bacteria | 930 |
| 196 | Ga0207705_10081584 | 3300025909 | Bacteria | 2357 |
| 197 | Ga0207684_10009868 | 3300025910 | Bacteria | 8426 |
| 198 | Ga0207707_10046648 | 3300025912 | Bacteria | 3774 |
| 199 | Ga0207707_10191122 | 3300025912 | Bacteria | 1786 |
| 200 | Ga0207707_10362648 | 3300025912 | Bacteria | 1247 |
| 201 | Ga0207695_10150512 | 3300025913 | Bacteria | 2266 |
| 202 | Ga0207695_10425500 | 3300025913 | Bacteria | 1212 |
| 203 | Ga0207671_10081911 | 3300025914 | Bacteria | 2421 |
| 204 | Ga0207693_10001115 | 3300025915 | Bacteria | 24125 |
| 205 | Ga0207663_10005008 | 3300025916 | Bacteria | 6646 |
| 206 | Ga0207660_10015308 | 3300025917 | Bacteria | 5059 |
| 207 | Ga0207660_10203761 | 3300025917 | Bacteria | 1546 |
| 208 | Ga0207657_10011831 | 3300025919 | Bacteria | 8637 |
| 209 | Ga0207649_10195361 | 3300025920 | Bacteria | 1426 |
| 210 | Ga0207652_10011230 | 3300025921 | Bacteria | 7214 |
| 211 | Ga0207652_10072444 | 3300025921 | Bacteria | 2996 |
| 212 | Ga0207652_10243452 | 3300025921 | Bacteria | 1621 |
| 213 | Ga0207652_10265087 | 3300025921 | Bacteria | 1550 |
| 214 | Ga0207646_10000787 | 3300025922 | Bacteria | 41124 |
| 215 | Ga0207646_10002366 | 3300025922 | Bacteria | 22286 |
| 216 | Ga0207646_10003767 | 3300025922 | Bacteria | 16897 |
| 217 | Ga0207646_10021628 | 3300025922 | Bacteria | 5938 |
| 218 | Ga0207646_10182500 | 3300025922 | Bacteria | 1895 |
| 219 | Ga0207646_10249254 | 3300025922 | Bacteria | 1604 |
| 220 | Ga0207694_10105778 | 3300025924 | Bacteria | 2234 |
| 221 | Ga0207694_10274510 | 3300025924 | Bacteria | 1383 |
| 222 | Ga0207659_10238186 | 3300025926 | Bacteria | 1471 |
| 223 | Ga0207687_10013714 | 3300025927 | Bacteria | 5291 |
| 224 | Ga0207687_10171008 | 3300025927 | Bacteria | 1676 |
| 225 | Ga0207687_10192374 | 3300025927 | Bacteria | 1589 |
| 226 | Ga0207700_10000376 | 3300025928 | Bacteria | 26077 |
| 227 | Ga0207700_10013007 | 3300025928 | Bacteria | 5394 |
| 228 | Ga0207700_10140318 | 3300025928 | Bacteria | 1985 |
| 229 | Ga0207700_10162732 | 3300025928 | Bacteria | 1854 |
| 230 | Ga0207664_10000616 | 3300025929 | Bacteria | 24677 |
| 231 | Ga0207664_10002754 | 3300025929 | Bacteria | 11668 |
| 232 | Ga0207664_10009185 | 3300025929 | Bacteria | 6927 |
| 233 | Ga0207664_10017979 | 3300025929 | Bacteria | 5194 |
| 234 | Ga0207664_10078835 | 3300025929 | Bacteria | 2672 |
| 235 | Ga0207664_10123149 | 3300025929 | Bacteria | 2173 |
| 236 | Ga0207664_10534646 | 3300025929 | Bacteria | 1051 |
| 237 | Ga0207644_10206426 | 3300025931 | Bacteria | 1552 |
| 238 | Ga0207690_10013385 | 3300025932 | Bacteria | 4929 |
| 239 | Ga0207690_10046792 | 3300025932 | Bacteria | 2867 |
| 240 | Ga0207709_10278680 | 3300025935 | Bacteria | 1234 |
| 241 | Ga0207665_10001058 | 3300025939 | Bacteria | 18527 |
| 242 | Ga0207665_10006091 | 3300025939 | Bacteria | 8010 |
| 243 | Ga0207665_10075499 | 3300025939 | Bacteria | 2309 |
| 244 | Ga0207661_10024764 | 3300025944 | Bacteria | 4553 |
| 245 | Ga0207661_10066131 | 3300025944 | Bacteria | 2936 |
| 246 | Ga0207661_10119079 | 3300025944 | Bacteria | 2246 |
| 247 | Ga0207661_10661363 | 3300025944 | Bacteria | 960 |
| 248 | Ga0207667_10048763 | 3300025949 | Bacteria | 4476 |
| 249 | Ga0207712_10013163 | 3300025961 | Bacteria | 5302 |
| 250 | Ga0207668_10047899 | 3300025972 | Bacteria | 2929 |
| 251 | Ga0207640_10177664 | 3300025981 | Bacteria | 1593 |
| 252 | Ga0207640_10208579 | 3300025981 | Bacteria | 1486 |
| 253 | Ga0207640_10565608 | 3300025981 | Bacteria | 957 |
| 254 | Ga0207640_10667565 | 3300025981 | Bacteria | 887 |
| 255 | Ga0207677_10466142 | 3300026023 | Bacteria | 1085 |
| 256 | Ga0207677_10495280 | 3300026023 | Bacteria | 1055 |
| 257 | Ga0207639_10262899 | 3300026041 | Bacteria | 1510 |
| 258 | Ga0207639_10581040 | 3300026041 | Bacteria | 1031 |
| 259 | Ga0207639_10622121 | 3300026041 | Bacteria | 997 |
| 260 | Ga0207678_10000065 | 3300026067 | Bacteria | 83028 |
| 261 | Ga0207678_10062607 | 3300026067 | Bacteria | 3197 |
| 262 | Ga0207678_10064141 | 3300026067 | Bacteria | 3156 |
| 263 | Ga0207702_10123146 | 3300026078 | Bacteria | 2323 |
| 264 | Ga0207702_10179579 | 3300026078 | Bacteria | 1948 |
| 265 | Ga0207702_10432098 | 3300026078 | Bacteria | 1275 |
| 266 | Ga0207702_10760291 | 3300026078 | Bacteria | 957 |
| 267 | Ga0207702_10904689 | 3300026078 | Bacteria | 874 |
| 268 | Ga0207641_10042899 | 3300026088 | Bacteria | 3797 |
| 269 | Ga0207648_11080995 | 3300026089 | Bacteria | 752 |
| 270 | Ga0207676_10102595 | 3300026095 | Bacteria | 2375 |
| 271 | Ga0207674_10032175 | 3300026116 | Bacteria | 5502 |
| 272 | Ga0207674_10060394 | 3300026116 | Bacteria | 3834 |
| 273 | Ga0207675_100608683 | 3300026118 | Bacteria | 1096 |
| 274 | Ga0207683_10187873 | 3300026121 | Bacteria | 1875 |
| 275 | Ga0207683_10290806 | 3300026121 | Bacteria | 1494 |
| 276 | Ga0207698_10431311 | 3300026142 | Bacteria | 1267 |
| 277 | Ga0268266_10003180 | 3300028379 | Bacteria | 16659 |
| 278 | Ga0268266_10071603 | 3300028379 | Bacteria | 3005 |
| 279 | Ga0268266_10272672 | 3300028379 | Bacteria | 1571 |
| 280 | Ga0268266_10700459 | 3300028379 | Bacteria | 976 |
| 281 | Ga0268266_10722210 | 3300028379 | Bacteria | 961 |
| 282 | Ga0268264_10485720 | 3300028381 | Bacteria | 1202 |
| 283 | Ga0265336_10005555 | 3300028666 | Bacteria | 4640 |
| 284 | Ga0307517_10012612 | 3300028786 | Bacteria | 11575 |
| 285 | Ga0307515_10000287 | 3300028794 | Bacteria | 123976 |
| 286 | Ga0307515_10057382 | 3300028794 | Bacteria | 5635 |
| 287 | Ga0307515_10285340 | 3300028794 | Bacteria | 1353 |
| 288 | Ga0265338_10008871 | 3300028800 | Bacteria | 12124 |
| 289 | Ga0307511_10001720 | 3300030521 | Bacteria | 23047 |
| 290 | Ga0307511_10065316 | 3300030521 | Bacteria | 2725 |
| 291 | Ga0307512_10031261 | 3300030522 | Bacteria | 4614 |
| 292 | Ga0307512_10073303 | 3300030522 | Bacteria | 2523 |
| 293 | Ga0307512_10116505 | 3300030522 | Bacteria | 1736 |
| 294 | Ga0307512_10164737 | 3300030522 | Bacteria | 1288 |
| 295 | Ga0314311_1039871 | 3300030733 | Bacteria | 9000 |
| 296 | Ga0316180_1027963 | 3300030736 | Bacteria | 2277 |
| 297 | Ga0307513_10004055 | 3300031456 | Bacteria | 19633 |
| 298 | Ga0307513_10222279 | 3300031456 | Bacteria | 1708 |
| 299 | Ga0307513_10279780 | 3300031456 | Bacteria | 1446 |
| 300 | Ga0307509_10050413 | 3300031507 | Bacteria | 4457 |
| 301 | Ga0307509_10373441 | 3300031507 | Bacteria | 1141 |
| 302 | Ga0307508_10036278 | 3300031616 | Bacteria | 4439 |
| 303 | Ga0307514_10027128 | 3300031649 | Bacteria | 4628 |
| 304 | Ga0307514_10130321 | 3300031649 | Bacteria | 1733 |
| 305 | Ga0307516_10035339 | 3300031730 | Bacteria | 5015 |
| 306 | Ga0307516_10044287 | 3300031730 | Bacteria | 4404 |
| 307 | Ga0307518_10000187 | 3300031838 | Bacteria | 47022 |
| 308 | Ga0307518_10016155 | 3300031838 | Bacteria | 5346 |
| 309 | Ga0307407_10063280 | 3300031903 | Bacteria | 2170 |
| 310 | Ga0307409_100025807 | 3300031995 | Bacteria | 4130 |
| 311 | Ga0307409_100501832 | 3300031995 | Bacteria | 1182 |
| 312 | Ga0307416_100215184 | 3300032002 | Bacteria | 1837 |
| 313 | Ga0307415_100154126 | 3300032126 | Bacteria | 1772 |
| 314 | Ga0307415_100158083 | 3300032126 | Bacteria | 1753 |
| 315 | Ga0307507_10010287 | 3300033179 | Bacteria | 12137 |
| 316 | Ga0307507_10031670 | 3300033179 | Bacteria | 5544 |
| 317 | Ga0307507_10047750 | 3300033179 | Bacteria | 4175 |
| 318 | Ga0307510_10000644 | 3300033180 | Bacteria | 35417 |
| 319 | Ga0307510_10112929 | 3300033180 | Bacteria | 2452 |
| 320 | Ga0373934_0010252 | 3300035086 | Bacteria | 3518 |
| 321 | Ga0373934_0137327 | 3300035086 | Bacteria | 999 |
| 322 | Ga0373944_0006890 | 3300035089 | Bacteria | 3033 |
| 323 | Ga0373936_0212412 | 3300035113 | Bacteria | 856 |
| 324 | Ga0373953_0019808 | 3300035117 | Bacteria | 2508 |
| 325 | Ga0373954_0054426 | 3300035118 | Bacteria | 1882 |
| 326 | Ga0373956_0011043 | 3300035119 | Bacteria | 3719 |
| 327 | Ga0373956_0122307 | 3300035119 | Bacteria | 1216 |
| 328 | Ga0373957_0041995 | 3300035120 | Bacteria | 1724 |
| 329 | Ga0373943_0019277 | 3300035170 | Bacteria | 3136 |
| 330 | Ga0373955_0359489 | 3300035172 | Bacteria | 882 |
| 331 | Ga0373924_0024459 | 3300035410 | Bacteria | 2380 |
| 332 | Ga0373935_0087985 | 3300035692 | Bacteria | 2029 |
| 333 | Ga0373933_0077075 | 3300035724 | Bacteria | 2037 |
| 334 | Ga0373947_0371043 | 3300035725 | Bacteria | 962 |
| 335 | Ga0373937_0009708 | 3300036401 | Bacteria | 8389 |
| 336 | Ga0373937_0024043 | 3300036401 | Bacteria | 5493 |
| 337 | Ga0373937_0135353 | 3300036401 | Bacteria | 2304 |
| 338 | Ga0373925_0004007 | 3300037068 | Bacteria | 11206 |
| 339 | Ga0373925_0118650 | 3300037068 | Bacteria | 2051 |
| 340 | Ga0395899_0323570 | 3300037312 | Bacteria | 1038 |
| 341 | Ga0395900_0528046 | 3300037418 | Bacteria | 1127 |
| 342 | Ga0395898_0007795 | 3300037466 | Bacteria | 11365 |
| 343 | Ga0395898_0194689 | 3300037466 | Bacteria | 1937 |
| 344 | Ga0395898_0247181 | 3300037466 | Bacteria | 1701 |
| 345 | Ga0436364_1360402 | 3300037853 | Bacteria | 2658 |
| 346 | Ga0395901_0186849 | 3300038443 | Bacteria | 2173 |
| 347 | Ga0395901_0235728 | 3300038443 | Bacteria | 1910 |
| 348 | Ga0436365_0278358 | 3300039437 | Bacteria | 4336 |
| 349 | Ga0439436_0004403 | 3300041404 | Bacteria | 4312 |
| 350 | Ga0439436_0016465 | 3300041404 | Bacteria | 2217 |
| 351 | Ga0439436_0032644 | 3300041404 | Bacteria | 1509 |
| 352 | Ga0439438_042727 | 3300041405 | Bacteria | 1172 |
| 353 | Ga0439439_0003198 | 3300041406 | Bacteria | 3588 |
| 354 | Ga0439439_0010488 | 3300041406 | Bacteria | 2216 |
| 355 | Ga0451802_1162497 | 3300041460 | Bacteria | 831 |
| 356 | Ga0451837_1577462 | 3300041494 | Bacteria | 2969 |
| 357 | Ga0451853_1404968 | 3300041512 | Bacteria | 3970 |
| 358 | Ga0451853_2550968 | 3300041512 | Bacteria | 2847 |
| 359 | Ga0439433_0001272 | 3300041999 | Bacteria | 5209 |
| 360 | Ga0439442_009247 | 3300042002 | Bacteria | 1993 |
| 361 | Ga0439442_023112 | 3300042002 | Bacteria | 1292 |
| 362 | Ga0439442_039778 | 3300042002 | Bacteria | 986 |
| 363 | Ga0439448_0041472 | 3300042005 | Bacteria | 1489 |
| 364 | Ga0439432_085318 | 3300042006 | Bacteria | 953 |
| 365 | Ga0439449_0093824 | 3300042007 | Bacteria | 1108 |
| 366 | Ga0439457_001153 | 3300042014 | Bacteria | 7949 |
| 367 | Ga0439462_0095769 | 3300042015 | Bacteria | 816 |
| 368 | Ga0450900_023064 | 3300042136 | Bacteria | 877 |
| 369 | Ga0450903_000178 | 3300042138 | Bacteria | 13985 |
| 370 | Ga0439446_0023092 | 3300042156 | Bacteria | 1767 |
| 371 | Ga0439458_0000694 | 3300042157 | Bacteria | 8705 |
| 372 | Ga0466969_0017309 | 3300044656 | Bacteria | 3765 |
| 373 | Ga0466972_0007816 | 3300044658 | Bacteria | 5365 |
| 374 | Ga0466972_0012228 | 3300044658 | Bacteria | 4315 |
| 375 | Ga0466972_0014301 | 3300044658 | Bacteria | 3976 |
| 376 | Ga0466972_0023889 | 3300044658 | Bacteria | 3037 |
| 377 | Ga0466965_0000544 | 3300044683 | Bacteria | 13582 |
| 378 | Ga0466965_0027756 | 3300044683 | Bacteria | 2748 |
| 379 | Ga0466965_0071861 | 3300044683 | Bacteria | 1741 |
| 380 | Ga0466965_0081301 | 3300044683 | Bacteria | 1638 |
| 381 | Ga0466966_0010560 | 3300044684 | Bacteria | 6138 |
| 382 | Ga0466966_0012306 | 3300044684 | Bacteria | 5669 |
| 383 | Ga0466966_0118121 | 3300044684 | Unclassified | 1631 |
| 384 | Ga0466961_0016316 | 3300044693 | Bacteria | 4770 |
| 385 | Ga0466961_0107037 | 3300044693 | Bacteria | 1760 |
| 386 | Ga0466961_0370172 | 3300044693 | Unclassified | 871 |
| 387 | Ga0466961_0388562 | 3300044693 | Bacteria | 847 |
| 388 | Ga0466963_0026338 | 3300044694 | Bacteria | 3718 |
| 389 | Ga0466963_0036762 | 3300044694 | Bacteria | 3194 |
| 390 | Ga0466963_0057304 | 3300044694 | Bacteria | 2595 |
| 391 | Ga0466963_0117072 | 3300044694 | Bacteria | 1831 |
| 392 | Ga0466964_0052239 | 3300044706 | Bacteria | 1680 |
| 393 | Ga0466964_0134798 | 3300044706 | Bacteria | 1129 |
| 394 | Ga0466971_0002653 | 3300044719 | Bacteria | 7553 |
| 395 | Ga0466971_0009135 | 3300044719 | Bacteria | 4334 |
| 396 | Ga0466968_0001070 | 3300044735 | Bacteria | 9698 |
| 397 | Ga0466968_0005233 | 3300044735 | Bacteria | 4860 |
| 398 | Ga0466968_0083235 | 3300044735 | Bacteria | 1409 |
| 399 | Ga0466968_0124218 | 3300044735 | Bacteria | 1170 |
| 400 | Ga0466970_0001010 | 3300044765 | Bacteria | 13557 |
| 401 | Ga0466970_0017784 | 3300044765 | Bacteria | 3675 |
| 402 | Ga0466970_0066150 | 3300044765 | Bacteria | 1940 |
| 403 | Ga0466970_0119208 | 3300044765 | Bacteria | 1445 |
| 404 | Ga0466970_0119308 | 3300044765 | Bacteria | 1444 |
| 405 | Ga0466970_0143464 | 3300044765 | Bacteria | 1316 |
| 406 | Ga0466970_0221070 | 3300044765 | Bacteria | 1057 |
| 407 | Ga0466970_0252014 | 3300044765 | Bacteria | 989 |
| 408 | Ga0466957_0006437 | 3300044842 | Bacteria | 6631 |
| 409 | Ga0466957_0042974 | 3300044842 | Bacteria | 2735 |
| 410 | Ga0466957_0065104 | 3300044842 | Bacteria | 2244 |
| 411 | Ga0466957_0110442 | 3300044842 | Bacteria | 1743 |
| 412 | Ga0466957_0198397 | 3300044842 | Bacteria | 1317 |
| 413 | Ga0466960_0003032 | 3300044901 | Bacteria | 6411 |
| 414 | Ga0466960_0008740 | 3300044901 | Bacteria | 4157 |
| 415 | Ga0466959_0107109 | 3300045049 | Bacteria | 1998 |
| 416 | Ga0466958_0000718 | 3300045836 | Bacteria | 14480 |
| 417 | Ga0466958_0033825 | 3300045836 | Bacteria | 3047 |
| 418 | Ga0466958_0049358 | 3300045836 | Bacteria | 2546 |
| 419 | Ga0466958_0104637 | 3300045836 | Bacteria | 1763 |
| 420 | Ga0466958_0109359 | 3300045836 | Bacteria | 1725 |
| 421 | Ga0466958_0156201 | 3300045836 | Bacteria | 1440 |
| 422 | Ga0466958_0226848 | 3300045836 | Bacteria | 1192 |
| 423 | Ga0466967_0026337 | 3300045976 | Bacteria | 4815 |
| 424 | Ga0466967_0076001 | 3300045976 | Bacteria | 3020 |
| 425 | Ga0466967_0206357 | 3300045976 | Bacteria | 1863 |
| 426 | Ga0466967_0231742 | 3300045976 | Bacteria | 1758 |
| 427 | Ga0466967_0233958 | 3300045976 | Bacteria | 1750 |
| 428 | Ga0466967_0272735 | 3300045976 | Bacteria | 1621 |
| 429 | Ga0466967_0345556 | 3300045976 | Bacteria | 1439 |
| 430 | Ga0466967_0899349 | 3300045976 | Bacteria | 880 |
| 431 | Ga0495617_049616 | 3300046452 | Bacteria | 1396 |
| 432 | Ga0495592_0013138 | 3300046454 | Bacteria | 6302 |
| 433 | Ga0495592_0017645 | 3300046454 | Bacteria | 5424 |
| 434 | Ga0495592_0032833 | 3300046454 | Bacteria | 3915 |
| 435 | Ga0495592_0168274 | 3300046454 | Bacteria | 1502 |
| 436 | Ga0495592_0278936 | 3300046454 | Bacteria | 1094 |
| 437 | Ga0495603_0000038 | 3300046455 | Bacteria | 56885 |
| 438 | Ga0495603_0005963 | 3300046455 | Bacteria | 7286 |
| 439 | Ga0495603_0033390 | 3300046455 | Bacteria | 3096 |
| 440 | Ga0495603_0055304 | 3300046455 | Bacteria | 2351 |
| 441 | Ga0495629_0005692 | 3300046459 | Bacteria | 9307 |
| 442 | Ga0495629_0006176 | 3300046459 | Bacteria | 8897 |
| 443 | Ga0495629_0020835 | 3300046459 | Bacteria | 4679 |
| 444 | Ga0495629_0040143 | 3300046459 | Bacteria | 3292 |
| 445 | Ga0495629_0125586 | 3300046459 | Bacteria | 1787 |
| 446 | Ga0495629_0174973 | 3300046459 | Bacteria | 1489 |
| 447 | Ga0495629_0335109 | 3300046459 | Bacteria | 1033 |
| 448 | Ga0495638_0073293 | 3300046460 | Bacteria | 2090 |
| 449 | Ga0495638_0197410 | 3300046460 | Bacteria | 1138 |
| 450 | Ga0495651_0002692 | 3300046462 | Bacteria | 13787 |
| 451 | Ga0495651_0007293 | 3300046462 | Bacteria | 8453 |
| 452 | Ga0495651_0248148 | 3300046462 | Bacteria | 1217 |
| 453 | Ga0495653_0077176 | 3300046463 | Bacteria | 2474 |
| 454 | Ga0495650_0023768 | 3300046471 | Bacteria | 2910 |
| 455 | Ga0495580_0069800 | 3300046472 | Bacteria | 2455 |
| 456 | Ga0495580_0101543 | 3300046472 | Bacteria | 2000 |
| 457 | Ga0495582_0039185 | 3300046473 | Bacteria | 2609 |
| 458 | Ga0495605_0107843 | 3300046474 | Bacteria | 1274 |
| 459 | Ga0495639_0021326 | 3300046475 | Bacteria | 2834 |
| 460 | Ga0495662_0000436 | 3300046476 | Bacteria | 18733 |
| 461 | Ga0495662_0022526 | 3300046476 | Bacteria | 3041 |
| 462 | Ga0495662_0095002 | 3300046476 | Bacteria | 1456 |
| 463 | Ga0495662_0099497 | 3300046476 | Bacteria | 1422 |
| 464 | Ga0495662_0101616 | 3300046476 | Bacteria | 1406 |
| 465 | Ga0495664_0013903 | 3300046477 | Bacteria | 4562 |
| 466 | Ga0495664_0193671 | 3300046477 | Bacteria | 1232 |
| 467 | Ga0495664_0378265 | 3300046477 | Bacteria | 851 |
| 468 | Ga0495584_0114125 | 3300046491 | Bacteria | 1367 |
| 469 | Ga0495594_0310521 | 3300046499 | Bacteria | 898 |
| 470 | Ga0495594_0439404 | 3300046499 | Bacteria | 742 |
| 471 | Ga0495596_0102831 | 3300046500 | Bacteria | 1110 |
| 472 | Ga0495607_0037006 | 3300046501 | Bacteria | 2934 |
| 473 | Ga0495583_0056746 | 3300046506 | Bacteria | 1764 |
| 474 | Ga0495583_0100817 | 3300046506 | Bacteria | 1232 |
| 475 | Ga0495606_0004135 | 3300046507 | Bacteria | 14728 |
| 476 | Ga0495608_0000081 | 3300046511 | Bacteria | 69898 |
| 477 | Ga0495608_0076379 | 3300046511 | Bacteria | 2182 |
| 478 | Ga0495608_0187339 | 3300046511 | Bacteria | 1307 |
| 479 | Ga0495608_0299594 | 3300046511 | Bacteria | 995 |
| 480 | Ga0495610_0034625 | 3300046512 | Bacteria | 2600 |
| 481 | Ga0495616_0020462 | 3300046513 | Bacteria | 3598 |
| 482 | Ga0495618_0006775 | 3300046514 | Bacteria | 6939 |
| 483 | Ga0495618_0043697 | 3300046514 | Bacteria | 2827 |
| 484 | Ga0495618_0048910 | 3300046514 | Bacteria | 2670 |
| 485 | Ga0495618_0172146 | 3300046514 | Bacteria | 1377 |
| 486 | Ga0495620_0007810 | 3300046515 | Bacteria | 5778 |
| 487 | Ga0495620_0007954 | 3300046515 | Bacteria | 5717 |
| 488 | Ga0495628_0020871 | 3300046516 | Bacteria | 5396 |
| 489 | Ga0495628_0022627 | 3300046516 | Bacteria | 5162 |
| 490 | Ga0495628_0148447 | 3300046516 | Bacteria | 1786 |
| 491 | Ga0495628_0470603 | 3300046516 | Bacteria | 910 |
| 492 | Ga0495628_0537511 | 3300046516 | Bacteria | 840 |
| 493 | Ga0495630_0081592 | 3300046517 | Bacteria | 2440 |
| 494 | Ga0495631_0007379 | 3300046518 | Bacteria | 5593 |
| 495 | Ga0495637_0061409 | 3300046520 | Bacteria | 1541 |
| 496 | Ga0495643_0039751 | 3300046522 | Bacteria | 2571 |
| 497 | Ga0495648_0078830 | 3300046524 | Bacteria | 1882 |
| 498 | Ga0495666_0017841 | 3300046526 | Bacteria | 3535 |
| 499 | Ga0495666_0073113 | 3300046526 | Bacteria | 1627 |
| 500 | Ga0495666_0088084 | 3300046526 | Bacteria | 1466 |
| 501 | Ga0495652_0006178 | 3300046529 | Bacteria | 11176 |
| 502 | Ga0495652_0056716 | 3300046529 | Bacteria | 3325 |
| 503 | Ga0495652_0181027 | 3300046529 | Bacteria | 1617 |
| 504 | Ga0495652_0219301 | 3300046529 | Bacteria | 1430 |
| 505 | Ga0495652_0282800 | 3300046529 | Bacteria | 1214 |
| 506 | Ga0495652_0415896 | 3300046529 | Bacteria | 949 |
| 507 | Ga0495665_0126182 | 3300046531 | Bacteria | 1340 |
| 508 | Ga0495640_0003158 | 3300046533 | Bacteria | 13271 |
| 509 | Ga0495640_0072507 | 3300046533 | Bacteria | 2307 |
| 510 | Ga0495586_0059691 | 3300046535 | Bacteria | 2073 |
| 511 | Ga0495586_0200905 | 3300046535 | Bacteria | 1130 |
| 512 | Ga0495587_0020823 | 3300046536 | Bacteria | 4045 |
| 513 | Ga0495587_0021932 | 3300046536 | Bacteria | 3937 |
| 514 | Ga0495587_0051104 | 3300046536 | Bacteria | 2444 |
| 515 | Ga0495587_0092203 | 3300046536 | Bacteria | 1749 |
| 516 | Ga0495609_0079300 | 3300046538 | Bacteria | 1436 |
| 517 | Ga0495597_0048292 | 3300046542 | Bacteria | 1883 |
| 518 | Ga0495645_0012603 | 3300046543 | Bacteria | 5961 |
| 519 | Ga0495645_0014612 | 3300046543 | Bacteria | 5574 |
| 520 | Ga0495645_0014842 | 3300046543 | Bacteria | 5535 |
| 521 | Ga0495645_0043465 | 3300046543 | Bacteria | 3277 |
| 522 | Ga0495633_0045184 | 3300046558 | Bacteria | 2086 |
| 523 | Ga0495667_0001808 | 3300046559 | Bacteria | 14207 |
| 524 | Ga0495667_0047219 | 3300046559 | Bacteria | 2845 |
| 525 | Ga0495667_0094568 | 3300046559 | Bacteria | 1935 |
| 526 | Ga0495667_0119439 | 3300046559 | Bacteria | 1702 |
| 527 | Ga0495667_0163470 | 3300046559 | Bacteria | 1431 |
| 528 | Ga0495668_0062572 | 3300046616 | Bacteria | 2050 |
| 529 | Ga0495668_0269848 | 3300046616 | Bacteria | 932 |
| 530 | Ga0495634_0017179 | 3300046642 | Bacteria | 5167 |
| 531 | Ga0495634_0022096 | 3300046642 | Bacteria | 4485 |
| 532 | Ga0495634_0090584 | 3300046642 | Bacteria | 1986 |
| 533 | Ga0495634_0369246 | 3300046642 | Bacteria | 856 |
| 534 | Ga0495625_0007591 | 3300046660 | Bacteria | 9415 |
| 535 | Ga0495625_0069062 | 3300046660 | Bacteria | 2483 |
| 536 | Ga0495625_0139481 | 3300046660 | Bacteria | 1636 |
| 537 | Ga0495635_0018440 | 3300046663 | Bacteria | 4869 |
| 538 | Ga0495635_0031036 | 3300046663 | Bacteria | 3712 |
| 539 | Ga0495635_0034588 | 3300046663 | Bacteria | 3505 |
| 540 | Ga0495659_0144150 | 3300046664 | Bacteria | 953 |
| 541 | Ga0495661_0005397 | 3300046665 | Bacteria | 9088 |
| 542 | Ga0495588_0030614 | 3300046674 | Bacteria | 2705 |
| 543 | Ga0495588_0279310 | 3300046674 | Bacteria | 880 |
| 544 | Ga0495657_0018127 | 3300046675 | Bacteria | 5100 |
| 545 | Ga0495657_0020166 | 3300046675 | Bacteria | 4795 |
| 546 | Ga0495657_0118079 | 3300046675 | Bacteria | 1673 |
| 547 | Ga0495599_0004232 | 3300046678 | Bacteria | 8481 |
| 548 | Ga0495599_0394306 | 3300046678 | Bacteria | 825 |
| 549 | Ga0495623_0013779 | 3300046679 | Bacteria | 5241 |
| 550 | Ga0495623_0055675 | 3300046679 | Bacteria | 2492 |
| 551 | Ga0495623_0091737 | 3300046679 | Bacteria | 1863 |
| 552 | Ga0495623_0109229 | 3300046679 | Bacteria | 1678 |
| 553 | Ga0495623_0112950 | 3300046679 | Bacteria | 1644 |
| 554 | Ga0495646_0001725 | 3300046680 | Bacteria | 13115 |
| 555 | Ga0495646_0045970 | 3300046680 | Bacteria | 2664 |
| 556 | Ga0495646_0104388 | 3300046680 | Bacteria | 1620 |
| 557 | Ga0495646_0213872 | 3300046680 | Bacteria | 1045 |
| 558 | Ga0495647_0127657 | 3300046681 | Bacteria | 1075 |
| 559 | Ga0495658_0060078 | 3300046683 | Bacteria | 2179 |
| 560 | Ga0495658_0193310 | 3300046683 | Bacteria | 1266 |
| 561 | Ga0495613_0003220 | 3300046689 | Bacteria | 12219 |
| 562 | Ga0495613_0006178 | 3300046689 | Bacteria | 8964 |
| 563 | Ga0495613_0006739 | 3300046689 | Bacteria | 8578 |
| 564 | Ga0495624_0014308 | 3300046690 | Bacteria | 5387 |
| 565 | Ga0495624_0075002 | 3300046690 | Bacteria | 2101 |
| 566 | Ga0495624_0263790 | 3300046690 | Bacteria | 1041 |
| 567 | Ga0495624_0362501 | 3300046690 | Bacteria | 871 |
| 568 | Ga0495670_0135427 | 3300046691 | Bacteria | 1286 |
| 569 | Ga0495649_0165816 | 3300046694 | Bacteria | 1157 |
| 570 | Ga0495589_0052307 | 3300046794 | Bacteria | 2018 |
| 571 | Ga0495589_0058130 | 3300046794 | Bacteria | 1902 |
| 572 | Ga0495589_0227350 | 3300046794 | Bacteria | 875 |
| 573 | Ga0495600_0014821 | 3300046809 | Bacteria | 4917 |
| 574 | Ga0495600_0053305 | 3300046809 | Bacteria | 2641 |
| 575 | Ga0495600_0054859 | 3300046809 | Bacteria | 2603 |
| 576 | Ga0495600_0076318 | 3300046809 | Bacteria | 2188 |
| 577 | Ga0495600_0110322 | 3300046809 | Bacteria | 1791 |
| 578 | Ga0495660_0132716 | 3300046810 | Bacteria | 1247 |
| 579 | Ga0495581_0025349 | 3300047315 | Bacteria | 3438 |
| 580 | Ga0495604_0001681 | 3300047317 | Bacteria | 18210 |
| 581 | Ga0495604_0008372 | 3300047317 | Bacteria | 8177 |
| 582 | Ga0495604_0016027 | 3300047317 | Bacteria | 5985 |
| 583 | Ga0495604_0016764 | 3300047317 | Bacteria | 5860 |
| 584 | Ga0495604_0020734 | 3300047317 | Bacteria | 5248 |
| 585 | Ga0495604_0082937 | 3300047317 | Bacteria | 2396 |
| 586 | Ga0495604_0167809 | 3300047317 | Bacteria | 1546 |
| 587 | Ga0495636_0000492 | 3300047318 | Bacteria | 14555 |
| 588 | Ga0495674_0037074 | 3300047319 | Bacteria | 4383 |
| 589 | Ga0495674_0120604 | 3300047319 | Bacteria | 2215 |
| 590 | Ga0495674_0179803 | 3300047319 | Bacteria | 1762 |
| 591 | Ga0495674_0619876 | 3300047319 | Bacteria | 855 |
| 592 | Ga0495672_0238441 | 3300047320 | Bacteria | 889 |
| 593 | Ga0495676_0001378 | 3300047321 | Bacteria | 20945 |
| 594 | Ga0495676_0016397 | 3300047321 | Bacteria | 6579 |
| 595 | Ga0495676_0026048 | 3300047321 | Bacteria | 5039 |
| 596 | Ga0495676_0055392 | 3300047321 | Bacteria | 3144 |
| 597 | Ga0495676_0063378 | 3300047321 | Bacteria | 2881 |
| 598 | Ga0495680_0002145 | 3300047322 | Bacteria | 20477 |
| 599 | Ga0495680_0010272 | 3300047322 | Bacteria | 8351 |
| 600 | Ga0495680_0027595 | 3300047322 | Bacteria | 4662 |
| 601 | Ga0495680_0300721 | 3300047322 | Bacteria | 1126 |
| 602 | Ga0495683_0057405 | 3300047323 | Bacteria | 1935 |
| 603 | Ga0495683_0081415 | 3300047323 | Bacteria | 1578 |
| 604 | Ga0495687_001283 | 3300047443 | Bacteria | 23656 |
| 605 | Ga0495687_016780 | 3300047443 | Bacteria | 3672 |
| 606 | Ga0495687_023981 | 3300047443 | Bacteria | 2907 |
| 607 | Ga0495687_073012 | 3300047443 | Bacteria | 1368 |
| 608 | Ga0495675_0004402 | 3300047444 | Bacteria | 8523 |
| 609 | Ga0495675_0011001 | 3300047444 | Bacteria | 5671 |
| 610 | Ga0495675_0027857 | 3300047444 | Bacteria | 3601 |
| 611 | Ga0495675_0031352 | 3300047444 | Bacteria | 3393 |
| 612 | Ga0495675_0254291 | 3300047444 | Bacteria | 1054 |
| 613 | Ga0495677_0094727 | 3300047445 | Bacteria | 1127 |
| 614 | Ga0495685_009381 | 3300047447 | Bacteria | 3266 |
| 615 | Ga0495685_038671 | 3300047447 | Bacteria | 1634 |
| 616 | Ga0495685_092965 | 3300047447 | Bacteria | 998 |
| 617 | Ga0495681_0016334 | 3300047470 | Bacteria | 4164 |
| 618 | Ga0495684_0002552 | 3300047471 | Bacteria | 14487 |
| 619 | Ga0495684_0030858 | 3300047471 | Bacteria | 4114 |
| 620 | Ga0495684_0067917 | 3300047471 | Bacteria | 2711 |
| 621 | Ga0495593_0021941 | 3300047673 | Bacteria | 3562 |
| 622 | Ga0495593_0026111 | 3300047673 | Bacteria | 3228 |
| 623 | Ga0495593_0048634 | 3300047673 | Bacteria | 2253 |
| 624 | Ga0495593_0061116 | 3300047673 | Bacteria | 1971 |
| 625 | Ga0495602_0036878 | 3300048088 | Bacteria | 4544 |
| 626 | Ga0495602_0039724 | 3300048088 | Bacteria | 4328 |
| 627 | Ga0495602_0091463 | 3300048088 | Bacteria | 2523 |
| 628 | Ga0495602_0096673 | 3300048088 | Bacteria | 2435 |
| 629 | Ga0495602_0248473 | 3300048088 | Bacteria | 1327 |
| 630 | Ga0495602_0297058 | 3300048088 | Bacteria | 1183 |
| 631 | Ga0495614_0003869 | 3300048089 | Bacteria | 6729 |
| 632 | Ga0495614_0018379 | 3300048089 | Bacteria | 3028 |
| 633 | Ga0495614_0021021 | 3300048089 | Bacteria | 2821 |
| 634 | Ga0495614_0060964 | 3300048089 | Bacteria | 1620 |
| 635 | Ga0495614_0076287 | 3300048089 | Bacteria | 1449 |
| 636 | Ga0495614_0172222 | 3300048089 | Bacteria | 971 |
| 637 | Ga0496100_0119412 | 3300048903 | Bacteria | 1842 |
| 638 | Ga0496101_0030634 | 3300048904 | Bacteria | 3774 |
| 639 | Ga0496102_0031505 | 3300048905 | Bacteria | 4757 |
| 640 | Ga0496102_0048348 | 3300048905 | Bacteria | 3868 |
| 641 | Ga0496103_0176207 | 3300048906 | Bacteria | 1374 |
| 642 | Ga0496104_0026135 | 3300048907 | Bacteria | 5386 |
| 643 | Ga0496104_0056091 | 3300048907 | Bacteria | 3725 |
| 644 | Ga0496104_0595854 | 3300048907 | Bacteria | 1015 |
| 645 | Ga0496105_0004683 | 3300048908 | Bacteria | 10311 |
| 646 | Ga0496105_0017025 | 3300048908 | Bacteria | 5818 |
| 647 | Ga0496105_0019234 | 3300048908 | Bacteria | 5507 |
| 648 | Ga0496106_0009222 | 3300048909 | Bacteria | 7289 |
| 649 | Ga0496106_0172434 | 3300048909 | Bacteria | 1715 |
| 650 | Ga0496107_0025625 | 3300048910 | Bacteria | 4176 |
| 651 | Ga0496107_0077109 | 3300048910 | Bacteria | 2427 |
| 652 | Ga0496107_0301326 | 3300048910 | Bacteria | 1193 |
| 653 | Ga0496107_0484911 | 3300048910 | Bacteria | 917 |
| 654 | Ga0496108_0002269 | 3300048911 | Bacteria | 15405 |
| 655 | Ga0496108_0026052 | 3300048911 | Bacteria | 4823 |
| 656 | Ga0496109_0065271 | 3300048912 | Bacteria | 3332 |
| 657 | Ga0496110_0035945 | 3300048913 | Bacteria | 4301 |
| 658 | Ga0496110_0075328 | 3300048913 | Bacteria | 2998 |
| 659 | Ga0496111_0100586 | 3300048914 | Bacteria | 2123 |
| 660 | Ga0496111_0405477 | 3300048914 | Bacteria | 1007 |
| 661 | Ga0496113_0002886 | 3300048916 | Bacteria | 10118 |
| 662 | Ga0496114_0055660 | 3300048917 | Bacteria | 3299 |
| 663 | Ga0496114_0293925 | 3300048917 | Bacteria | 1434 |
| 664 | Ga0496114_0333909 | 3300048917 | Bacteria | 1340 |
| 665 | Ga0496115_0088219 | 3300048918 | Bacteria | 2532 |
| 666 | Ga0496115_0172067 | 3300048918 | Bacteria | 1791 |
| 667 | Ga0496126_0039141 | 3300048929 | Bacteria | 4403 |
| 668 | Ga0496126_0072955 | 3300048929 | Bacteria | 3052 |
| 669 | Ga0495678_026140 | 3300049459 | Bacteria | 2496 |
| 670 | Ga0501031_0000271 | 3300049568 | Bacteria | 29369 |
| 671 | Ga0501031_0143497 | 3300049568 | Bacteria | 1560 |
| 672 | Ga0501031_0148210 | 3300049568 | Bacteria | 1533 |
| 673 | Ga0501031_0220787 | 3300049568 | Bacteria | 1234 |
| 674 | Ga0501031_0271846 | 3300049568 | Bacteria | 1100 |
| 675 | Ga0501031_0278914 | 3300049568 | Bacteria | 1084 |
| 676 | Ga0501031_0550610 | 3300049568 | Bacteria | 743 |
| 677 | Ga0501032_0000877 | 3300049569 | Bacteria | 24422 |
| 678 | Ga0501032_0211538 | 3300049569 | Bacteria | 1264 |
| 679 | Ga0501033_0001027 | 3300049570 | Bacteria | 25391 |
| 680 | Ga0501033_0007592 | 3300049570 | Bacteria | 8432 |
| 681 | Ga0501033_0007870 | 3300049570 | Bacteria | 8259 |
| 682 | Ga0501034_0001799 | 3300049571 | Bacteria | 27362 |
| 683 | Ga0501034_0005247 | 3300049571 | Bacteria | 14221 |
| 684 | Ga0501034_0031993 | 3300049571 | Bacteria | 5344 |
| 685 | Ga0501034_0110403 | 3300049571 | Bacteria | 2741 |
| 686 | Ga0501034_0179654 | 3300049571 | Bacteria | 2081 |
| 687 | Ga0501036_0001507 | 3300049572 | Bacteria | 17961 |
| 688 | Ga0501036_0010404 | 3300049572 | Bacteria | 7681 |
| 689 | Ga0501036_0089159 | 3300049572 | Bacteria | 2606 |
| 690 | Ga0501036_0172628 | 3300049572 | Bacteria | 1821 |
| 691 | Ga0501036_0207761 | 3300049572 | Bacteria | 1646 |
| 692 | Ga0501037_0002088 | 3300049573 | Bacteria | 14486 |
| 693 | Ga0501037_0100295 | 3300049573 | Bacteria | 2091 |
| 694 | Ga0501037_0226531 | 3300049573 | Bacteria | 1313 |
| 695 | Ga0501038_0003094 | 3300049574 | Bacteria | 15506 |
| 696 | Ga0501038_0117244 | 3300049574 | Bacteria | 2199 |
| 697 | Ga0501039_0049390 | 3300049575 | Bacteria | 3252 |
| 698 | Ga0501039_0051266 | 3300049575 | Bacteria | 3194 |
| 699 | Ga0501039_0103658 | 3300049575 | Bacteria | 2221 |
| 700 | Ga0501039_0118948 | 3300049575 | Bacteria | 2069 |
| 701 | Ga0501039_0238244 | 3300049575 | Bacteria | 1431 |
| 702 | Ga0501039_0287137 | 3300049575 | Bacteria | 1293 |
| 703 | Ga0501041_0039450 | 3300049577 | Bacteria | 2866 |
| 704 | Ga0501041_0225661 | 3300049577 | Bacteria | 1176 |
| 705 | Ga0501042_0008013 | 3300049578 | Bacteria | 6952 |
| 706 | Ga0501042_0036140 | 3300049578 | Bacteria | 3504 |
| 707 | Ga0501042_0074520 | 3300049578 | Bacteria | 2429 |
| 708 | Ga0501043_0002492 | 3300049579 | Bacteria | 15571 |
| 709 | Ga0501043_0005810 | 3300049579 | Bacteria | 9924 |
| 710 | Ga0501043_0174209 | 3300049579 | Bacteria | 1678 |
| 711 | Ga0501047_0000118 | 3300049581 | Bacteria | 96347 |
| 712 | Ga0501047_0011932 | 3300049581 | Bacteria | 8223 |
| 713 | Ga0501047_0188943 | 3300049581 | Bacteria | 1924 |
| 714 | Ga0501047_0364334 | 3300049581 | Bacteria | 1281 |
| 715 | Ga0501048_0000654 | 3300049582 | Bacteria | 24940 |
| 716 | Ga0501048_0073926 | 3300049582 | Bacteria | 2405 |
| 717 | Ga0501067_0005406 | 3300049583 | Bacteria | 7092 |
| 718 | Ga0501067_0009506 | 3300049583 | Bacteria | 5384 |
| 719 | Ga0501067_0011887 | 3300049583 | Bacteria | 4825 |
| 720 | Ga0501067_0032541 | 3300049583 | Bacteria | 2895 |
| 721 | Ga0501067_0180442 | 3300049583 | Bacteria | 1176 |
| 722 | Ga0501068_0142532 | 3300049584 | Bacteria | 1502 |
| 723 | Ga0501068_0289115 | 3300049584 | Bacteria | 1048 |
| 724 | Ga0501069_0001722 | 3300049585 | Bacteria | 10900 |
| 725 | Ga0501069_0002785 | 3300049585 | Bacteria | 8935 |
| 726 | Ga0501069_0115925 | 3300049585 | Bacteria | 1528 |
| 727 | Ga0501070_0002795 | 3300049586 | Bacteria | 15236 |
| 728 | Ga0501070_0004372 | 3300049586 | Bacteria | 12143 |
| 729 | Ga0501070_0007168 | 3300049586 | Bacteria | 9473 |
| 730 | Ga0501070_0007465 | 3300049586 | Bacteria | 9288 |
| 731 | Ga0501070_0433413 | 3300049586 | Bacteria | 1061 |
| 732 | Ga0501070_0593863 | 3300049586 | Unclassified | 883 |
| 733 | Ga0501071_0020808 | 3300049587 | Bacteria | 4563 |
| 734 | Ga0501071_0041076 | 3300049587 | Bacteria | 3312 |
| 735 | Ga0501071_0058236 | 3300049587 | Bacteria | 2793 |
| 736 | Ga0501071_0220168 | 3300049587 | Bacteria | 1428 |
| 737 | Ga0501072_0014056 | 3300049588 | Bacteria | 6135 |
| 738 | Ga0501072_0273549 | 3300049588 | Bacteria | 1344 |
| 739 | Ga0501073_0027549 | 3300049589 | Bacteria | 4063 |
| 740 | Ga0501074_0001645 | 3300049590 | Bacteria | 15150 |
| 741 | Ga0501074_0007423 | 3300049590 | Bacteria | 7931 |
| 742 | Ga0501074_0074161 | 3300049590 | Bacteria | 2443 |
| 743 | Ga0501074_0089998 | 3300049590 | Bacteria | 2198 |
| 744 | Ga0501074_0439644 | 3300049590 | Bacteria | 925 |
| 745 | Ga0501075_0027122 | 3300049591 | Bacteria | 4220 |
| 746 | Ga0501075_0432365 | 3300049591 | Bacteria | 1004 |
| 747 | Ga0501076_0019494 | 3300049592 | Bacteria | 5186 |
| 748 | Ga0501076_0189270 | 3300049592 | Bacteria | 1679 |
| 749 | Ga0501076_0385777 | 3300049592 | Bacteria | 1151 |
| 750 | Ga0501077_0159263 | 3300049593 | Bacteria | 1433 |
| 751 | Ga0501079_0079936 | 3300049741 | Bacteria | 2528 |
| 752 | Ga0501079_0291744 | 3300049741 | Bacteria | 1276 |
| 753 | Ga0501079_0490860 | 3300049741 | Bacteria | 965 |
| 754 | Ga0501080_0000361 | 3300049742 | Bacteria | 35108 |
| 755 | Ga0501080_0001246 | 3300049742 | Bacteria | 21206 |
| 756 | Ga0501080_0121439 | 3300049742 | Bacteria | 2421 |
| 757 | Ga0501080_0345719 | 3300049742 | Bacteria | 1344 |
| 758 | Ga0501081_0155505 | 3300049743 | Bacteria | 1645 |
| 759 | Ga0501081_0484341 | 3300049743 | Bacteria | 921 |
| 760 | Ga0501083_0176851 | 3300049744 | Bacteria | 1394 |
| 761 | Ga0501035_0003465 | 3300049822 | Bacteria | 15106 |
| 762 | Ga0501035_0022357 | 3300049822 | Bacteria | 5807 |
| 763 | Ga0501035_0051954 | 3300049822 | Bacteria | 3667 |
| 764 | Ga0501035_0239367 | 3300049822 | Bacteria | 1544 |
| 765 | Ga0501044_0005136 | 3300049823 | Bacteria | 14600 |
| 766 | Ga0501044_0078132 | 3300049823 | Bacteria | 3354 |
| 767 | Ga0501044_0288623 | 3300049823 | Bacteria | 1572 |
| 768 | Ga0501045_0111206 | 3300049824 | Bacteria | 2031 |
| 769 | Ga0501045_0179760 | 3300049824 | Bacteria | 1576 |
| 770 | Ga0501045_0221421 | 3300049824 | Bacteria | 1409 |
| 771 | Ga0501045_0228208 | 3300049824 | Bacteria | 1386 |
| 772 | Ga0501045_0294743 | 3300049824 | Bacteria | 1207 |
| 773 | nmdc:mga00v17_80174_c1 | 3300050491 | Bacteria | 2037 |
| 774 | nmdc:mga05p37_193583_c1 | 3300050507 | Bacteria | 2467 |
| 775 | nmdc:mga05p37_815_c1 | 3300050507 | Bacteria | 34870 |
| 776 | nmdc:mga09592_879_c1 | 3300050508 | Bacteria | 23524 |
| 777 | nmdc:mga0qj67_20070_c1 | 3300050509 | Bacteria | 5114 |
| 778 | nmdc:mga06r32_106_c1 | 3300050510 | Bacteria | 58645 |
| 779 | nmdc:mga06r32_1482_c1 | 3300050510 | Bacteria | 21098 |
| 780 | nmdc:mga08y16_2869_c1 | 3300050511 | Bacteria | 17731 |
| 781 | nmdc:mga0n895_166739_c1 | 3300050512 | Bacteria | 2234 |
| 782 | nmdc:mga0n895_199314_c1 | 3300050512 | Bacteria | 2033 |
| 783 | nmdc:mga0rr50_162160_c1 | 3300050513 | Bacteria | 1815 |
| 784 | Ga0495601_0023504 | 3300053077 | Bacteria | 3787 |
| 785 | Ga0495601_0105853 | 3300053077 | Bacteria | 1819 |
| 786 | Ga0495612_0164914 | 3300053078 | Bacteria | 968 |
| 787 | Ga0495655_0137651 | 3300053083 | Bacteria | 757 |
| 788 | Ga0495619_0651134 | 3300053085 | Bacteria | 718 |
| 789 | Ga0500644_0035803 | 3300053088 | Bacteria | 1611 |
| 790 | Ga0500644_0056149 | 3300053088 | Bacteria | 1370 |
| 791 | Ga0500583_0089994 | 3300053092 | Bacteria | 1493 |
| 792 | Ga0500560_003768 | 3300053107 | Bacteria | 3118 |
| 793 | Ga0500572_018074 | 3300053111 | Bacteria | 1820 |
| 794 | Ga0500573_0018878 | 3300053140 | Bacteria | 3939 |
| 795 | Ga0501084_0016029 | 3300054114 | Bacteria | 6219 |
| 796 | Ga0501084_0025730 | 3300054114 | Bacteria | 4907 |
| 797 | Ga0501084_0277760 | 3300054114 | Bacteria | 1414 |
| 798 | Ga0590075_033303 | 3300059424 | Bacteria | 1308 |
| 799 | Ga0501082_0163367 | 3300060353 | Bacteria | 1935 |
| 800 | Ga0501082_0851232 | 3300060353 | Bacteria | 798 |
| 801 | Ga0466962_0010345 | 3300061719 | Bacteria | 4482 |
| 802 | Ga0466962_0035839 | 3300061719 | Bacteria | 2374 |
| 803 | Ga0466962_0131269 | 3300061719 | Unclassified | 1211 |
| 804 | Ga0530510_0085728 | 3300061734 | Bacteria | 2295 |
| 805 | Ga0530510_0094201 | 3300061734 | Bacteria | 2187 |
| 806 | 2585300794 | 2582581312 | Bacteria | 7308206 |
| 807 | 2585304110 | 2582581313 | Bacteria | 10042643 |
| 808 | 2585312103 | 2582581314 | Bacteria | 11452267 |
| 809 | 2586059570 | 2585427649 | Bacteria | 9053857 |
| 810 | 2616698931 | 2616644814 | Bacteria | 11555299 |
| 811 | 2616905667 | 2616644941 | Bacteria | 8510691 |
| 812 | 2643761299 | 2643221548 | Bacteria | 8053412 |
| 813 | 2643901655 | 2643221578 | Bacteria | 9213798 |
| 814 | 2644014129 | 2643221601 | Bacteria | 7493239 |
| 815 | 2644175477 | 2643221631 | Bacteria | 8168043 |
| 816 | 2644407801 | 2643221673 | Bacteria | 9196637 |
| 817 | 2644459299 | 2643221682 | Bacteria | 6743283 |
| 818 | 2739367211 | 2738543034 | Bacteria | 6084756 |
| 819 | 2785339753 | 2784746763 | Bacteria | 9783172 |
| 820 | 2785373192 | 2784746768 | Bacteria | 10036182 |
| 821 | 2786674811 | 2786546132 | Bacteria | 10419719 |
| 822 | 2791913488 | 2791354901 | Bacteria | 8322202 |
| 823 | 2793981130 | 2791355406 | Bacteria | 11364898 |
| 824 | 2804849158 | 2802429296 | Bacteria | 7227771 |
| 825 | 2809591667 | 2808606522 | Bacteria | 9488490 |
| 826 | 2812354380 | 2811994879 | Bacteria | 9313447 |
| 827 | 2812482827 | 2811994917 | Bacteria | 7761064 |
| 828 | 2819696155 | 2818991463 | Bacteria | 7948711 |
| 829 | 2819743381 | 2818991472 | Bacteria | 10089953 |
| 830 | 2827634467 | 2827628540 | Bacteria | 6858585 |
| 831 | 2852636002 | 2852635781 | Bacteria | 8251373 |
| 832 | 2862383911 | 2862382967 | Bacteria | 10317375 |
| 833 | 2862507646 | 2862507626 | Bacteria | 9425308 |
| 834 | 2862576168 | 2862574272 | Bacteria | 10567477 |
| 835 | 2863410267 | 2863404153 | Bacteria | 9672205 |
| 836 | 2867374914 | 2867369537 | Bacteria | 6501581 |
| 837 | 2867436385 | 2867428634 | Bacteria | 9590268 |
| 838 | 2875397942 | 2875391855 | Bacteria | 7600475 |
| 839 | 2891330896 | 2891326441 | Bacteria | 6439512 |
| 840 | 2899364011 | 2899359706 | Bacteria | 10940472 |
| 841 | 2904768701 | 2904765812 | Bacteria | 5369154 |
| 842 | 2904772027 | 2904770941 | Bacteria | 5580202 |
| 843 | 2908812679 | 2908811453 | Bacteria | 5478616 |
| 844 | 2912716000 | 2912715099 | Bacteria | 9460473 |
| 845 | 2912728958 | 2912723979 | Bacteria | 8557534 |
| 846 | 2935392967 | 2935390628 | Bacteria | 7043367 |
| 847 | 2946046537 | 2946045630 | Bacteria | 8527308 |
| 848 | 2946071323 | 2946064051 | Bacteria | 8957905 |
| 849 | 2954009638 | 2954002825 | Bacteria | 9173742 |
| 850 | 2954680591 | 2954673503 | Bacteria | 9685905 |
| 851 | 2954683562 | 2954682443 | Bacteria | 9862841 |
| 852 | 2966599525 | 2966598605 | Bacteria | 7676064 |
| 853 | 2995470480 | 2995463766 | Bacteria | 8577691 |
| 854 | 2997455265 | 2997451912 | Bacteria | 8492419 |
| 855 | 2997605220 | 2997600082 | Bacteria | 9896405 |
| 856 | 3006397002 | 3006393351 | Bacteria | 6615579 |
| 857 | 3006488811 | 3006486233 | Bacteria | 8157040 |
| 858 | 3006494607 | 3006493962 | Bacteria | 8825450 |
| 859 | 8003322282 | 8003314358 | Bacteria | 10575343 |
| 860 | 8003323040 | 8003314358 | Bacteria | 10575343 |
| 861 | 8008564263 | 8008558824 | Bacteria | 10610750 |
| 862 | 8008575866 | 8008574985 | Bacteria | 7815457 |
| 863 | 8025535316 | 8025530807 | Bacteria | 8495698 |
| 864 | 8047713570 | 8047710418 | Bacteria | 11023148 |
| 865 | 8047900180 | 8047893842 | Bacteria | 11723082 |
| 866 | 8048133994 | 8048127548 | Bacteria | 11053136 |
| 867 | 8048358747 | 8048356638 | Bacteria | 11044339 |
| 868 | 8048377127 | 8048369669 | Bacteria | 11666822 |
| 869 | 8048386182 | 8048379754 | Bacteria | 11877923 |
| 870 | 8048411911 | 8048406513 | Bacteria | 8936924 |
| 871 | 8056062542 | 8056060235 | Bacteria | 7259403 |
| 872 | 8056212381 | 8056207758 | Bacteria | 8639239 |
| 873 | 8056836115 | 8056829672 | Bacteria | 9045328 |
| 874 | Ga0501035_0046679 | |||
| 875 | rootH1_10041079 | |||
| 876 | rootH2_10014028 | |||
| 877 | rootH2_10125902 | |||
| 878 | rootH1_10000628 | |||
| 879 | rootH1_10039347 | |||
| 880 | rootH1_10093147 | |||
| 881 | JGI25160J50197_1017047 | |||
| 882 | JGI25407J50210_10007407 | |||
| 883 | Ga0070658_10127072 | |||
| 884 | Ga0070683_100078557 | |||
| 885 | Ga0070683_100098482 | |||
| 886 | Ga0070683_100415034 | |||
| 887 | Ga0068868_100220600 | |||
| 888 | Ga0070660_100085794 | |||
| 889 | Ga0070660_100277059 | |||
| 890 | Ga0070661_100156503 | |||
| 891 | Ga0070661_100231090 | |||
| 892 | Ga0070661_100252855 | |||
| 893 | Ga0070661_100350152 | |||
| 894 | Ga0070692_10061483 | |||
| 895 | Ga0070692_10151247 | |||
| 896 | Ga0070668_100000654 | |||
| 897 | Ga0070675_100510288 | |||
| 898 | Ga0070674_100287931 | |||
| 899 | Ga0070659_100575541 | |||
| 900 | Ga0070709_10020372 | |||
| 901 | Ga0070709_10061975 | |||
| 902 | Ga0070709_10088572 | |||
| 903 | Ga0070709_10443303 | |||
| 904 | Ga0070709_10570442 | |||
| 905 | Ga0070714_100003898 | |||
| 906 | Ga0070714_100004647 | |||
| 907 | Ga0070714_100004987 | |||
| 908 | Ga0070714_100046062 | |||
| 909 | Ga0070714_100097787 | |||
| 910 | Ga0070714_100297154 | |||
| 911 | Ga0070714_100411550 | |||
| 912 | Ga0070714_100648059 | |||
| 913 | Ga0070714_101164355 | |||
| 914 | Ga0070713_100010129 | |||
| 915 | Ga0070713_100017234 | |||
| 916 | Ga0070713_100291471 | |||
| 917 | Ga0070710_10000044 | |||
| 918 | Ga0070710_10000818 | |||
| 919 | Ga0070710_10026061 | |||
| 920 | Ga0070711_100007336 | |||
| 921 | Ga0070711_100198319 | |||
| 922 | Ga0070711_100471871 | |||
| 923 | Ga0070705_100273482 | |||
| 924 | Ga0070705_100517345 | |||
| 925 | Ga0070694_100024596 | |||
| 926 | Ga0070694_100146697 | |||
| 927 | Ga0070708_100022119 | |||
| 928 | Ga0070708_100203359 | |||
| 929 | Ga0070663_100000249 | |||
| 930 | Ga0070663_100109548 | |||
| 931 | Ga0070678_100221563 | |||
| 932 | Ga0070678_100386459 | |||
| 933 | Ga0070678_100499511 | |||
| 934 | Ga0070681_10012815 | |||
| 935 | Ga0070681_10075300 | |||
| 936 | Ga0070681_10235076 | |||
| 937 | Ga0070681_10398382 | |||
| 938 | Ga0070685_10476091 | |||
| 939 | Ga0070706_100007732 | |||
| 940 | Ga0070707_100007169 | |||
| 941 | Ga0070707_100042733 | |||
| 942 | Ga0070707_100124832 | |||
| 943 | Ga0070698_100003266 | |||
| 944 | Ga0070699_100374721 | |||
| 945 | Ga0070699_100402406 | |||
| 946 | Ga0070679_100029541 | |||
| 947 | Ga0070679_100060535 | |||
| 948 | Ga0070679_100173536 | |||
| 949 | Ga0070679_100270356 | |||
| 950 | Ga0070684_100179038 | |||
| 951 | Ga0070697_100017778 | |||
| 952 | Ga0068853_100149931 | |||
| 953 | Ga0068853_100271296 | |||
| 954 | Ga0070686_100150353 | |||
| 955 | Ga0070686_100193517 | |||
| 956 | Ga0070686_100255985 | |||
| 957 | Ga0070665_100001537 | |||
| 958 | Ga0070665_100058138 | |||
| 959 | Ga0070704_100007703 | |||
| 960 | Ga0068855_100039742 | |||
| 961 | Ga0068857_100073213 | |||
| 962 | Ga0068854_100101835 | |||
| 963 | Ga0068854_100114116 | |||
| 964 | Ga0068854_100143513 | |||
| 965 | Ga0068854_100216504 | |||
| 966 | Ga0068854_100436146 | |||
| 967 | Ga0068856_100024430 | |||
| 968 | Ga0068856_100145850 | |||
| 969 | Ga0068856_100163980 | |||
| 970 | Ga0068856_100201100 | |||
| 971 | Ga0068856_100529393 | |||
| 972 | Ga0070702_100125197 | |||
| 973 | Ga0068863_100253152 | |||
| 974 | Ga0068863_100358061 | |||
| 975 | Ga0081455_10000155 | |||
| 976 | Ga0081455_10012770 | |||
| 977 | Ga0081455_10061058 | |||
| 978 | Ga0081455_10108634 | |||
| 979 | Ga0081455_10181745 | |||
| 980 | Ga0081538_10000092 | |||
| 981 | Ga0081540_1011819 | |||
| 982 | Ga0070717_10191264 | |||
| 983 | Ga0070717_10274218 | |||
| 984 | Ga0070717_10405128 | |||
| 985 | Ga0070715_10000604 | |||
| 986 | Ga0070715_10067979 | |||
| 987 | Ga0070715_10250047 | |||
| 988 | Ga0070716_100014234 | |||
| 989 | Ga0070716_100135036 | |||
| 990 | Ga0070712_100001324 | |||
| 991 | Ga0070712_100170326 | |||
| 992 | Ga0097621_100026603 | |||
| 993 | Ga0068871_100549039 | |||
| 994 | Ga0075428_100105427 | |||
| 995 | Ga0075430_100021727 | |||
| 996 | Ga0075431_100001884 | |||
| 997 | Ga0075431_100167210 | |||
| 998 | Ga0075434_100080611 | |||
| 999 | Ga0075434_100086392 | |||
| 1000 | Ga0075434_100587729 | |||
| 1001 | Ga0075429_100045340 | |||
| 1002 | Ga0075435_100026088 | |||
| 1003 | Ga0075435_100037406 | |||
| 1004 | Ga0075435_100277727 | |||
| 1005 | Ga0105250_10136370 | |||
| 1006 | Ga0105240_10296540 | |||
| 1007 | Ga0105240_10430336 | |||
| 1008 | Ga0111539_10041947 | |||
| 1009 | Ga0105245_10066020 | |||
| 1010 | Ga0105245_10329610 | |||
| 1011 | Ga0114129_10020245 | |||
| 1012 | Ga0114129_10037757 | |||
| 1013 | Ga0105243_10076132 | |||
| 1014 | Ga0105237_10138217 | |||
| 1015 | Ga0105237_10378399 | |||
| 1016 | Ga0105238_10047445 | |||
| 1017 | Ga0105238_10201226 | |||
| 1018 | Ga0105249_10004292 | |||
| 1019 | Ga0105249_10252720 | |||
| 1020 | Ga0105239_10048937 | |||
| 1021 | Ga0105239_10767357 | |||
| 1022 | Ga0105239_11177322 | |||
| 1023 | Ga0105246_10457669 | |||
| 1024 | Ga0157371_10328289 | |||
| 1025 | Ga0157370_10025062 | |||
| 1026 | Ga0157370_10155952 | |||
| 1027 | Ga0157370_10325871 | |||
| 1028 | Ga0157369_10065615 | |||
| 1029 | Ga0157369_10232162 | |||
| 1030 | Ga0157369_10311976 | |||
| 1031 | Ga0157369_10404040 | |||
| 1032 | Ga0157369_10482019 | |||
| 1033 | Ga0157374_10017252 | |||
| 1034 | Ga0157374_10054840 | |||
| 1035 | Ga0157374_10482444 | |||
| 1036 | Ga0163162_10144977 | |||
| 1037 | Ga0163162_11237451 | |||
| 1038 | Ga0157372_10153346 | |||
| 1039 | Ga0157372_10160400 | |||
| 1040 | Ga0157372_10592947 | |||
| 1041 | Ga0157372_10695616 | |||
| 1042 | Ga0157372_10733129 | |||
| 1043 | Ga0157372_10760570 | |||
| 1044 | Ga0157379_10008723 | |||
| 1045 | Ga0157376_10138658 | |||
| 1046 | Ga0206356_10181501 | |||
| 1047 | Ga0206356_11179862 | |||
| 1048 | Ga0206350_11409316 | |||
| 1049 | Ga0206353_11671143 | |||
| 1050 | Ga0206353_11785731 | |||
| 1051 | Ga0213875_10028304 | |||
| 1052 | Ga0224712_10046583 | |||
| 1053 | Ga0224712_10118669 | |||
| 1054 | Ga0207692_10000357 | |||
| 1055 | Ga0207692_10001795 | |||
| 1056 | Ga0207692_10054028 | |||
| 1057 | Ga0207692_10129548 | |||
| 1058 | Ga0207688_10017141 | |||
| 1059 | Ga0207647_10157646 | |||
| 1060 | Ga0207685_10000722 | |||
| 1061 | Ga0207685_10026039 | |||
| 1062 | Ga0207699_10001097 | |||
| 1063 | Ga0207699_10022227 | |||
| 1064 | Ga0207699_10044847 | |||
| 1065 | Ga0207699_10107805 | |||
| 1066 | Ga0207699_10443580 | |||
| 1067 | Ga0207705_10081584 | |||
| 1068 | Ga0207684_10009868 | |||
| 1069 | Ga0207707_10046648 | |||
| 1070 | Ga0207707_10191122 | |||
| 1071 | Ga0207707_10362648 | |||
| 1072 | Ga0207695_10150512 | |||
| 1073 | Ga0207695_10425500 | |||
| 1074 | Ga0207671_10081911 | |||
| 1075 | Ga0207693_10001115 | |||
| 1076 | Ga0207663_10005008 | |||
| 1077 | Ga0207660_10015308 | |||
| 1078 | Ga0207660_10203761 | |||
| 1079 | Ga0207657_10011831 | |||
| 1080 | Ga0207649_10195361 | |||
| 1081 | Ga0207652_10011230 | |||
| 1082 | Ga0207652_10072444 | |||
| 1083 | Ga0207652_10243452 | |||
| 1084 | Ga0207652_10265087 | |||
| 1085 | Ga0207646_10000787 | |||
| 1086 | Ga0207646_10002366 | |||
| 1087 | Ga0207646_10003767 | |||
| 1088 | Ga0207646_10021628 | |||
| 1089 | Ga0207646_10182500 | |||
| 1090 | Ga0207646_10249254 | |||
| 1091 | Ga0207694_10105778 | |||
| 1092 | Ga0207694_10274510 | |||
| 1093 | Ga0207659_10238186 | |||
| 1094 | Ga0207687_10013714 | |||
| 1095 | Ga0207687_10171008 | |||
| 1096 | Ga0207687_10192374 | |||
| 1097 | Ga0207700_10000376 | |||
| 1098 | Ga0207700_10013007 | |||
| 1099 | Ga0207700_10140318 | |||
| 1100 | Ga0207700_10162732 | |||
| 1101 | Ga0207664_10000616 | |||
| 1102 | Ga0207664_10002754 | |||
| 1103 | Ga0207664_10009185 | |||
| 1104 | Ga0207664_10017979 | |||
| 1105 | Ga0207664_10078835 | |||
| 1106 | Ga0207664_10123149 | |||
| 1107 | Ga0207664_10534646 | |||
| 1108 | Ga0207644_10206426 | |||
| 1109 | Ga0207690_10013385 | |||
| 1110 | Ga0207690_10046792 | |||
| 1111 | Ga0207709_10278680 | |||
| 1112 | Ga0207665_10001058 | |||
| 1113 | Ga0207665_10006091 | |||
| 1114 | Ga0207665_10075499 | |||
| 1115 | Ga0207661_10024764 | |||
| 1116 | Ga0207661_10066131 | |||
| 1117 | Ga0207661_10119079 | |||
| 1118 | Ga0207661_10661363 | |||
| 1119 | Ga0207667_10048763 | |||
| 1120 | Ga0207712_10013163 | |||
| 1121 | Ga0207668_10047899 | |||
| 1122 | Ga0207640_10177664 | |||
| 1123 | Ga0207640_10208579 | |||
| 1124 | Ga0207640_10565608 | |||
| 1125 | Ga0207640_10667565 | |||
| 1126 | Ga0207677_10466142 | |||
| 1127 | Ga0207677_10495280 | |||
| 1128 | Ga0207639_10262899 | |||
| 1129 | Ga0207639_10581040 | |||
| 1130 | Ga0207639_10622121 | |||
| 1131 | Ga0207678_10000065 | |||
| 1132 | Ga0207678_10062607 | |||
| 1133 | Ga0207678_10064141 | |||
| 1134 | Ga0207702_10123146 | |||
| 1135 | Ga0207702_10179579 | |||
| 1136 | Ga0207702_10432098 | |||
| 1137 | Ga0207702_10760291 | |||
| 1138 | Ga0207702_10904689 | |||
| 1139 | Ga0207641_10042899 | |||
| 1140 | Ga0207648_11080995 | |||
| 1141 | Ga0207676_10102595 | |||
| 1142 | Ga0207674_10032175 | |||
| 1143 | Ga0207674_10060394 | |||
| 1144 | Ga0207675_100608683 | |||
| 1145 | Ga0207683_10187873 | |||
| 1146 | Ga0207683_10290806 | |||
| 1147 | Ga0207698_10431311 | |||
| 1148 | Ga0268266_10003180 | |||
| 1149 | Ga0268266_10071603 | |||
| 1150 | Ga0268266_10272672 | |||
| 1151 | Ga0268266_10700459 | |||
| 1152 | Ga0268266_10722210 | |||
| 1153 | Ga0268264_10485720 | |||
| 1154 | Ga0265336_10005555 | |||
| 1155 | Ga0307517_10012612 | |||
| 1156 | Ga0307515_10000287 | |||
| 1157 | Ga0307515_10057382 | |||
| 1158 | Ga0307515_10285340 | |||
| 1159 | Ga0265338_10008871 | |||
| 1160 | Ga0307511_10001720 | |||
| 1161 | Ga0307511_10065316 | |||
| 1162 | Ga0307512_10031261 | |||
| 1163 | Ga0307512_10073303 | |||
| 1164 | Ga0307512_10116505 | |||
| 1165 | Ga0307512_10164737 | |||
| 1166 | Ga0314311_1039871 | |||
| 1167 | Ga0316180_1027963 | |||
| 1168 | Ga0307513_10004055 | |||
| 1169 | Ga0307513_10222279 | |||
| 1170 | Ga0307513_10279780 | |||
| 1171 | Ga0307509_10050413 | |||
| 1172 | Ga0307509_10373441 | |||
| 1173 | Ga0307508_10036278 | |||
| 1174 | Ga0307514_10027128 | |||
| 1175 | Ga0307514_10130321 | |||
| 1176 | Ga0307516_10035339 | |||
| 1177 | Ga0307516_10044287 | |||
| 1178 | Ga0307518_10000187 | |||
| 1179 | Ga0307518_10016155 | |||
| 1180 | Ga0307407_10063280 | |||
| 1181 | Ga0307409_100025807 | |||
| 1182 | Ga0307409_100501832 | |||
| 1183 | Ga0307416_100215184 | |||
| 1184 | Ga0307415_100154126 | |||
| 1185 | Ga0307415_100158083 | |||
| 1186 | Ga0307507_10010287 | |||
| 1187 | Ga0307507_10031670 | |||
| 1188 | Ga0307507_10047750 | |||
| 1189 | Ga0307510_10000644 | |||
| 1190 | Ga0307510_10112929 | |||
| 1191 | Ga0373934_0010252 | |||
| 1192 | Ga0373934_0137327 | |||
| 1193 | Ga0373944_0006890 | |||
| 1194 | Ga0373936_0212412 | |||
| 1195 | Ga0373953_0019808 | |||
| 1196 | Ga0373954_0054426 | |||
| 1197 | Ga0373956_0011043 | |||
| 1198 | Ga0373956_0122307 | |||
| 1199 | Ga0373957_0041995 | |||
| 1200 | Ga0373943_0019277 | |||
| 1201 | Ga0373955_0359489 | |||
| 1202 | Ga0373924_0024459 | |||
| 1203 | Ga0373935_0087985 | |||
| 1204 | Ga0373933_0077075 | |||
| 1205 | Ga0373947_0371043 | |||
| 1206 | Ga0373937_0009708 | |||
| 1207 | Ga0373937_0024043 | |||
| 1208 | Ga0373937_0135353 | |||
| 1209 | Ga0373925_0004007 | |||
| 1210 | Ga0373925_0118650 | |||
| 1211 | Ga0395899_0323570 | |||
| 1212 | Ga0395900_0528046 | |||
| 1213 | Ga0395898_0007795 | |||
| 1214 | Ga0395898_0194689 | |||
| 1215 | Ga0395898_0247181 | |||
| 1216 | Ga0436364_1360402 | |||
| 1217 | Ga0395901_0186849 | |||
| 1218 | Ga0395901_0235728 | |||
| 1219 | Ga0436365_0278358 | |||
| 1220 | Ga0439436_0004403 | |||
| 1221 | Ga0439436_0016465 | |||
| 1222 | Ga0439436_0032644 | |||
| 1223 | Ga0439438_042727 | |||
| 1224 | Ga0439439_0003198 | |||
| 1225 | Ga0439439_0010488 | |||
| 1226 | Ga0451802_1162497 | |||
| 1227 | Ga0451837_1577462 | |||
| 1228 | Ga0451853_1404968 | |||
| 1229 | Ga0451853_2550968 | |||
| 1230 | Ga0439433_0001272 | |||
| 1231 | Ga0439442_009247 | |||
| 1232 | Ga0439442_023112 | |||
| 1233 | Ga0439442_039778 | |||
| 1234 | Ga0439448_0041472 | |||
| 1235 | Ga0439432_085318 | |||
| 1236 | Ga0439449_0093824 | |||
| 1237 | Ga0439457_001153 | |||
| 1238 | Ga0439462_0095769 | |||
| 1239 | Ga0450900_023064 | |||
| 1240 | Ga0450903_000178 | |||
| 1241 | Ga0439446_0023092 | |||
| 1242 | Ga0439458_0000694 | |||
| 1243 | Ga0466969_0017309 | |||
| 1244 | Ga0466972_0007816 | |||
| 1245 | Ga0466972_0012228 | |||
| 1246 | Ga0466972_0014301 | |||
| 1247 | Ga0466972_0023889 | |||
| 1248 | Ga0466965_0000544 | |||
| 1249 | Ga0466965_0027756 | |||
| 1250 | Ga0466965_0071861 | |||
| 1251 | Ga0466965_0081301 | |||
| 1252 | Ga0466966_0010560 | |||
| 1253 | Ga0466966_0012306 | |||
| 1254 | Ga0466966_0118121 | |||
| 1255 | Ga0466961_0016316 | |||
| 1256 | Ga0466961_0107037 | |||
| 1257 | Ga0466961_0370172 | |||
| 1258 | Ga0466961_0388562 | |||
| 1259 | Ga0466963_0026338 | |||
| 1260 | Ga0466963_0036762 | |||
| 1261 | Ga0466963_0057304 | |||
| 1262 | Ga0466963_0117072 | |||
| 1263 | Ga0466964_0052239 | |||
| 1264 | Ga0466964_0134798 | |||
| 1265 | Ga0466971_0002653 | |||
| 1266 | Ga0466971_0009135 | |||
| 1267 | Ga0466968_0001070 | |||
| 1268 | Ga0466968_0005233 | |||
| 1269 | Ga0466968_0083235 | |||
| 1270 | Ga0466968_0124218 | |||
| 1271 | Ga0466970_0001010 | |||
| 1272 | Ga0466970_0017784 | |||
| 1273 | Ga0466970_0066150 | |||
| 1274 | Ga0466970_0119208 | |||
| 1275 | Ga0466970_0119308 | |||
| 1276 | Ga0466970_0143464 | |||
| 1277 | Ga0466970_0221070 | |||
| 1278 | Ga0466970_0252014 | |||
| 1279 | Ga0466957_0006437 | |||
| 1280 | Ga0466957_0042974 | |||
| 1281 | Ga0466957_0065104 | |||
| 1282 | Ga0466957_0110442 | |||
| 1283 | Ga0466957_0198397 | |||
| 1284 | Ga0466960_0003032 | |||
| 1285 | Ga0466960_0008740 | |||
| 1286 | Ga0466959_0107109 | |||
| 1287 | Ga0466958_0000718 | |||
| 1288 | Ga0466958_0033825 | |||
| 1289 | Ga0466958_0049358 | |||
| 1290 | Ga0466958_0104637 | |||
| 1291 | Ga0466958_0109359 | |||
| 1292 | Ga0466958_0156201 | |||
| 1293 | Ga0466958_0226848 | |||
| 1294 | Ga0466967_0026337 | |||
| 1295 | Ga0466967_0076001 | |||
| 1296 | Ga0466967_0206357 | |||
| 1297 | Ga0466967_0231742 | |||
| 1298 | Ga0466967_0233958 | |||
| 1299 | Ga0466967_0272735 | |||
| 1300 | Ga0466967_0345556 | |||
| 1301 | Ga0466967_0899349 | |||
| 1302 | Ga0495617_049616 | |||
| 1303 | Ga0495592_0013138 | |||
| 1304 | Ga0495592_0017645 | |||
| 1305 | Ga0495592_0032833 | |||
| 1306 | Ga0495592_0168274 | |||
| 1307 | Ga0495592_0278936 | |||
| 1308 | Ga0495603_0000038 | |||
| 1309 | Ga0495603_0005963 | |||
| 1310 | Ga0495603_0033390 | |||
| 1311 | Ga0495603_0055304 | |||
| 1312 | Ga0495629_0005692 | |||
| 1313 | Ga0495629_0006176 | |||
| 1314 | Ga0495629_0020835 | |||
| 1315 | Ga0495629_0040143 | |||
| 1316 | Ga0495629_0125586 | |||
| 1317 | Ga0495629_0174973 | |||
| 1318 | Ga0495629_0335109 | |||
| 1319 | Ga0495638_0073293 | |||
| 1320 | Ga0495638_0197410 | |||
| 1321 | Ga0495651_0002692 | |||
| 1322 | Ga0495651_0007293 | |||
| 1323 | Ga0495651_0248148 | |||
| 1324 | Ga0495653_0077176 | |||
| 1325 | Ga0495650_0023768 | |||
| 1326 | Ga0495580_0069800 | |||
| 1327 | Ga0495580_0101543 | |||
| 1328 | Ga0495582_0039185 | |||
| 1329 | Ga0495605_0107843 | |||
| 1330 | Ga0495639_0021326 | |||
| 1331 | Ga0495662_0000436 | |||
| 1332 | Ga0495662_0022526 | |||
| 1333 | Ga0495662_0095002 | |||
| 1334 | Ga0495662_0099497 | |||
| 1335 | Ga0495662_0101616 | |||
| 1336 | Ga0495664_0013903 | |||
| 1337 | Ga0495664_0193671 | |||
| 1338 | Ga0495664_0378265 | |||
| 1339 | Ga0495584_0114125 | |||
| 1340 | Ga0495594_0310521 | |||
| 1341 | Ga0495594_0439404 | |||
| 1342 | Ga0495596_0102831 | |||
| 1343 | Ga0495607_0037006 | |||
| 1344 | Ga0495583_0056746 | |||
| 1345 | Ga0495583_0100817 | |||
| 1346 | Ga0495606_0004135 | |||
| 1347 | Ga0495608_0000081 | |||
| 1348 | Ga0495608_0076379 | |||
| 1349 | Ga0495608_0187339 | |||
| 1350 | Ga0495608_0299594 | |||
| 1351 | Ga0495610_0034625 | |||
| 1352 | Ga0495616_0020462 | |||
| 1353 | Ga0495618_0006775 | |||
| 1354 | Ga0495618_0043697 | |||
| 1355 | Ga0495618_0048910 | |||
| 1356 | Ga0495618_0172146 | |||
| 1357 | Ga0495620_0007810 | |||
| 1358 | Ga0495620_0007954 | |||
| 1359 | Ga0495628_0020871 | |||
| 1360 | Ga0495628_0022627 | |||
| 1361 | Ga0495628_0148447 | |||
| 1362 | Ga0495628_0470603 | |||
| 1363 | Ga0495628_0537511 | |||
| 1364 | Ga0495630_0081592 | |||
| 1365 | Ga0495631_0007379 | |||
| 1366 | Ga0495637_0061409 | |||
| 1367 | Ga0495643_0039751 | |||
| 1368 | Ga0495648_0078830 | |||
| 1369 | Ga0495666_0017841 | |||
| 1370 | Ga0495666_0073113 | |||
| 1371 | Ga0495666_0088084 | |||
| 1372 | Ga0495652_0006178 | |||
| 1373 | Ga0495652_0056716 | |||
| 1374 | Ga0495652_0181027 | |||
| 1375 | Ga0495652_0219301 | |||
| 1376 | Ga0495652_0282800 | |||
| 1377 | Ga0495652_0415896 | |||
| 1378 | Ga0495665_0126182 | |||
| 1379 | Ga0495640_0003158 | |||
| 1380 | Ga0495640_0072507 | |||
| 1381 | Ga0495586_0059691 | |||
| 1382 | Ga0495586_0200905 | |||
| 1383 | Ga0495587_0020823 | |||
| 1384 | Ga0495587_0021932 | |||
| 1385 | Ga0495587_0051104 | |||
| 1386 | Ga0495587_0092203 | |||
| 1387 | Ga0495609_0079300 | |||
| 1388 | Ga0495597_0048292 | |||
| 1389 | Ga0495645_0012603 | |||
| 1390 | Ga0495645_0014612 | |||
| 1391 | Ga0495645_0014842 | |||
| 1392 | Ga0495645_0043465 | |||
| 1393 | Ga0495633_0045184 | |||
| 1394 | Ga0495667_0001808 | |||
| 1395 | Ga0495667_0047219 | |||
| 1396 | Ga0495667_0094568 | |||
| 1397 | Ga0495667_0119439 | |||
| 1398 | Ga0495667_0163470 | |||
| 1399 | Ga0495668_0062572 | |||
| 1400 | Ga0495668_0269848 | |||
| 1401 | Ga0495634_0017179 | |||
| 1402 | Ga0495634_0022096 | |||
| 1403 | Ga0495634_0090584 | |||
| 1404 | Ga0495634_0369246 | |||
| 1405 | Ga0495625_0007591 | |||
| 1406 | Ga0495625_0069062 | |||
| 1407 | Ga0495625_0139481 | |||
| 1408 | Ga0495635_0018440 | |||
| 1409 | Ga0495635_0031036 | |||
| 1410 | Ga0495635_0034588 | |||
| 1411 | Ga0495659_0144150 | |||
| 1412 | Ga0495661_0005397 | |||
| 1413 | Ga0495588_0030614 | |||
| 1414 | Ga0495588_0279310 | |||
| 1415 | Ga0495657_0018127 | |||
| 1416 | Ga0495657_0020166 | |||
| 1417 | Ga0495657_0118079 | |||
| 1418 | Ga0495599_0004232 | |||
| 1419 | Ga0495599_0394306 | |||
| 1420 | Ga0495623_0013779 | |||
| 1421 | Ga0495623_0055675 | |||
| 1422 | Ga0495623_0091737 | |||
| 1423 | Ga0495623_0109229 | |||
| 1424 | Ga0495623_0112950 | |||
| 1425 | Ga0495646_0001725 | |||
| 1426 | Ga0495646_0045970 | |||
| 1427 | Ga0495646_0104388 | |||
| 1428 | Ga0495646_0213872 | |||
| 1429 | Ga0495647_0127657 | |||
| 1430 | Ga0495658_0060078 | |||
| 1431 | Ga0495658_0193310 | |||
| 1432 | Ga0495613_0003220 | |||
| 1433 | Ga0495613_0006178 | |||
| 1434 | Ga0495613_0006739 | |||
| 1435 | Ga0495624_0014308 | |||
| 1436 | Ga0495624_0075002 | |||
| 1437 | Ga0495624_0263790 | |||
| 1438 | Ga0495624_0362501 | |||
| 1439 | Ga0495670_0135427 | |||
| 1440 | Ga0495649_0165816 | |||
| 1441 | Ga0495589_0052307 | |||
| 1442 | Ga0495589_0058130 | |||
| 1443 | Ga0495589_0227350 | |||
| 1444 | Ga0495600_0014821 | |||
| 1445 | Ga0495600_0053305 | |||
| 1446 | Ga0495600_0054859 | |||
| 1447 | Ga0495600_0076318 | |||
| 1448 | Ga0495600_0110322 | |||
| 1449 | Ga0495660_0132716 | |||
| 1450 | Ga0495581_0025349 | |||
| 1451 | Ga0495604_0001681 | |||
| 1452 | Ga0495604_0008372 | |||
| 1453 | Ga0495604_0016027 | |||
| 1454 | Ga0495604_0016764 | |||
| 1455 | Ga0495604_0020734 | |||
| 1456 | Ga0495604_0082937 | |||
| 1457 | Ga0495604_0167809 | |||
| 1458 | Ga0495636_0000492 | |||
| 1459 | Ga0495674_0037074 | |||
| 1460 | Ga0495674_0120604 | |||
| 1461 | Ga0495674_0179803 | |||
| 1462 | Ga0495674_0619876 | |||
| 1463 | Ga0495672_0238441 | |||
| 1464 | Ga0495676_0001378 | |||
| 1465 | Ga0495676_0016397 | |||
| 1466 | Ga0495676_0026048 | |||
| 1467 | Ga0495676_0055392 | |||
| 1468 | Ga0495676_0063378 | |||
| 1469 | Ga0495680_0002145 | |||
| 1470 | Ga0495680_0010272 | |||
| 1471 | Ga0495680_0027595 | |||
| 1472 | Ga0495680_0300721 | |||
| 1473 | Ga0495683_0057405 | |||
| 1474 | Ga0495683_0081415 | |||
| 1475 | Ga0495687_001283 | |||
| 1476 | Ga0495687_016780 | |||
| 1477 | Ga0495687_023981 | |||
| 1478 | Ga0495687_073012 | |||
| 1479 | Ga0495675_0004402 | |||
| 1480 | Ga0495675_0011001 | |||
| 1481 | Ga0495675_0027857 | |||
| 1482 | Ga0495675_0031352 | |||
| 1483 | Ga0495675_0254291 | |||
| 1484 | Ga0495677_0094727 | |||
| 1485 | Ga0495685_009381 | |||
| 1486 | Ga0495685_038671 | |||
| 1487 | Ga0495685_092965 | |||
| 1488 | Ga0495681_0016334 | |||
| 1489 | Ga0495684_0002552 | |||
| 1490 | Ga0495684_0030858 | |||
| 1491 | Ga0495684_0067917 | |||
| 1492 | Ga0495593_0021941 | |||
| 1493 | Ga0495593_0026111 | |||
| 1494 | Ga0495593_0048634 | |||
| 1495 | Ga0495593_0061116 | |||
| 1496 | Ga0495602_0036878 | |||
| 1497 | Ga0495602_0039724 | |||
| 1498 | Ga0495602_0091463 | |||
| 1499 | Ga0495602_0096673 | |||
| 1500 | Ga0495602_0248473 | |||
| 1501 | Ga0495602_0297058 | |||
| 1502 | Ga0495614_0003869 | |||
| 1503 | Ga0495614_0018379 | |||
| 1504 | Ga0495614_0021021 | |||
| 1505 | Ga0495614_0060964 | |||
| 1506 | Ga0495614_0076287 | |||
| 1507 | Ga0495614_0172222 | |||
| 1508 | Ga0496100_0119412 | |||
| 1509 | Ga0496101_0030634 | |||
| 1510 | Ga0496102_0031505 | |||
| 1511 | Ga0496102_0048348 | |||
| 1512 | Ga0496103_0176207 | |||
| 1513 | Ga0496104_0026135 | |||
| 1514 | Ga0496104_0056091 | |||
| 1515 | Ga0496104_0595854 | |||
| 1516 | Ga0496105_0004683 | |||
| 1517 | Ga0496105_0017025 | |||
| 1518 | Ga0496105_0019234 | |||
| 1519 | Ga0496106_0009222 | |||
| 1520 | Ga0496106_0172434 | |||
| 1521 | Ga0496107_0025625 | |||
| 1522 | Ga0496107_0077109 | |||
| 1523 | Ga0496107_0301326 | |||
| 1524 | Ga0496107_0484911 | |||
| 1525 | Ga0496108_0002269 | |||
| 1526 | Ga0496108_0026052 | |||
| 1527 | Ga0496109_0065271 | |||
| 1528 | Ga0496110_0035945 | |||
| 1529 | Ga0496110_0075328 | |||
| 1530 | Ga0496111_0100586 | |||
| 1531 | Ga0496111_0405477 | |||
| 1532 | Ga0496113_0002886 | |||
| 1533 | Ga0496114_0055660 | |||
| 1534 | Ga0496114_0293925 | |||
| 1535 | Ga0496114_0333909 | |||
| 1536 | Ga0496115_0088219 | |||
| 1537 | Ga0496115_0172067 | |||
| 1538 | Ga0496126_0039141 | |||
| 1539 | Ga0496126_0072955 | |||
| 1540 | Ga0495678_026140 | |||
| 1541 | Ga0501031_0000271 | |||
| 1542 | Ga0501031_0143497 | |||
| 1543 | Ga0501031_0148210 | |||
| 1544 | Ga0501031_0220787 | |||
| 1545 | Ga0501031_0271846 | |||
| 1546 | Ga0501031_0278914 | |||
| 1547 | Ga0501031_0550610 | |||
| 1548 | Ga0501032_0000877 | |||
| 1549 | Ga0501032_0211538 | |||
| 1550 | Ga0501033_0001027 | |||
| 1551 | Ga0501033_0007592 | |||
| 1552 | Ga0501033_0007870 | |||
| 1553 | Ga0501034_0001799 | |||
| 1554 | Ga0501034_0005247 | |||
| 1555 | Ga0501034_0031993 | |||
| 1556 | Ga0501034_0110403 | |||
| 1557 | Ga0501034_0179654 | |||
| 1558 | Ga0501036_0001507 | |||
| 1559 | Ga0501036_0010404 | |||
| 1560 | Ga0501036_0089159 | |||
| 1561 | Ga0501036_0172628 | |||
| 1562 | Ga0501036_0207761 | |||
| 1563 | Ga0501037_0002088 | |||
| 1564 | Ga0501037_0100295 | |||
| 1565 | Ga0501037_0226531 | |||
| 1566 | Ga0501038_0003094 | |||
| 1567 | Ga0501038_0117244 | |||
| 1568 | Ga0501039_0049390 | |||
| 1569 | Ga0501039_0051266 | |||
| 1570 | Ga0501039_0103658 | |||
| 1571 | Ga0501039_0118948 | |||
| 1572 | Ga0501039_0238244 | |||
| 1573 | Ga0501039_0287137 | |||
| 1574 | Ga0501041_0039450 | |||
| 1575 | Ga0501041_0225661 | |||
| 1576 | Ga0501042_0008013 | |||
| 1577 | Ga0501042_0036140 | |||
| 1578 | Ga0501042_0074520 | |||
| 1579 | Ga0501043_0002492 | |||
| 1580 | Ga0501043_0005810 | |||
| 1581 | Ga0501043_0174209 | |||
| 1582 | Ga0501047_0000118 | |||
| 1583 | Ga0501047_0011932 | |||
| 1584 | Ga0501047_0188943 | |||
| 1585 | Ga0501047_0364334 | |||
| 1586 | Ga0501048_0000654 | |||
| 1587 | Ga0501048_0073926 | |||
| 1588 | Ga0501067_0005406 | |||
| 1589 | Ga0501067_0009506 | |||
| 1590 | Ga0501067_0011887 | |||
| 1591 | Ga0501067_0032541 | |||
| 1592 | Ga0501067_0180442 | |||
| 1593 | Ga0501068_0142532 | |||
| 1594 | Ga0501068_0289115 | |||
| 1595 | Ga0501069_0001722 | |||
| 1596 | Ga0501069_0002785 | |||
| 1597 | Ga0501069_0115925 | |||
| 1598 | Ga0501070_0002795 | |||
| 1599 | Ga0501070_0004372 | |||
| 1600 | Ga0501070_0007168 | |||
| 1601 | Ga0501070_0007465 | |||
| 1602 | Ga0501070_0433413 | |||
| 1603 | Ga0501070_0593863 | |||
| 1604 | Ga0501071_0020808 | |||
| 1605 | Ga0501071_0041076 | |||
| 1606 | Ga0501071_0058236 | |||
| 1607 | Ga0501071_0220168 | |||
| 1608 | Ga0501072_0014056 | |||
| 1609 | Ga0501072_0273549 | |||
| 1610 | Ga0501073_0027549 | |||
| 1611 | Ga0501074_0001645 | |||
| 1612 | Ga0501074_0007423 | |||
| 1613 | Ga0501074_0074161 | |||
| 1614 | Ga0501074_0089998 | |||
| 1615 | Ga0501074_0439644 | |||
| 1616 | Ga0501075_0027122 | |||
| 1617 | Ga0501075_0432365 | |||
| 1618 | Ga0501076_0019494 | |||
| 1619 | Ga0501076_0189270 | |||
| 1620 | Ga0501076_0385777 | |||
| 1621 | Ga0501077_0159263 | |||
| 1622 | Ga0501079_0079936 | |||
| 1623 | Ga0501079_0291744 | |||
| 1624 | Ga0501079_0490860 | |||
| 1625 | Ga0501080_0000361 | |||
| 1626 | Ga0501080_0001246 | |||
| 1627 | Ga0501080_0121439 | |||
| 1628 | Ga0501080_0345719 | |||
| 1629 | Ga0501081_0155505 | |||
| 1630 | Ga0501081_0484341 | |||
| 1631 | Ga0501083_0176851 | |||
| 1632 | Ga0501035_0003465 | |||
| 1633 | Ga0501035_0022357 | |||
| 1634 | Ga0501035_0051954 | |||
| 1635 | Ga0501035_0239367 | |||
| 1636 | Ga0501044_0005136 | |||
| 1637 | Ga0501044_0078132 | |||
| 1638 | Ga0501044_0288623 | |||
| 1639 | Ga0501045_0111206 | |||
| 1640 | Ga0501045_0179760 | |||
| 1641 | Ga0501045_0221421 | |||
| 1642 | Ga0501045_0228208 | |||
| 1643 | Ga0501045_0294743 | |||
| 1644 | nmdc:mga00v17_80174_c1 | |||
| 1645 | nmdc:mga05p37_193583_c1 | |||
| 1646 | nmdc:mga05p37_815_c1 | |||
| 1647 | nmdc:mga09592_879_c1 | |||
| 1648 | nmdc:mga0qj67_20070_c1 | |||
| 1649 | nmdc:mga06r32_106_c1 | |||
| 1650 | nmdc:mga06r32_1482_c1 | |||
| 1651 | nmdc:mga08y16_2869_c1 | |||
| 1652 | nmdc:mga0n895_166739_c1 | |||
| 1653 | nmdc:mga0n895_199314_c1 | |||
| 1654 | nmdc:mga0rr50_162160_c1 | |||
| 1655 | Ga0495601_0023504 | |||
| 1656 | Ga0495601_0105853 | |||
| 1657 | Ga0495612_0164914 | |||
| 1658 | Ga0495655_0137651 | |||
| 1659 | Ga0495619_0651134 | |||
| 1660 | Ga0500644_0035803 | |||
| 1661 | Ga0500644_0056149 | |||
| 1662 | Ga0500583_0089994 | |||
| 1663 | Ga0500560_003768 | |||
| 1664 | Ga0500572_018074 | |||
| 1665 | Ga0500573_0018878 | |||
| 1666 | Ga0501084_0016029 | |||
| 1667 | Ga0501084_0025730 | |||
| 1668 | Ga0501084_0277760 | |||
| 1669 | Ga0590075_033303 | |||
| 1670 | Ga0501082_0163367 | |||
| 1671 | Ga0501082_0851232 | |||
| 1672 | Ga0466962_0010345 | |||
| 1673 | Ga0466962_0035839 | |||
| 1674 | Ga0466962_0131269 | |||
| 1675 | Ga0530510_0085728 | |||
| 1676 | Ga0530510_0094201 | |||
| 1677 | 2585300794 | |||
| 1678 | 2585304110 | |||
| 1679 | 2585312103 | |||
| 1680 | 2586059570 | |||
| 1681 | 2616698931 | |||
| 1682 | 2616905667 | |||
| 1683 | 2643761299 | |||
| 1684 | 2643901655 | |||
| 1685 | 2644014129 | |||
| 1686 | 2644175477 | |||
| 1687 | 2644407801 | |||
| 1688 | 2644459299 | |||
| 1689 | 2739367211 | |||
| 1690 | 2785339753 | |||
| 1691 | 2785373192 | |||
| 1692 | 2786674811 | |||
| 1693 | 2791913488 | |||
| 1694 | 2793981130 | |||
| 1695 | 2804849158 | |||
| 1696 | 2809591667 | |||
| 1697 | 2812354380 | |||
| 1698 | 2812482827 | |||
| 1699 | 2819696155 | |||
| 1700 | 2819743381 | |||
| 1701 | 2827634467 | |||
| 1702 | 2852636002 | |||
| 1703 | 2862383911 | |||
| 1704 | 2862507646 | |||
| 1705 | 2862576168 | |||
| 1706 | 2863410267 | |||
| 1707 | 2867374914 | |||
| 1708 | 2867436385 | |||
| 1709 | 2875397942 | |||
| 1710 | 2891330896 | |||
| 1711 | 2899364011 | |||
| 1712 | 2904768701 | |||
| 1713 | 2904772027 | |||
| 1714 | 2908812679 | |||
| 1715 | 2912716000 | |||
| 1716 | 2912728958 | |||
| 1717 | 2935392967 | |||
| 1718 | 2946046537 | |||
| 1719 | 2946071323 | |||
| 1720 | 2954009638 | |||
| 1721 | 2954680591 | |||
| 1722 | 2954683562 | |||
| 1723 | 2966599525 | |||
| 1724 | 2995470480 | |||
| 1725 | 2997455265 | |||
| 1726 | 2997605220 | |||
| 1727 | 3006397002 | |||
| 1728 | 3006488811 | |||
| 1729 | 3006494607 | |||
| 1730 | 8003322282 | |||
| 1731 | 8003323040 | |||
| 1732 | 8008564263 | |||
| 1733 | 8008575866 | |||
| 1734 | 8025535316 | |||
| 1735 | 8047713570 | |||
| 1736 | 8047900180 | |||
| 1737 | 8048133994 | |||
| 1738 | 8048358747 | |||
| 1739 | 8048377127 | |||
| 1740 | 8048386182 | |||
| 1741 | 8048411911 | |||
| 1742 | 8056062542 | |||
| 1743 | 8056212381 | |||
| 1744 | 8056836115 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vrb-assembly1.cif.gz_A | crystal structure of a transketolase from neisseria gonorrhoeae | 0.8712 | 12 | 227 |
| 5vrb-assembly3.cif.gz_C | crystal structure of a transketolase from neisseria gonorrhoeae | 0.8689 | 13 | 229 |
| 3rim-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis transketolase (rv1449c) | 0.8558 | 13 | 227 |
| 5i5g-assembly1.cif.gz_A-2 | crystal structure of transketolase mutant-r525l from pichia stipitis | 0.8498 | 30 | 227 |
| 5hgx-assembly1.cif.gz_A | crystal structure of transketolase mutant - h261f from pichia stipitis | 0.8476 | 26 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYT8_1_292_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8977 | 39 | 228 | 3.40.50.970 |
| af_Q58094_1_274_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8561 | 6 | 227 | 3.40.50.970 |
| 3rimD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8558 | 13 | 227 | 3.40.50.970 |
| af_Q4CW17_1_198_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8454 | 139 | 227 | 3.40.50.970 |
| 5hjeA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8451 | 14 | 227 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W9HBD8-F1-model_v4 | Transketolase (EC 2.2.1.1) | 0.9803 | 1 | 230 |
GO:0000287
GO:0004802 |
| AF-A0A1C5EZ75-F1-model_v4 | Transketolase | 0.9787 | 3 | 231 |
GO:0000287
|
| AF-A0A2P8B6X8-F1-model_v4 | deleted | 0.975 | 4 | 231 |
|
| AF-A0A754B5C4-F1-model_v4 | Transketolase | 0.9743 | 12 | 231 |
|
| AF-A0A4D4KVS4-F1-model_v4 | Transketolase N-terminal domain-containing protein | 0.9736 | 105 | 231 |
GO:0000287
|