F484204

General Info

Members Datasets Scaffolds Average Seq Length
871 416 1744 229

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0046679|Ga0501035_0046679_2914_3705
Length 263
Sequence VIAHPFPRPHHLRVTLDLKLGRGRTIDGMTITEQRTQTYGYSDLPGLMGLMTGDEKHGPAATSTLDVLWVLYDRVLRVGPDSADAPGRDRFLLSKGHGPMAYYAVLAAKGFLPADWLPGFSSYDSPLGHHPDRTLVPGVEIGSGSLGHGLPIAVGTALGLRAQGLHDPAVWTLIGDAELDEGSNHEAIAFAGPAGLDRLHTVVVDNSSASYARPGGIAARFEAAGWAARTVDGRDHDALYAAFTAPHPGRPHVVVARVEPKNA

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
134 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
135 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
136 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
174 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
177 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
180 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
181 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
182 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
183 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
184 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
272 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
273 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
274 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
275 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
276 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
320 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
321 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
341 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
342 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
343 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
344 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
345 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
346 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
348 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
349 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
350 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
351 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
352 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
353 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
354 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
355 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
356 2643221548 Streptomyces sp. Root55 Isolate Unclassified
357 2643221578 Streptomyces sp. Root63 Isolate Unclassified
358 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
359 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
360 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
361 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
362 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
363 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
364 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
365 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
366 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
367 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
368 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
369 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
370 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
371 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
372 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
373 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
374 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
375 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
376 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
377 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
378 2862574272 Streptomyces sp. AcE210 Isolate Nodule
379 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
380 2867369537 Streptomyces sp. Z26 Isolate Unclassified
381 2867428634 Streptomyces sp. RP5T Isolate Unclassified
382 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
383 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
384 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
385 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
386 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
387 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
388 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
389 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
390 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
391 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
392 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
393 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
394 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
395 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
396 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
397 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
398 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
399 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
400 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
401 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
402 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
403 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
404 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
405 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
406 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
407 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
408 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
409 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
410 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
411 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
412 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
413 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
414 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
415 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
416 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.39
Metatranscriptomes 0.8
Isolates 7.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0.34
Rhizoplane 3.67
Rhizosphere 86.8
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0046679 3300049822 Bacteria 3896
2 rootH1_10041079 3300003316 Bacteria 2974
3 rootH1_10041079 3300003323 Bacteria 7321
4 rootH2_10014028 3300003320 Bacteria 5668
5 rootH2_10125902 3300003320 Bacteria 2570
6 rootH1_10000628 3300003323 Bacteria 10860
7 rootH1_10039347 3300003316 Bacteria 17782
8 rootH1_10039347 3300003323 Bacteria 1765
9 rootH1_10093147 3300003323 Bacteria 2461
10 JGI25160J50197_1017047 3300003354 Bacteria 2317
11 JGI25407J50210_10007407 3300003373 Bacteria 2748
12 Ga0070658_10127072 3300005327 Bacteria 2122
13 Ga0070683_100078557 3300005329 Bacteria 3087
14 Ga0070683_100098482 3300005329 Bacteria 2752
15 Ga0070683_100415034 3300005329 Bacteria 1284
16 Ga0068868_100220600 3300005338 Bacteria 1587
17 Ga0070660_100085794 3300005339 Bacteria 2477
18 Ga0070660_100277059 3300005339 Bacteria 1372
19 Ga0070661_100156503 3300005344 Bacteria 1724
20 Ga0070661_100231090 3300005344 Bacteria 1421
21 Ga0070661_100252855 3300005344 Bacteria 1360
22 Ga0070661_100350152 3300005344 Bacteria 1159
23 Ga0070692_10061483 3300005345 Bacteria 1980
24 Ga0070692_10151247 3300005345 Bacteria 1322
25 Ga0070668_100000654 3300005347 Bacteria 23449
26 Ga0070675_100510288 3300005354 Bacteria 1084
27 Ga0070674_100287931 3300005356 Bacteria 1305
28 Ga0070659_100575541 3300005366 Bacteria 966
29 Ga0070709_10020372 3300005434 Bacteria 3847
30 Ga0070709_10061975 3300005434 Bacteria 2383
31 Ga0070709_10088572 3300005434 Bacteria 2036
32 Ga0070709_10443303 3300005434 Bacteria 977
33 Ga0070709_10570442 3300005434 Bacteria 868
34 Ga0070714_100003898 3300005435 Bacteria 11212
35 Ga0070714_100004647 3300005435 Bacteria 10363
36 Ga0070714_100004987 3300005435 Bacteria 10091
37 Ga0070714_100046062 3300005435 Bacteria 3698
38 Ga0070714_100097787 3300005435 Bacteria 2581
39 Ga0070714_100297154 3300005435 Bacteria 1504
40 Ga0070714_100411550 3300005435 Bacteria 1280
41 Ga0070714_100648059 3300005435 Bacteria 1017
42 Ga0070714_101164355 3300005435 Bacteria 752
43 Ga0070713_100010129 3300005436 Bacteria 6798
44 Ga0070713_100017234 3300005436 Bacteria 5457
45 Ga0070713_100291471 3300005436 Bacteria 1500
46 Ga0070710_10000044 3300005437 Bacteria 58112
47 Ga0070710_10000818 3300005437 Bacteria 14979
48 Ga0070710_10026061 3300005437 Bacteria 3102
49 Ga0070711_100007336 3300005439 Bacteria 6709
50 Ga0070711_100198319 3300005439 Bacteria 1547
51 Ga0070711_100471871 3300005439 Bacteria 1030
52 Ga0070705_100273482 3300005440 Bacteria 1197
53 Ga0070705_100517345 3300005440 Bacteria 909
54 Ga0070694_100024596 3300005444 Bacteria 3888
55 Ga0070694_100146697 3300005444 Bacteria 1719
56 Ga0070708_100022119 3300005445 Bacteria 5389
57 Ga0070708_100203359 3300005445 Bacteria 1854
58 Ga0070663_100000249 3300005455 Bacteria 27248
59 Ga0070663_100109548 3300005455 Bacteria 2073
60 Ga0070678_100221563 3300005456 Bacteria 1573
61 Ga0070678_100386459 3300005456 Bacteria 1212
62 Ga0070678_100499511 3300005456 Bacteria 1073
63 Ga0070681_10012815 3300005458 Bacteria 8322
64 Ga0070681_10075300 3300005458 Bacteria 3335
65 Ga0070681_10235076 3300005458 Bacteria 1747
66 Ga0070681_10398382 3300005458 Bacteria 1288
67 Ga0070685_10476091 3300005466 Bacteria 879
68 Ga0070706_100007732 3300005467 Bacteria 10053
69 Ga0070707_100007169 3300005468 Bacteria 10338
70 Ga0070707_100042733 3300005468 Bacteria 4339
71 Ga0070707_100124832 3300005468 Bacteria 2500
72 Ga0070698_100003266 3300005471 Bacteria 17815
73 Ga0070699_100374721 3300005518 Bacteria 1284
74 Ga0070699_100402406 3300005518 Bacteria 1238
75 Ga0070679_100029541 3300005530 Bacteria 5409
76 Ga0070679_100060535 3300005530 Bacteria 3773
77 Ga0070679_100173536 3300005530 Bacteria 2128
78 Ga0070679_100270356 3300005530 Bacteria 1654
79 Ga0070684_100179038 3300005535 Bacteria 1927
80 Ga0070697_100017778 3300005536 Bacteria 5599
81 Ga0068853_100149931 3300005539 Bacteria 2099
82 Ga0068853_100271296 3300005539 Bacteria 1562
83 Ga0070686_100150353 3300005544 Bacteria 1630
84 Ga0070686_100193517 3300005544 Bacteria 1453
85 Ga0070686_100255985 3300005544 Bacteria 1281
86 Ga0070665_100001537 3300005548 Bacteria 26667
87 Ga0070665_100058138 3300005548 Bacteria 3877
88 Ga0070704_100007703 3300005549 Bacteria 6418
89 Ga0068855_100039742 3300005563 Bacteria 5585
90 Ga0068857_100073213 3300005577 Bacteria 3052
91 Ga0068854_100101835 3300005578 Bacteria 2154
92 Ga0068854_100114116 3300005578 Bacteria 2042
93 Ga0068854_100143513 3300005578 Bacteria 1834
94 Ga0068854_100216504 3300005578 Bacteria 1513
95 Ga0068854_100436146 3300005578 Bacteria 1091
96 Ga0068856_100024430 3300005614 Bacteria 5883
97 Ga0068856_100145850 3300005614 Bacteria 2374
98 Ga0068856_100163980 3300005614 Bacteria 2233
99 Ga0068856_100201100 3300005614 Bacteria 2007
100 Ga0068856_100529393 3300005614 Bacteria 1200
101 Ga0070702_100125197 3300005615 Bacteria 1615
102 Ga0068863_100253152 3300005841 Bacteria 1701
103 Ga0068863_100358061 3300005841 Bacteria 1422
104 Ga0081455_10000155 3300005937 Bacteria 82490
105 Ga0081455_10012770 3300005937 Bacteria 8351
106 Ga0081455_10061058 3300005937 Bacteria 3174
107 Ga0081455_10108634 3300005937 Bacteria 2209
108 Ga0081455_10181745 3300005937 Bacteria 1591
109 Ga0081538_10000092 3300005981 Bacteria 87123
110 Ga0081540_1011819 3300005983 Bacteria 5800
111 Ga0070717_10191264 3300006028 Bacteria 1788
112 Ga0070717_10274218 3300006028 Bacteria 1494
113 Ga0070717_10405128 3300006028 Bacteria 1226
114 Ga0070715_10000604 3300006163 Bacteria 9491
115 Ga0070715_10067979 3300006163 Bacteria 1583
116 Ga0070715_10250047 3300006163 Bacteria 926
117 Ga0070716_100014234 3300006173 Bacteria 4072
118 Ga0070716_100135036 3300006173 Bacteria 1565
119 Ga0070712_100001324 3300006175 Bacteria 15011
120 Ga0070712_100170326 3300006175 Bacteria 1689
121 Ga0097621_100026603 3300006237 Bacteria 4541
122 Ga0068871_100549039 3300006358 Bacteria 1046
123 Ga0075428_100105427 3300006844 Bacteria 3074
124 Ga0075430_100021727 3300006846 Bacteria 5454
125 Ga0075431_100001884 3300006847 Bacteria 19894
126 Ga0075431_100167210 3300006847 Bacteria 2260
127 Ga0075434_100080611 3300006871 Bacteria 3252
128 Ga0075434_100086392 3300006871 Bacteria 3136
129 Ga0075434_100587729 3300006871 Bacteria 1133
130 Ga0075429_100045340 3300006880 Bacteria 3825
131 Ga0075435_100026088 3300007076 Bacteria 4555
132 Ga0075435_100037406 3300007076 Bacteria 3864
133 Ga0075435_100277727 3300007076 Bacteria 1430
134 Ga0105250_10136370 3300009092 Bacteria 1015
135 Ga0105240_10296540 3300009093 Bacteria 1851
136 Ga0105240_10430336 3300009093 Bacteria 1481
137 Ga0111539_10041947 3300009094 Bacteria 5498
138 Ga0105245_10066020 3300009098 Bacteria 3274
139 Ga0105245_10329610 3300009098 Bacteria 1506
140 Ga0114129_10020245 3300009147 Bacteria 9469
141 Ga0114129_10037757 3300009147 Bacteria 6818
142 Ga0105243_10076132 3300009148 Bacteria 2725
143 Ga0105237_10138217 3300009545 Bacteria 2431
144 Ga0105237_10378399 3300009545 Bacteria 1420
145 Ga0105238_10047445 3300009551 Bacteria 4330
146 Ga0105238_10201226 3300009551 Bacteria 1967
147 Ga0105249_10004292 3300009553 Bacteria 12323
148 Ga0105249_10252720 3300009553 Bacteria 1748
149 Ga0105239_10048937 3300010375 Bacteria 4634
150 Ga0105239_10767357 3300010375 Bacteria 1104
151 Ga0105239_11177322 3300010375 Bacteria 883
152 Ga0105246_10457669 3300011119 Bacteria 1074
153 Ga0157371_10328289 3300013102 Bacteria 1111
154 Ga0157370_10025062 3300013104 Bacteria 5904
155 Ga0157370_10155952 3300013104 Bacteria 2124
156 Ga0157370_10325871 3300013104 Bacteria 1416
157 Ga0157369_10065615 3300013105 Bacteria 3906
158 Ga0157369_10232162 3300013105 Bacteria 1929
159 Ga0157369_10311976 3300013105 Bacteria 1635
160 Ga0157369_10404040 3300013105 Bacteria 1417
161 Ga0157369_10482019 3300013105 Bacteria 1284
162 Ga0157374_10017252 3300013296 Bacteria 6355
163 Ga0157374_10054840 3300013296 Bacteria 3719
164 Ga0157374_10482444 3300013296 Bacteria 1243
165 Ga0163162_10144977 3300013306 Bacteria 2490
166 Ga0163162_11237451 3300013306 Bacteria 848
167 Ga0157372_10153346 3300013307 Bacteria 2660
168 Ga0157372_10160400 3300013307 Bacteria 2599
169 Ga0157372_10592947 3300013307 Bacteria 1292
170 Ga0157372_10695616 3300013307 Bacteria 1183
171 Ga0157372_10733129 3300013307 Bacteria 1149
172 Ga0157372_10760570 3300013307 Bacteria 1126
173 Ga0157379_10008723 3300014968 Bacteria 8835
174 Ga0157376_10138658 3300014969 Bacteria 2179
175 Ga0206356_10181501 3300020070 Bacteria 928
176 Ga0206356_11179862 3300020070 Bacteria 2627
177 Ga0206350_11409316 3300020080 Bacteria 1538
178 Ga0206353_11671143 3300020082 Bacteria 1706
179 Ga0206353_11785731 3300020082 Bacteria 890
180 Ga0213875_10028304 3300021388 Bacteria 2663
181 Ga0224712_10046583 3300022467 Bacteria 1665
182 Ga0224712_10118669 3300022467 Bacteria 1143
183 Ga0207692_10000357 3300025898 Bacteria 15729
184 Ga0207692_10001795 3300025898 Bacteria 8137
185 Ga0207692_10054028 3300025898 Bacteria 2049
186 Ga0207692_10129548 3300025898 Bacteria 1423
187 Ga0207688_10017141 3300025901 Bacteria 3936
188 Ga0207647_10157646 3300025904 Bacteria 1325
189 Ga0207685_10000722 3300025905 Bacteria 5998
190 Ga0207685_10026039 3300025905 Bacteria 2028
191 Ga0207699_10001097 3300025906 Bacteria 12779
192 Ga0207699_10022227 3300025906 Bacteria 3433
193 Ga0207699_10044847 3300025906 Bacteria 2576
194 Ga0207699_10107805 3300025906 Bacteria 1780
195 Ga0207699_10443580 3300025906 Bacteria 930
196 Ga0207705_10081584 3300025909 Bacteria 2357
197 Ga0207684_10009868 3300025910 Bacteria 8426
198 Ga0207707_10046648 3300025912 Bacteria 3774
199 Ga0207707_10191122 3300025912 Bacteria 1786
200 Ga0207707_10362648 3300025912 Bacteria 1247
201 Ga0207695_10150512 3300025913 Bacteria 2266
202 Ga0207695_10425500 3300025913 Bacteria 1212
203 Ga0207671_10081911 3300025914 Bacteria 2421
204 Ga0207693_10001115 3300025915 Bacteria 24125
205 Ga0207663_10005008 3300025916 Bacteria 6646
206 Ga0207660_10015308 3300025917 Bacteria 5059
207 Ga0207660_10203761 3300025917 Bacteria 1546
208 Ga0207657_10011831 3300025919 Bacteria 8637
209 Ga0207649_10195361 3300025920 Bacteria 1426
210 Ga0207652_10011230 3300025921 Bacteria 7214
211 Ga0207652_10072444 3300025921 Bacteria 2996
212 Ga0207652_10243452 3300025921 Bacteria 1621
213 Ga0207652_10265087 3300025921 Bacteria 1550
214 Ga0207646_10000787 3300025922 Bacteria 41124
215 Ga0207646_10002366 3300025922 Bacteria 22286
216 Ga0207646_10003767 3300025922 Bacteria 16897
217 Ga0207646_10021628 3300025922 Bacteria 5938
218 Ga0207646_10182500 3300025922 Bacteria 1895
219 Ga0207646_10249254 3300025922 Bacteria 1604
220 Ga0207694_10105778 3300025924 Bacteria 2234
221 Ga0207694_10274510 3300025924 Bacteria 1383
222 Ga0207659_10238186 3300025926 Bacteria 1471
223 Ga0207687_10013714 3300025927 Bacteria 5291
224 Ga0207687_10171008 3300025927 Bacteria 1676
225 Ga0207687_10192374 3300025927 Bacteria 1589
226 Ga0207700_10000376 3300025928 Bacteria 26077
227 Ga0207700_10013007 3300025928 Bacteria 5394
228 Ga0207700_10140318 3300025928 Bacteria 1985
229 Ga0207700_10162732 3300025928 Bacteria 1854
230 Ga0207664_10000616 3300025929 Bacteria 24677
231 Ga0207664_10002754 3300025929 Bacteria 11668
232 Ga0207664_10009185 3300025929 Bacteria 6927
233 Ga0207664_10017979 3300025929 Bacteria 5194
234 Ga0207664_10078835 3300025929 Bacteria 2672
235 Ga0207664_10123149 3300025929 Bacteria 2173
236 Ga0207664_10534646 3300025929 Bacteria 1051
237 Ga0207644_10206426 3300025931 Bacteria 1552
238 Ga0207690_10013385 3300025932 Bacteria 4929
239 Ga0207690_10046792 3300025932 Bacteria 2867
240 Ga0207709_10278680 3300025935 Bacteria 1234
241 Ga0207665_10001058 3300025939 Bacteria 18527
242 Ga0207665_10006091 3300025939 Bacteria 8010
243 Ga0207665_10075499 3300025939 Bacteria 2309
244 Ga0207661_10024764 3300025944 Bacteria 4553
245 Ga0207661_10066131 3300025944 Bacteria 2936
246 Ga0207661_10119079 3300025944 Bacteria 2246
247 Ga0207661_10661363 3300025944 Bacteria 960
248 Ga0207667_10048763 3300025949 Bacteria 4476
249 Ga0207712_10013163 3300025961 Bacteria 5302
250 Ga0207668_10047899 3300025972 Bacteria 2929
251 Ga0207640_10177664 3300025981 Bacteria 1593
252 Ga0207640_10208579 3300025981 Bacteria 1486
253 Ga0207640_10565608 3300025981 Bacteria 957
254 Ga0207640_10667565 3300025981 Bacteria 887
255 Ga0207677_10466142 3300026023 Bacteria 1085
256 Ga0207677_10495280 3300026023 Bacteria 1055
257 Ga0207639_10262899 3300026041 Bacteria 1510
258 Ga0207639_10581040 3300026041 Bacteria 1031
259 Ga0207639_10622121 3300026041 Bacteria 997
260 Ga0207678_10000065 3300026067 Bacteria 83028
261 Ga0207678_10062607 3300026067 Bacteria 3197
262 Ga0207678_10064141 3300026067 Bacteria 3156
263 Ga0207702_10123146 3300026078 Bacteria 2323
264 Ga0207702_10179579 3300026078 Bacteria 1948
265 Ga0207702_10432098 3300026078 Bacteria 1275
266 Ga0207702_10760291 3300026078 Bacteria 957
267 Ga0207702_10904689 3300026078 Bacteria 874
268 Ga0207641_10042899 3300026088 Bacteria 3797
269 Ga0207648_11080995 3300026089 Bacteria 752
270 Ga0207676_10102595 3300026095 Bacteria 2375
271 Ga0207674_10032175 3300026116 Bacteria 5502
272 Ga0207674_10060394 3300026116 Bacteria 3834
273 Ga0207675_100608683 3300026118 Bacteria 1096
274 Ga0207683_10187873 3300026121 Bacteria 1875
275 Ga0207683_10290806 3300026121 Bacteria 1494
276 Ga0207698_10431311 3300026142 Bacteria 1267
277 Ga0268266_10003180 3300028379 Bacteria 16659
278 Ga0268266_10071603 3300028379 Bacteria 3005
279 Ga0268266_10272672 3300028379 Bacteria 1571
280 Ga0268266_10700459 3300028379 Bacteria 976
281 Ga0268266_10722210 3300028379 Bacteria 961
282 Ga0268264_10485720 3300028381 Bacteria 1202
283 Ga0265336_10005555 3300028666 Bacteria 4640
284 Ga0307517_10012612 3300028786 Bacteria 11575
285 Ga0307515_10000287 3300028794 Bacteria 123976
286 Ga0307515_10057382 3300028794 Bacteria 5635
287 Ga0307515_10285340 3300028794 Bacteria 1353
288 Ga0265338_10008871 3300028800 Bacteria 12124
289 Ga0307511_10001720 3300030521 Bacteria 23047
290 Ga0307511_10065316 3300030521 Bacteria 2725
291 Ga0307512_10031261 3300030522 Bacteria 4614
292 Ga0307512_10073303 3300030522 Bacteria 2523
293 Ga0307512_10116505 3300030522 Bacteria 1736
294 Ga0307512_10164737 3300030522 Bacteria 1288
295 Ga0314311_1039871 3300030733 Bacteria 9000
296 Ga0316180_1027963 3300030736 Bacteria 2277
297 Ga0307513_10004055 3300031456 Bacteria 19633
298 Ga0307513_10222279 3300031456 Bacteria 1708
299 Ga0307513_10279780 3300031456 Bacteria 1446
300 Ga0307509_10050413 3300031507 Bacteria 4457
301 Ga0307509_10373441 3300031507 Bacteria 1141
302 Ga0307508_10036278 3300031616 Bacteria 4439
303 Ga0307514_10027128 3300031649 Bacteria 4628
304 Ga0307514_10130321 3300031649 Bacteria 1733
305 Ga0307516_10035339 3300031730 Bacteria 5015
306 Ga0307516_10044287 3300031730 Bacteria 4404
307 Ga0307518_10000187 3300031838 Bacteria 47022
308 Ga0307518_10016155 3300031838 Bacteria 5346
309 Ga0307407_10063280 3300031903 Bacteria 2170
310 Ga0307409_100025807 3300031995 Bacteria 4130
311 Ga0307409_100501832 3300031995 Bacteria 1182
312 Ga0307416_100215184 3300032002 Bacteria 1837
313 Ga0307415_100154126 3300032126 Bacteria 1772
314 Ga0307415_100158083 3300032126 Bacteria 1753
315 Ga0307507_10010287 3300033179 Bacteria 12137
316 Ga0307507_10031670 3300033179 Bacteria 5544
317 Ga0307507_10047750 3300033179 Bacteria 4175
318 Ga0307510_10000644 3300033180 Bacteria 35417
319 Ga0307510_10112929 3300033180 Bacteria 2452
320 Ga0373934_0010252 3300035086 Bacteria 3518
321 Ga0373934_0137327 3300035086 Bacteria 999
322 Ga0373944_0006890 3300035089 Bacteria 3033
323 Ga0373936_0212412 3300035113 Bacteria 856
324 Ga0373953_0019808 3300035117 Bacteria 2508
325 Ga0373954_0054426 3300035118 Bacteria 1882
326 Ga0373956_0011043 3300035119 Bacteria 3719
327 Ga0373956_0122307 3300035119 Bacteria 1216
328 Ga0373957_0041995 3300035120 Bacteria 1724
329 Ga0373943_0019277 3300035170 Bacteria 3136
330 Ga0373955_0359489 3300035172 Bacteria 882
331 Ga0373924_0024459 3300035410 Bacteria 2380
332 Ga0373935_0087985 3300035692 Bacteria 2029
333 Ga0373933_0077075 3300035724 Bacteria 2037
334 Ga0373947_0371043 3300035725 Bacteria 962
335 Ga0373937_0009708 3300036401 Bacteria 8389
336 Ga0373937_0024043 3300036401 Bacteria 5493
337 Ga0373937_0135353 3300036401 Bacteria 2304
338 Ga0373925_0004007 3300037068 Bacteria 11206
339 Ga0373925_0118650 3300037068 Bacteria 2051
340 Ga0395899_0323570 3300037312 Bacteria 1038
341 Ga0395900_0528046 3300037418 Bacteria 1127
342 Ga0395898_0007795 3300037466 Bacteria 11365
343 Ga0395898_0194689 3300037466 Bacteria 1937
344 Ga0395898_0247181 3300037466 Bacteria 1701
345 Ga0436364_1360402 3300037853 Bacteria 2658
346 Ga0395901_0186849 3300038443 Bacteria 2173
347 Ga0395901_0235728 3300038443 Bacteria 1910
348 Ga0436365_0278358 3300039437 Bacteria 4336
349 Ga0439436_0004403 3300041404 Bacteria 4312
350 Ga0439436_0016465 3300041404 Bacteria 2217
351 Ga0439436_0032644 3300041404 Bacteria 1509
352 Ga0439438_042727 3300041405 Bacteria 1172
353 Ga0439439_0003198 3300041406 Bacteria 3588
354 Ga0439439_0010488 3300041406 Bacteria 2216
355 Ga0451802_1162497 3300041460 Bacteria 831
356 Ga0451837_1577462 3300041494 Bacteria 2969
357 Ga0451853_1404968 3300041512 Bacteria 3970
358 Ga0451853_2550968 3300041512 Bacteria 2847
359 Ga0439433_0001272 3300041999 Bacteria 5209
360 Ga0439442_009247 3300042002 Bacteria 1993
361 Ga0439442_023112 3300042002 Bacteria 1292
362 Ga0439442_039778 3300042002 Bacteria 986
363 Ga0439448_0041472 3300042005 Bacteria 1489
364 Ga0439432_085318 3300042006 Bacteria 953
365 Ga0439449_0093824 3300042007 Bacteria 1108
366 Ga0439457_001153 3300042014 Bacteria 7949
367 Ga0439462_0095769 3300042015 Bacteria 816
368 Ga0450900_023064 3300042136 Bacteria 877
369 Ga0450903_000178 3300042138 Bacteria 13985
370 Ga0439446_0023092 3300042156 Bacteria 1767
371 Ga0439458_0000694 3300042157 Bacteria 8705
372 Ga0466969_0017309 3300044656 Bacteria 3765
373 Ga0466972_0007816 3300044658 Bacteria 5365
374 Ga0466972_0012228 3300044658 Bacteria 4315
375 Ga0466972_0014301 3300044658 Bacteria 3976
376 Ga0466972_0023889 3300044658 Bacteria 3037
377 Ga0466965_0000544 3300044683 Bacteria 13582
378 Ga0466965_0027756 3300044683 Bacteria 2748
379 Ga0466965_0071861 3300044683 Bacteria 1741
380 Ga0466965_0081301 3300044683 Bacteria 1638
381 Ga0466966_0010560 3300044684 Bacteria 6138
382 Ga0466966_0012306 3300044684 Bacteria 5669
383 Ga0466966_0118121 3300044684 Unclassified 1631
384 Ga0466961_0016316 3300044693 Bacteria 4770
385 Ga0466961_0107037 3300044693 Bacteria 1760
386 Ga0466961_0370172 3300044693 Unclassified 871
387 Ga0466961_0388562 3300044693 Bacteria 847
388 Ga0466963_0026338 3300044694 Bacteria 3718
389 Ga0466963_0036762 3300044694 Bacteria 3194
390 Ga0466963_0057304 3300044694 Bacteria 2595
391 Ga0466963_0117072 3300044694 Bacteria 1831
392 Ga0466964_0052239 3300044706 Bacteria 1680
393 Ga0466964_0134798 3300044706 Bacteria 1129
394 Ga0466971_0002653 3300044719 Bacteria 7553
395 Ga0466971_0009135 3300044719 Bacteria 4334
396 Ga0466968_0001070 3300044735 Bacteria 9698
397 Ga0466968_0005233 3300044735 Bacteria 4860
398 Ga0466968_0083235 3300044735 Bacteria 1409
399 Ga0466968_0124218 3300044735 Bacteria 1170
400 Ga0466970_0001010 3300044765 Bacteria 13557
401 Ga0466970_0017784 3300044765 Bacteria 3675
402 Ga0466970_0066150 3300044765 Bacteria 1940
403 Ga0466970_0119208 3300044765 Bacteria 1445
404 Ga0466970_0119308 3300044765 Bacteria 1444
405 Ga0466970_0143464 3300044765 Bacteria 1316
406 Ga0466970_0221070 3300044765 Bacteria 1057
407 Ga0466970_0252014 3300044765 Bacteria 989
408 Ga0466957_0006437 3300044842 Bacteria 6631
409 Ga0466957_0042974 3300044842 Bacteria 2735
410 Ga0466957_0065104 3300044842 Bacteria 2244
411 Ga0466957_0110442 3300044842 Bacteria 1743
412 Ga0466957_0198397 3300044842 Bacteria 1317
413 Ga0466960_0003032 3300044901 Bacteria 6411
414 Ga0466960_0008740 3300044901 Bacteria 4157
415 Ga0466959_0107109 3300045049 Bacteria 1998
416 Ga0466958_0000718 3300045836 Bacteria 14480
417 Ga0466958_0033825 3300045836 Bacteria 3047
418 Ga0466958_0049358 3300045836 Bacteria 2546
419 Ga0466958_0104637 3300045836 Bacteria 1763
420 Ga0466958_0109359 3300045836 Bacteria 1725
421 Ga0466958_0156201 3300045836 Bacteria 1440
422 Ga0466958_0226848 3300045836 Bacteria 1192
423 Ga0466967_0026337 3300045976 Bacteria 4815
424 Ga0466967_0076001 3300045976 Bacteria 3020
425 Ga0466967_0206357 3300045976 Bacteria 1863
426 Ga0466967_0231742 3300045976 Bacteria 1758
427 Ga0466967_0233958 3300045976 Bacteria 1750
428 Ga0466967_0272735 3300045976 Bacteria 1621
429 Ga0466967_0345556 3300045976 Bacteria 1439
430 Ga0466967_0899349 3300045976 Bacteria 880
431 Ga0495617_049616 3300046452 Bacteria 1396
432 Ga0495592_0013138 3300046454 Bacteria 6302
433 Ga0495592_0017645 3300046454 Bacteria 5424
434 Ga0495592_0032833 3300046454 Bacteria 3915
435 Ga0495592_0168274 3300046454 Bacteria 1502
436 Ga0495592_0278936 3300046454 Bacteria 1094
437 Ga0495603_0000038 3300046455 Bacteria 56885
438 Ga0495603_0005963 3300046455 Bacteria 7286
439 Ga0495603_0033390 3300046455 Bacteria 3096
440 Ga0495603_0055304 3300046455 Bacteria 2351
441 Ga0495629_0005692 3300046459 Bacteria 9307
442 Ga0495629_0006176 3300046459 Bacteria 8897
443 Ga0495629_0020835 3300046459 Bacteria 4679
444 Ga0495629_0040143 3300046459 Bacteria 3292
445 Ga0495629_0125586 3300046459 Bacteria 1787
446 Ga0495629_0174973 3300046459 Bacteria 1489
447 Ga0495629_0335109 3300046459 Bacteria 1033
448 Ga0495638_0073293 3300046460 Bacteria 2090
449 Ga0495638_0197410 3300046460 Bacteria 1138
450 Ga0495651_0002692 3300046462 Bacteria 13787
451 Ga0495651_0007293 3300046462 Bacteria 8453
452 Ga0495651_0248148 3300046462 Bacteria 1217
453 Ga0495653_0077176 3300046463 Bacteria 2474
454 Ga0495650_0023768 3300046471 Bacteria 2910
455 Ga0495580_0069800 3300046472 Bacteria 2455
456 Ga0495580_0101543 3300046472 Bacteria 2000
457 Ga0495582_0039185 3300046473 Bacteria 2609
458 Ga0495605_0107843 3300046474 Bacteria 1274
459 Ga0495639_0021326 3300046475 Bacteria 2834
460 Ga0495662_0000436 3300046476 Bacteria 18733
461 Ga0495662_0022526 3300046476 Bacteria 3041
462 Ga0495662_0095002 3300046476 Bacteria 1456
463 Ga0495662_0099497 3300046476 Bacteria 1422
464 Ga0495662_0101616 3300046476 Bacteria 1406
465 Ga0495664_0013903 3300046477 Bacteria 4562
466 Ga0495664_0193671 3300046477 Bacteria 1232
467 Ga0495664_0378265 3300046477 Bacteria 851
468 Ga0495584_0114125 3300046491 Bacteria 1367
469 Ga0495594_0310521 3300046499 Bacteria 898
470 Ga0495594_0439404 3300046499 Bacteria 742
471 Ga0495596_0102831 3300046500 Bacteria 1110
472 Ga0495607_0037006 3300046501 Bacteria 2934
473 Ga0495583_0056746 3300046506 Bacteria 1764
474 Ga0495583_0100817 3300046506 Bacteria 1232
475 Ga0495606_0004135 3300046507 Bacteria 14728
476 Ga0495608_0000081 3300046511 Bacteria 69898
477 Ga0495608_0076379 3300046511 Bacteria 2182
478 Ga0495608_0187339 3300046511 Bacteria 1307
479 Ga0495608_0299594 3300046511 Bacteria 995
480 Ga0495610_0034625 3300046512 Bacteria 2600
481 Ga0495616_0020462 3300046513 Bacteria 3598
482 Ga0495618_0006775 3300046514 Bacteria 6939
483 Ga0495618_0043697 3300046514 Bacteria 2827
484 Ga0495618_0048910 3300046514 Bacteria 2670
485 Ga0495618_0172146 3300046514 Bacteria 1377
486 Ga0495620_0007810 3300046515 Bacteria 5778
487 Ga0495620_0007954 3300046515 Bacteria 5717
488 Ga0495628_0020871 3300046516 Bacteria 5396
489 Ga0495628_0022627 3300046516 Bacteria 5162
490 Ga0495628_0148447 3300046516 Bacteria 1786
491 Ga0495628_0470603 3300046516 Bacteria 910
492 Ga0495628_0537511 3300046516 Bacteria 840
493 Ga0495630_0081592 3300046517 Bacteria 2440
494 Ga0495631_0007379 3300046518 Bacteria 5593
495 Ga0495637_0061409 3300046520 Bacteria 1541
496 Ga0495643_0039751 3300046522 Bacteria 2571
497 Ga0495648_0078830 3300046524 Bacteria 1882
498 Ga0495666_0017841 3300046526 Bacteria 3535
499 Ga0495666_0073113 3300046526 Bacteria 1627
500 Ga0495666_0088084 3300046526 Bacteria 1466
501 Ga0495652_0006178 3300046529 Bacteria 11176
502 Ga0495652_0056716 3300046529 Bacteria 3325
503 Ga0495652_0181027 3300046529 Bacteria 1617
504 Ga0495652_0219301 3300046529 Bacteria 1430
505 Ga0495652_0282800 3300046529 Bacteria 1214
506 Ga0495652_0415896 3300046529 Bacteria 949
507 Ga0495665_0126182 3300046531 Bacteria 1340
508 Ga0495640_0003158 3300046533 Bacteria 13271
509 Ga0495640_0072507 3300046533 Bacteria 2307
510 Ga0495586_0059691 3300046535 Bacteria 2073
511 Ga0495586_0200905 3300046535 Bacteria 1130
512 Ga0495587_0020823 3300046536 Bacteria 4045
513 Ga0495587_0021932 3300046536 Bacteria 3937
514 Ga0495587_0051104 3300046536 Bacteria 2444
515 Ga0495587_0092203 3300046536 Bacteria 1749
516 Ga0495609_0079300 3300046538 Bacteria 1436
517 Ga0495597_0048292 3300046542 Bacteria 1883
518 Ga0495645_0012603 3300046543 Bacteria 5961
519 Ga0495645_0014612 3300046543 Bacteria 5574
520 Ga0495645_0014842 3300046543 Bacteria 5535
521 Ga0495645_0043465 3300046543 Bacteria 3277
522 Ga0495633_0045184 3300046558 Bacteria 2086
523 Ga0495667_0001808 3300046559 Bacteria 14207
524 Ga0495667_0047219 3300046559 Bacteria 2845
525 Ga0495667_0094568 3300046559 Bacteria 1935
526 Ga0495667_0119439 3300046559 Bacteria 1702
527 Ga0495667_0163470 3300046559 Bacteria 1431
528 Ga0495668_0062572 3300046616 Bacteria 2050
529 Ga0495668_0269848 3300046616 Bacteria 932
530 Ga0495634_0017179 3300046642 Bacteria 5167
531 Ga0495634_0022096 3300046642 Bacteria 4485
532 Ga0495634_0090584 3300046642 Bacteria 1986
533 Ga0495634_0369246 3300046642 Bacteria 856
534 Ga0495625_0007591 3300046660 Bacteria 9415
535 Ga0495625_0069062 3300046660 Bacteria 2483
536 Ga0495625_0139481 3300046660 Bacteria 1636
537 Ga0495635_0018440 3300046663 Bacteria 4869
538 Ga0495635_0031036 3300046663 Bacteria 3712
539 Ga0495635_0034588 3300046663 Bacteria 3505
540 Ga0495659_0144150 3300046664 Bacteria 953
541 Ga0495661_0005397 3300046665 Bacteria 9088
542 Ga0495588_0030614 3300046674 Bacteria 2705
543 Ga0495588_0279310 3300046674 Bacteria 880
544 Ga0495657_0018127 3300046675 Bacteria 5100
545 Ga0495657_0020166 3300046675 Bacteria 4795
546 Ga0495657_0118079 3300046675 Bacteria 1673
547 Ga0495599_0004232 3300046678 Bacteria 8481
548 Ga0495599_0394306 3300046678 Bacteria 825
549 Ga0495623_0013779 3300046679 Bacteria 5241
550 Ga0495623_0055675 3300046679 Bacteria 2492
551 Ga0495623_0091737 3300046679 Bacteria 1863
552 Ga0495623_0109229 3300046679 Bacteria 1678
553 Ga0495623_0112950 3300046679 Bacteria 1644
554 Ga0495646_0001725 3300046680 Bacteria 13115
555 Ga0495646_0045970 3300046680 Bacteria 2664
556 Ga0495646_0104388 3300046680 Bacteria 1620
557 Ga0495646_0213872 3300046680 Bacteria 1045
558 Ga0495647_0127657 3300046681 Bacteria 1075
559 Ga0495658_0060078 3300046683 Bacteria 2179
560 Ga0495658_0193310 3300046683 Bacteria 1266
561 Ga0495613_0003220 3300046689 Bacteria 12219
562 Ga0495613_0006178 3300046689 Bacteria 8964
563 Ga0495613_0006739 3300046689 Bacteria 8578
564 Ga0495624_0014308 3300046690 Bacteria 5387
565 Ga0495624_0075002 3300046690 Bacteria 2101
566 Ga0495624_0263790 3300046690 Bacteria 1041
567 Ga0495624_0362501 3300046690 Bacteria 871
568 Ga0495670_0135427 3300046691 Bacteria 1286
569 Ga0495649_0165816 3300046694 Bacteria 1157
570 Ga0495589_0052307 3300046794 Bacteria 2018
571 Ga0495589_0058130 3300046794 Bacteria 1902
572 Ga0495589_0227350 3300046794 Bacteria 875
573 Ga0495600_0014821 3300046809 Bacteria 4917
574 Ga0495600_0053305 3300046809 Bacteria 2641
575 Ga0495600_0054859 3300046809 Bacteria 2603
576 Ga0495600_0076318 3300046809 Bacteria 2188
577 Ga0495600_0110322 3300046809 Bacteria 1791
578 Ga0495660_0132716 3300046810 Bacteria 1247
579 Ga0495581_0025349 3300047315 Bacteria 3438
580 Ga0495604_0001681 3300047317 Bacteria 18210
581 Ga0495604_0008372 3300047317 Bacteria 8177
582 Ga0495604_0016027 3300047317 Bacteria 5985
583 Ga0495604_0016764 3300047317 Bacteria 5860
584 Ga0495604_0020734 3300047317 Bacteria 5248
585 Ga0495604_0082937 3300047317 Bacteria 2396
586 Ga0495604_0167809 3300047317 Bacteria 1546
587 Ga0495636_0000492 3300047318 Bacteria 14555
588 Ga0495674_0037074 3300047319 Bacteria 4383
589 Ga0495674_0120604 3300047319 Bacteria 2215
590 Ga0495674_0179803 3300047319 Bacteria 1762
591 Ga0495674_0619876 3300047319 Bacteria 855
592 Ga0495672_0238441 3300047320 Bacteria 889
593 Ga0495676_0001378 3300047321 Bacteria 20945
594 Ga0495676_0016397 3300047321 Bacteria 6579
595 Ga0495676_0026048 3300047321 Bacteria 5039
596 Ga0495676_0055392 3300047321 Bacteria 3144
597 Ga0495676_0063378 3300047321 Bacteria 2881
598 Ga0495680_0002145 3300047322 Bacteria 20477
599 Ga0495680_0010272 3300047322 Bacteria 8351
600 Ga0495680_0027595 3300047322 Bacteria 4662
601 Ga0495680_0300721 3300047322 Bacteria 1126
602 Ga0495683_0057405 3300047323 Bacteria 1935
603 Ga0495683_0081415 3300047323 Bacteria 1578
604 Ga0495687_001283 3300047443 Bacteria 23656
605 Ga0495687_016780 3300047443 Bacteria 3672
606 Ga0495687_023981 3300047443 Bacteria 2907
607 Ga0495687_073012 3300047443 Bacteria 1368
608 Ga0495675_0004402 3300047444 Bacteria 8523
609 Ga0495675_0011001 3300047444 Bacteria 5671
610 Ga0495675_0027857 3300047444 Bacteria 3601
611 Ga0495675_0031352 3300047444 Bacteria 3393
612 Ga0495675_0254291 3300047444 Bacteria 1054
613 Ga0495677_0094727 3300047445 Bacteria 1127
614 Ga0495685_009381 3300047447 Bacteria 3266
615 Ga0495685_038671 3300047447 Bacteria 1634
616 Ga0495685_092965 3300047447 Bacteria 998
617 Ga0495681_0016334 3300047470 Bacteria 4164
618 Ga0495684_0002552 3300047471 Bacteria 14487
619 Ga0495684_0030858 3300047471 Bacteria 4114
620 Ga0495684_0067917 3300047471 Bacteria 2711
621 Ga0495593_0021941 3300047673 Bacteria 3562
622 Ga0495593_0026111 3300047673 Bacteria 3228
623 Ga0495593_0048634 3300047673 Bacteria 2253
624 Ga0495593_0061116 3300047673 Bacteria 1971
625 Ga0495602_0036878 3300048088 Bacteria 4544
626 Ga0495602_0039724 3300048088 Bacteria 4328
627 Ga0495602_0091463 3300048088 Bacteria 2523
628 Ga0495602_0096673 3300048088 Bacteria 2435
629 Ga0495602_0248473 3300048088 Bacteria 1327
630 Ga0495602_0297058 3300048088 Bacteria 1183
631 Ga0495614_0003869 3300048089 Bacteria 6729
632 Ga0495614_0018379 3300048089 Bacteria 3028
633 Ga0495614_0021021 3300048089 Bacteria 2821
634 Ga0495614_0060964 3300048089 Bacteria 1620
635 Ga0495614_0076287 3300048089 Bacteria 1449
636 Ga0495614_0172222 3300048089 Bacteria 971
637 Ga0496100_0119412 3300048903 Bacteria 1842
638 Ga0496101_0030634 3300048904 Bacteria 3774
639 Ga0496102_0031505 3300048905 Bacteria 4757
640 Ga0496102_0048348 3300048905 Bacteria 3868
641 Ga0496103_0176207 3300048906 Bacteria 1374
642 Ga0496104_0026135 3300048907 Bacteria 5386
643 Ga0496104_0056091 3300048907 Bacteria 3725
644 Ga0496104_0595854 3300048907 Bacteria 1015
645 Ga0496105_0004683 3300048908 Bacteria 10311
646 Ga0496105_0017025 3300048908 Bacteria 5818
647 Ga0496105_0019234 3300048908 Bacteria 5507
648 Ga0496106_0009222 3300048909 Bacteria 7289
649 Ga0496106_0172434 3300048909 Bacteria 1715
650 Ga0496107_0025625 3300048910 Bacteria 4176
651 Ga0496107_0077109 3300048910 Bacteria 2427
652 Ga0496107_0301326 3300048910 Bacteria 1193
653 Ga0496107_0484911 3300048910 Bacteria 917
654 Ga0496108_0002269 3300048911 Bacteria 15405
655 Ga0496108_0026052 3300048911 Bacteria 4823
656 Ga0496109_0065271 3300048912 Bacteria 3332
657 Ga0496110_0035945 3300048913 Bacteria 4301
658 Ga0496110_0075328 3300048913 Bacteria 2998
659 Ga0496111_0100586 3300048914 Bacteria 2123
660 Ga0496111_0405477 3300048914 Bacteria 1007
661 Ga0496113_0002886 3300048916 Bacteria 10118
662 Ga0496114_0055660 3300048917 Bacteria 3299
663 Ga0496114_0293925 3300048917 Bacteria 1434
664 Ga0496114_0333909 3300048917 Bacteria 1340
665 Ga0496115_0088219 3300048918 Bacteria 2532
666 Ga0496115_0172067 3300048918 Bacteria 1791
667 Ga0496126_0039141 3300048929 Bacteria 4403
668 Ga0496126_0072955 3300048929 Bacteria 3052
669 Ga0495678_026140 3300049459 Bacteria 2496
670 Ga0501031_0000271 3300049568 Bacteria 29369
671 Ga0501031_0143497 3300049568 Bacteria 1560
672 Ga0501031_0148210 3300049568 Bacteria 1533
673 Ga0501031_0220787 3300049568 Bacteria 1234
674 Ga0501031_0271846 3300049568 Bacteria 1100
675 Ga0501031_0278914 3300049568 Bacteria 1084
676 Ga0501031_0550610 3300049568 Bacteria 743
677 Ga0501032_0000877 3300049569 Bacteria 24422
678 Ga0501032_0211538 3300049569 Bacteria 1264
679 Ga0501033_0001027 3300049570 Bacteria 25391
680 Ga0501033_0007592 3300049570 Bacteria 8432
681 Ga0501033_0007870 3300049570 Bacteria 8259
682 Ga0501034_0001799 3300049571 Bacteria 27362
683 Ga0501034_0005247 3300049571 Bacteria 14221
684 Ga0501034_0031993 3300049571 Bacteria 5344
685 Ga0501034_0110403 3300049571 Bacteria 2741
686 Ga0501034_0179654 3300049571 Bacteria 2081
687 Ga0501036_0001507 3300049572 Bacteria 17961
688 Ga0501036_0010404 3300049572 Bacteria 7681
689 Ga0501036_0089159 3300049572 Bacteria 2606
690 Ga0501036_0172628 3300049572 Bacteria 1821
691 Ga0501036_0207761 3300049572 Bacteria 1646
692 Ga0501037_0002088 3300049573 Bacteria 14486
693 Ga0501037_0100295 3300049573 Bacteria 2091
694 Ga0501037_0226531 3300049573 Bacteria 1313
695 Ga0501038_0003094 3300049574 Bacteria 15506
696 Ga0501038_0117244 3300049574 Bacteria 2199
697 Ga0501039_0049390 3300049575 Bacteria 3252
698 Ga0501039_0051266 3300049575 Bacteria 3194
699 Ga0501039_0103658 3300049575 Bacteria 2221
700 Ga0501039_0118948 3300049575 Bacteria 2069
701 Ga0501039_0238244 3300049575 Bacteria 1431
702 Ga0501039_0287137 3300049575 Bacteria 1293
703 Ga0501041_0039450 3300049577 Bacteria 2866
704 Ga0501041_0225661 3300049577 Bacteria 1176
705 Ga0501042_0008013 3300049578 Bacteria 6952
706 Ga0501042_0036140 3300049578 Bacteria 3504
707 Ga0501042_0074520 3300049578 Bacteria 2429
708 Ga0501043_0002492 3300049579 Bacteria 15571
709 Ga0501043_0005810 3300049579 Bacteria 9924
710 Ga0501043_0174209 3300049579 Bacteria 1678
711 Ga0501047_0000118 3300049581 Bacteria 96347
712 Ga0501047_0011932 3300049581 Bacteria 8223
713 Ga0501047_0188943 3300049581 Bacteria 1924
714 Ga0501047_0364334 3300049581 Bacteria 1281
715 Ga0501048_0000654 3300049582 Bacteria 24940
716 Ga0501048_0073926 3300049582 Bacteria 2405
717 Ga0501067_0005406 3300049583 Bacteria 7092
718 Ga0501067_0009506 3300049583 Bacteria 5384
719 Ga0501067_0011887 3300049583 Bacteria 4825
720 Ga0501067_0032541 3300049583 Bacteria 2895
721 Ga0501067_0180442 3300049583 Bacteria 1176
722 Ga0501068_0142532 3300049584 Bacteria 1502
723 Ga0501068_0289115 3300049584 Bacteria 1048
724 Ga0501069_0001722 3300049585 Bacteria 10900
725 Ga0501069_0002785 3300049585 Bacteria 8935
726 Ga0501069_0115925 3300049585 Bacteria 1528
727 Ga0501070_0002795 3300049586 Bacteria 15236
728 Ga0501070_0004372 3300049586 Bacteria 12143
729 Ga0501070_0007168 3300049586 Bacteria 9473
730 Ga0501070_0007465 3300049586 Bacteria 9288
731 Ga0501070_0433413 3300049586 Bacteria 1061
732 Ga0501070_0593863 3300049586 Unclassified 883
733 Ga0501071_0020808 3300049587 Bacteria 4563
734 Ga0501071_0041076 3300049587 Bacteria 3312
735 Ga0501071_0058236 3300049587 Bacteria 2793
736 Ga0501071_0220168 3300049587 Bacteria 1428
737 Ga0501072_0014056 3300049588 Bacteria 6135
738 Ga0501072_0273549 3300049588 Bacteria 1344
739 Ga0501073_0027549 3300049589 Bacteria 4063
740 Ga0501074_0001645 3300049590 Bacteria 15150
741 Ga0501074_0007423 3300049590 Bacteria 7931
742 Ga0501074_0074161 3300049590 Bacteria 2443
743 Ga0501074_0089998 3300049590 Bacteria 2198
744 Ga0501074_0439644 3300049590 Bacteria 925
745 Ga0501075_0027122 3300049591 Bacteria 4220
746 Ga0501075_0432365 3300049591 Bacteria 1004
747 Ga0501076_0019494 3300049592 Bacteria 5186
748 Ga0501076_0189270 3300049592 Bacteria 1679
749 Ga0501076_0385777 3300049592 Bacteria 1151
750 Ga0501077_0159263 3300049593 Bacteria 1433
751 Ga0501079_0079936 3300049741 Bacteria 2528
752 Ga0501079_0291744 3300049741 Bacteria 1276
753 Ga0501079_0490860 3300049741 Bacteria 965
754 Ga0501080_0000361 3300049742 Bacteria 35108
755 Ga0501080_0001246 3300049742 Bacteria 21206
756 Ga0501080_0121439 3300049742 Bacteria 2421
757 Ga0501080_0345719 3300049742 Bacteria 1344
758 Ga0501081_0155505 3300049743 Bacteria 1645
759 Ga0501081_0484341 3300049743 Bacteria 921
760 Ga0501083_0176851 3300049744 Bacteria 1394
761 Ga0501035_0003465 3300049822 Bacteria 15106
762 Ga0501035_0022357 3300049822 Bacteria 5807
763 Ga0501035_0051954 3300049822 Bacteria 3667
764 Ga0501035_0239367 3300049822 Bacteria 1544
765 Ga0501044_0005136 3300049823 Bacteria 14600
766 Ga0501044_0078132 3300049823 Bacteria 3354
767 Ga0501044_0288623 3300049823 Bacteria 1572
768 Ga0501045_0111206 3300049824 Bacteria 2031
769 Ga0501045_0179760 3300049824 Bacteria 1576
770 Ga0501045_0221421 3300049824 Bacteria 1409
771 Ga0501045_0228208 3300049824 Bacteria 1386
772 Ga0501045_0294743 3300049824 Bacteria 1207
773 nmdc:mga00v17_80174_c1 3300050491 Bacteria 2037
774 nmdc:mga05p37_193583_c1 3300050507 Bacteria 2467
775 nmdc:mga05p37_815_c1 3300050507 Bacteria 34870
776 nmdc:mga09592_879_c1 3300050508 Bacteria 23524
777 nmdc:mga0qj67_20070_c1 3300050509 Bacteria 5114
778 nmdc:mga06r32_106_c1 3300050510 Bacteria 58645
779 nmdc:mga06r32_1482_c1 3300050510 Bacteria 21098
780 nmdc:mga08y16_2869_c1 3300050511 Bacteria 17731
781 nmdc:mga0n895_166739_c1 3300050512 Bacteria 2234
782 nmdc:mga0n895_199314_c1 3300050512 Bacteria 2033
783 nmdc:mga0rr50_162160_c1 3300050513 Bacteria 1815
784 Ga0495601_0023504 3300053077 Bacteria 3787
785 Ga0495601_0105853 3300053077 Bacteria 1819
786 Ga0495612_0164914 3300053078 Bacteria 968
787 Ga0495655_0137651 3300053083 Bacteria 757
788 Ga0495619_0651134 3300053085 Bacteria 718
789 Ga0500644_0035803 3300053088 Bacteria 1611
790 Ga0500644_0056149 3300053088 Bacteria 1370
791 Ga0500583_0089994 3300053092 Bacteria 1493
792 Ga0500560_003768 3300053107 Bacteria 3118
793 Ga0500572_018074 3300053111 Bacteria 1820
794 Ga0500573_0018878 3300053140 Bacteria 3939
795 Ga0501084_0016029 3300054114 Bacteria 6219
796 Ga0501084_0025730 3300054114 Bacteria 4907
797 Ga0501084_0277760 3300054114 Bacteria 1414
798 Ga0590075_033303 3300059424 Bacteria 1308
799 Ga0501082_0163367 3300060353 Bacteria 1935
800 Ga0501082_0851232 3300060353 Bacteria 798
801 Ga0466962_0010345 3300061719 Bacteria 4482
802 Ga0466962_0035839 3300061719 Bacteria 2374
803 Ga0466962_0131269 3300061719 Unclassified 1211
804 Ga0530510_0085728 3300061734 Bacteria 2295
805 Ga0530510_0094201 3300061734 Bacteria 2187
806 2585300794 2582581312 Bacteria 7308206
807 2585304110 2582581313 Bacteria 10042643
808 2585312103 2582581314 Bacteria 11452267
809 2586059570 2585427649 Bacteria 9053857
810 2616698931 2616644814 Bacteria 11555299
811 2616905667 2616644941 Bacteria 8510691
812 2643761299 2643221548 Bacteria 8053412
813 2643901655 2643221578 Bacteria 9213798
814 2644014129 2643221601 Bacteria 7493239
815 2644175477 2643221631 Bacteria 8168043
816 2644407801 2643221673 Bacteria 9196637
817 2644459299 2643221682 Bacteria 6743283
818 2739367211 2738543034 Bacteria 6084756
819 2785339753 2784746763 Bacteria 9783172
820 2785373192 2784746768 Bacteria 10036182
821 2786674811 2786546132 Bacteria 10419719
822 2791913488 2791354901 Bacteria 8322202
823 2793981130 2791355406 Bacteria 11364898
824 2804849158 2802429296 Bacteria 7227771
825 2809591667 2808606522 Bacteria 9488490
826 2812354380 2811994879 Bacteria 9313447
827 2812482827 2811994917 Bacteria 7761064
828 2819696155 2818991463 Bacteria 7948711
829 2819743381 2818991472 Bacteria 10089953
830 2827634467 2827628540 Bacteria 6858585
831 2852636002 2852635781 Bacteria 8251373
832 2862383911 2862382967 Bacteria 10317375
833 2862507646 2862507626 Bacteria 9425308
834 2862576168 2862574272 Bacteria 10567477
835 2863410267 2863404153 Bacteria 9672205
836 2867374914 2867369537 Bacteria 6501581
837 2867436385 2867428634 Bacteria 9590268
838 2875397942 2875391855 Bacteria 7600475
839 2891330896 2891326441 Bacteria 6439512
840 2899364011 2899359706 Bacteria 10940472
841 2904768701 2904765812 Bacteria 5369154
842 2904772027 2904770941 Bacteria 5580202
843 2908812679 2908811453 Bacteria 5478616
844 2912716000 2912715099 Bacteria 9460473
845 2912728958 2912723979 Bacteria 8557534
846 2935392967 2935390628 Bacteria 7043367
847 2946046537 2946045630 Bacteria 8527308
848 2946071323 2946064051 Bacteria 8957905
849 2954009638 2954002825 Bacteria 9173742
850 2954680591 2954673503 Bacteria 9685905
851 2954683562 2954682443 Bacteria 9862841
852 2966599525 2966598605 Bacteria 7676064
853 2995470480 2995463766 Bacteria 8577691
854 2997455265 2997451912 Bacteria 8492419
855 2997605220 2997600082 Bacteria 9896405
856 3006397002 3006393351 Bacteria 6615579
857 3006488811 3006486233 Bacteria 8157040
858 3006494607 3006493962 Bacteria 8825450
859 8003322282 8003314358 Bacteria 10575343
860 8003323040 8003314358 Bacteria 10575343
861 8008564263 8008558824 Bacteria 10610750
862 8008575866 8008574985 Bacteria 7815457
863 8025535316 8025530807 Bacteria 8495698
864 8047713570 8047710418 Bacteria 11023148
865 8047900180 8047893842 Bacteria 11723082
866 8048133994 8048127548 Bacteria 11053136
867 8048358747 8048356638 Bacteria 11044339
868 8048377127 8048369669 Bacteria 11666822
869 8048386182 8048379754 Bacteria 11877923
870 8048411911 8048406513 Bacteria 8936924
871 8056062542 8056060235 Bacteria 7259403
872 8056212381 8056207758 Bacteria 8639239
873 8056836115 8056829672 Bacteria 9045328
874 Ga0501035_0046679
875 rootH1_10041079
876 rootH2_10014028
877 rootH2_10125902
878 rootH1_10000628
879 rootH1_10039347
880 rootH1_10093147
881 JGI25160J50197_1017047
882 JGI25407J50210_10007407
883 Ga0070658_10127072
884 Ga0070683_100078557
885 Ga0070683_100098482
886 Ga0070683_100415034
887 Ga0068868_100220600
888 Ga0070660_100085794
889 Ga0070660_100277059
890 Ga0070661_100156503
891 Ga0070661_100231090
892 Ga0070661_100252855
893 Ga0070661_100350152
894 Ga0070692_10061483
895 Ga0070692_10151247
896 Ga0070668_100000654
897 Ga0070675_100510288
898 Ga0070674_100287931
899 Ga0070659_100575541
900 Ga0070709_10020372
901 Ga0070709_10061975
902 Ga0070709_10088572
903 Ga0070709_10443303
904 Ga0070709_10570442
905 Ga0070714_100003898
906 Ga0070714_100004647
907 Ga0070714_100004987
908 Ga0070714_100046062
909 Ga0070714_100097787
910 Ga0070714_100297154
911 Ga0070714_100411550
912 Ga0070714_100648059
913 Ga0070714_101164355
914 Ga0070713_100010129
915 Ga0070713_100017234
916 Ga0070713_100291471
917 Ga0070710_10000044
918 Ga0070710_10000818
919 Ga0070710_10026061
920 Ga0070711_100007336
921 Ga0070711_100198319
922 Ga0070711_100471871
923 Ga0070705_100273482
924 Ga0070705_100517345
925 Ga0070694_100024596
926 Ga0070694_100146697
927 Ga0070708_100022119
928 Ga0070708_100203359
929 Ga0070663_100000249
930 Ga0070663_100109548
931 Ga0070678_100221563
932 Ga0070678_100386459
933 Ga0070678_100499511
934 Ga0070681_10012815
935 Ga0070681_10075300
936 Ga0070681_10235076
937 Ga0070681_10398382
938 Ga0070685_10476091
939 Ga0070706_100007732
940 Ga0070707_100007169
941 Ga0070707_100042733
942 Ga0070707_100124832
943 Ga0070698_100003266
944 Ga0070699_100374721
945 Ga0070699_100402406
946 Ga0070679_100029541
947 Ga0070679_100060535
948 Ga0070679_100173536
949 Ga0070679_100270356
950 Ga0070684_100179038
951 Ga0070697_100017778
952 Ga0068853_100149931
953 Ga0068853_100271296
954 Ga0070686_100150353
955 Ga0070686_100193517
956 Ga0070686_100255985
957 Ga0070665_100001537
958 Ga0070665_100058138
959 Ga0070704_100007703
960 Ga0068855_100039742
961 Ga0068857_100073213
962 Ga0068854_100101835
963 Ga0068854_100114116
964 Ga0068854_100143513
965 Ga0068854_100216504
966 Ga0068854_100436146
967 Ga0068856_100024430
968 Ga0068856_100145850
969 Ga0068856_100163980
970 Ga0068856_100201100
971 Ga0068856_100529393
972 Ga0070702_100125197
973 Ga0068863_100253152
974 Ga0068863_100358061
975 Ga0081455_10000155
976 Ga0081455_10012770
977 Ga0081455_10061058
978 Ga0081455_10108634
979 Ga0081455_10181745
980 Ga0081538_10000092
981 Ga0081540_1011819
982 Ga0070717_10191264
983 Ga0070717_10274218
984 Ga0070717_10405128
985 Ga0070715_10000604
986 Ga0070715_10067979
987 Ga0070715_10250047
988 Ga0070716_100014234
989 Ga0070716_100135036
990 Ga0070712_100001324
991 Ga0070712_100170326
992 Ga0097621_100026603
993 Ga0068871_100549039
994 Ga0075428_100105427
995 Ga0075430_100021727
996 Ga0075431_100001884
997 Ga0075431_100167210
998 Ga0075434_100080611
999 Ga0075434_100086392
1000 Ga0075434_100587729
1001 Ga0075429_100045340
1002 Ga0075435_100026088
1003 Ga0075435_100037406
1004 Ga0075435_100277727
1005 Ga0105250_10136370
1006 Ga0105240_10296540
1007 Ga0105240_10430336
1008 Ga0111539_10041947
1009 Ga0105245_10066020
1010 Ga0105245_10329610
1011 Ga0114129_10020245
1012 Ga0114129_10037757
1013 Ga0105243_10076132
1014 Ga0105237_10138217
1015 Ga0105237_10378399
1016 Ga0105238_10047445
1017 Ga0105238_10201226
1018 Ga0105249_10004292
1019 Ga0105249_10252720
1020 Ga0105239_10048937
1021 Ga0105239_10767357
1022 Ga0105239_11177322
1023 Ga0105246_10457669
1024 Ga0157371_10328289
1025 Ga0157370_10025062
1026 Ga0157370_10155952
1027 Ga0157370_10325871
1028 Ga0157369_10065615
1029 Ga0157369_10232162
1030 Ga0157369_10311976
1031 Ga0157369_10404040
1032 Ga0157369_10482019
1033 Ga0157374_10017252
1034 Ga0157374_10054840
1035 Ga0157374_10482444
1036 Ga0163162_10144977
1037 Ga0163162_11237451
1038 Ga0157372_10153346
1039 Ga0157372_10160400
1040 Ga0157372_10592947
1041 Ga0157372_10695616
1042 Ga0157372_10733129
1043 Ga0157372_10760570
1044 Ga0157379_10008723
1045 Ga0157376_10138658
1046 Ga0206356_10181501
1047 Ga0206356_11179862
1048 Ga0206350_11409316
1049 Ga0206353_11671143
1050 Ga0206353_11785731
1051 Ga0213875_10028304
1052 Ga0224712_10046583
1053 Ga0224712_10118669
1054 Ga0207692_10000357
1055 Ga0207692_10001795
1056 Ga0207692_10054028
1057 Ga0207692_10129548
1058 Ga0207688_10017141
1059 Ga0207647_10157646
1060 Ga0207685_10000722
1061 Ga0207685_10026039
1062 Ga0207699_10001097
1063 Ga0207699_10022227
1064 Ga0207699_10044847
1065 Ga0207699_10107805
1066 Ga0207699_10443580
1067 Ga0207705_10081584
1068 Ga0207684_10009868
1069 Ga0207707_10046648
1070 Ga0207707_10191122
1071 Ga0207707_10362648
1072 Ga0207695_10150512
1073 Ga0207695_10425500
1074 Ga0207671_10081911
1075 Ga0207693_10001115
1076 Ga0207663_10005008
1077 Ga0207660_10015308
1078 Ga0207660_10203761
1079 Ga0207657_10011831
1080 Ga0207649_10195361
1081 Ga0207652_10011230
1082 Ga0207652_10072444
1083 Ga0207652_10243452
1084 Ga0207652_10265087
1085 Ga0207646_10000787
1086 Ga0207646_10002366
1087 Ga0207646_10003767
1088 Ga0207646_10021628
1089 Ga0207646_10182500
1090 Ga0207646_10249254
1091 Ga0207694_10105778
1092 Ga0207694_10274510
1093 Ga0207659_10238186
1094 Ga0207687_10013714
1095 Ga0207687_10171008
1096 Ga0207687_10192374
1097 Ga0207700_10000376
1098 Ga0207700_10013007
1099 Ga0207700_10140318
1100 Ga0207700_10162732
1101 Ga0207664_10000616
1102 Ga0207664_10002754
1103 Ga0207664_10009185
1104 Ga0207664_10017979
1105 Ga0207664_10078835
1106 Ga0207664_10123149
1107 Ga0207664_10534646
1108 Ga0207644_10206426
1109 Ga0207690_10013385
1110 Ga0207690_10046792
1111 Ga0207709_10278680
1112 Ga0207665_10001058
1113 Ga0207665_10006091
1114 Ga0207665_10075499
1115 Ga0207661_10024764
1116 Ga0207661_10066131
1117 Ga0207661_10119079
1118 Ga0207661_10661363
1119 Ga0207667_10048763
1120 Ga0207712_10013163
1121 Ga0207668_10047899
1122 Ga0207640_10177664
1123 Ga0207640_10208579
1124 Ga0207640_10565608
1125 Ga0207640_10667565
1126 Ga0207677_10466142
1127 Ga0207677_10495280
1128 Ga0207639_10262899
1129 Ga0207639_10581040
1130 Ga0207639_10622121
1131 Ga0207678_10000065
1132 Ga0207678_10062607
1133 Ga0207678_10064141
1134 Ga0207702_10123146
1135 Ga0207702_10179579
1136 Ga0207702_10432098
1137 Ga0207702_10760291
1138 Ga0207702_10904689
1139 Ga0207641_10042899
1140 Ga0207648_11080995
1141 Ga0207676_10102595
1142 Ga0207674_10032175
1143 Ga0207674_10060394
1144 Ga0207675_100608683
1145 Ga0207683_10187873
1146 Ga0207683_10290806
1147 Ga0207698_10431311
1148 Ga0268266_10003180
1149 Ga0268266_10071603
1150 Ga0268266_10272672
1151 Ga0268266_10700459
1152 Ga0268266_10722210
1153 Ga0268264_10485720
1154 Ga0265336_10005555
1155 Ga0307517_10012612
1156 Ga0307515_10000287
1157 Ga0307515_10057382
1158 Ga0307515_10285340
1159 Ga0265338_10008871
1160 Ga0307511_10001720
1161 Ga0307511_10065316
1162 Ga0307512_10031261
1163 Ga0307512_10073303
1164 Ga0307512_10116505
1165 Ga0307512_10164737
1166 Ga0314311_1039871
1167 Ga0316180_1027963
1168 Ga0307513_10004055
1169 Ga0307513_10222279
1170 Ga0307513_10279780
1171 Ga0307509_10050413
1172 Ga0307509_10373441
1173 Ga0307508_10036278
1174 Ga0307514_10027128
1175 Ga0307514_10130321
1176 Ga0307516_10035339
1177 Ga0307516_10044287
1178 Ga0307518_10000187
1179 Ga0307518_10016155
1180 Ga0307407_10063280
1181 Ga0307409_100025807
1182 Ga0307409_100501832
1183 Ga0307416_100215184
1184 Ga0307415_100154126
1185 Ga0307415_100158083
1186 Ga0307507_10010287
1187 Ga0307507_10031670
1188 Ga0307507_10047750
1189 Ga0307510_10000644
1190 Ga0307510_10112929
1191 Ga0373934_0010252
1192 Ga0373934_0137327
1193 Ga0373944_0006890
1194 Ga0373936_0212412
1195 Ga0373953_0019808
1196 Ga0373954_0054426
1197 Ga0373956_0011043
1198 Ga0373956_0122307
1199 Ga0373957_0041995
1200 Ga0373943_0019277
1201 Ga0373955_0359489
1202 Ga0373924_0024459
1203 Ga0373935_0087985
1204 Ga0373933_0077075
1205 Ga0373947_0371043
1206 Ga0373937_0009708
1207 Ga0373937_0024043
1208 Ga0373937_0135353
1209 Ga0373925_0004007
1210 Ga0373925_0118650
1211 Ga0395899_0323570
1212 Ga0395900_0528046
1213 Ga0395898_0007795
1214 Ga0395898_0194689
1215 Ga0395898_0247181
1216 Ga0436364_1360402
1217 Ga0395901_0186849
1218 Ga0395901_0235728
1219 Ga0436365_0278358
1220 Ga0439436_0004403
1221 Ga0439436_0016465
1222 Ga0439436_0032644
1223 Ga0439438_042727
1224 Ga0439439_0003198
1225 Ga0439439_0010488
1226 Ga0451802_1162497
1227 Ga0451837_1577462
1228 Ga0451853_1404968
1229 Ga0451853_2550968
1230 Ga0439433_0001272
1231 Ga0439442_009247
1232 Ga0439442_023112
1233 Ga0439442_039778
1234 Ga0439448_0041472
1235 Ga0439432_085318
1236 Ga0439449_0093824
1237 Ga0439457_001153
1238 Ga0439462_0095769
1239 Ga0450900_023064
1240 Ga0450903_000178
1241 Ga0439446_0023092
1242 Ga0439458_0000694
1243 Ga0466969_0017309
1244 Ga0466972_0007816
1245 Ga0466972_0012228
1246 Ga0466972_0014301
1247 Ga0466972_0023889
1248 Ga0466965_0000544
1249 Ga0466965_0027756
1250 Ga0466965_0071861
1251 Ga0466965_0081301
1252 Ga0466966_0010560
1253 Ga0466966_0012306
1254 Ga0466966_0118121
1255 Ga0466961_0016316
1256 Ga0466961_0107037
1257 Ga0466961_0370172
1258 Ga0466961_0388562
1259 Ga0466963_0026338
1260 Ga0466963_0036762
1261 Ga0466963_0057304
1262 Ga0466963_0117072
1263 Ga0466964_0052239
1264 Ga0466964_0134798
1265 Ga0466971_0002653
1266 Ga0466971_0009135
1267 Ga0466968_0001070
1268 Ga0466968_0005233
1269 Ga0466968_0083235
1270 Ga0466968_0124218
1271 Ga0466970_0001010
1272 Ga0466970_0017784
1273 Ga0466970_0066150
1274 Ga0466970_0119208
1275 Ga0466970_0119308
1276 Ga0466970_0143464
1277 Ga0466970_0221070
1278 Ga0466970_0252014
1279 Ga0466957_0006437
1280 Ga0466957_0042974
1281 Ga0466957_0065104
1282 Ga0466957_0110442
1283 Ga0466957_0198397
1284 Ga0466960_0003032
1285 Ga0466960_0008740
1286 Ga0466959_0107109
1287 Ga0466958_0000718
1288 Ga0466958_0033825
1289 Ga0466958_0049358
1290 Ga0466958_0104637
1291 Ga0466958_0109359
1292 Ga0466958_0156201
1293 Ga0466958_0226848
1294 Ga0466967_0026337
1295 Ga0466967_0076001
1296 Ga0466967_0206357
1297 Ga0466967_0231742
1298 Ga0466967_0233958
1299 Ga0466967_0272735
1300 Ga0466967_0345556
1301 Ga0466967_0899349
1302 Ga0495617_049616
1303 Ga0495592_0013138
1304 Ga0495592_0017645
1305 Ga0495592_0032833
1306 Ga0495592_0168274
1307 Ga0495592_0278936
1308 Ga0495603_0000038
1309 Ga0495603_0005963
1310 Ga0495603_0033390
1311 Ga0495603_0055304
1312 Ga0495629_0005692
1313 Ga0495629_0006176
1314 Ga0495629_0020835
1315 Ga0495629_0040143
1316 Ga0495629_0125586
1317 Ga0495629_0174973
1318 Ga0495629_0335109
1319 Ga0495638_0073293
1320 Ga0495638_0197410
1321 Ga0495651_0002692
1322 Ga0495651_0007293
1323 Ga0495651_0248148
1324 Ga0495653_0077176
1325 Ga0495650_0023768
1326 Ga0495580_0069800
1327 Ga0495580_0101543
1328 Ga0495582_0039185
1329 Ga0495605_0107843
1330 Ga0495639_0021326
1331 Ga0495662_0000436
1332 Ga0495662_0022526
1333 Ga0495662_0095002
1334 Ga0495662_0099497
1335 Ga0495662_0101616
1336 Ga0495664_0013903
1337 Ga0495664_0193671
1338 Ga0495664_0378265
1339 Ga0495584_0114125
1340 Ga0495594_0310521
1341 Ga0495594_0439404
1342 Ga0495596_0102831
1343 Ga0495607_0037006
1344 Ga0495583_0056746
1345 Ga0495583_0100817
1346 Ga0495606_0004135
1347 Ga0495608_0000081
1348 Ga0495608_0076379
1349 Ga0495608_0187339
1350 Ga0495608_0299594
1351 Ga0495610_0034625
1352 Ga0495616_0020462
1353 Ga0495618_0006775
1354 Ga0495618_0043697
1355 Ga0495618_0048910
1356 Ga0495618_0172146
1357 Ga0495620_0007810
1358 Ga0495620_0007954
1359 Ga0495628_0020871
1360 Ga0495628_0022627
1361 Ga0495628_0148447
1362 Ga0495628_0470603
1363 Ga0495628_0537511
1364 Ga0495630_0081592
1365 Ga0495631_0007379
1366 Ga0495637_0061409
1367 Ga0495643_0039751
1368 Ga0495648_0078830
1369 Ga0495666_0017841
1370 Ga0495666_0073113
1371 Ga0495666_0088084
1372 Ga0495652_0006178
1373 Ga0495652_0056716
1374 Ga0495652_0181027
1375 Ga0495652_0219301
1376 Ga0495652_0282800
1377 Ga0495652_0415896
1378 Ga0495665_0126182
1379 Ga0495640_0003158
1380 Ga0495640_0072507
1381 Ga0495586_0059691
1382 Ga0495586_0200905
1383 Ga0495587_0020823
1384 Ga0495587_0021932
1385 Ga0495587_0051104
1386 Ga0495587_0092203
1387 Ga0495609_0079300
1388 Ga0495597_0048292
1389 Ga0495645_0012603
1390 Ga0495645_0014612
1391 Ga0495645_0014842
1392 Ga0495645_0043465
1393 Ga0495633_0045184
1394 Ga0495667_0001808
1395 Ga0495667_0047219
1396 Ga0495667_0094568
1397 Ga0495667_0119439
1398 Ga0495667_0163470
1399 Ga0495668_0062572
1400 Ga0495668_0269848
1401 Ga0495634_0017179
1402 Ga0495634_0022096
1403 Ga0495634_0090584
1404 Ga0495634_0369246
1405 Ga0495625_0007591
1406 Ga0495625_0069062
1407 Ga0495625_0139481
1408 Ga0495635_0018440
1409 Ga0495635_0031036
1410 Ga0495635_0034588
1411 Ga0495659_0144150
1412 Ga0495661_0005397
1413 Ga0495588_0030614
1414 Ga0495588_0279310
1415 Ga0495657_0018127
1416 Ga0495657_0020166
1417 Ga0495657_0118079
1418 Ga0495599_0004232
1419 Ga0495599_0394306
1420 Ga0495623_0013779
1421 Ga0495623_0055675
1422 Ga0495623_0091737
1423 Ga0495623_0109229
1424 Ga0495623_0112950
1425 Ga0495646_0001725
1426 Ga0495646_0045970
1427 Ga0495646_0104388
1428 Ga0495646_0213872
1429 Ga0495647_0127657
1430 Ga0495658_0060078
1431 Ga0495658_0193310
1432 Ga0495613_0003220
1433 Ga0495613_0006178
1434 Ga0495613_0006739
1435 Ga0495624_0014308
1436 Ga0495624_0075002
1437 Ga0495624_0263790
1438 Ga0495624_0362501
1439 Ga0495670_0135427
1440 Ga0495649_0165816
1441 Ga0495589_0052307
1442 Ga0495589_0058130
1443 Ga0495589_0227350
1444 Ga0495600_0014821
1445 Ga0495600_0053305
1446 Ga0495600_0054859
1447 Ga0495600_0076318
1448 Ga0495600_0110322
1449 Ga0495660_0132716
1450 Ga0495581_0025349
1451 Ga0495604_0001681
1452 Ga0495604_0008372
1453 Ga0495604_0016027
1454 Ga0495604_0016764
1455 Ga0495604_0020734
1456 Ga0495604_0082937
1457 Ga0495604_0167809
1458 Ga0495636_0000492
1459 Ga0495674_0037074
1460 Ga0495674_0120604
1461 Ga0495674_0179803
1462 Ga0495674_0619876
1463 Ga0495672_0238441
1464 Ga0495676_0001378
1465 Ga0495676_0016397
1466 Ga0495676_0026048
1467 Ga0495676_0055392
1468 Ga0495676_0063378
1469 Ga0495680_0002145
1470 Ga0495680_0010272
1471 Ga0495680_0027595
1472 Ga0495680_0300721
1473 Ga0495683_0057405
1474 Ga0495683_0081415
1475 Ga0495687_001283
1476 Ga0495687_016780
1477 Ga0495687_023981
1478 Ga0495687_073012
1479 Ga0495675_0004402
1480 Ga0495675_0011001
1481 Ga0495675_0027857
1482 Ga0495675_0031352
1483 Ga0495675_0254291
1484 Ga0495677_0094727
1485 Ga0495685_009381
1486 Ga0495685_038671
1487 Ga0495685_092965
1488 Ga0495681_0016334
1489 Ga0495684_0002552
1490 Ga0495684_0030858
1491 Ga0495684_0067917
1492 Ga0495593_0021941
1493 Ga0495593_0026111
1494 Ga0495593_0048634
1495 Ga0495593_0061116
1496 Ga0495602_0036878
1497 Ga0495602_0039724
1498 Ga0495602_0091463
1499 Ga0495602_0096673
1500 Ga0495602_0248473
1501 Ga0495602_0297058
1502 Ga0495614_0003869
1503 Ga0495614_0018379
1504 Ga0495614_0021021
1505 Ga0495614_0060964
1506 Ga0495614_0076287
1507 Ga0495614_0172222
1508 Ga0496100_0119412
1509 Ga0496101_0030634
1510 Ga0496102_0031505
1511 Ga0496102_0048348
1512 Ga0496103_0176207
1513 Ga0496104_0026135
1514 Ga0496104_0056091
1515 Ga0496104_0595854
1516 Ga0496105_0004683
1517 Ga0496105_0017025
1518 Ga0496105_0019234
1519 Ga0496106_0009222
1520 Ga0496106_0172434
1521 Ga0496107_0025625
1522 Ga0496107_0077109
1523 Ga0496107_0301326
1524 Ga0496107_0484911
1525 Ga0496108_0002269
1526 Ga0496108_0026052
1527 Ga0496109_0065271
1528 Ga0496110_0035945
1529 Ga0496110_0075328
1530 Ga0496111_0100586
1531 Ga0496111_0405477
1532 Ga0496113_0002886
1533 Ga0496114_0055660
1534 Ga0496114_0293925
1535 Ga0496114_0333909
1536 Ga0496115_0088219
1537 Ga0496115_0172067
1538 Ga0496126_0039141
1539 Ga0496126_0072955
1540 Ga0495678_026140
1541 Ga0501031_0000271
1542 Ga0501031_0143497
1543 Ga0501031_0148210
1544 Ga0501031_0220787
1545 Ga0501031_0271846
1546 Ga0501031_0278914
1547 Ga0501031_0550610
1548 Ga0501032_0000877
1549 Ga0501032_0211538
1550 Ga0501033_0001027
1551 Ga0501033_0007592
1552 Ga0501033_0007870
1553 Ga0501034_0001799
1554 Ga0501034_0005247
1555 Ga0501034_0031993
1556 Ga0501034_0110403
1557 Ga0501034_0179654
1558 Ga0501036_0001507
1559 Ga0501036_0010404
1560 Ga0501036_0089159
1561 Ga0501036_0172628
1562 Ga0501036_0207761
1563 Ga0501037_0002088
1564 Ga0501037_0100295
1565 Ga0501037_0226531
1566 Ga0501038_0003094
1567 Ga0501038_0117244
1568 Ga0501039_0049390
1569 Ga0501039_0051266
1570 Ga0501039_0103658
1571 Ga0501039_0118948
1572 Ga0501039_0238244
1573 Ga0501039_0287137
1574 Ga0501041_0039450
1575 Ga0501041_0225661
1576 Ga0501042_0008013
1577 Ga0501042_0036140
1578 Ga0501042_0074520
1579 Ga0501043_0002492
1580 Ga0501043_0005810
1581 Ga0501043_0174209
1582 Ga0501047_0000118
1583 Ga0501047_0011932
1584 Ga0501047_0188943
1585 Ga0501047_0364334
1586 Ga0501048_0000654
1587 Ga0501048_0073926
1588 Ga0501067_0005406
1589 Ga0501067_0009506
1590 Ga0501067_0011887
1591 Ga0501067_0032541
1592 Ga0501067_0180442
1593 Ga0501068_0142532
1594 Ga0501068_0289115
1595 Ga0501069_0001722
1596 Ga0501069_0002785
1597 Ga0501069_0115925
1598 Ga0501070_0002795
1599 Ga0501070_0004372
1600 Ga0501070_0007168
1601 Ga0501070_0007465
1602 Ga0501070_0433413
1603 Ga0501070_0593863
1604 Ga0501071_0020808
1605 Ga0501071_0041076
1606 Ga0501071_0058236
1607 Ga0501071_0220168
1608 Ga0501072_0014056
1609 Ga0501072_0273549
1610 Ga0501073_0027549
1611 Ga0501074_0001645
1612 Ga0501074_0007423
1613 Ga0501074_0074161
1614 Ga0501074_0089998
1615 Ga0501074_0439644
1616 Ga0501075_0027122
1617 Ga0501075_0432365
1618 Ga0501076_0019494
1619 Ga0501076_0189270
1620 Ga0501076_0385777
1621 Ga0501077_0159263
1622 Ga0501079_0079936
1623 Ga0501079_0291744
1624 Ga0501079_0490860
1625 Ga0501080_0000361
1626 Ga0501080_0001246
1627 Ga0501080_0121439
1628 Ga0501080_0345719
1629 Ga0501081_0155505
1630 Ga0501081_0484341
1631 Ga0501083_0176851
1632 Ga0501035_0003465
1633 Ga0501035_0022357
1634 Ga0501035_0051954
1635 Ga0501035_0239367
1636 Ga0501044_0005136
1637 Ga0501044_0078132
1638 Ga0501044_0288623
1639 Ga0501045_0111206
1640 Ga0501045_0179760
1641 Ga0501045_0221421
1642 Ga0501045_0228208
1643 Ga0501045_0294743
1644 nmdc:mga00v17_80174_c1
1645 nmdc:mga05p37_193583_c1
1646 nmdc:mga05p37_815_c1
1647 nmdc:mga09592_879_c1
1648 nmdc:mga0qj67_20070_c1
1649 nmdc:mga06r32_106_c1
1650 nmdc:mga06r32_1482_c1
1651 nmdc:mga08y16_2869_c1
1652 nmdc:mga0n895_166739_c1
1653 nmdc:mga0n895_199314_c1
1654 nmdc:mga0rr50_162160_c1
1655 Ga0495601_0023504
1656 Ga0495601_0105853
1657 Ga0495612_0164914
1658 Ga0495655_0137651
1659 Ga0495619_0651134
1660 Ga0500644_0035803
1661 Ga0500644_0056149
1662 Ga0500583_0089994
1663 Ga0500560_003768
1664 Ga0500572_018074
1665 Ga0500573_0018878
1666 Ga0501084_0016029
1667 Ga0501084_0025730
1668 Ga0501084_0277760
1669 Ga0590075_033303
1670 Ga0501082_0163367
1671 Ga0501082_0851232
1672 Ga0466962_0010345
1673 Ga0466962_0035839
1674 Ga0466962_0131269
1675 Ga0530510_0085728
1676 Ga0530510_0094201
1677 2585300794
1678 2585304110
1679 2585312103
1680 2586059570
1681 2616698931
1682 2616905667
1683 2643761299
1684 2643901655
1685 2644014129
1686 2644175477
1687 2644407801
1688 2644459299
1689 2739367211
1690 2785339753
1691 2785373192
1692 2786674811
1693 2791913488
1694 2793981130
1695 2804849158
1696 2809591667
1697 2812354380
1698 2812482827
1699 2819696155
1700 2819743381
1701 2827634467
1702 2852636002
1703 2862383911
1704 2862507646
1705 2862576168
1706 2863410267
1707 2867374914
1708 2867436385
1709 2875397942
1710 2891330896
1711 2899364011
1712 2904768701
1713 2904772027
1714 2908812679
1715 2912716000
1716 2912728958
1717 2935392967
1718 2946046537
1719 2946071323
1720 2954009638
1721 2954680591
1722 2954683562
1723 2966599525
1724 2995470480
1725 2997455265
1726 2997605220
1727 3006397002
1728 3006488811
1729 3006494607
1730 8003322282
1731 8003323040
1732 8008564263
1733 8008575866
1734 8025535316
1735 8047713570
1736 8047900180
1737 8048133994
1738 8048358747
1739 8048377127
1740 8048386182
1741 8048411911
1742 8056062542
1743 8056212381
1744 8056836115

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00456

Transketolase_N

Transketolase, thiamine diphosphate binding domain

51

258

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vrb-assembly1.cif.gz_A crystal structure of a transketolase from neisseria gonorrhoeae 0.8712 12 227
5vrb-assembly3.cif.gz_C crystal structure of a transketolase from neisseria gonorrhoeae 0.8689 13 229
3rim-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis transketolase (rv1449c) 0.8558 13 227
5i5g-assembly1.cif.gz_A-2 crystal structure of transketolase mutant-r525l from pichia stipitis 0.8498 30 227
5hgx-assembly1.cif.gz_A crystal structure of transketolase mutant - h261f from pichia stipitis 0.8476 26 227
ID Description Score Start End Superfamily
af_Q2FYT8_1_292_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8977 39 228 3.40.50.970
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8561 6 227 3.40.50.970
3rimD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8558 13 227 3.40.50.970
af_Q4CW17_1_198_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8454 139 227 3.40.50.970
5hjeA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8451 14 227 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7W9HBD8-F1-model_v4 Transketolase (EC 2.2.1.1) 0.9803 1 230 GO:0000287
GO:0004802
AF-A0A1C5EZ75-F1-model_v4 Transketolase 0.9787 3 231 GO:0000287
AF-A0A2P8B6X8-F1-model_v4 deleted 0.975 4 231
AF-A0A754B5C4-F1-model_v4 Transketolase 0.9743 12 231
AF-A0A4D4KVS4-F1-model_v4 Transketolase N-terminal domain-containing protein 0.9736 105 231 GO:0000287

Map