F484203

General Info

Members Datasets Scaffolds Average Seq Length
871 537 1742 155

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0025504|Ga0496126_0025504_1620_2069
Length 149
Sequence MSGFAPKNPDFRAIATATFDAQRAMRTLGMTLARLEPGEVDLVMPYAEFTQQNGFVHAGIITAGLDNACGIAAFALMPAGSDILTVEFKTNLLAPAKGERFRFHGIVIKPGRTLTVSEGRAYAEQDGVETLMATMTGTLMALPRRDRVE

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
78 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
79 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
80 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
81 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
129 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
130 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
131 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
177 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
178 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
179 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
252 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
295 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
301 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
302 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
305 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
306 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
307 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
308 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
309 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
310 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
311 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
312 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
313 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
314 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
315 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
316 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
317 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
318 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
319 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
320 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
321 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
322 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
323 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
324 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
325 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
328 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
329 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
330 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
331 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
332 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
333 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
334 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
335 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
336 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
337 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
338 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
339 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
340 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
341 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
342 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
343 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
344 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
345 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
346 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
347 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
348 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
349 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
350 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
351 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
352 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
353 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
354 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
355 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
356 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
357 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
358 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
359 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
360 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
361 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
362 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
363 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
364 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
365 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
366 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
367 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
368 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
369 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
370 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
371 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
372 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
373 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
374 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
375 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
376 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
377 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
378 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
379 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
380 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
381 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
382 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
383 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
384 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
385 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
386 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
387 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
388 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
389 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
390 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
391 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
392 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
393 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
394 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
395 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
396 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
397 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
398 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
399 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
400 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
401 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
402 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
403 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
404 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
405 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
406 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
407 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
408 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
409 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
410 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
411 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
412 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
413 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
414 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
415 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
416 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
417 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
418 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
419 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
420 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
421 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
422 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
423 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
424 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
425 2906610324
426 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
427 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
428 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
429 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
430 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
431 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
432 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
433 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
434 2922425934
435 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
436 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
437 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
438 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
439 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
440 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
441 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
442 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
443 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
444 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
445 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
446 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
447 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
448 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
449 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
450 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
451 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
452 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
453 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
454 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
455 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
456 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
457 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
458 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
459 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
460 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
461 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
462 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
463 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
464 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
465 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
466 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
467 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
468 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
469 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
470 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
471 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
472 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
473 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
474 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
475 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
476 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
477 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
478 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
479 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
480 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
481 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
482 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
483 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
484 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
485 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
486 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
487 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
488 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
489 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
490 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
491 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
492 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
493 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
494 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
495 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
496 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
497 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
498 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
499 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
500 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
501 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
502 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
503 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
504 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
505 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
506 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
507 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
508 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
509 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
510 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
511 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
512 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
513 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
514 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
515 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
516 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
517 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
518 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
519 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
520 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
521 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
522 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
523 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
524 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
525 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
526 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
527 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
528 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
529 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
530 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
531 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
532 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
533 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
534 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
535 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
536 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
537 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.45
Metatranscriptomes 0
Isolates 22.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.99
Nodule 18.71
Rhizoplane 7.35
Rhizosphere 44.43
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0025504 3300048929 Bacteria 5685
2 JGI24735J21928_10120518 3300002067 Bacteria 755
3 JGI25153J46596_10001308 3300003215 Bacteria 14903
4 JGI25153J46596_10002547 3300003215 Bacteria 10449
5 rootH2_10036861 3300003320 Bacteria 1319
6 JGI25160J50197_1001680 3300003354 Bacteria 10780
7 Ga0055524_1052347 3300003775 Bacteria 913
8 Ga0055531_10007525 3300003794 Bacteria 5917
9 Ga0055543_1017259 3300004625 Bacteria 1359
10 Ga0065165_1000370 3300005262 Bacteria 73604
11 Ga0065165_1012184 3300005262 Bacteria 3520
12 Ga0065165_1089545 3300005262 Bacteria 786
13 Ga0070670_100127407 3300005331 Bacteria 2197
14 Ga0068869_100345363 3300005334 Bacteria 1212
15 Ga0070682_100070266 3300005337 Bacteria 2238
16 Ga0070682_100618117 3300005337 Bacteria 858
17 Ga0070682_100915362 3300005337 Bacteria 722
18 Ga0068868_100640290 3300005338 Bacteria 946
19 Ga0070691_10270772 3300005341 Bacteria 918
20 Ga0070668_100027658 3300005347 Bacteria 4306
21 Ga0070668_100038158 3300005347 Bacteria 3670
22 Ga0070671_100032245 3300005355 Bacteria 4332
23 Ga0070671_100222294 3300005355 Bacteria 1602
24 Ga0070674_101038155 3300005356 Bacteria 721
25 Ga0070667_100094535 3300005367 Bacteria 2576
26 Ga0070667_100320826 3300005367 Bacteria 1398
27 Ga0070713_101699087 3300005436 Bacteria 613
28 Ga0070710_10180853 3300005437 Bacteria 1320
29 Ga0070663_100125401 3300005455 Bacteria 1944
30 Ga0070663_100268976 3300005455 Bacteria 1354
31 Ga0070663_100320285 3300005455 Bacteria 1246
32 Ga0070663_100365362 3300005455 Bacteria 1172
33 Ga0070662_100500807 3300005457 Bacteria 1013
34 Ga0070685_10412259 3300005466 Bacteria 938
35 Ga0070684_101031935 3300005535 Bacteria 772
36 Ga0068853_100024253 3300005539 Bacteria 5083
37 Ga0068853_100817741 3300005539 Bacteria 893
38 Ga0070672_100541762 3300005543 Bacteria 1010
39 Ga0070665_100021994 3300005548 Bacteria 6415
40 Ga0070665_100534235 3300005548 Bacteria 1185
41 Ga0068855_100709390 3300005563 Bacteria 1076
42 Ga0068855_101276537 3300005563 Bacteria 761
43 Ga0068855_101561652 3300005563 Bacteria 676
44 Ga0070664_100389100 3300005564 Bacteria 1274
45 Ga0070664_100636204 3300005564 Bacteria 991
46 Ga0068857_100399548 3300005577 Bacteria 1279
47 Ga0068857_100491475 3300005577 Bacteria 1151
48 Ga0068857_101078712 3300005577 Bacteria 775
49 Ga0068854_100170385 3300005578 Bacteria 1694
50 Ga0068854_100178571 3300005578 Bacteria 1657
51 Ga0068854_100373166 3300005578 Bacteria 1174
52 Ga0068854_100521212 3300005578 Bacteria 1004
53 Ga0068854_101806427 3300005578 Bacteria 560
54 Ga0068856_100253525 3300005614 Bacteria 1775
55 Ga0068856_100854963 3300005614 Bacteria 929
56 Ga0068852_100002075 3300005616 Bacteria 13685
57 Ga0068852_100671593 3300005616 Bacteria 1045
58 Ga0068852_100810600 3300005616 Bacteria 950
59 Ga0068861_100289094 3300005719 Bacteria 1415
60 Ga0068861_101115917 3300005719 Bacteria 759
61 Ga0068863_100979469 3300005841 Bacteria 848
62 Ga0068858_100256203 3300005842 Bacteria 1663
63 Ga0068858_100263829 3300005842 Bacteria 1638
64 Ga0068858_100798159 3300005842 Bacteria 921
65 Ga0068858_101492214 3300005842 Bacteria 667
66 Ga0068862_100249639 3300005844 Bacteria 1617
67 Ga0081455_10007464 3300005937 Bacteria 11515
68 Ga0081455_10020189 3300005937 Bacteria 6283
69 Ga0081540_1041170 3300005983 Bacteria 2398
70 Ga0070717_10579720 3300006028 Bacteria 1017
71 Ga0075365_10033553 3300006038 Bacteria 3309
72 Ga0075365_10046161 3300006038 Bacteria 2860
73 Ga0075365_10148175 3300006038 Bacteria 1632
74 Ga0075363_100003880 3300006048 Bacteria 6449
75 Ga0075363_100013785 3300006048 Bacteria 3932
76 Ga0075364_10055786 3300006051 Bacteria 2585
77 Ga0075364_10119783 3300006051 Bacteria 1761
78 Ga0075364_10598188 3300006051 Bacteria 754
79 Ga0070715_10132550 3300006163 Bacteria 1201
80 Ga0070712_100096023 3300006175 Bacteria 2182
81 Ga0075362_10329822 3300006177 Bacteria 761
82 Ga0075362_10497166 3300006177 Bacteria 623
83 Ga0075367_10022695 3300006178 Bacteria 3523
84 Ga0075367_10094061 3300006178 Bacteria 1826
85 Ga0075367_10505315 3300006178 Bacteria 767
86 Ga0075367_10704593 3300006178 Bacteria 642
87 Ga0075369_10054171 3300006186 Bacteria 1741
88 Ga0075369_10217195 3300006186 Bacteria 885
89 Ga0075369_10410523 3300006186 Bacteria 639
90 Ga0075366_10008044 3300006195 Bacteria 5844
91 Ga0075366_10025744 3300006195 Bacteria 3441
92 Ga0075366_10516214 3300006195 Bacteria 739
93 Ga0075366_10704728 3300006195 Bacteria 627
94 Ga0075370_10016468 3300006353 Bacteria 3977
95 Ga0075370_10095493 3300006353 Bacteria 1717
96 Ga0075370_10116208 3300006353 Bacteria 1555
97 Ga0075370_10165223 3300006353 Bacteria 1300
98 Ga0075370_10331045 3300006353 Bacteria 908
99 Ga0075370_10572254 3300006353 Bacteria 684
100 Ga0099824_1018951 3300006942 Bacteria 5500
101 Ga0099824_1045954 3300006942 Bacteria 908
102 Ga0099794_10604276 3300007265 Bacteria 581
103 Ga0105240_10002295 3300009093 Bacteria 30967
104 Ga0105240_10158314 3300009093 Bacteria 2692
105 Ga0105245_10132261 3300009098 Bacteria 2341
106 Ga0105247_10060123 3300009101 Bacteria 2354
107 Ga0105247_11056686 3300009101 Bacteria 638
108 Ga0105243_11137849 3300009148 Bacteria 791
109 Ga0105241_10012898 3300009174 Bacteria 6131
110 Ga0105241_10046174 3300009174 Bacteria 3307
111 Ga0105241_10083696 3300009174 Bacteria 2503
112 Ga0105242_10234670 3300009176 Bacteria 1646
113 Ga0105248_10208125 3300009177 Bacteria 2204
114 Ga0105237_10002301 3300009545 Bacteria 23744
115 Ga0105237_10026831 3300009545 Bacteria 5887
116 Ga0105237_10243165 3300009545 Bacteria 1801
117 Ga0105237_10282281 3300009545 Bacteria 1663
118 Ga0105237_10430729 3300009545 Bacteria 1325
119 Ga0105237_10522577 3300009545 Bacteria 1193
120 Ga0105237_10777870 3300009545 Bacteria 964
121 Ga0105237_10818919 3300009545 Bacteria 938
122 Ga0105238_10222417 3300009551 Bacteria 1864
123 Ga0105238_10343414 3300009551 Bacteria 1481
124 Ga0105238_10345957 3300009551 Bacteria 1475
125 Ga0105238_10816526 3300009551 Bacteria 948
126 Ga0105249_10597028 3300009553 Bacteria 1158
127 Ga0099796_10104707 3300010159 Bacteria 1069
128 Ga0105239_10083534 3300010375 Bacteria 3517
129 Ga0105239_10192439 3300010375 Bacteria 2283
130 Ga0105239_10248964 3300010375 Bacteria 1996
131 Ga0105239_10310473 3300010375 Bacteria 1777
132 Ga0105239_10321091 3300010375 Bacteria 1746
133 Ga0105239_10363670 3300010375 Bacteria 1634
134 Ga0105239_10484570 3300010375 Bacteria 1405
135 Ga0105239_10764953 3300010375 Bacteria 1106
136 Ga0105246_10047093 3300011119 Bacteria 2943
137 Ga0105246_10628795 3300011119 Bacteria 931
138 Ga0157373_10620341 3300013100 Bacteria 788
139 Ga0157370_10923850 3300013104 Bacteria 791
140 Ga0157369_10728786 3300013105 Bacteria 1020
141 Ga0157374_10414808 3300013296 Bacteria 1344
142 Ga0157378_10083406 3300013297 Bacteria 2892
143 Ga0163162_10155709 3300013306 Bacteria 2405
144 Ga0163162_10205407 3300013306 Bacteria 2099
145 Ga0157372_10511678 3300013307 Bacteria 1400
146 Ga0157375_10076159 3300013308 Bacteria 3381
147 Ga0157375_11002182 3300013308 Bacteria 975
148 Ga0163163_10043948 3300014325 Bacteria 4382
149 Ga0163163_10203230 3300014325 Bacteria 2030
150 Ga0157380_10931751 3300014326 Bacteria 897
151 Ga0157376_10420109 3300014969 Bacteria 1297
152 Ga0157376_11956442 3300014969 Bacteria 624
153 Ga0214544_1000003 3300021320 Bacteria 643752
154 Ga0214544_1027500 3300021320 Bacteria 2356
155 Ga0214542_1000003 3300021321 Bacteria 435700
156 Ga0214542_1021066 3300021321 Bacteria 4603
157 Ga0214545_1000004 3300021324 Bacteria 453352
158 Ga0214545_1021274 3300021324 Bacteria 4909
159 Ga0214543_1000007 3300021327 Bacteria 414744
160 Ga0214543_1038892 3300021327 Bacteria 1339
161 Ga0213871_10252072 3300021441 Bacteria 561
162 Ga0209148_1000267 3300025254 Bacteria 81839
163 Ga0209233_1006433 3300025261 Bacteria 3787
164 Ga0209233_1057807 3300025261 Bacteria 760
165 Ga0209455_1001737 3300025272 Bacteria 9272
166 Ga0209455_1020988 3300025272 Bacteria 1278
167 Ga0209564_1010432 3300025295 Bacteria 4282
168 Ga0209564_1013885 3300025295 Bacteria 3387
169 Ga0209758_1000030 3300025297 Bacteria 509217
170 Ga0209758_1000711 3300025297 Bacteria 49164
171 Ga0209758_1000893 3300025297 Bacteria 40627
172 Ga0209758_1001645 3300025297 Bacteria 25366
173 Ga0209758_1005049 3300025297 Bacteria 10483
174 Ga0209758_1048977 3300025297 Bacteria 1496
175 Ga0209758_1050772 3300025297 Bacteria 1451
176 Ga0209256_1002674 3300025299 Bacteria 13977
177 Ga0209256_1064108 3300025299 Bacteria 846
178 Ga0207426_1000271 3300025302 Bacteria 108392
179 Ga0207426_1028587 3300025302 Bacteria 1846
180 Ga0207426_1050390 3300025302 Bacteria 1241
181 Ga0209257_1000662 3300025304 Bacteria 54143
182 Ga0209257_1034819 3300025304 Bacteria 1565
183 Ga0207642_10250153 3300025899 Bacteria 1005
184 Ga0207710_10036862 3300025900 Bacteria 2157
185 Ga0207688_10040030 3300025901 Bacteria 2604
186 Ga0207688_10776181 3300025901 Bacteria 607
187 Ga0207647_10008109 3300025904 Bacteria 7549
188 Ga0207685_10177044 3300025905 Bacteria 986
189 Ga0207643_10271744 3300025908 Bacteria 1049
190 Ga0207654_10035222 3300025911 Bacteria 2788
191 Ga0207654_10050459 3300025911 Bacteria 2391
192 Ga0207654_10350344 3300025911 Bacteria 1016
193 Ga0207695_10000059 3300025913 Bacteria 363920
194 Ga0207695_10166168 3300025913 Bacteria 2135
195 Ga0207671_10001109 3300025914 Bacteria 32478
196 Ga0207671_10162971 3300025914 Bacteria 1727
197 Ga0207671_10626334 3300025914 Bacteria 857
198 Ga0207693_10086703 3300025915 Bacteria 2453
199 Ga0207663_11305480 3300025916 Bacteria 584
200 Ga0207657_10125678 3300025919 Bacteria 2106
201 Ga0207657_10301648 3300025919 Bacteria 1269
202 Ga0207649_10182539 3300025920 Bacteria 1469
203 Ga0207649_10697362 3300025920 Bacteria 787
204 Ga0207694_10239734 3300025924 Bacteria 1482
205 Ga0207694_10550030 3300025924 Bacteria 969
206 Ga0207694_10898332 3300025924 Bacteria 749
207 Ga0207650_10166112 3300025925 Bacteria 1751
208 Ga0207687_10110408 3300025927 Bacteria 2039
209 Ga0207687_10543234 3300025927 Bacteria 974
210 Ga0207690_10485716 3300025932 Bacteria 997
211 Ga0207665_10785494 3300025939 Bacteria 752
212 Ga0207691_10479033 3300025940 Bacteria 1058
213 Ga0207711_10464090 3300025941 Bacteria 1179
214 Ga0207711_11102262 3300025941 Bacteria 735
215 Ga0207689_10234288 3300025942 Bacteria 1517
216 Ga0207679_10254565 3300025945 Bacteria 1494
217 Ga0207679_11686947 3300025945 Bacteria 580
218 Ga0207667_11023619 3300025949 Bacteria 812
219 Ga0207651_10460290 3300025960 Bacteria 1093
220 Ga0207712_10946577 3300025961 Bacteria 763
221 Ga0207712_11242900 3300025961 Bacteria 665
222 Ga0207668_10421140 3300025972 Bacteria 1133
223 Ga0207640_10106784 3300025981 Bacteria 1976
224 Ga0207640_10134688 3300025981 Bacteria 1791
225 Ga0207640_10156872 3300025981 Bacteria 1679
226 Ga0207640_11489768 3300025981 Bacteria 608
227 Ga0207658_11144038 3300025986 Bacteria 711
228 Ga0207677_10334122 3300026023 Bacteria 1264
229 Ga0207677_10334697 3300026023 Bacteria 1263
230 Ga0207703_10614907 3300026035 Bacteria 1029
231 Ga0207639_10122810 3300026041 Bacteria 2136
232 Ga0207678_10021386 3300026067 Bacteria 5673
233 Ga0207678_10023768 3300026067 Bacteria 5359
234 Ga0207678_10165908 3300026067 Bacteria 1886
235 Ga0207678_10368582 3300026067 Bacteria 1240
236 Ga0207678_10496147 3300026067 Bacteria 1064
237 Ga0207702_10186192 3300026078 Bacteria 1915
238 Ga0207702_10603282 3300026078 Bacteria 1077
239 Ga0207676_10128955 3300026095 Bacteria 2147
240 Ga0207674_10057340 3300026116 Bacteria 3948
241 Ga0207674_10825419 3300026116 Bacteria 894
242 Ga0207675_100264139 3300026118 Bacteria 1669
243 Ga0207683_11205942 3300026121 Bacteria 701
244 Ga0207683_11515192 3300026121 Bacteria 619
245 Ga0207698_10013446 3300026142 Bacteria 5400
246 Ga0207698_10087346 3300026142 Bacteria 2539
247 Ga0207698_10528309 3300026142 Bacteria 1152
248 Ga0207698_11098225 3300026142 Bacteria 808
249 Ga0209389_1000055 3300027296 Bacteria 108798
250 Ga0209389_1000494 3300027296 Bacteria 23661
251 Ga0209589_1000024 3300027357 Bacteria 169886
252 Ga0209489_100123 3300027361 Bacteria 113105
253 Ga0209489_103769 3300027361 Bacteria 28981
254 Ga0209700_100420 3300027363 Bacteria 77617
255 Ga0209813_10053446 3300027866 Bacteria 1270
256 Ga0265356_1010764 3300028017 Bacteria 1018
257 Ga0268266_10001364 3300028379 Bacteria 29475
258 Ga0268266_10239343 3300028379 Bacteria 1674
259 Ga0268266_10298514 3300028379 Bacteria 1502
260 Ga0268265_10140308 3300028380 Bacteria 2023
261 Ga0268265_10210914 3300028380 Bacteria 1692
262 Ga0268264_11133699 3300028381 Bacteria 791
263 Ga0265334_10011370 3300028573 Bacteria 3749
264 Ga0307517_10332209 3300028786 Bacteria 835
265 Ga0307517_10403363 3300028786 Bacteria 723
266 Ga0307517_10441337 3300028786 Bacteria 677
267 Ga0307511_10297718 3300030521 Bacteria 731
268 Ga0265339_10071045 3300031249 Bacteria 1855
269 Ga0265331_10031992 3300031250 Bacteria 2610
270 Ga0307508_10512881 3300031616 Bacteria 794
271 Ga0265314_10053666 3300031711 Bacteria 2795
272 Ga0265342_10008706 3300031712 Bacteria 7240
273 Ga0307516_10229979 3300031730 Bacteria 1558
274 Ga0307516_10241341 3300031730 Bacteria 1505
275 Ga0307405_10095835 3300031731 Bacteria 1977
276 Ga0307414_11321901 3300032004 Bacteria 669
277 Ga0307411_10365037 3300032005 Bacteria 1182
278 Ga0307507_10103959 3300033179 Bacteria 2360
279 Ga0307510_10022034 3300033180 Bacteria 7406
280 Ga0307510_10108546 3300033180 Bacteria 2528
281 Ga0307510_10119002 3300033180 Bacteria 2353
282 Ga0315911_1000005 3300033442 Bacteria 426255
283 Ga0373934_0000358 3300035086 Bacteria 15879
284 Ga0373923_0000753 3300035111 Bacteria 8382
285 Ga0373932_0204291 3300035112 Bacteria 704
286 Ga0373936_0169488 3300035113 Bacteria 954
287 Ga0373945_0110163 3300035116 Bacteria 1086
288 Ga0373953_0002484 3300035117 Bacteria 5578
289 Ga0373954_0000139 3300035118 Bacteria 25320
290 Ga0373954_0242770 3300035118 Bacteria 886
291 Ga0373956_0003582 3300035119 Bacteria 6264
292 Ga0373957_0000613 3300035120 Bacteria 9090
293 Ga0373957_0154460 3300035120 Bacteria 943
294 Ga0373955_0001252 3300035172 Bacteria 10793
295 Ga0373955_0381066 3300035172 Bacteria 856
296 Ga0373955_0866763 3300035172 Bacteria 555
297 Ga0373924_0000828 3300035410 Bacteria 9668
298 Ga0373927_0261782 3300035695 Bacteria 1137
299 Ga0373933_0000018 3300035724 Bacteria 98044
300 Ga0373933_0000483 3300035724 Bacteria 24839
301 Ga0373947_0350593 3300035725 Bacteria 990
302 Ga0373947_0810916 3300035725 Bacteria 639
303 Ga0373937_0001773 3300036401 Bacteria 18126
304 Ga0373925_0019338 3300037068 Bacteria 4953
305 Ga0395898_0555782 3300037466 Bacteria 1090
306 Ga0395905_0005908 3300037471 Bacteria 12410
307 Ga0395905_0592385 3300037471 Bacteria 1010
308 Ga0436364_0801353 3300037853 Bacteria 781
309 Ga0395901_1264844 3300038443 Bacteria 701
310 Ga0436365_0754803 3300039437 Bacteria 693
311 Ga0436360_0772853 3300039438 Bacteria 892
312 Ga0436360_0804832 3300039438 Bacteria 2262
313 Ga0436363_0094513 3300039450 Bacteria 3452
314 Ga0451793_1169719 3300041452 Bacteria 582
315 Ga0451797_0446152 3300041453 Bacteria 1147
316 Ga0451795_1352875 3300041456 Bacteria 655
317 Ga0451800_0990012 3300041459 Bacteria 531
318 Ga0451804_0138868 3300041463 Bacteria 621
319 Ga0451807_2098532 3300041486 Bacteria 578
320 Ga0451841_1306720 3300041498 Bacteria 776
321 Ga0451853_0845700 3300041512 Bacteria 963
322 Ga0439458_0021899 3300042157 Bacteria 1482
323 Ga0466969_0026762 3300044656 Bacteria 2957
324 Ga0466972_0000124 3300044658 Bacteria 65163
325 Ga0466972_0002537 3300044658 Bacteria 9032
326 Ga0466972_0033197 3300044658 Bacteria 2532
327 Ga0466972_0262935 3300044658 Bacteria 807
328 Ga0466972_0465292 3300044658 Bacteria 594
329 Ga0466965_0026765 3300044683 Bacteria 2796
330 Ga0466966_0000411 3300044684 Bacteria 27522
331 Ga0466961_0000065 3300044693 Bacteria 63259
332 Ga0466963_0027444 3300044694 Bacteria 3646
333 Ga0466964_0035942 3300044706 Bacteria 1984
334 Ga0466964_0516493 3300044706 Bacteria 644
335 Ga0466968_0006334 3300044735 Bacteria 4457
336 Ga0466970_0148197 3300044765 Bacteria 1295
337 Ga0466957_0504412 3300044842 Bacteria 839
338 Ga0466960_0001481 3300044901 Bacteria 8559
339 Ga0466960_0052310 3300044901 Bacteria 1976
340 Ga0466960_0139165 3300044901 Bacteria 1288
341 Ga0466960_0507829 3300044901 Bacteria 707
342 Ga0466959_0000634 3300045049 Bacteria 20407
343 Ga0451576_1972404 3300045051 Bacteria 602
344 Ga0466967_0761480 3300045976 Bacteria 960
345 Ga0495617_065178 3300046452 Bacteria 1202
346 Ga0495592_0001002 3300046454 Bacteria 19619
347 Ga0495592_0041982 3300046454 Bacteria 3426
348 Ga0495592_0736988 3300046454 Bacteria 590
349 Ga0495603_0082839 3300046455 Bacteria 1879
350 Ga0495603_0449954 3300046455 Bacteria 738
351 Ga0495629_0000548 3300046459 Bacteria 30813
352 Ga0495629_0003519 3300046459 Bacteria 11838
353 Ga0495638_0358715 3300046460 Bacteria 767
354 Ga0495651_0004449 3300046462 Bacteria 10735
355 Ga0495651_0008038 3300046462 Bacteria 8087
356 Ga0495651_0017692 3300046462 Bacteria 5518
357 Ga0495651_0055832 3300046462 Bacteria 3034
358 Ga0495653_0000621 3300046463 Bacteria 27177
359 Ga0495650_0189933 3300046471 Bacteria 718
360 Ga0495605_0187040 3300046474 Bacteria 908
361 Ga0495605_0213581 3300046474 Bacteria 836
362 Ga0495664_0011915 3300046477 Bacteria 4914
363 Ga0495664_0845483 3300046477 Bacteria 537
364 Ga0495584_0195624 3300046491 Bacteria 1028
365 Ga0495607_0220741 3300046501 Bacteria 927
366 Ga0495583_0085723 3300046506 Bacteria 1363
367 Ga0495606_0111396 3300046507 Bacteria 1650
368 Ga0495606_0125680 3300046507 Bacteria 1529
369 Ga0495606_0303432 3300046507 Bacteria 864
370 Ga0495608_0004080 3300046511 Bacteria 10475
371 Ga0495608_0009906 3300046511 Bacteria 6653
372 Ga0495608_0137141 3300046511 Bacteria 1563
373 Ga0495610_0039495 3300046512 Bacteria 2386
374 Ga0495610_0092527 3300046512 Bacteria 1368
375 Ga0495610_0104078 3300046512 Bacteria 1267
376 Ga0495616_0100882 3300046513 Bacteria 1354
377 Ga0495616_0156383 3300046513 Bacteria 1028
378 Ga0495618_0050116 3300046514 Bacteria 2637
379 Ga0495618_0209615 3300046514 Bacteria 1232
380 Ga0495620_0303203 3300046515 Bacteria 607
381 Ga0495632_0323814 3300046519 Bacteria 681
382 Ga0495632_0435183 3300046519 Bacteria 570
383 Ga0495643_0084086 3300046522 Bacteria 1651
384 Ga0495643_0348331 3300046522 Bacteria 664
385 Ga0495648_0008955 3300046524 Bacteria 7820
386 Ga0495648_0118511 3300046524 Bacteria 1427
387 Ga0495648_0129020 3300046524 Bacteria 1347
388 Ga0495648_0371427 3300046524 Bacteria 647
389 Ga0495648_0418892 3300046524 Bacteria 594
390 Ga0495652_0005458 3300046529 Bacteria 11981
391 Ga0495652_0009264 3300046529 Bacteria 8948
392 Ga0495652_0089837 3300046529 Bacteria 2514
393 Ga0495652_0496148 3300046529 Bacteria 847
394 Ga0495640_0003653 3300046533 Bacteria 12360
395 Ga0495640_0024790 3300046533 Bacteria 4359
396 Ga0495640_0109383 3300046533 Bacteria 1807
397 Ga0495640_0143090 3300046533 Bacteria 1541
398 Ga0495587_0004331 3300046536 Bacteria 9367
399 Ga0495587_0008038 3300046536 Bacteria 6810
400 Ga0495609_0074392 3300046538 Bacteria 1490
401 Ga0495609_0281370 3300046538 Bacteria 680
402 Ga0495597_0054038 3300046542 Bacteria 1765
403 Ga0495597_0164380 3300046542 Bacteria 904
404 Ga0495597_0270201 3300046542 Bacteria 664
405 Ga0495645_0006393 3300046543 Bacteria 8180
406 Ga0495645_0060436 3300046543 Bacteria 2747
407 Ga0495622_0075579 3300046557 Bacteria 1552
408 Ga0495622_0085644 3300046557 Bacteria 1449
409 Ga0495667_0005992 3300046559 Bacteria 8219
410 Ga0495667_0010990 3300046559 Bacteria 6118
411 Ga0495667_0255562 3300046559 Bacteria 1115
412 Ga0495634_0027492 3300046642 Bacteria 3957
413 Ga0495611_0117288 3300046648 Bacteria 1241
414 Ga0495625_0125577 3300046660 Bacteria 1742
415 Ga0495625_0153452 3300046660 Bacteria 1547
416 Ga0495625_0173943 3300046660 Bacteria 1436
417 Ga0495635_0000485 3300046663 Bacteria 25077
418 Ga0495635_0034679 3300046663 Bacteria 3500
419 Ga0495661_0078682 3300046665 Bacteria 1907
420 Ga0495661_0161351 3300046665 Bacteria 1203
421 Ga0495588_0001353 3300046674 Bacteria 10458
422 Ga0495657_0002384 3300046675 Bacteria 15809
423 Ga0495657_0009555 3300046675 Bacteria 7346
424 Ga0495657_0014532 3300046675 Bacteria 5776
425 Ga0495599_0004607 3300046678 Bacteria 8178
426 Ga0495599_0007052 3300046678 Bacteria 6799
427 Ga0495623_0004663 3300046679 Bacteria 9010
428 Ga0495623_0010248 3300046679 Bacteria 6064
429 Ga0495623_0515362 3300046679 Bacteria 630
430 Ga0495623_0530501 3300046679 Bacteria 618
431 Ga0495646_0001052 3300046680 Bacteria 15982
432 Ga0495646_0084868 3300046680 Bacteria 1838
433 Ga0495647_0277678 3300046681 Bacteria 751
434 Ga0495647_0567668 3300046681 Bacteria 531
435 Ga0495613_0018736 3300046689 Bacteria 5162
436 Ga0495613_0026235 3300046689 Bacteria 4341
437 Ga0495613_0203892 3300046689 Bacteria 1393
438 Ga0495624_0110799 3300046690 Bacteria 1688
439 Ga0495624_0133408 3300046690 Bacteria 1522
440 Ga0495671_0044614 3300046692 Bacteria 2222
441 Ga0495671_0072278 3300046692 Bacteria 1694
442 Ga0495671_0137433 3300046692 Bacteria 1191
443 Ga0495649_0195374 3300046694 Bacteria 1052
444 Ga0495649_0501496 3300046694 Bacteria 603
445 Ga0495649_0553598 3300046694 Bacteria 569
446 Ga0495600_0002436 3300046809 Bacteria 10671
447 Ga0495600_0040201 3300046809 Bacteria 3045
448 Ga0495660_0232610 3300046810 Bacteria 863
449 Ga0495581_0322033 3300047315 Bacteria 903
450 Ga0495604_0002741 3300047317 Bacteria 14128
451 Ga0495604_0011194 3300047317 Bacteria 7123
452 Ga0495674_0010919 3300047319 Bacteria 8583
453 Ga0495674_0018174 3300047319 Bacteria 6545
454 Ga0495672_0113778 3300047320 Bacteria 1449
455 Ga0495672_0280888 3300047320 Bacteria 796
456 Ga0495672_0440711 3300047320 Bacteria 589
457 Ga0495676_0862556 3300047321 Bacteria 581
458 Ga0495680_0001218 3300047322 Bacteria 28201
459 Ga0495680_0001876 3300047322 Bacteria 22116
460 Ga0495683_0108129 3300047323 Bacteria 1330
461 Ga0495683_0226122 3300047323 Bacteria 832
462 Ga0495687_016979 3300047443 Bacteria 3645
463 Ga0495675_0005191 3300047444 Bacteria 7928
464 Ga0495675_0007387 3300047444 Bacteria 6766
465 Ga0495673_0086675 3300047469 Bacteria 1287
466 Ga0495673_0101252 3300047469 Bacteria 1164
467 Ga0495673_0144885 3300047469 Bacteria 923
468 Ga0495684_0006208 3300047471 Bacteria 9295
469 Ga0495686_0102462 3300047472 Bacteria 1725
470 Ga0495593_0006582 3300047673 Bacteria 6800
471 Ga0495593_0042988 3300047673 Bacteria 2424
472 Ga0495593_0283657 3300047673 Bacteria 828
473 Ga0495602_0025825 3300048088 Bacteria 5678
474 Ga0495602_0043056 3300048088 Bacteria 4108
475 Ga0495602_0116623 3300048088 Bacteria 2157
476 Ga0495626_0238207 3300048091 Bacteria 733
477 Ga0496100_0369209 3300048903 Bacteria 1088
478 Ga0496100_0378706 3300048903 Bacteria 1074
479 Ga0496101_0055034 3300048904 Bacteria 2873
480 Ga0496101_0197965 3300048904 Bacteria 1552
481 Ga0496101_0203491 3300048904 Bacteria 1531
482 Ga0496101_0261857 3300048904 Bacteria 1349
483 Ga0496101_0377982 3300048904 Bacteria 1114
484 Ga0496102_0065986 3300048905 Bacteria 3317
485 Ga0496102_0134420 3300048905 Bacteria 2317
486 Ga0496102_0665425 3300048905 Bacteria 964
487 Ga0496102_0771706 3300048905 Bacteria 884
488 Ga0496102_1143397 3300048905 Unclassified 698
489 Ga0496103_0170816 3300048906 Bacteria 1396
490 Ga0496103_0296277 3300048906 Bacteria 1040
491 Ga0496104_0009070 3300048907 Bacteria 8843
492 Ga0496104_0009239 3300048907 Bacteria 8766
493 Ga0496104_0024225 3300048907 Bacteria 5582
494 Ga0496104_0300591 3300048907 Bacteria 1517
495 Ga0496105_0022832 3300048908 Bacteria 5070
496 Ga0496105_0039456 3300048908 Bacteria 3892
497 Ga0496105_0099088 3300048908 Bacteria 2407
498 Ga0496105_0414876 3300048908 Bacteria 1067
499 Ga0496105_0521582 3300048908 Bacteria 930
500 Ga0496106_0167040 3300048909 Bacteria 1742
501 Ga0496106_0436924 3300048909 Bacteria 1052
502 Ga0496106_0559714 3300048909 Bacteria 917
503 Ga0496106_0779263 3300048909 Bacteria 759
504 Ga0496107_0011974 3300048910 Bacteria 6054
505 Ga0496107_0386949 3300048910 Bacteria 1040
506 Ga0496107_0634846 3300048910 Bacteria 788
507 Ga0496108_0013488 3300048911 Bacteria 6669
508 Ga0496108_0264468 3300048911 Bacteria 1497
509 Ga0496108_0597150 3300048911 Bacteria 962
510 Ga0496108_0714595 3300048911 Bacteria 868
511 Ga0496108_1247714 3300048911 Bacteria 627
512 Ga0496109_0222517 3300048912 Bacteria 1775
513 Ga0496109_1135777 3300048912 Bacteria 718
514 Ga0496109_1868522 3300048912 Bacteria 533
515 Ga0496110_0015752 3300048913 Bacteria 6301
516 Ga0496110_0645228 3300048913 Bacteria 958
517 Ga0496110_0781267 3300048913 Bacteria 859
518 Ga0496111_0056301 3300048914 Bacteria 2845
519 Ga0496112_0112634 3300048915 Bacteria 2691
520 Ga0496112_0180234 3300048915 Bacteria 2076
521 Ga0496112_0358092 3300048915 Bacteria 1401
522 Ga0496112_0621920 3300048915 Bacteria 1011
523 Ga0496112_0910348 3300048915 Bacteria 801
524 Ga0496113_0132671 3300048916 Bacteria 1955
525 Ga0496113_0172916 3300048916 Bacteria 1711
526 Ga0496113_0825141 3300048916 Bacteria 736
527 Ga0496114_0014145 3300048917 Bacteria 6399
528 Ga0496114_0106684 3300048917 Bacteria 2397
529 Ga0496114_0768772 3300048917 Bacteria 841
530 Ga0496114_1165417 3300048917 Bacteria 656
531 Ga0496115_0069485 3300048918 Bacteria 2853
532 Ga0496115_0623086 3300048918 Bacteria 856
533 Ga0496115_0681863 3300048918 Bacteria 809
534 Ga0496116_0028887 3300048919 Bacteria 4009
535 Ga0496116_0032538 3300048919 Bacteria 3715
536 Ga0496116_0176733 3300048919 Bacteria 1148
537 Ga0496117_0138840 3300048920 Bacteria 1459
538 Ga0496118_0058655 3300048921 Bacteria 2874
539 Ga0496118_0086650 3300048921 Bacteria 2175
540 Ga0496118_0132742 3300048921 Bacteria 1595
541 Ga0496118_0183080 3300048921 Bacteria 1263
542 Ga0496119_0015983 3300048922 Bacteria 5739
543 Ga0496119_0099238 3300048922 Bacteria 1638
544 Ga0496119_0114528 3300048922 Bacteria 1491
545 Ga0496119_0173832 3300048922 Bacteria 1135
546 Ga0496119_0197583 3300048922 Bacteria 1043
547 Ga0496120_0033190 3300048923 Bacteria 3103
548 Ga0496120_0035858 3300048923 Bacteria 2958
549 Ga0496120_0180493 3300048923 Bacteria 1037
550 Ga0496120_0342058 3300048923 Bacteria 674
551 Ga0496121_0051348 3300048924 Bacteria 3473
552 Ga0496121_0071559 3300048924 Bacteria 2788
553 Ga0496121_0156417 3300048924 Bacteria 1672
554 Ga0496121_0181808 3300048924 Bacteria 1517
555 Ga0496121_0257607 3300048924 Bacteria 1206
556 Ga0496121_0585819 3300048924 Bacteria 691
557 Ga0496122_0107056 3300048925 Bacteria 1849
558 Ga0496122_0172742 3300048925 Bacteria 1300
559 Ga0496124_0053485 3300048927 Bacteria 3422
560 Ga0496124_0094461 3300048927 Bacteria 2432
561 Ga0496124_0465222 3300048927 Bacteria 858
562 Ga0496125_0072928 3300048928 Bacteria 2673
563 Ga0496125_0090959 3300048928 Bacteria 2288
564 Ga0496125_0107839 3300048928 Bacteria 2028
565 Ga0496126_0053629 3300048929 Bacteria 3657
566 Ga0496126_0079669 3300048929 Bacteria 2899
567 Ga0496126_0116717 3300048929 Bacteria 2319
568 Ga0496126_0123836 3300048929 Bacteria 2239
569 Ga0496126_0128136 3300048929 Bacteria 2195
570 Ga0496126_0136445 3300048929 Bacteria 2115
571 Ga0496126_0165102 3300048929 Bacteria 1890
572 Ga0496126_0181616 3300048929 Bacteria 1787
573 Ga0496126_0216603 3300048929 Bacteria 1610
574 Ga0496126_0719225 3300048929 Bacteria 774
575 Ga0501069_0255397 3300049585 Bacteria 1023
576 nmdc:mga03n38_208_c1 3300050490 Bacteria 12446
577 nmdc:mga00v17_47055_c1 3300050491 Bacteria 2612
578 nmdc:mga0yw44_14616_c1 3300050492 Bacteria 4175
579 nmdc:mga0yw44_311037_c1 3300050492 Bacteria 1057
580 nmdc:mga0yw44_314564_c1 3300050492 Bacteria 1051
581 nmdc:mga0yw44_392453_c1 3300050492 Bacteria 938
582 nmdc:mga0yw44_65034_c1 3300050492 Bacteria 2246
583 nmdc:mga0k408_243398_c1 3300050493 Bacteria 1074
584 nmdc:mga0k408_38473_c1 3300050493 Bacteria 2745
585 nmdc:mga06z11_16946_c1 3300050494 Bacteria 3295
586 nmdc:mga06z11_49948_c1 3300050494 Bacteria 2136
587 nmdc:mga06z11_504482_c1 3300050494 Bacteria 733
588 nmdc:mga07m45_130015_c1 3300050496 Bacteria 1457
589 nmdc:mga07m45_14648_c1 3300050496 Bacteria 4182
590 nmdc:mga07m45_16646_c1 3300050496 Bacteria 3937
591 nmdc:mga07m45_222539_c1 3300050496 Bacteria 1098
592 nmdc:mga07m45_623685_c1 3300050496 Bacteria 622
593 nmdc:mga07m45_63200_c1 3300050496 Bacteria 2099
594 nmdc:mga0sz30_151294_c1 3300050516 Bacteria 1027
595 nmdc:mga0sz30_6086_c1 3300050516 Bacteria 4162
596 nmdc:mga0sz30_73187_c1 3300050516 Bacteria 1477
597 Ga0495601_0033196 3300053077 Bacteria 3215
598 Ga0495601_0272517 3300053077 Bacteria 1104
599 Ga0500635_0006652 3300053080 Bacteria 3095
600 Ga0500635_0304780 3300053080 Bacteria 629
601 Ga0495655_0007685 3300053083 Bacteria 2016
602 Ga0495595_0000228 3300053084 Bacteria 22263
603 Ga0495595_0086573 3300053084 Bacteria 1499
604 Ga0495619_0010162 3300053085 Bacteria 5927
605 Ga0495619_0032494 3300053085 Bacteria 3387
606 Ga0495619_0132565 3300053085 Bacteria 1713
607 Ga0500578_0075763 3300053086 Bacteria 2143
608 Ga0500578_0112060 3300053086 Bacteria 1719
609 Ga0500578_0137131 3300053086 Bacteria 1531
610 Ga0500578_0310679 3300053086 Bacteria 932
611 Ga0500643_000028 3300053087 Bacteria 245672
612 Ga0500646_0073762 3300053090 Bacteria 1028
613 Ga0500646_0283400 3300053090 Bacteria 591
614 Ga0500647_0018007 3300053091 Bacteria 3267
615 Ga0500583_0022614 3300053092 Bacteria 2636
616 Ga0500651_0038098 3300053093 Bacteria 3029
617 Ga0500651_0292826 3300053093 Bacteria 936
618 Ga0500566_0000245 3300053094 Bacteria 28976
619 Ga0500566_0030646 3300053094 Bacteria 3136
620 Ga0500566_0036675 3300053094 Bacteria 2843
621 Ga0500641_0128217 3300053096 Bacteria 1094
622 Ga0500648_402598 3300053097 Bacteria 518
623 Ga0500650_0156669 3300053098 Bacteria 1051
624 Ga0500650_0212197 3300053098 Bacteria 879
625 Ga0500554_004128 3300053102 Bacteria 3048
626 Ga0500554_169053 3300053102 Bacteria 737
627 Ga0500555_002075 3300053103 Bacteria 5892
628 Ga0500557_000116 3300053105 Bacteria 22549
629 Ga0500562_033049 3300053108 Bacteria 1366
630 Ga0500569_073810 3300053109 Bacteria 1078
631 Ga0500569_086035 3300053109 Bacteria 1012
632 Ga0500572_004788 3300053111 Bacteria 3067
633 Ga0500595_000580 3300053119 Bacteria 21802
634 Ga0500595_022059 3300053119 Bacteria 2262
635 Ga0500595_028183 3300053119 Bacteria 1917
636 Ga0500595_035552 3300053119 Bacteria 1639
637 Ga0500595_070336 3300053119 Bacteria 1039
638 Ga0500614_029540 3300053123 Bacteria 1331
639 Ga0500621_083974 3300053126 Bacteria 1274
640 Ga0500626_101125 3300053128 Bacteria 1256
641 Ga0500642_0000113 3300053130 Bacteria 37567
642 Ga0500642_0001807 3300053130 Bacteria 6174
643 Ga0500642_0122019 3300053130 Bacteria 1219
644 Ga0500655_052564 3300053133 Bacteria 813
645 Ga0500559_0015844 3300053136 Bacteria 3183
646 Ga0500559_0089064 3300053136 Bacteria 1411
647 Ga0500559_0154303 3300053136 Bacteria 1078
648 Ga0500568_0008444 3300053139 Bacteria 4959
649 Ga0500573_0080595 3300053140 Bacteria 1849
650 Ga0500588_0240251 3300053146 Bacteria 678
651 Ga0500590_072629 3300053148 Bacteria 1707
652 Ga0500590_146045 3300053148 Bacteria 1074
653 Ga0500590_161657 3300053148 Bacteria 997
654 Ga0500590_226676 3300053148 Bacteria 765
655 Ga0500603_006835 3300053150 Bacteria 2488
656 Ga0500616_0029749 3300053153 Bacteria 3004
657 Ga0500622_0041342 3300053156 Bacteria 2400
658 Ga0500624_087586 3300053157 Bacteria 628
659 Ga0500627_0022685 3300053158 Bacteria 2548
660 Ga0500633_0037108 3300053160 Bacteria 1616
661 Ga0500638_080762 3300053162 Bacteria 1544
662 Ga0500636_0000054 3300053177 Bacteria 54446
663 Ga0500636_0198312 3300053177 Bacteria 1064
664 Ga0500636_0298034 3300053177 Bacteria 796
665 Ga0500636_0312870 3300053177 Bacteria 767
666 Ga0500637_0000303 3300053178 Bacteria 18607
667 Ga0500637_0176292 3300053178 Bacteria 1226
668 Ga0500649_238065 3300053722 Bacteria 542
669 Ga0500625_017426 3300053729 Bacteria 3355
670 Ga0500596_001601 3300053735 Bacteria 4589
671 Ga0500599_001389 3300053736 Bacteria 2765
672 Ga0500601_000834 3300053737 Bacteria 3791
673 Ga0500661_001086 3300055283 Bacteria 5115
674 2507504488 2507262055 Bacteria 8048963
675 2508694744 2508501042 Bacteria 8719808
676 2511400261 2511231028 Bacteria 8046582
677 2513624283 2513237092 Bacteria 8341956
678 2513638768 2513237094 Bacteria 8789602
679 2513649246 2513237095 Bacteria 8976980
680 2513656160 2513237096 Bacteria 8722461
681 2513706205 2513237102 Bacteria 7703324
682 2513716655 2513237104 Bacteria 10034502
683 2513861587 2513237137 Bacteria 9558895
684 2513874128 2513237139 Bacteria 8737671
685 2513917660 2513237145 Bacteria 8979722
686 2514010105 2513237161 Bacteria 8871253
687 2515624337 2515154112 Bacteria 8294334
688 2517103026 2517093001 Bacteria 9002274
689 2517889798 2517572143 Bacteria 9484767
690 2524438867 2524023205 Bacteria 8918781
691 2528849487 2528768022 Bacteria 10457665
692 2617350253 2617270735 Bacteria 9163226
693 2617374345 2617270741 Bacteria 8201522
694 2671119646 2667528175 Bacteria 7532676
695 2728748325 2728368998 Bacteria 8720350
696 2745080372 2744054633 Bacteria 8678936
697 2793059254 2791355196 Bacteria 7323613
698 2805920847 2802429603 Bacteria 8777136
699 2818240635 2816332527 Bacteria 8933356
700 2824607603 2824600985 Bacteria 8488197
701 2824615345 2824609381 Bacteria 8672835
702 2824618794 2824617872 Bacteria 8814715
703 2824628900 2824626560 Bacteria 8813858
704 2824638411 2824635225 Bacteria 8785348
705 2824648043 2824644064 Bacteria 8743947
706 2824657966 2824653114 Bacteria 8493680
707 2824665884 2824661429 Bacteria 9877870
708 2824675854 2824671348 Bacteria 8369588
709 2824681637 2824679649 Bacteria 8248951
710 2824692815 2824687955 Bacteria 8360029
711 2824699394 2824696289 Bacteria 8335049
712 2824710855 2824704595 Bacteria 9667483
713 2824722612 2824714736 Bacteria 8717648
714 2824726002 2824723954 Bacteria 8758240
715 2824736434 2824732956 Bacteria 7810675
716 2824751040 2824746037 Bacteria 7911610
717 2824761522 2824753945 Bacteria 9787441
718 2824765065 2824763712 Bacteria 9792355
719 2824778050 2824773399 Bacteria 8360218
720 2838125983 2838122688 Bacteria 8803140
721 2841942622 2841941048 Bacteria 8688029
722 2841953026 2841949485 Bacteria 8680857
723 2841963875 2841957949 Bacteria 8652217
724 2841970948 2841966195 Bacteria 8673214
725 2841977794 2841974524 Bacteria 8931498
726 2841984644 2841983080 Bacteria 8395090
727 2842041633 2842038055 Bacteria 8002051
728 2842049675 2842045827 Bacteria 8006841
729 2844321471 2844315083 Bacteria 8138177
730 2847931927 2847930680 Bacteria 9342022
731 2847943165 2847939898 Bacteria 8606328
732 2857514829 2857509624 Bacteria 7472071
733 2874595376 2874590934 Bacteria 8299676
734 2874620427 2874612657 Bacteria 8252029
735 2874621917 2874620515 Bacteria 8290088
736 2874629589 2874628541 Bacteria 8630250
737 2874651802 2874645413 Bacteria 8214782
738 2876763621 2876761206 Bacteria 10111113
739 2876775570 2876771140 Bacteria 8287509
740 2876812908 2876808645 Bacteria 8824342
741 2876823562 2876818435 Bacteria 8274608
742 2879079661 2879074833 Bacteria 8279565
743 2879091163 2879083081 Bacteria 8587928
744 2879104442 2879099564 Bacteria 10442239
745 2879112373 2879110137 Bacteria 8907982
746 2879133935 2879127579 Bacteria 8294491
747 2879145068 2879142872 Bacteria 8267021
748 2881364577 2881364244 Bacteria 7710352
749 2881673320 2881665667 Bacteria 8175609
750 2885374339 2885366525 Bacteria 8326213
751 2885413719 2885409591 Bacteria 9235467
752 2888387315 2888378607 Bacteria 9652610
753 2888426992 2888419890 Bacteria 7857137
754 2903727950 2903727486 Bacteria 8281579
755 2904669490 2904666416 Bacteria 8226587
756 2904695184 2904690495 Bacteria 9412302
757 2904716496 2904711408 Bacteria 9771557
758 2906602566 2906602504 Bacteria 8295279
759 2906612473
760 2906629674 2906626472 Bacteria 8826946
761 2906642496 2906635258 Bacteria 8601019
762 2906645794 2906643746 Bacteria 8722424
763 2906661050 2906660503 Bacteria 8595048
764 2908757586 2908756301 Bacteria 8864324
765 2908776827 2908775508 Bacteria 8092255
766 2922391703 2922386360 Bacteria 7017218
767 2922400121 2922393267 Bacteria 8285685
768 2922433028
769 2929622688 2929615660 Bacteria 9193770
770 2929632209 2929624759 Bacteria 9339455
771 2932789974 2932784394 Bacteria 9704911
772 2932800649 2932794094 Bacteria 7915132
773 2932808380 2932801729 Bacteria 7987968
774 2932815516 2932809354 Bacteria 9135765
775 2932824908 2932818245 Bacteria 9955613
776 2932829170 2932828146 Bacteria 9745859
777 2933584681 2933577622 Bacteria 9116884
778 2935613108 2935608549 Bacteria 8203142
779 2935617645 2935616580 Bacteria 9032984
780 2935632982 2935630451 Bacteria 8169952
781 2935643690 2935638405 Bacteria 10015038
782 2935654064 2935648319 Bacteria 8801166
783 2935662834 2935656913 Bacteria 8965014
784 2935671000 2935665750 Bacteria 9571747
785 2935681643 2935675223 Bacteria 9928132
786 2935692620 2935684952 Bacteria 9590419
787 2935702606 2935694250 Bacteria 9291695
788 2935711894 2935703347 Bacteria 10242284
789 2935721238 2935713505 Bacteria 9608509
790 2935730768 2935722832 Bacteria 9608746
791 2935739928 2935732158 Bacteria 9706831
792 2935748966 2935741537 Bacteria 9707219
793 2935758836 2935750917 Bacteria 9590372
794 2935767100 2935760218 Bacteria 9817913
795 2935774864 2935769743 Bacteria 7878163
796 2935779950 2935777560 Bacteria 8077691
797 2935792218 2935785616 Bacteria 7962367
798 2935798613 2935793552 Bacteria 8012592
799 2935806865 2935801545 Bacteria 9301974
800 2935818870 2935810662 Bacteria 9401221
801 2935825040 2935819856 Bacteria 8261050
802 2935834375 2935827899 Bacteria 10038562
803 2935843900 2935837841 Bacteria 9454360
804 2935852259 2935847175 Bacteria 8228321
805 2935856856 2935855204 Bacteria 9035059
806 2935868383 2935864058 Bacteria 9784707
807 2935879693 2935873716 Bacteria 9632195
808 2935910692 2935908558 Bacteria 8568796
809 2935921872 2935916978 Bacteria 9113783
810 2935929989 2935926038 Bacteria 8601059
811 2935937657 2935934488 Bacteria 8602579
812 2935949761 2935942939 Bacteria 8599779
813 2935956857 2935951376 Bacteria 8602333
814 2935965319 2935959822 Bacteria 7869783
815 2935970886 2935967501 Bacteria 8603075
816 2935982984 2935975950 Bacteria 8347125
817 2935984373 2935984226 Bacteria 8302647
818 2935997199 2935992306 Bacteria 9802711
819 2936009946 2936002035 Bacteria 9362176
820 2936016969 2936011229 Bacteria 8801034
821 2936025623 2936019824 Bacteria 8804134
822 2936034465 2936028420 Bacteria 8965941
823 2936045444 2936037263 Bacteria 9446081
824 2936052501 2936046547 Bacteria 8903709
825 2936055453 2936055302 Bacteria 8785755
826 2940564574 2940556831 Bacteria 9590747
827 2941509716 2941507105 Bacteria 8166816
828 2941517545 2941515067 Bacteria 8166720
829 2941526502 2941523033 Bacteria 8169134
830 2941532051 2941531003 Bacteria 7653939
831 2941545148 2941538514 Bacteria 9402094
832 3005475999 3005474847 Bacteria 9259049
833 3005506526 3005506211 Bacteria 6943378
834 3005593199 3005587118 Bacteria 7794411
835 3005601838 3005594810 Bacteria 8716512
836 3005717575 3005710791 Bacteria 7622528
837 3005724624 3005718088 Bacteria 8283608
838 8006928329 8006926726 Bacteria 6749210
839 8016519042 8016511872 Bacteria 9921665
840 8016525262 8016522445 Bacteria 8156687
841 8016538844 8016530956 Bacteria 8155261
842 8016543127 8016539877 Bacteria 8155419
843 8016550162 8016548790 Bacteria 8155074
844 8016558571 8016557553 Bacteria 8154380
845 8016568540 8016566248 Bacteria 8158151
846 8016581184 8016575299 Bacteria 8154085
847 8016587518 8016583857 Bacteria 10421953
848 8016596554 8016595262 Bacteria 8149947
849 8016607413 8016603502 Bacteria 8731218
850 8016619221 8016613128 Bacteria 8794220
851 8016630378 8016622563 Bacteria 7999408
852 8016636755 8016630954 Bacteria 9217207
853 8017057654 8017057580 Bacteria 10023680
854 8019541310 8019538911 Bacteria 7872763
855 8019549321 8019547302 Bacteria 7996444
856 8019561321 8019555841 Bacteria 9642137
857 8019571404 8019565922 Bacteria 9639779
858 8019596194 8019586578 Bacteria 10212056
859 8019605500 8019597564 Bacteria 10041141
860 8019613038 8019608314 Bacteria 10042931
861 8019623725 8019619141 Bacteria 9218857
862 8019638309 8019629233 Bacteria 8687553
863 8019641327 8019638758 Bacteria 9062356
864 8019651698 8019648815 Bacteria 10014479
865 8019666233 8019659431 Bacteria 8577854
866 8019675735 8019668869 Bacteria 8791617
867 8019680364 8019678201 Bacteria 8863603
868 8019695456 8019687851 Bacteria 8712826
869 8055750571 8055742211 Bacteria 9226248
870 8056692087 8056689827 Bacteria 6712655
871 8056975348 8056967851 Bacteria 9038162
872 Ga0496126_0025504
873 JGI24735J21928_10120518
874 JGI25153J46596_10001308
875 JGI25153J46596_10002547
876 rootH2_10036861
877 JGI25160J50197_1001680
878 Ga0055524_1052347
879 Ga0055531_10007525
880 Ga0055543_1017259
881 Ga0065165_1000370
882 Ga0065165_1012184
883 Ga0065165_1089545
884 Ga0070670_100127407
885 Ga0068869_100345363
886 Ga0070682_100070266
887 Ga0070682_100618117
888 Ga0070682_100915362
889 Ga0068868_100640290
890 Ga0070691_10270772
891 Ga0070668_100027658
892 Ga0070668_100038158
893 Ga0070671_100032245
894 Ga0070671_100222294
895 Ga0070674_101038155
896 Ga0070667_100094535
897 Ga0070667_100320826
898 Ga0070713_101699087
899 Ga0070710_10180853
900 Ga0070663_100125401
901 Ga0070663_100268976
902 Ga0070663_100320285
903 Ga0070663_100365362
904 Ga0070662_100500807
905 Ga0070685_10412259
906 Ga0070684_101031935
907 Ga0068853_100024253
908 Ga0068853_100817741
909 Ga0070672_100541762
910 Ga0070665_100021994
911 Ga0070665_100534235
912 Ga0068855_100709390
913 Ga0068855_101276537
914 Ga0068855_101561652
915 Ga0070664_100389100
916 Ga0070664_100636204
917 Ga0068857_100399548
918 Ga0068857_100491475
919 Ga0068857_101078712
920 Ga0068854_100170385
921 Ga0068854_100178571
922 Ga0068854_100373166
923 Ga0068854_100521212
924 Ga0068854_101806427
925 Ga0068856_100253525
926 Ga0068856_100854963
927 Ga0068852_100002075
928 Ga0068852_100671593
929 Ga0068852_100810600
930 Ga0068861_100289094
931 Ga0068861_101115917
932 Ga0068863_100979469
933 Ga0068858_100256203
934 Ga0068858_100263829
935 Ga0068858_100798159
936 Ga0068858_101492214
937 Ga0068862_100249639
938 Ga0081455_10007464
939 Ga0081455_10020189
940 Ga0081540_1041170
941 Ga0070717_10579720
942 Ga0075365_10033553
943 Ga0075365_10046161
944 Ga0075365_10148175
945 Ga0075363_100003880
946 Ga0075363_100013785
947 Ga0075364_10055786
948 Ga0075364_10119783
949 Ga0075364_10598188
950 Ga0070715_10132550
951 Ga0070712_100096023
952 Ga0075362_10329822
953 Ga0075362_10497166
954 Ga0075367_10022695
955 Ga0075367_10094061
956 Ga0075367_10505315
957 Ga0075367_10704593
958 Ga0075369_10054171
959 Ga0075369_10217195
960 Ga0075369_10410523
961 Ga0075366_10008044
962 Ga0075366_10025744
963 Ga0075366_10516214
964 Ga0075366_10704728
965 Ga0075370_10016468
966 Ga0075370_10095493
967 Ga0075370_10116208
968 Ga0075370_10165223
969 Ga0075370_10331045
970 Ga0075370_10572254
971 Ga0099824_1018951
972 Ga0099824_1045954
973 Ga0099794_10604276
974 Ga0105240_10002295
975 Ga0105240_10158314
976 Ga0105245_10132261
977 Ga0105247_10060123
978 Ga0105247_11056686
979 Ga0105243_11137849
980 Ga0105241_10012898
981 Ga0105241_10046174
982 Ga0105241_10083696
983 Ga0105242_10234670
984 Ga0105248_10208125
985 Ga0105237_10002301
986 Ga0105237_10026831
987 Ga0105237_10243165
988 Ga0105237_10282281
989 Ga0105237_10430729
990 Ga0105237_10522577
991 Ga0105237_10777870
992 Ga0105237_10818919
993 Ga0105238_10222417
994 Ga0105238_10343414
995 Ga0105238_10345957
996 Ga0105238_10816526
997 Ga0105249_10597028
998 Ga0099796_10104707
999 Ga0105239_10083534
1000 Ga0105239_10192439
1001 Ga0105239_10248964
1002 Ga0105239_10310473
1003 Ga0105239_10321091
1004 Ga0105239_10363670
1005 Ga0105239_10484570
1006 Ga0105239_10764953
1007 Ga0105246_10047093
1008 Ga0105246_10628795
1009 Ga0157373_10620341
1010 Ga0157370_10923850
1011 Ga0157369_10728786
1012 Ga0157374_10414808
1013 Ga0157378_10083406
1014 Ga0163162_10155709
1015 Ga0163162_10205407
1016 Ga0157372_10511678
1017 Ga0157375_10076159
1018 Ga0157375_11002182
1019 Ga0163163_10043948
1020 Ga0163163_10203230
1021 Ga0157380_10931751
1022 Ga0157376_10420109
1023 Ga0157376_11956442
1024 Ga0214544_1000003
1025 Ga0214544_1027500
1026 Ga0214542_1000003
1027 Ga0214542_1021066
1028 Ga0214545_1000004
1029 Ga0214545_1021274
1030 Ga0214543_1000007
1031 Ga0214543_1038892
1032 Ga0213871_10252072
1033 Ga0209148_1000267
1034 Ga0209233_1006433
1035 Ga0209233_1057807
1036 Ga0209455_1001737
1037 Ga0209455_1020988
1038 Ga0209564_1010432
1039 Ga0209564_1013885
1040 Ga0209758_1000030
1041 Ga0209758_1000711
1042 Ga0209758_1000893
1043 Ga0209758_1001645
1044 Ga0209758_1005049
1045 Ga0209758_1048977
1046 Ga0209758_1050772
1047 Ga0209256_1002674
1048 Ga0209256_1064108
1049 Ga0207426_1000271
1050 Ga0207426_1028587
1051 Ga0207426_1050390
1052 Ga0209257_1000662
1053 Ga0209257_1034819
1054 Ga0207642_10250153
1055 Ga0207710_10036862
1056 Ga0207688_10040030
1057 Ga0207688_10776181
1058 Ga0207647_10008109
1059 Ga0207685_10177044
1060 Ga0207643_10271744
1061 Ga0207654_10035222
1062 Ga0207654_10050459
1063 Ga0207654_10350344
1064 Ga0207695_10000059
1065 Ga0207695_10166168
1066 Ga0207671_10001109
1067 Ga0207671_10162971
1068 Ga0207671_10626334
1069 Ga0207693_10086703
1070 Ga0207663_11305480
1071 Ga0207657_10125678
1072 Ga0207657_10301648
1073 Ga0207649_10182539
1074 Ga0207649_10697362
1075 Ga0207694_10239734
1076 Ga0207694_10550030
1077 Ga0207694_10898332
1078 Ga0207650_10166112
1079 Ga0207687_10110408
1080 Ga0207687_10543234
1081 Ga0207690_10485716
1082 Ga0207665_10785494
1083 Ga0207691_10479033
1084 Ga0207711_10464090
1085 Ga0207711_11102262
1086 Ga0207689_10234288
1087 Ga0207679_10254565
1088 Ga0207679_11686947
1089 Ga0207667_11023619
1090 Ga0207651_10460290
1091 Ga0207712_10946577
1092 Ga0207712_11242900
1093 Ga0207668_10421140
1094 Ga0207640_10106784
1095 Ga0207640_10134688
1096 Ga0207640_10156872
1097 Ga0207640_11489768
1098 Ga0207658_11144038
1099 Ga0207677_10334122
1100 Ga0207677_10334697
1101 Ga0207703_10614907
1102 Ga0207639_10122810
1103 Ga0207678_10021386
1104 Ga0207678_10023768
1105 Ga0207678_10165908
1106 Ga0207678_10368582
1107 Ga0207678_10496147
1108 Ga0207702_10186192
1109 Ga0207702_10603282
1110 Ga0207676_10128955
1111 Ga0207674_10057340
1112 Ga0207674_10825419
1113 Ga0207675_100264139
1114 Ga0207683_11205942
1115 Ga0207683_11515192
1116 Ga0207698_10013446
1117 Ga0207698_10087346
1118 Ga0207698_10528309
1119 Ga0207698_11098225
1120 Ga0209389_1000055
1121 Ga0209389_1000494
1122 Ga0209589_1000024
1123 Ga0209489_100123
1124 Ga0209489_103769
1125 Ga0209700_100420
1126 Ga0209813_10053446
1127 Ga0265356_1010764
1128 Ga0268266_10001364
1129 Ga0268266_10239343
1130 Ga0268266_10298514
1131 Ga0268265_10140308
1132 Ga0268265_10210914
1133 Ga0268264_11133699
1134 Ga0265334_10011370
1135 Ga0307517_10332209
1136 Ga0307517_10403363
1137 Ga0307517_10441337
1138 Ga0307511_10297718
1139 Ga0265339_10071045
1140 Ga0265331_10031992
1141 Ga0307508_10512881
1142 Ga0265314_10053666
1143 Ga0265342_10008706
1144 Ga0307516_10229979
1145 Ga0307516_10241341
1146 Ga0307405_10095835
1147 Ga0307414_11321901
1148 Ga0307411_10365037
1149 Ga0307507_10103959
1150 Ga0307510_10022034
1151 Ga0307510_10108546
1152 Ga0307510_10119002
1153 Ga0315911_1000005
1154 Ga0373934_0000358
1155 Ga0373923_0000753
1156 Ga0373932_0204291
1157 Ga0373936_0169488
1158 Ga0373945_0110163
1159 Ga0373953_0002484
1160 Ga0373954_0000139
1161 Ga0373954_0242770
1162 Ga0373956_0003582
1163 Ga0373957_0000613
1164 Ga0373957_0154460
1165 Ga0373955_0001252
1166 Ga0373955_0381066
1167 Ga0373955_0866763
1168 Ga0373924_0000828
1169 Ga0373927_0261782
1170 Ga0373933_0000018
1171 Ga0373933_0000483
1172 Ga0373947_0350593
1173 Ga0373947_0810916
1174 Ga0373937_0001773
1175 Ga0373925_0019338
1176 Ga0395898_0555782
1177 Ga0395905_0005908
1178 Ga0395905_0592385
1179 Ga0436364_0801353
1180 Ga0395901_1264844
1181 Ga0436365_0754803
1182 Ga0436360_0772853
1183 Ga0436360_0804832
1184 Ga0436363_0094513
1185 Ga0451793_1169719
1186 Ga0451797_0446152
1187 Ga0451795_1352875
1188 Ga0451800_0990012
1189 Ga0451804_0138868
1190 Ga0451807_2098532
1191 Ga0451841_1306720
1192 Ga0451853_0845700
1193 Ga0439458_0021899
1194 Ga0466969_0026762
1195 Ga0466972_0000124
1196 Ga0466972_0002537
1197 Ga0466972_0033197
1198 Ga0466972_0262935
1199 Ga0466972_0465292
1200 Ga0466965_0026765
1201 Ga0466966_0000411
1202 Ga0466961_0000065
1203 Ga0466963_0027444
1204 Ga0466964_0035942
1205 Ga0466964_0516493
1206 Ga0466968_0006334
1207 Ga0466970_0148197
1208 Ga0466957_0504412
1209 Ga0466960_0001481
1210 Ga0466960_0052310
1211 Ga0466960_0139165
1212 Ga0466960_0507829
1213 Ga0466959_0000634
1214 Ga0451576_1972404
1215 Ga0466967_0761480
1216 Ga0495617_065178
1217 Ga0495592_0001002
1218 Ga0495592_0041982
1219 Ga0495592_0736988
1220 Ga0495603_0082839
1221 Ga0495603_0449954
1222 Ga0495629_0000548
1223 Ga0495629_0003519
1224 Ga0495638_0358715
1225 Ga0495651_0004449
1226 Ga0495651_0008038
1227 Ga0495651_0017692
1228 Ga0495651_0055832
1229 Ga0495653_0000621
1230 Ga0495650_0189933
1231 Ga0495605_0187040
1232 Ga0495605_0213581
1233 Ga0495664_0011915
1234 Ga0495664_0845483
1235 Ga0495584_0195624
1236 Ga0495607_0220741
1237 Ga0495583_0085723
1238 Ga0495606_0111396
1239 Ga0495606_0125680
1240 Ga0495606_0303432
1241 Ga0495608_0004080
1242 Ga0495608_0009906
1243 Ga0495608_0137141
1244 Ga0495610_0039495
1245 Ga0495610_0092527
1246 Ga0495610_0104078
1247 Ga0495616_0100882
1248 Ga0495616_0156383
1249 Ga0495618_0050116
1250 Ga0495618_0209615
1251 Ga0495620_0303203
1252 Ga0495632_0323814
1253 Ga0495632_0435183
1254 Ga0495643_0084086
1255 Ga0495643_0348331
1256 Ga0495648_0008955
1257 Ga0495648_0118511
1258 Ga0495648_0129020
1259 Ga0495648_0371427
1260 Ga0495648_0418892
1261 Ga0495652_0005458
1262 Ga0495652_0009264
1263 Ga0495652_0089837
1264 Ga0495652_0496148
1265 Ga0495640_0003653
1266 Ga0495640_0024790
1267 Ga0495640_0109383
1268 Ga0495640_0143090
1269 Ga0495587_0004331
1270 Ga0495587_0008038
1271 Ga0495609_0074392
1272 Ga0495609_0281370
1273 Ga0495597_0054038
1274 Ga0495597_0164380
1275 Ga0495597_0270201
1276 Ga0495645_0006393
1277 Ga0495645_0060436
1278 Ga0495622_0075579
1279 Ga0495622_0085644
1280 Ga0495667_0005992
1281 Ga0495667_0010990
1282 Ga0495667_0255562
1283 Ga0495634_0027492
1284 Ga0495611_0117288
1285 Ga0495625_0125577
1286 Ga0495625_0153452
1287 Ga0495625_0173943
1288 Ga0495635_0000485
1289 Ga0495635_0034679
1290 Ga0495661_0078682
1291 Ga0495661_0161351
1292 Ga0495588_0001353
1293 Ga0495657_0002384
1294 Ga0495657_0009555
1295 Ga0495657_0014532
1296 Ga0495599_0004607
1297 Ga0495599_0007052
1298 Ga0495623_0004663
1299 Ga0495623_0010248
1300 Ga0495623_0515362
1301 Ga0495623_0530501
1302 Ga0495646_0001052
1303 Ga0495646_0084868
1304 Ga0495647_0277678
1305 Ga0495647_0567668
1306 Ga0495613_0018736
1307 Ga0495613_0026235
1308 Ga0495613_0203892
1309 Ga0495624_0110799
1310 Ga0495624_0133408
1311 Ga0495671_0044614
1312 Ga0495671_0072278
1313 Ga0495671_0137433
1314 Ga0495649_0195374
1315 Ga0495649_0501496
1316 Ga0495649_0553598
1317 Ga0495600_0002436
1318 Ga0495600_0040201
1319 Ga0495660_0232610
1320 Ga0495581_0322033
1321 Ga0495604_0002741
1322 Ga0495604_0011194
1323 Ga0495674_0010919
1324 Ga0495674_0018174
1325 Ga0495672_0113778
1326 Ga0495672_0280888
1327 Ga0495672_0440711
1328 Ga0495676_0862556
1329 Ga0495680_0001218
1330 Ga0495680_0001876
1331 Ga0495683_0108129
1332 Ga0495683_0226122
1333 Ga0495687_016979
1334 Ga0495675_0005191
1335 Ga0495675_0007387
1336 Ga0495673_0086675
1337 Ga0495673_0101252
1338 Ga0495673_0144885
1339 Ga0495684_0006208
1340 Ga0495686_0102462
1341 Ga0495593_0006582
1342 Ga0495593_0042988
1343 Ga0495593_0283657
1344 Ga0495602_0025825
1345 Ga0495602_0043056
1346 Ga0495602_0116623
1347 Ga0495626_0238207
1348 Ga0496100_0369209
1349 Ga0496100_0378706
1350 Ga0496101_0055034
1351 Ga0496101_0197965
1352 Ga0496101_0203491
1353 Ga0496101_0261857
1354 Ga0496101_0377982
1355 Ga0496102_0065986
1356 Ga0496102_0134420
1357 Ga0496102_0665425
1358 Ga0496102_0771706
1359 Ga0496102_1143397
1360 Ga0496103_0170816
1361 Ga0496103_0296277
1362 Ga0496104_0009070
1363 Ga0496104_0009239
1364 Ga0496104_0024225
1365 Ga0496104_0300591
1366 Ga0496105_0022832
1367 Ga0496105_0039456
1368 Ga0496105_0099088
1369 Ga0496105_0414876
1370 Ga0496105_0521582
1371 Ga0496106_0167040
1372 Ga0496106_0436924
1373 Ga0496106_0559714
1374 Ga0496106_0779263
1375 Ga0496107_0011974
1376 Ga0496107_0386949
1377 Ga0496107_0634846
1378 Ga0496108_0013488
1379 Ga0496108_0264468
1380 Ga0496108_0597150
1381 Ga0496108_0714595
1382 Ga0496108_1247714
1383 Ga0496109_0222517
1384 Ga0496109_1135777
1385 Ga0496109_1868522
1386 Ga0496110_0015752
1387 Ga0496110_0645228
1388 Ga0496110_0781267
1389 Ga0496111_0056301
1390 Ga0496112_0112634
1391 Ga0496112_0180234
1392 Ga0496112_0358092
1393 Ga0496112_0621920
1394 Ga0496112_0910348
1395 Ga0496113_0132671
1396 Ga0496113_0172916
1397 Ga0496113_0825141
1398 Ga0496114_0014145
1399 Ga0496114_0106684
1400 Ga0496114_0768772
1401 Ga0496114_1165417
1402 Ga0496115_0069485
1403 Ga0496115_0623086
1404 Ga0496115_0681863
1405 Ga0496116_0028887
1406 Ga0496116_0032538
1407 Ga0496116_0176733
1408 Ga0496117_0138840
1409 Ga0496118_0058655
1410 Ga0496118_0086650
1411 Ga0496118_0132742
1412 Ga0496118_0183080
1413 Ga0496119_0015983
1414 Ga0496119_0099238
1415 Ga0496119_0114528
1416 Ga0496119_0173832
1417 Ga0496119_0197583
1418 Ga0496120_0033190
1419 Ga0496120_0035858
1420 Ga0496120_0180493
1421 Ga0496120_0342058
1422 Ga0496121_0051348
1423 Ga0496121_0071559
1424 Ga0496121_0156417
1425 Ga0496121_0181808
1426 Ga0496121_0257607
1427 Ga0496121_0585819
1428 Ga0496122_0107056
1429 Ga0496122_0172742
1430 Ga0496124_0053485
1431 Ga0496124_0094461
1432 Ga0496124_0465222
1433 Ga0496125_0072928
1434 Ga0496125_0090959
1435 Ga0496125_0107839
1436 Ga0496126_0053629
1437 Ga0496126_0079669
1438 Ga0496126_0116717
1439 Ga0496126_0123836
1440 Ga0496126_0128136
1441 Ga0496126_0136445
1442 Ga0496126_0165102
1443 Ga0496126_0181616
1444 Ga0496126_0216603
1445 Ga0496126_0719225
1446 Ga0501069_0255397
1447 nmdc:mga03n38_208_c1
1448 nmdc:mga00v17_47055_c1
1449 nmdc:mga0yw44_14616_c1
1450 nmdc:mga0yw44_311037_c1
1451 nmdc:mga0yw44_314564_c1
1452 nmdc:mga0yw44_392453_c1
1453 nmdc:mga0yw44_65034_c1
1454 nmdc:mga0k408_243398_c1
1455 nmdc:mga0k408_38473_c1
1456 nmdc:mga06z11_16946_c1
1457 nmdc:mga06z11_49948_c1
1458 nmdc:mga06z11_504482_c1
1459 nmdc:mga07m45_130015_c1
1460 nmdc:mga07m45_14648_c1
1461 nmdc:mga07m45_16646_c1
1462 nmdc:mga07m45_222539_c1
1463 nmdc:mga07m45_623685_c1
1464 nmdc:mga07m45_63200_c1
1465 nmdc:mga0sz30_151294_c1
1466 nmdc:mga0sz30_6086_c1
1467 nmdc:mga0sz30_73187_c1
1468 Ga0495601_0033196
1469 Ga0495601_0272517
1470 Ga0500635_0006652
1471 Ga0500635_0304780
1472 Ga0495655_0007685
1473 Ga0495595_0000228
1474 Ga0495595_0086573
1475 Ga0495619_0010162
1476 Ga0495619_0032494
1477 Ga0495619_0132565
1478 Ga0500578_0075763
1479 Ga0500578_0112060
1480 Ga0500578_0137131
1481 Ga0500578_0310679
1482 Ga0500643_000028
1483 Ga0500646_0073762
1484 Ga0500646_0283400
1485 Ga0500647_0018007
1486 Ga0500583_0022614
1487 Ga0500651_0038098
1488 Ga0500651_0292826
1489 Ga0500566_0000245
1490 Ga0500566_0030646
1491 Ga0500566_0036675
1492 Ga0500641_0128217
1493 Ga0500648_402598
1494 Ga0500650_0156669
1495 Ga0500650_0212197
1496 Ga0500554_004128
1497 Ga0500554_169053
1498 Ga0500555_002075
1499 Ga0500557_000116
1500 Ga0500562_033049
1501 Ga0500569_073810
1502 Ga0500569_086035
1503 Ga0500572_004788
1504 Ga0500595_000580
1505 Ga0500595_022059
1506 Ga0500595_028183
1507 Ga0500595_035552
1508 Ga0500595_070336
1509 Ga0500614_029540
1510 Ga0500621_083974
1511 Ga0500626_101125
1512 Ga0500642_0000113
1513 Ga0500642_0001807
1514 Ga0500642_0122019
1515 Ga0500655_052564
1516 Ga0500559_0015844
1517 Ga0500559_0089064
1518 Ga0500559_0154303
1519 Ga0500568_0008444
1520 Ga0500573_0080595
1521 Ga0500588_0240251
1522 Ga0500590_072629
1523 Ga0500590_146045
1524 Ga0500590_161657
1525 Ga0500590_226676
1526 Ga0500603_006835
1527 Ga0500616_0029749
1528 Ga0500622_0041342
1529 Ga0500624_087586
1530 Ga0500627_0022685
1531 Ga0500633_0037108
1532 Ga0500638_080762
1533 Ga0500636_0000054
1534 Ga0500636_0198312
1535 Ga0500636_0298034
1536 Ga0500636_0312870
1537 Ga0500637_0000303
1538 Ga0500637_0176292
1539 Ga0500649_238065
1540 Ga0500625_017426
1541 Ga0500596_001601
1542 Ga0500599_001389
1543 Ga0500601_000834
1544 Ga0500661_001086
1545 2507504488
1546 2508694744
1547 2511400261
1548 2513624283
1549 2513638768
1550 2513649246
1551 2513656160
1552 2513706205
1553 2513716655
1554 2513861587
1555 2513874128
1556 2513917660
1557 2514010105
1558 2515624337
1559 2517103026
1560 2517889798
1561 2524438867
1562 2528849487
1563 2617350253
1564 2617374345
1565 2671119646
1566 2728748325
1567 2745080372
1568 2793059254
1569 2805920847
1570 2818240635
1571 2824607603
1572 2824615345
1573 2824618794
1574 2824628900
1575 2824638411
1576 2824648043
1577 2824657966
1578 2824665884
1579 2824675854
1580 2824681637
1581 2824692815
1582 2824699394
1583 2824710855
1584 2824722612
1585 2824726002
1586 2824736434
1587 2824751040
1588 2824761522
1589 2824765065
1590 2824778050
1591 2838125983
1592 2841942622
1593 2841953026
1594 2841963875
1595 2841970948
1596 2841977794
1597 2841984644
1598 2842041633
1599 2842049675
1600 2844321471
1601 2847931927
1602 2847943165
1603 2857514829
1604 2874595376
1605 2874620427
1606 2874621917
1607 2874629589
1608 2874651802
1609 2876763621
1610 2876775570
1611 2876812908
1612 2876823562
1613 2879079661
1614 2879091163
1615 2879104442
1616 2879112373
1617 2879133935
1618 2879145068
1619 2881364577
1620 2881673320
1621 2885374339
1622 2885413719
1623 2888387315
1624 2888426992
1625 2903727950
1626 2904669490
1627 2904695184
1628 2904716496
1629 2906602566
1630 2906612473
1631 2906629674
1632 2906642496
1633 2906645794
1634 2906661050
1635 2908757586
1636 2908776827
1637 2922391703
1638 2922400121
1639 2922433028
1640 2929622688
1641 2929632209
1642 2932789974
1643 2932800649
1644 2932808380
1645 2932815516
1646 2932824908
1647 2932829170
1648 2933584681
1649 2935613108
1650 2935617645
1651 2935632982
1652 2935643690
1653 2935654064
1654 2935662834
1655 2935671000
1656 2935681643
1657 2935692620
1658 2935702606
1659 2935711894
1660 2935721238
1661 2935730768
1662 2935739928
1663 2935748966
1664 2935758836
1665 2935767100
1666 2935774864
1667 2935779950
1668 2935792218
1669 2935798613
1670 2935806865
1671 2935818870
1672 2935825040
1673 2935834375
1674 2935843900
1675 2935852259
1676 2935856856
1677 2935868383
1678 2935879693
1679 2935910692
1680 2935921872
1681 2935929989
1682 2935937657
1683 2935949761
1684 2935956857
1685 2935965319
1686 2935970886
1687 2935982984
1688 2935984373
1689 2935997199
1690 2936009946
1691 2936016969
1692 2936025623
1693 2936034465
1694 2936045444
1695 2936052501
1696 2936055453
1697 2940564574
1698 2941509716
1699 2941517545
1700 2941526502
1701 2941532051
1702 2941545148
1703 3005475999
1704 3005506526
1705 3005593199
1706 3005601838
1707 3005717575
1708 3005724624
1709 8006928329
1710 8016519042
1711 8016525262
1712 8016538844
1713 8016543127
1714 8016550162
1715 8016558571
1716 8016568540
1717 8016581184
1718 8016587518
1719 8016596554
1720 8016607413
1721 8016619221
1722 8016630378
1723 8016636755
1724 8017057654
1725 8019541310
1726 8019549321
1727 8019561321
1728 8019571404
1729 8019596194
1730 8019605500
1731 8019613038
1732 8019623725
1733 8019638309
1734 8019641327
1735 8019651698
1736 8019666233
1737 8019675735
1738 8019680364
1739 8019695456
1740 8055750571
1741 8056692087
1742 8056975348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

53

130

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e1e-assembly1.cif.gz_B crystal structure of a thioesterase family protein from silicibacter pomeroyi. northeast structural genomics target sir180a 0.9961 6 144
3e1e-assembly1.cif.gz_B crystal structure of a thioesterase family protein from silicibacter pomeroyi. northeast structural genomics target sir180a 0.982 6 144
3nwz-assembly3.cif.gz_D crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9686 42 143
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9413 22 143
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9394 22 143
ID Description Score Start End Superfamily
3e1eD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9929 10 144 3.10.129.10
3e1eD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9714 10 144 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9212 22 143 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9151 22 143 3.10.129.10
af_Q9HDW5_92_245_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9139 39 141 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A4E0Q1Z6-F1-model_v4 deleted 1.001 1 145
AF-A0A6G8UCS0-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9999 1 146 GO:0016289
AF-A0A7V9UPY1-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9958 25 142 GO:0016289
AF-A0A176FA14-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9947 1 144 GO:0016289
AF-A0A3C1EEI2-F1-model_v4 Thioesterase 0.9946 1 143 GO:0047617

Map