F484188

General Info

Members Datasets Scaffolds Average Seq Length
871 340 871 168

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_11605391|Ga0207676_116053911
Length 190
Sequence MRGRRPPLAVGAPRMESPINPFFRKAGAWLHRRAENVAAGLLAAMFIAFVLQIFFRYVFNFPIGWTSELTVITWLWLVLWGAAFVVKESDEIRFDLLYSAAGRRARVVVGIVAAVSIIALYAASLPATISYVSFMKVEKTAYLKIRFDHLFSIYVIFAVAIIVRYVWILWRLLRDRKAADDDPTSVSSGL

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
209 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
233 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
234 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
235 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
236 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
237 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
258 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
290 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
291 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
292 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
340 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 1.03
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10367499 3300005289 Bacteria 789
2 Ga0065715_10962985 3300005293 Bacteria 556
3 Ga0065707_10173185 3300005295 Bacteria 1467
4 Ga0065707_10846835 3300005295 Unclassified 581
5 Ga0070658_10017623 3300005327 Bacteria 5713
6 Ga0070658_10105219 3300005327 Bacteria 2335
7 Ga0070676_10001406 3300005328 Bacteria 12138
8 Ga0070676_10014325 3300005328 Bacteria 4359
9 Ga0070683_100003515 3300005329 Bacteria 12748
10 Ga0070683_101543511 3300005329 Bacteria 638
11 Ga0070690_100016568 3300005330 Bacteria 4418
12 Ga0070690_100193928 3300005330 Bacteria 1410
13 Ga0070670_100005195 3300005331 Bacteria 10960
14 Ga0070670_100252819 3300005331 Bacteria 1535
15 Ga0070677_10086386 3300005333 Bacteria 1355
16 Ga0070677_10125758 3300005333 Bacteria 1164
17 Ga0068869_100003269 3300005334 Bacteria 9895
18 Ga0068869_100003339 3300005334 Bacteria 9801
19 Ga0068869_100005842 3300005334 Bacteria 7767
20 Ga0068869_100203016 3300005334 Bacteria 1564
21 Ga0068869_100474259 3300005334 Bacteria 1041
22 Ga0068869_101094994 3300005334 Unclassified 697
23 Ga0070666_10001532 3300005335 Bacteria 14033
24 Ga0070666_10027573 3300005335 Bacteria 3721
25 Ga0070666_10286263 3300005335 Bacteria 1172
26 Ga0070666_10489697 3300005335 Bacteria 891
27 Ga0070680_100071170 3300005336 Bacteria 2857
28 Ga0070680_100239501 3300005336 Bacteria 1533
29 Ga0070680_100255550 3300005336 Bacteria 1482
30 Ga0070682_100329616 3300005337 Bacteria 1131
31 Ga0068868_100003224 3300005338 Bacteria 11348
32 Ga0068868_100003921 3300005338 Bacteria 10393
33 Ga0068868_100150123 3300005338 Bacteria 1918
34 Ga0070660_100007313 3300005339 Bacteria 7695
35 Ga0070660_100023611 3300005339 Bacteria 4557
36 Ga0070660_100066979 3300005339 Bacteria 2797
37 Ga0070660_100375605 3300005339 Bacteria 1173
38 Ga0070660_100839845 3300005339 Bacteria 773
39 Ga0070689_100030682 3300005340 Bacteria 4081
40 Ga0070689_100499672 3300005340 Bacteria 1042
41 Ga0070691_10041575 3300005341 Bacteria 2174
42 Ga0070691_10228340 3300005341 Bacteria 989
43 Ga0070687_100000139 3300005343 Bacteria 25149
44 Ga0070661_100004250 3300005344 Bacteria 9878
45 Ga0070661_100185500 3300005344 Bacteria 1584
46 Ga0070692_10008048 3300005345 Bacteria 4679
47 Ga0070692_10109928 3300005345 Bacteria 1523
48 Ga0070668_100000553 3300005347 Bacteria 24984
49 Ga0070668_100001829 3300005347 Bacteria 15477
50 Ga0070668_100027620 3300005347 Bacteria 4308
51 Ga0070668_100233465 3300005347 Bacteria 1521
52 Ga0070668_100288544 3300005347 Bacteria 1373
53 Ga0070668_100705899 3300005347 Bacteria 890
54 Ga0070669_100011703 3300005353 Bacteria 6223
55 Ga0070669_100113075 3300005353 Bacteria 2062
56 Ga0070669_100450731 3300005353 Bacteria 1060
57 Ga0070675_100012659 3300005354 Bacteria 6617
58 Ga0070675_100107221 3300005354 Bacteria 2359
59 Ga0070675_100281842 3300005354 Bacteria 1461
60 Ga0070671_100012100 3300005355 Bacteria 6943
61 Ga0070671_100123074 3300005355 Bacteria 2183
62 Ga0070671_100259147 3300005355 Bacteria 1478
63 Ga0070674_100148057 3300005356 Bacteria 1769
64 Ga0070674_100160383 3300005356 Bacteria 1706
65 Ga0070674_100286421 3300005356 Bacteria 1308
66 Ga0070674_100421142 3300005356 Bacteria 1096
67 Ga0070674_100865250 3300005356 Bacteria 785
68 Ga0070673_100004291 3300005364 Bacteria 9001
69 Ga0070673_100070921 3300005364 Bacteria 2798
70 Ga0070673_100151764 3300005364 Bacteria 1963
71 Ga0070673_100519856 3300005364 Bacteria 1078
72 Ga0070673_100719390 3300005364 Bacteria 918
73 Ga0070688_100066343 3300005365 Bacteria 2296
74 Ga0070659_100012507 3300005366 Bacteria 6293
75 Ga0070659_100129150 3300005366 Bacteria 2051
76 Ga0070659_100444822 3300005366 Bacteria 1099
77 Ga0070667_100009252 3300005367 Bacteria 8162
78 Ga0070667_100026164 3300005367 Bacteria 4853
79 Ga0070667_100282438 3300005367 Bacteria 1491
80 Ga0070703_10004181 3300005406 Bacteria 4065
81 Ga0070714_100018613 3300005435 Bacteria 5645
82 Ga0070713_100049434 3300005436 Bacteria 3469
83 Ga0070710_10251153 3300005437 Bacteria 1137
84 Ga0070710_10279780 3300005437 Bacteria 1082
85 Ga0070701_10138222 3300005438 Bacteria 1390
86 Ga0070705_100087187 3300005440 Bacteria 1934
87 Ga0070705_100211272 3300005440 Bacteria 1338
88 Ga0070700_100000374 3300005441 Bacteria 22955
89 Ga0070700_100885364 3300005441 Bacteria 726
90 Ga0070700_101025582 3300005441 Unclassified 680
91 Ga0070694_100001221 3300005444 Bacteria 14849
92 Ga0070694_100083162 3300005444 Bacteria 2230
93 Ga0070694_100092518 3300005444 Bacteria 2124
94 Ga0070694_100114246 3300005444 Bacteria 1928
95 Ga0070694_100381309 3300005444 Bacteria 1100
96 Ga0070694_100616602 3300005444 Bacteria 875
97 Ga0070663_100349509 3300005455 Bacteria 1197
98 Ga0070663_100523116 3300005455 Bacteria 988
99 Ga0070678_100014335 3300005456 Bacteria 4998
100 Ga0070678_100175237 3300005456 Bacteria 1750
101 Ga0070678_100649930 3300005456 Bacteria 946
102 Ga0070678_100955075 3300005456 Bacteria 786
103 Ga0070678_101215715 3300005456 Unclassified 699
104 Ga0070662_100000736 3300005457 Bacteria 20017
105 Ga0070662_100136103 3300005457 Bacteria 1899
106 Ga0070662_100799200 3300005457 Bacteria 802
107 Ga0070681_10000525 3300005458 Bacteria 31394
108 Ga0070681_10106763 3300005458 Bacteria 2742
109 Ga0070681_10135653 3300005458 Bacteria 2392
110 Ga0070681_10170304 3300005458 Bacteria 2099
111 Ga0068867_100002804 3300005459 Bacteria 12256
112 Ga0068867_100026483 3300005459 Bacteria 4164
113 Ga0068867_100108575 3300005459 Bacteria 2128
114 Ga0068867_100176558 3300005459 Bacteria 1695
115 Ga0068867_100217565 3300005459 Bacteria 1537
116 Ga0068867_100752900 3300005459 Bacteria 865
117 Ga0068867_101023212 3300005459 Bacteria 750
118 Ga0068867_101229621 3300005459 Bacteria 689
119 Ga0070685_10297270 3300005466 Bacteria 1087
120 Ga0070685_10511738 3300005466 Bacteria 851
121 Ga0070706_100429719 3300005467 Bacteria 1229
122 Ga0070707_100089839 3300005468 Bacteria 2973
123 Ga0070707_101442371 3300005468 Bacteria 655
124 Ga0070698_100992188 3300005471 Bacteria 787
125 Ga0070698_101465006 3300005471 Unclassified 634
126 Ga0070699_100457184 3300005518 Bacteria 1158
127 Ga0070679_100025788 3300005530 Bacteria 5769
128 Ga0070679_100026536 3300005530 Bacteria 5693
129 Ga0070679_100125504 3300005530 Bacteria 2549
130 Ga0070679_101530350 3300005530 Bacteria 614
131 Ga0070684_100192719 3300005535 Bacteria 1855
132 Ga0070684_100208130 3300005535 Bacteria 1783
133 Ga0068853_100001643 3300005539 Bacteria 16346
134 Ga0068853_100008824 3300005539 Bacteria 8110
135 Ga0068853_100140234 3300005539 Bacteria 2170
136 Ga0070672_100004288 3300005543 Bacteria 9324
137 Ga0070672_100055056 3300005543 Bacteria 3115
138 Ga0070672_100094372 3300005543 Bacteria 2418
139 Ga0070686_100017659 3300005544 Bacteria 4172
140 Ga0070686_100027666 3300005544 Bacteria 3433
141 Ga0070695_100011120 3300005545 Bacteria 5379
142 Ga0070695_100095000 3300005545 Bacteria 1997
143 Ga0070695_100138917 3300005545 Bacteria 1682
144 Ga0070695_100592935 3300005545 Bacteria 869
145 Ga0070695_100607065 3300005545 Bacteria 859
146 Ga0070696_100009847 3300005546 Bacteria 6393
147 Ga0070696_100022409 3300005546 Bacteria 4290
148 Ga0070696_100242345 3300005546 Bacteria 1360
149 Ga0070696_100413428 3300005546 Bacteria 1058
150 Ga0070696_100463781 3300005546 Bacteria 1002
151 Ga0070696_101146917 3300005546 Bacteria 655
152 Ga0070693_100653133 3300005547 Bacteria 765
153 Ga0070665_100013156 3300005548 Bacteria 8334
154 Ga0070665_101117197 3300005548 Bacteria 800
155 Ga0070704_100006411 3300005549 Bacteria 6936
156 Ga0070704_100007749 3300005549 Bacteria 6401
157 Ga0070704_100008762 3300005549 Bacteria 6085
158 Ga0070704_100012920 3300005549 Bacteria 5166
159 Ga0070704_100019651 3300005549 Bacteria 4344
160 Ga0070704_100056487 3300005549 Bacteria 2787
161 Ga0070704_100134095 3300005549 Bacteria 1924
162 Ga0068855_100005356 3300005563 Bacteria 15649
163 Ga0068855_100011048 3300005563 Bacteria 10893
164 Ga0068855_100111489 3300005563 Bacteria 3140
165 Ga0068855_100483866 3300005563 Bacteria 1347
166 Ga0068855_100709777 3300005563 Bacteria 1075
167 Ga0070664_100000563 3300005564 Bacteria 28381
168 Ga0070664_100484371 3300005564 Bacteria 1139
169 Ga0070664_100727218 3300005564 Bacteria 926
170 Ga0070664_100844740 3300005564 Bacteria 857
171 Ga0068857_100227016 3300005577 Bacteria 1707
172 Ga0068857_100391635 3300005577 Bacteria 1292
173 Ga0068857_101006881 3300005577 Bacteria 802
174 Ga0068854_100048676 3300005578 Bacteria 3025
175 Ga0068854_100640277 3300005578 Bacteria 912
176 Ga0068856_100000246 3300005614 Bacteria 59117
177 Ga0068856_100004757 3300005614 Bacteria 13477
178 Ga0068856_100065408 3300005614 Bacteria 3594
179 Ga0070702_100007791 3300005615 Bacteria 5149
180 Ga0070702_100334784 3300005615 Bacteria 1060
181 Ga0068852_100002071 3300005616 Bacteria 13700
182 Ga0068852_100915872 3300005616 Bacteria 894
183 Ga0068859_100019223 3300005617 Bacteria 6863
184 Ga0068859_100051616 3300005617 Bacteria 4134
185 Ga0068859_100106540 3300005617 Bacteria 2862
186 Ga0068859_100320738 3300005617 Bacteria 1643
187 Ga0068859_100369576 3300005617 Bacteria 1530
188 Ga0068859_100420040 3300005617 Bacteria 1434
189 Ga0068864_100010798 3300005618 Bacteria 7548
190 Ga0068864_100014467 3300005618 Bacteria 6554
191 Ga0068864_100056893 3300005618 Bacteria 3378
192 Ga0068864_100356244 3300005618 Bacteria 1382
193 Ga0068866_10001678 3300005718 Bacteria 9328
194 Ga0068866_10091197 3300005718 Bacteria 1660
195 Ga0068861_100081661 3300005719 Bacteria 2531
196 Ga0068861_100504920 3300005719 Bacteria 1094
197 Ga0068861_100678397 3300005719 Bacteria 955
198 Ga0068870_10030932 3300005840 Bacteria 2709
199 Ga0068870_10040091 3300005840 Bacteria 2426
200 Ga0068863_100002779 3300005841 Bacteria 17339
201 Ga0068863_100029642 3300005841 Bacteria 5223
202 Ga0068863_100095134 3300005841 Bacteria 2827
203 Ga0068863_100104413 3300005841 Bacteria 2695
204 Ga0068863_100489886 3300005841 Bacteria 1210
205 Ga0068863_100681989 3300005841 Bacteria 1020
206 Ga0068863_101153982 3300005841 Bacteria 780
207 Ga0068858_100006644 3300005842 Bacteria 11248
208 Ga0068858_100022411 3300005842 Bacteria 5895
209 Ga0068858_100140876 3300005842 Bacteria 2264
210 Ga0068858_100189487 3300005842 Bacteria 1943
211 Ga0068858_100541516 3300005842 Bacteria 1127
212 Ga0068860_100016867 3300005843 Bacteria 7119
213 Ga0068860_100017448 3300005843 Bacteria 6994
214 Ga0068860_100205548 3300005843 Bacteria 1909
215 Ga0068860_100492758 3300005843 Bacteria 1223
216 Ga0068860_100576602 3300005843 Bacteria 1129
217 Ga0068860_100750371 3300005843 Bacteria 988
218 Ga0068860_100992042 3300005843 Bacteria 857
219 Ga0068862_100018766 3300005844 Bacteria 5763
220 Ga0068862_100128722 3300005844 Bacteria 2238
221 Ga0068862_100128972 3300005844 Bacteria 2235
222 Ga0068862_100173270 3300005844 Bacteria 1933
223 Ga0068862_100196411 3300005844 Bacteria 1818
224 Ga0068862_100209317 3300005844 Bacteria 1762
225 Ga0068862_100271661 3300005844 Bacteria 1551
226 Ga0068862_100399367 3300005844 Bacteria 1286
227 Ga0068862_100406277 3300005844 Bacteria 1275
228 Ga0068862_100744777 3300005844 Bacteria 953
229 Ga0068862_100961204 3300005844 Bacteria 843
230 Ga0068862_101279875 3300005844 Bacteria 734
231 Ga0068862_101404517 3300005844 Bacteria 701
232 Ga0075366_10016409 3300006195 Bacteria 4256
233 Ga0097621_100004433 3300006237 Bacteria 9772
234 Ga0097621_100014655 3300006237 Bacteria 5874
235 Ga0097621_100028572 3300006237 Bacteria 4396
236 Ga0097621_100059139 3300006237 Bacteria 3136
237 Ga0068871_100001217 3300006358 Bacteria 17173
238 Ga0068871_100001947 3300006358 Bacteria 13973
239 Ga0068871_100009329 3300006358 Bacteria 7103
240 Ga0068871_100024471 3300006358 Bacteria 4684
241 Ga0068871_100363427 3300006358 Bacteria 1282
242 Ga0068871_100462541 3300006358 Bacteria 1139
243 Ga0068871_101012900 3300006358 Bacteria 774
244 Ga0075428_100004924 3300006844 Bacteria 14832
245 Ga0075428_100032310 3300006844 Bacteria 5780
246 Ga0075428_100212084 3300006844 Bacteria 2093
247 Ga0075428_100252508 3300006844 Bacteria 1900
248 Ga0075428_101471643 3300006844 Unclassified 714
249 Ga0075430_100008955 3300006846 Bacteria 8454
250 Ga0075431_100028736 3300006847 Bacteria 5717
251 Ga0075431_100035634 3300006847 Bacteria 5123
252 Ga0075431_100368984 3300006847 Bacteria 1441
253 Ga0075431_100757129 3300006847 Bacteria 946
254 Ga0075433_10110592 3300006852 Bacteria 2438
255 Ga0075433_10168533 3300006852 Bacteria 1949
256 Ga0075433_10737483 3300006852 Bacteria 862
257 Ga0075433_11011523 3300006852 Bacteria 724
258 Ga0075429_100048791 3300006880 Bacteria 3681
259 Ga0075429_100729213 3300006880 Bacteria 868
260 Ga0068865_100006340 3300006881 Bacteria 7208
261 Ga0068865_100103934 3300006881 Bacteria 2084
262 Ga0068865_100321595 3300006881 Bacteria 1245
263 Ga0068865_101172241 3300006881 Bacteria 679
264 Ga0097620_100019223 3300006931 Bacteria 6863
265 Ga0097620_100051611 3300006931 Bacteria 4134
266 Ga0097620_100106540 3300006931 Bacteria 2862
267 Ga0097620_100320732 3300006931 Bacteria 1643
268 Ga0097620_100369575 3300006931 Bacteria 1530
269 Ga0097620_100420020 3300006931 Bacteria 1434
270 Ga0075435_100006615 3300007076 Bacteria 8208
271 Ga0075435_100295086 3300007076 Bacteria 1386
272 Ga0099794_10130495 3300007265 Bacteria 1269
273 Ga0099795_10021429 3300007788 Bacteria 2120
274 Ga0105240_10001484 3300009093 Bacteria 39913
275 Ga0111539_10190681 3300009094 Bacteria 2392
276 Ga0111539_10546683 3300009094 Bacteria 1349
277 Ga0111539_10567725 3300009094 Bacteria 1321
278 Ga0111539_10578456 3300009094 Bacteria 1308
279 Ga0105245_10007955 3300009098 Bacteria 9273
280 Ga0105245_10140491 3300009098 Bacteria 2274
281 Ga0105245_10321831 3300009098 Bacteria 1524
282 Ga0105245_10473920 3300009098 Bacteria 1264
283 Ga0105247_10038720 3300009101 Bacteria 2912
284 Ga0114129_10059617 3300009147 Bacteria 5336
285 Ga0105243_10038478 3300009148 Bacteria 3725
286 Ga0105243_10093097 3300009148 Bacteria 2487
287 Ga0105243_10144052 3300009148 Bacteria 2036
288 Ga0105243_10313230 3300009148 Bacteria 1427
289 Ga0105243_10331948 3300009148 Bacteria 1389
290 Ga0105243_10376513 3300009148 Bacteria 1311
291 Ga0105241_10067205 3300009174 Bacteria 2774
292 Ga0105242_10364006 3300009176 Bacteria 1339
293 Ga0105242_10871161 3300009176 Unclassified 898
294 Ga0105242_12110272 3300009176 Archaea 607
295 Ga0105248_10008149 3300009177 Bacteria 11507
296 Ga0105248_10014298 3300009177 Bacteria 8737
297 Ga0105248_10195035 3300009177 Bacteria 2282
298 Ga0105248_10301555 3300009177 Bacteria 1804
299 Ga0105248_10416896 3300009177 Bacteria 1512
300 Ga0105248_10919275 3300009177 Bacteria 988
301 Ga0105248_11215947 3300009177 Bacteria 852
302 Ga0105248_11682742 3300009177 Bacteria 719
303 Ga0105237_10265184 3300009545 Bacteria 1720
304 Ga0105238_10007836 3300009551 Bacteria 10680
305 Ga0105238_10069042 3300009551 Bacteria 3534
306 Ga0105249_10010159 3300009553 Bacteria 8264
307 Ga0105249_10056270 3300009553 Bacteria 3601
308 Ga0105249_10941885 3300009553 Bacteria 931
309 Ga0105249_10983254 3300009553 Bacteria 912
310 Ga0105239_10090003 3300010375 Bacteria 3385
311 Ga0105246_10930533 3300011119 Bacteria 782
312 Ga0157373_10001898 3300013100 Bacteria 15867
313 Ga0157373_10030058 3300013100 Bacteria 3910
314 Ga0157371_10110570 3300013102 Bacteria 1950
315 Ga0157371_10459264 3300013102 Bacteria 937
316 Ga0157370_10040718 3300013104 Bacteria 4485
317 Ga0157369_10005068 3300013105 Bacteria 15414
318 Ga0157369_11627961 3300013105 Bacteria 656
319 Ga0157374_10229316 3300013296 Bacteria 1824
320 Ga0157374_10272697 3300013296 Bacteria 1668
321 Ga0157378_10149000 3300013297 Bacteria 2179
322 Ga0157378_11445407 3300013297 Bacteria 731
323 Ga0163162_10007370 3300013306 Bacteria 10696
324 Ga0163162_10187695 3300013306 Bacteria 2194
325 Ga0163162_10357833 3300013306 Bacteria 1593
326 Ga0163162_10398791 3300013306 Bacteria 1508
327 Ga0163162_10559869 3300013306 Bacteria 1271
328 Ga0163162_11187131 3300013306 Bacteria 866
329 Ga0163162_11750397 3300013306 Unclassified 710
330 Ga0157372_10005517 3300013307 Bacteria 13448
331 Ga0157372_10039943 3300013307 Bacteria 5181
332 Ga0157372_10158219 3300013307 Bacteria 2617
333 Ga0157375_10005693 3300013308 Bacteria 10846
334 Ga0157375_10040255 3300013308 Bacteria 4504
335 Ga0157375_10042034 3300013308 Bacteria 4420
336 Ga0157375_10209989 3300013308 Bacteria 2104
337 Ga0157375_10453703 3300013308 Bacteria 1448
338 Ga0157375_11281319 3300013308 Bacteria 861
339 Ga0157375_12204822 3300013308 Bacteria 656
340 Ga0163163_10006010 3300014325 Bacteria 10561
341 Ga0163163_10292229 3300014325 Bacteria 1682
342 Ga0163163_12080633 3300014325 Unclassified 627
343 Ga0157380_10000875 3300014326 Bacteria 18931
344 Ga0157380_10045305 3300014326 Bacteria 3451
345 Ga0157380_10112646 3300014326 Bacteria 2289
346 Ga0157380_10346758 3300014326 Bacteria 1388
347 Ga0157380_10454974 3300014326 Bacteria 1230
348 Ga0157380_10614254 3300014326 Bacteria 1078
349 Ga0157380_10670353 3300014326 Bacteria 1037
350 Ga0157380_11050165 3300014326 Bacteria 851
351 Ga0157380_11153498 3300014326 Bacteria 816
352 Ga0157377_10232025 3300014745 Bacteria 1187
353 Ga0157379_10007045 3300014968 Bacteria 9716
354 Ga0157379_10040735 3300014968 Bacteria 4146
355 Ga0157379_10081604 3300014968 Bacteria 2897
356 Ga0157379_11321797 3300014968 Bacteria 697
357 Ga0157379_11610099 3300014968 Unclassified 634
358 Ga0157376_10036486 3300014969 Bacteria 3983
359 Ga0157376_10353660 3300014969 Bacteria 1407
360 Ga0163161_10011147 3300017792 Bacteria 6229
361 Ga0163161_10024325 3300017792 Bacteria 4278
362 Ga0163161_11007443 3300017792 Bacteria 711
363 Ga0207666_1008853 3300025271 Bacteria 1351
364 Ga0209676_1000214 3300025292 Bacteria 127818
365 Ga0207697_10005571 3300025315 Bacteria 5833
366 Ga0207697_10030825 3300025315 Bacteria 2194
367 Ga0207656_10082476 3300025321 Bacteria 1447
368 Ga0207656_10145377 3300025321 Bacteria 1120
369 Ga0207653_10005279 3300025885 Bacteria 4038
370 Ga0207692_10416819 3300025898 Unclassified 840
371 Ga0207642_10014088 3300025899 Bacteria 2939
372 Ga0207642_10110526 3300025899 Bacteria 1398
373 Ga0207642_10741368 3300025899 Unclassified 621
374 Ga0207688_10095870 3300025901 Bacteria 1708
375 Ga0207680_10002705 3300025903 Bacteria 8289
376 Ga0207680_10023216 3300025903 Bacteria 3384
377 Ga0207680_10128858 3300025903 Bacteria 1665
378 Ga0207680_10445824 3300025903 Bacteria 918
379 Ga0207645_10001263 3300025907 Bacteria 20825
380 Ga0207645_10021346 3300025907 Bacteria 4223
381 Ga0207645_10073047 3300025907 Bacteria 2196
382 Ga0207643_10013531 3300025908 Bacteria 4420
383 Ga0207643_10097822 3300025908 Bacteria 1718
384 Ga0207643_10161403 3300025908 Bacteria 1349
385 Ga0207643_10380375 3300025908 Bacteria 890
386 Ga0207705_10147254 3300025909 Bacteria 1762
387 Ga0207705_10690870 3300025909 Bacteria 793
388 Ga0207684_10663315 3300025910 Bacteria 888
389 Ga0207707_10008578 3300025912 Bacteria 8861
390 Ga0207707_10088630 3300025912 Bacteria 2703
391 Ga0207695_10780053 3300025913 Bacteria 836
392 Ga0207671_10236949 3300025914 Bacteria 1433
393 Ga0207660_10172861 3300025917 Bacteria 1673
394 Ga0207660_10173780 3300025917 Bacteria 1669
395 Ga0207660_10207380 3300025917 Bacteria 1533
396 Ga0207660_10419970 3300025917 Bacteria 1079
397 Ga0207662_10000214 3300025918 Bacteria 26908
398 Ga0207657_10000260 3300025919 Bacteria 56097
399 Ga0207657_10340185 3300025919 Bacteria 1184
400 Ga0207652_10051030 3300025921 Bacteria 3545
401 Ga0207652_10256557 3300025921 Bacteria 1577
402 Ga0207652_10700038 3300025921 Bacteria 904
403 Ga0207652_10752233 3300025921 Bacteria 867
404 Ga0207646_10103769 3300025922 Bacteria 2550
405 Ga0207646_10984727 3300025922 Bacteria 746
406 Ga0207646_11055183 3300025922 Bacteria 716
407 Ga0207681_10024887 3300025923 Bacteria 3845
408 Ga0207681_10053714 3300025923 Bacteria 2736
409 Ga0207681_10064043 3300025923 Bacteria 2537
410 Ga0207681_10293896 3300025923 Bacteria 1283
411 Ga0207694_10001424 3300025924 Bacteria 20507
412 Ga0207694_10223716 3300025924 Bacteria 1536
413 Ga0207650_10017437 3300025925 Bacteria 5029
414 Ga0207650_10054766 3300025925 Bacteria 2960
415 Ga0207650_10075623 3300025925 Bacteria 2542
416 Ga0207650_10081064 3300025925 Bacteria 2461
417 Ga0207650_10102176 3300025925 Bacteria 2208
418 Ga0207659_10001564 3300025926 Bacteria 13583
419 Ga0207659_10022668 3300025926 Bacteria 4183
420 Ga0207659_10024536 3300025926 Bacteria 4041
421 Ga0207659_10077692 3300025926 Bacteria 2444
422 Ga0207687_10045463 3300025927 Bacteria 3035
423 Ga0207664_10023189 3300025929 Bacteria 4647
424 Ga0207644_10017212 3300025931 Bacteria 4876
425 Ga0207644_10116540 3300025931 Bacteria 2027
426 Ga0207644_10156898 3300025931 Bacteria 1766
427 Ga0207644_10213775 3300025931 Bacteria 1526
428 Ga0207644_10221443 3300025931 Bacteria 1500
429 Ga0207690_10010711 3300025932 Bacteria 5464
430 Ga0207690_10028695 3300025932 Bacteria 3529
431 Ga0207690_10871979 3300025932 Unclassified 746
432 Ga0207706_10000190 3300025933 Bacteria 68803
433 Ga0207706_10050841 3300025933 Bacteria 3662
434 Ga0207686_10019943 3300025934 Bacteria 3823
435 Ga0207686_10627266 3300025934 Bacteria 848
436 Ga0207709_10195171 3300025935 Bacteria 1441
437 Ga0207709_10221923 3300025935 Bacteria 1364
438 Ga0207709_10249410 3300025935 Bacteria 1296
439 Ga0207670_10111012 3300025936 Bacteria 1976
440 Ga0207670_10342261 3300025936 Bacteria 1182
441 Ga0207669_10010050 3300025937 Bacteria 4540
442 Ga0207669_10216047 3300025937 Bacteria 1403
443 Ga0207669_10231575 3300025937 Bacteria 1363
444 Ga0207669_11073840 3300025937 Unclassified 679
445 Ga0207704_10047553 3300025938 Bacteria 2565
446 Ga0207704_10838160 3300025938 Unclassified 770
447 Ga0207665_10086177 3300025939 Bacteria 2169
448 Ga0207691_10000486 3300025940 Bacteria 39361
449 Ga0207691_10007762 3300025940 Bacteria 10333
450 Ga0207691_10042870 3300025940 Bacteria 4171
451 Ga0207691_10045827 3300025940 Bacteria 4019
452 Ga0207691_10052318 3300025940 Bacteria 3730
453 Ga0207691_10296198 3300025940 Bacteria 1391
454 Ga0207691_10522238 3300025940 Bacteria 1007
455 Ga0207711_10003467 3300025941 Bacteria 13656
456 Ga0207711_10186931 3300025941 Bacteria 1886
457 Ga0207711_10345933 3300025941 Bacteria 1376
458 Ga0207711_10604398 3300025941 Bacteria 1023
459 Ga0207711_10626640 3300025941 Bacteria 1003
460 Ga0207689_10001553 3300025942 Bacteria 21776
461 Ga0207689_10011895 3300025942 Bacteria 7456
462 Ga0207689_10014359 3300025942 Bacteria 6737
463 Ga0207689_10224033 3300025942 Bacteria 1554
464 Ga0207689_10923284 3300025942 Bacteria 736
465 Ga0207661_10209733 3300025944 Bacteria 1716
466 Ga0207661_10676440 3300025944 Bacteria 949
467 Ga0207679_10026009 3300025945 Bacteria 4031
468 Ga0207667_10005999 3300025949 Bacteria 14784
469 Ga0207667_10082654 3300025949 Bacteria 3326
470 Ga0207667_10094804 3300025949 Bacteria 3081
471 Ga0207667_11012527 3300025949 Bacteria 817
472 Ga0207651_10001328 3300025960 Bacteria 11163
473 Ga0207651_10021100 3300025960 Bacteria 3949
474 Ga0207651_10082842 3300025960 Bacteria 2317
475 Ga0207651_10084257 3300025960 Bacteria 2302
476 Ga0207712_10046922 3300025961 Bacteria 2997
477 Ga0207712_10048193 3300025961 Bacteria 2962
478 Ga0207712_10677516 3300025961 Bacteria 898
479 Ga0207712_10967381 3300025961 Bacteria 754
480 Ga0207668_10002243 3300025972 Bacteria 11276
481 Ga0207668_10005311 3300025972 Bacteria 7581
482 Ga0207668_10039464 3300025972 Bacteria 3178
483 Ga0207668_10249450 3300025972 Bacteria 1441
484 Ga0207668_10269851 3300025972 Bacteria 1390
485 Ga0207668_10510622 3300025972 Bacteria 1035
486 Ga0207668_10704872 3300025972 Bacteria 887
487 Ga0207668_10946098 3300025972 Bacteria 768
488 Ga0207640_10091347 3300025981 Bacteria 2109
489 Ga0207640_10163270 3300025981 Bacteria 1651
490 Ga0207640_10653989 3300025981 Bacteria 896
491 Ga0207658_10025142 3300025986 Bacteria 4168
492 Ga0207658_10085263 3300025986 Bacteria 2433
493 Ga0207658_10292302 3300025986 Bacteria 1401
494 Ga0207677_10004025 3300026023 Bacteria 7844
495 Ga0207677_10302789 3300026023 Bacteria 1321
496 Ga0207703_10000559 3300026035 Bacteria 38247
497 Ga0207703_10113356 3300026035 Bacteria 2317
498 Ga0207703_10274500 3300026035 Bacteria 1528
499 Ga0207703_10416683 3300026035 Bacteria 1249
500 Ga0207703_10528531 3300026035 Bacteria 1110
501 Ga0207703_10902855 3300026035 Bacteria 846
502 Ga0207639_10128920 3300026041 Bacteria 2091
503 Ga0207639_10173726 3300026041 Bacteria 1827
504 Ga0207639_10562146 3300026041 Bacteria 1048
505 Ga0207678_10169856 3300026067 Bacteria 1862
506 Ga0207678_10196589 3300026067 Bacteria 1724
507 Ga0207708_10016731 3300026075 Bacteria 5518
508 Ga0207708_10134264 3300026075 Bacteria 1937
509 Ga0207708_10410773 3300026075 Bacteria 1121
510 Ga0207708_10465009 3300026075 Bacteria 1055
511 Ga0207702_10004336 3300026078 Bacteria 12655
512 Ga0207702_10014826 3300026078 Bacteria 6464
513 Ga0207702_10059945 3300026078 Bacteria 3243
514 Ga0207702_10101643 3300026078 Bacteria 2539
515 Ga0207641_10002817 3300026088 Bacteria 15819
516 Ga0207641_10041229 3300026088 Bacteria 3868
517 Ga0207641_10096415 3300026088 Bacteria 2598
518 Ga0207641_10619328 3300026088 Bacteria 1061
519 Ga0207648_10000567 3300026089 Bacteria 41400
520 Ga0207648_10001585 3300026089 Bacteria 24939
521 Ga0207648_10041382 3300026089 Bacteria 4046
522 Ga0207648_10127349 3300026089 Bacteria 2240
523 Ga0207648_10131429 3300026089 Bacteria 2204
524 Ga0207648_10463927 3300026089 Bacteria 1155
525 Ga0207648_10491727 3300026089 Bacteria 1122
526 Ga0207648_10522246 3300026089 Bacteria 1088
527 Ga0207648_10846219 3300026089 Bacteria 853
528 Ga0207676_10030901 3300026095 Bacteria 4024
529 Ga0207676_10032345 3300026095 Bacteria 3941
530 Ga0207676_10783926 3300026095 Bacteria 929
531 Ga0207676_11605391 3300026095 Bacteria 648
532 Ga0207674_10000053 3300026116 Bacteria 114437
533 Ga0207674_10011703 3300026116 Bacteria 9848
534 Ga0207674_10293149 3300026116 Bacteria 1575
535 Ga0207674_10294974 3300026116 Bacteria 1570
536 Ga0207675_100001190 3300026118 Bacteria 25909
537 Ga0207675_100516759 3300026118 Bacteria 1190
538 Ga0207675_100526463 3300026118 Bacteria 1179
539 Ga0207675_101012982 3300026118 Unclassified 849
540 Ga0207683_10002530 3300026121 Bacteria 15972
541 Ga0207683_10012744 3300026121 Bacteria 7176
542 Ga0207683_10029332 3300026121 Bacteria 4763
543 Ga0207683_10094688 3300026121 Bacteria 2662
544 Ga0207683_10236043 3300026121 Bacteria 1668
545 Ga0207683_10666622 3300026121 Bacteria 964
546 Ga0207698_10007275 3300026142 Bacteria 6936
547 Ga0207698_10658978 3300026142 Bacteria 1038
548 Ga0207698_10868640 3300026142 Bacteria 908
549 Ga0207698_11104496 3300026142 Bacteria 806
550 Ga0209969_1004121 3300027360 Bacteria 2032
551 Ga0209967_1021413 3300027364 Bacteria 945
552 Ga0209981_1020994 3300027378 Bacteria 933
553 Ga0209996_1007218 3300027395 Bacteria 1445
554 Ga0210000_1002742 3300027462 Bacteria 2513
555 Ga0209968_1018914 3300027526 Bacteria 1107
556 Ga0209999_1033974 3300027543 Bacteria 949
557 Ga0209982_1020209 3300027552 Bacteria 1022
558 Ga0210002_1003831 3300027617 Bacteria 2233
559 Ga0209983_1011305 3300027665 Bacteria 1826
560 Ga0209983_1021656 3300027665 Bacteria 1344
561 Ga0209966_1040488 3300027695 Archaea 970
562 Ga0209974_10000626 3300027876 Bacteria 11888
563 Ga0207428_10038590 3300027907 Bacteria 3882
564 Ga0268266_10401163 3300028379 Bacteria 1296
565 Ga0268265_10019253 3300028380 Bacteria 4740
566 Ga0268265_10029417 3300028380 Bacteria 3942
567 Ga0268265_10158364 3300028380 Bacteria 1919
568 Ga0268265_10178046 3300028380 Bacteria 1824
569 Ga0268265_10288412 3300028380 Bacteria 1472
570 Ga0268265_10363799 3300028380 Bacteria 1325
571 Ga0268265_10388754 3300028380 Bacteria 1286
572 Ga0268265_10420929 3300028380 Bacteria 1240
573 Ga0268265_10606922 3300028380 Bacteria 1046
574 Ga0268265_10912826 3300028380 Bacteria 863
575 Ga0268265_11334259 3300028380 Bacteria 718
576 Ga0268264_10027956 3300028381 Bacteria 4611
577 Ga0268264_10044768 3300028381 Bacteria 3672
578 Ga0268264_10053029 3300028381 Bacteria 3383
579 Ga0268264_10153041 3300028381 Bacteria 2070
580 Ga0268264_10536929 3300028381 Bacteria 1145
581 Ga0268264_10838326 3300028381 Bacteria 920
582 Ga0268264_10851676 3300028381 Bacteria 913
583 Ga0307408_100004584 3300031548 Bacteria 9353
584 Ga0307408_100297167 3300031548 Bacteria 1351
585 Ga0307408_100303984 3300031548 Bacteria 1337
586 Ga0307408_100454487 3300031548 Bacteria 1112
587 Ga0316575_10040832 3300031665 Bacteria 1834
588 Ga0307405_11113419 3300031731 Bacteria 679
589 Ga0307413_10001161 3300031824 Bacteria 9678
590 Ga0307413_10005126 3300031824 Bacteria 5803
591 Ga0307413_10398133 3300031824 Bacteria 1078
592 Ga0307410_10001726 3300031852 Bacteria 10093
593 Ga0307410_10017001 3300031852 Bacteria 4355
594 Ga0307406_10004201 3300031901 Bacteria 7841
595 Ga0307406_10139061 3300031901 Bacteria 1716
596 Ga0307406_10402359 3300031901 Bacteria 1086
597 Ga0307407_10055414 3300031903 Bacteria 2291
598 Ga0307407_10070427 3300031903 Bacteria 2079
599 Ga0307412_10025231 3300031911 Bacteria 3679
600 Ga0307412_11001323 3300031911 Bacteria 738
601 Ga0307412_11287226 3300031911 Bacteria 658
602 Ga0307409_100023106 3300031995 Bacteria 4301
603 Ga0307409_100039662 3300031995 Bacteria 3497
604 Ga0307409_100072612 3300031995 Bacteria 2741
605 Ga0307416_100008129 3300032002 Bacteria 6737
606 Ga0307416_100121703 3300032002 Bacteria 2327
607 Ga0307416_100299519 3300032002 Bacteria 1597
608 Ga0307416_101044880 3300032002 Bacteria 921
609 Ga0307416_101372639 3300032002 Bacteria 812
610 Ga0307414_10528267 3300032004 Bacteria 1048
611 Ga0307414_10821135 3300032004 Bacteria 849
612 Ga0307411_10000419 3300032005 Bacteria 14481
613 Ga0307411_10095229 3300032005 Bacteria 2090
614 Ga0307411_10395361 3300032005 Bacteria 1141
615 Ga0307415_100003744 3300032126 Bacteria 7791
616 Ga0307415_100674385 3300032126 Bacteria 930
617 Ga0373930_0069943 3300034816 Bacteria 797
618 Ga0373926_0001761 3300035083 Bacteria 6721
619 Ga0373944_0002901 3300035089 Bacteria 4398
620 Ga0373949_0012467 3300035090 Bacteria 1881
621 Ga0373952_0007186 3300035092 Bacteria 2080
622 Ga0373936_0002101 3300035113 Bacteria 7395
623 Ga0373945_0001227 3300035116 Bacteria 7807
624 Ga0373953_0001098 3300035117 Bacteria 7666
625 Ga0373954_0000886 3300035118 Bacteria 11648
626 Ga0373954_0000956 3300035118 Bacteria 11300
627 Ga0373954_0007183 3300035118 Bacteria 4863
628 Ga0373956_0006046 3300035119 Bacteria 4847
629 Ga0373956_0040616 3300035119 Bacteria 2064
630 Ga0373957_0008637 3300035120 Bacteria 3309
631 Ga0373960_0061026 3300035121 Bacteria 1144
632 Ga0373943_0129637 3300035170 Bacteria 1348
633 Ga0373946_0003237 3300035171 Bacteria 5783
634 Ga0373955_0002788 3300035172 Bacteria 7673
635 Ga0373955_0205764 3300035172 Bacteria 1172
636 Ga0373955_0898358 3300035172 Bacteria 545
637 Ga0373942_0008784 3300035207 Bacteria 2360
638 Ga0373961_0087225 3300035241 Bacteria 991
639 Ga0373962_0285849 3300035242 Unclassified 581
640 Ga0373924_0050301 3300035410 Bacteria 1726
641 Ga0373924_0106831 3300035410 Bacteria 1207
642 Ga0373924_0130230 3300035410 Bacteria 1094
643 Ga0373931_0537482 3300035691 Bacteria 758
644 Ga0373935_0003235 3300035692 Bacteria 9413
645 Ga0373935_0009698 3300035692 Bacteria 5763
646 Ga0373935_0020689 3300035692 Bacteria 4022
647 Ga0373935_0376010 3300035692 Bacteria 1017
648 Ga0373927_0004974 3300035695 Bacteria 9213
649 Ga0373927_0012033 3300035695 Bacteria 5756
650 Ga0373933_0005538 3300035724 Bacteria 6879
651 Ga0373933_0093901 3300035724 Bacteria 1854
652 Ga0373947_0190358 3300035725 Bacteria 1338
653 Ga0373937_0001375 3300036401 Bacteria 20333
654 Ga0373937_0018732 3300036401 Bacteria 6187
655 Ga0373937_0116295 3300036401 Bacteria 2490
656 Ga0373937_0492926 3300036401 Bacteria 1164
657 Ga0373925_0630283 3300037068 Bacteria 883
658 Ga0439465_0221533 3300041413 Bacteria 694
659 Ga0451807_1341561 3300041486 Bacteria 692
660 Ga0451839_1410063 3300041496 Bacteria 656
661 Ga0451851_0505296 3300041507 Bacteria 1180
662 Ga0439435_0068346 3300042436 Unclassified 1048
663 Ga0439460_0049863 3300042461 Bacteria 1252
664 Ga0450893_0073115 3300042532 Bacteria 668
665 Ga0451576_0015516 3300045051 Bacteria 8434
666 Ga0451576_0743992 3300045051 Bacteria 1030
667 Ga0495592_0009555 3300046454 Bacteria 7296
668 Ga0495592_0830393 3300046454 Unclassified 547
669 Ga0495651_0007383 3300046462 Bacteria 8403
670 Ga0495653_0052750 3300046463 Bacteria 3115
671 Ga0495580_0003258 3300046472 Bacteria 13879
672 Ga0495580_0011647 3300046472 Bacteria 6800
673 Ga0495639_0003438 3300046475 Bacteria 6857
674 Ga0495662_0001381 3300046476 Bacteria 12021
675 Ga0495664_0015525 3300046477 Bacteria 4330
676 Ga0495594_0038985 3300046499 Bacteria 2596
677 Ga0495608_0037927 3300046511 Bacteria 3239
678 Ga0495608_0064356 3300046511 Bacteria 2404
679 Ga0495618_0014540 3300046514 Bacteria 4797
680 Ga0495628_0056593 3300046516 Bacteria 3086
681 Ga0495628_0058060 3300046516 Bacteria 3042
682 Ga0495628_0313466 3300046516 Bacteria 1159
683 Ga0495628_0729333 3300046516 Bacteria 698
684 Ga0495630_0002652 3300046517 Bacteria 12386
685 Ga0495630_0307648 3300046517 Bacteria 1211
686 Ga0495630_0990167 3300046517 Unclassified 639
687 Ga0495666_0005431 3300046526 Bacteria 6420
688 Ga0495652_0383264 3300046529 Bacteria 999
689 Ga0495640_0015829 3300046533 Bacteria 5660
690 Ga0495640_0329208 3300046533 Bacteria 945
691 Ga0495586_0003330 3300046535 Bacteria 8623
692 Ga0495586_0008942 3300046535 Bacteria 5330
693 Ga0495586_0201354 3300046535 Bacteria 1129
694 Ga0495587_0015110 3300046536 Bacteria 4825
695 Ga0495598_0078419 3300046537 Bacteria 1055
696 Ga0495621_0045695 3300046539 Bacteria 1552
697 Ga0495622_0022353 3300046557 Bacteria 2947
698 Ga0495667_0007991 3300046559 Bacteria 7174
699 Ga0495667_0035573 3300046559 Bacteria 3327
700 Ga0495667_0315589 3300046559 Bacteria 989
701 Ga0495634_0011268 3300046642 Bacteria 6512
702 Ga0495635_0043674 3300046663 Bacteria 3093
703 Ga0495635_0061937 3300046663 Bacteria 2569
704 Ga0495659_0084195 3300046664 Bacteria 1212
705 Ga0495588_0008086 3300046674 Bacteria 4811
706 Ga0495657_0015483 3300046675 Bacteria 5580
707 Ga0495657_0241703 3300046675 Bacteria 1089
708 Ga0495657_0259439 3300046675 Bacteria 1044
709 Ga0495599_0202113 3300046678 Bacteria 1220
710 Ga0495646_0201361 3300046680 Bacteria 1084
711 Ga0495647_0001261 3300046681 Bacteria 7809
712 Ga0495658_0001458 3300046683 Bacteria 12454
713 Ga0495658_0023245 3300046683 Bacteria 3288
714 Ga0495669_0056633 3300046684 Bacteria 1767
715 Ga0495613_0032286 3300046689 Bacteria 3888
716 Ga0495670_0747784 3300046691 Unclassified 533
717 Ga0495600_0009870 3300046809 Bacteria 5908
718 Ga0495581_0007160 3300047315 Bacteria 6458
719 Ga0495604_0064137 3300047317 Bacteria 2800
720 Ga0495604_0130988 3300047317 Bacteria 1803
721 Ga0495604_0241090 3300047317 Bacteria 1236
722 Ga0495636_0004078 3300047318 Bacteria 5716
723 Ga0495674_0005704 3300047319 Bacteria 11929
724 Ga0495676_0004858 3300047321 Bacteria 12334
725 Ga0495680_0010363 3300047322 Bacteria 8317
726 Ga0495680_0449377 3300047322 Bacteria 882
727 Ga0495675_0005938 3300047444 Bacteria 7462
728 Ga0495684_0009504 3300047471 Bacteria 7502
729 Ga0495684_0070548 3300047471 Bacteria 2656
730 Ga0495602_0092121 3300048088 Bacteria 2512
731 Ga0495602_0513574 3300048088 Unclassified 836
732 Ga0496102_1027255 3300048905 Bacteria 745
733 Ga0496103_0246924 3300048906 Bacteria 1148
734 Ga0496106_0000353 3300048909 Bacteria 32583
735 Ga0496107_0002903 3300048910 Bacteria 11327
736 Ga0496108_0155781 3300048911 Bacteria 1973
737 Ga0496108_0472082 3300048911 Bacteria 1096
738 Ga0496109_0416451 3300048912 Bacteria 1269
739 Ga0496111_0220598 3300048914 Bacteria 1409
740 Ga0501291_073183 3300049514 Bacteria 668
741 Ga0501291_116639 3300049514 Archaea 575
742 Ga0501296_011586 3300049519 Bacteria 1057
743 Ga0501299_006374 3300049522 Bacteria 1850
744 Ga0501031_0006797 3300049568 Bacteria 7464
745 Ga0501032_0268499 3300049569 Bacteria 1106
746 Ga0501033_0020624 3300049570 Bacteria 4979
747 Ga0501033_0424517 3300049570 Bacteria 926
748 Ga0501033_0641057 3300049570 Bacteria 726
749 Ga0501034_0080041 3300049571 Bacteria 3271
750 Ga0501036_0315791 3300049572 Bacteria 1306
751 Ga0501036_0685384 3300049572 Bacteria 847
752 Ga0501037_0019241 3300049573 Bacteria 5033
753 Ga0501038_0004889 3300049574 Bacteria 12446
754 Ga0501038_0152916 3300049574 Bacteria 1880
755 Ga0501038_0935625 3300049574 Bacteria 639
756 Ga0501039_0001273 3300049575 Bacteria 18447
757 Ga0501039_0056625 3300049575 Bacteria 3037
758 Ga0501039_0239545 3300049575 Bacteria 1426
759 Ga0501039_0458469 3300049575 Bacteria 1001
760 Ga0501040_0024943 3300049576 Bacteria 4018
761 Ga0501040_0160614 3300049576 Bacteria 1589
762 Ga0501040_0832380 3300049576 Bacteria 668
763 Ga0501041_0000677 3300049577 Bacteria 18046
764 Ga0501041_0014647 3300049577 Bacteria 4656
765 Ga0501041_0027145 3300049577 Bacteria 3450
766 Ga0501041_0035231 3300049577 Bacteria 3033
767 Ga0501041_0102091 3300049577 Bacteria 1776
768 Ga0501042_0002778 3300049578 Bacteria 10817
769 Ga0501042_0075351 3300049578 Bacteria 2415
770 Ga0501042_0424900 3300049578 Bacteria 963
771 Ga0501042_0634680 3300049578 Bacteria 777
772 Ga0501043_0057487 3300049579 Bacteria 3054
773 Ga0501043_0223851 3300049579 Bacteria 1455
774 Ga0501043_0717840 3300049579 Bacteria 729
775 Ga0501046_0007010 3300049580 Bacteria 9927
776 Ga0501046_0051885 3300049580 Bacteria 3235
777 Ga0501046_0090876 3300049580 Bacteria 2349
778 Ga0501047_0475759 3300049581 Bacteria 1077
779 Ga0501048_0004980 3300049582 Bacteria 10138
780 Ga0501048_0202091 3300049582 Bacteria 1409
781 Ga0501048_0421314 3300049582 Bacteria 955
782 Ga0501068_0235145 3300049584 Bacteria 1166
783 Ga0501069_0707338 3300049585 Bacteria 608
784 Ga0501069_0867108 3300049585 Bacteria 549
785 Ga0501070_0461423 3300049586 Bacteria 1023
786 Ga0501071_0150679 3300049587 Bacteria 1735
787 Ga0501071_0310810 3300049587 Bacteria 1196
788 Ga0501071_0334838 3300049587 Bacteria 1150
789 Ga0501072_0003828 3300049588 Bacteria 11366
790 Ga0501072_0038612 3300049588 Bacteria 3747
791 Ga0501072_0097666 3300049588 Bacteria 2335
792 Ga0501073_0020297 3300049589 Bacteria 4794
793 Ga0501074_0202053 3300049590 Bacteria 1416
794 Ga0501075_0000845 3300049591 Bacteria 19255
795 Ga0501075_0001572 3300049591 Bacteria 14926
796 Ga0501075_0060907 3300049591 Bacteria 2843
797 Ga0501075_0145481 3300049591 Bacteria 1806
798 Ga0501075_0425735 3300049591 Bacteria 1012
799 Ga0501076_0002762 3300049592 Bacteria 12152
800 Ga0501076_0129979 3300049592 Bacteria 2042
801 Ga0501076_0390604 3300049592 Bacteria 1144
802 Ga0501076_0483859 3300049592 Bacteria 1020
803 Ga0501076_1260927 3300049592 Bacteria 608
804 Ga0501077_0000567 3300049593 Bacteria 22432
805 Ga0501077_0253501 3300049593 Bacteria 1119
806 Ga0501077_0383243 3300049593 Bacteria 898
807 Ga0501217_051871 3300049661 Bacteria 1075
808 Ga0501079_0001645 3300049741 Bacteria 15915
809 Ga0501079_0087135 3300049741 Bacteria 2417
810 Ga0501079_0094111 3300049741 Bacteria 2322
811 Ga0501079_0166055 3300049741 Bacteria 1722
812 Ga0501079_0207874 3300049741 Bacteria 1529
813 Ga0501079_0348137 3300049741 Bacteria 1161
814 Ga0501080_0005671 3300049742 Bacteria 11159
815 Ga0501080_0418076 3300049742 Bacteria 1205
816 Ga0501080_1716471 3300049742 Bacteria 529
817 Ga0501081_0000144 3300049743 Bacteria 32232
818 Ga0501081_0040253 3300049743 Bacteria 3200
819 Ga0501081_0040598 3300049743 Bacteria 3186
820 Ga0501081_0579191 3300049743 Bacteria 839
821 Ga0501083_0378931 3300049744 Bacteria 920
822 Ga0501035_0010183 3300049822 Bacteria 8727
823 Ga0501035_0291320 3300049822 Bacteria 1378
824 Ga0501035_0680057 3300049822 Bacteria 832
825 Ga0501044_0359118 3300049823 Bacteria 1375
826 Ga0501045_0003807 3300049824 Bacteria 10372
827 Ga0501045_0108212 3300049824 Bacteria 2060
828 Ga0501045_0663500 3300049824 Bacteria 770
829 Ga0501045_1120024 3300049824 Bacteria 575
830 nmdc:mga0k408_37390_c1 3300050493 Bacteria 2787
831 nmdc:mga0k408_502170_c1 3300050493 Bacteria 719
832 nmdc:mga05p37_25768_c1 3300050507 Bacteria 7152
833 nmdc:mga09592_375490_c1 3300050508 Bacteria 1230
834 nmdc:mga09592_62720_c1 3300050508 Bacteria 3145
835 nmdc:mga09592_687876_c1 3300050508 Bacteria 871
836 nmdc:mga0qj67_23981_c1 3300050509 Bacteria 4700
837 nmdc:mga0qj67_868092_c1 3300050509 Unclassified 712
838 nmdc:mga06r32_151518_c1 3300050510 Bacteria 2297
839 nmdc:mga06r32_161293_c1 3300050510 Bacteria 2225
840 nmdc:mga06r32_214393_c1 3300050510 Bacteria 1913
841 nmdc:mga06r32_516349_c1 3300050510 Bacteria 1170
842 nmdc:mga08y16_1245586_c1 3300050511 Bacteria 713
843 nmdc:mga08y16_439948_c1 3300050511 Bacteria 1331
844 nmdc:mga08y16_44771_c1 3300050511 Bacteria 4638
845 nmdc:mga08y16_569702_c1 3300050511 Bacteria 1144
846 nmdc:mga08y16_78002_c1 3300050511 Bacteria 3454
847 nmdc:mga08y16_856284_c1 3300050511 Bacteria 898
848 nmdc:mga0rr50_26340_c1 3300050513 Bacteria 4055
849 nmdc:mga0rr50_56391_c2 3300050513 Bacteria 2371
850 nmdc:mga0a205_150917_c1 3300050515 Bacteria 2223
851 nmdc:mga0a205_159404_c1 3300050515 Bacteria 2154
852 nmdc:mga0a205_417621_c1 3300050515 Bacteria 1204
853 Ga0495601_0000899 3300053077 Bacteria 16237
854 Ga0495595_0035127 3300053084 Bacteria 2270
855 Ga0495619_0123830 3300053085 Bacteria 1773
856 Ga0500559_0143142 3300053136 Bacteria 1120
857 Ga0500568_0046010 3300053139 Bacteria 1734
858 Ga0501084_0028985 3300054114 Bacteria 4628
859 Ga0501084_0048367 3300054114 Bacteria 3560
860 Ga0501084_0155327 3300054114 Bacteria 1929
861 Ga0501084_0570291 3300054114 Bacteria 956
862 Ga0501082_0001649 3300060353 Bacteria 19664
863 Ga0501082_0119241 3300060353 Bacteria 2286
864 Ga0501082_0282932 3300060353 Bacteria 1443
865 Ga0530510_0001525 3300061734 Bacteria 15601
866 Ga0530510_0003532 3300061734 Bacteria 10763
867 Ga0530510_0004601 3300061734 Bacteria 9541
868 Ga0530510_0036224 3300061734 Bacteria 3556
869 Ga0530510_0371460 3300061734 Bacteria 1076
870 Ga0530510_0608776 3300061734 Bacteria 831
871 Ga0530510_0659178 3300061734 Bacteria 797

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100004924 Ga0075428_10000492415 136
2 3300006880 Ga0075429_100048791 Ga0075429_1000487912 136
3 3300035119 Ga0373956_0040616 Ga0373956_0040616_356_868 136
4 3300035172 Ga0373955_0205764 Ga0373955_0205764_133_645 136
5 3300035724 Ga0373933_0005538 Ga0373933_0005538_355_867 136
6 3300036401 Ga0373937_0018732 Ga0373937_0018732_4188_4700 136
7 3300046675 Ga0495657_0259439 Ga0495657_0259439_113_625 136
8 3300047317 Ga0495604_0241090 Ga0495604_0241090_555_1067 136
9 3300031824 Ga0307413_10005126 Ga0307413_100051265 137
10 3300031852 Ga0307410_10017001 Ga0307410_100170013 137
11 3300031901 Ga0307406_10139061 Ga0307406_101390612 137
12 3300031548 Ga0307408_100454487 Ga0307408_1004544872 138
13 3300032002 Ga0307416_101372639 Ga0307416_1013726392 138
14 3300049568 Ga0501031_0006797 Ga0501031_0006797_5685_6152 138
15 3300049570 Ga0501033_0020624 Ga0501033_0020624_3776_4243 138
16 3300049571 Ga0501034_0080041 Ga0501034_0080041_2770_3237 138
17 3300049573 Ga0501037_0019241 Ga0501037_0019241_3532_3999 138
18 3300049574 Ga0501038_0004889 Ga0501038_0004889_10169_10636 138
19 3300049575 Ga0501039_0001273 Ga0501039_0001273_10546_11013 138
20 3300049577 Ga0501041_0000677 Ga0501041_0000677_16262_16729 138
21 3300049578 Ga0501042_0002778 Ga0501042_0002778_7871_8338 138
22 3300049579 Ga0501043_0057487 Ga0501043_0057487_1293_1760 138
23 3300049580 Ga0501046_0007010 Ga0501046_0007010_7152_7619 138
24 3300049581 Ga0501047_0475759 Ga0501047_0475759_124_591 138
25 3300049582 Ga0501048_0004980 Ga0501048_0004980_633_1100 138
26 3300049585 Ga0501069_0867108 Ga0501069_0867108_65_532 138
27 3300049586 Ga0501070_0461423 Ga0501070_0461423_275_742 138
28 3300049587 Ga0501071_0334838 Ga0501071_0334838_661_1128 138
29 3300049588 Ga0501072_0003828 Ga0501072_0003828_3590_4057 138
30 3300049589 Ga0501073_0020297 Ga0501073_0020297_3975_4442 138
31 3300049590 Ga0501074_0202053 Ga0501074_0202053_381_848 138
32 3300049591 Ga0501075_0001572 Ga0501075_0001572_3710_4177 138
33 3300049592 Ga0501076_0002762 Ga0501076_0002762_730_1197 138
34 3300049593 Ga0501077_0000567 Ga0501077_0000567_7261_7728 138
35 3300049741 Ga0501079_0001645 Ga0501079_0001645_1318_1785 138
36 3300049742 Ga0501080_0005671 Ga0501080_0005671_6900_7367 138
37 3300049743 Ga0501081_0000144 Ga0501081_0000144_14104_14571 138
38 3300049822 Ga0501035_0010183 Ga0501035_0010183_2696_3163 138
39 3300049823 Ga0501044_0359118 Ga0501044_0359118_457_924 138
40 3300049824 Ga0501045_0003807 Ga0501045_0003807_2596_3063 138
41 3300054114 Ga0501084_0028985 Ga0501084_0028985_3436_3903 138
42 3300060353 Ga0501082_0001649 Ga0501082_0001649_1213_1680 138
43 3300061734 Ga0530510_0003532 Ga0530510_0003532_7835_8302 138
44 3300036401 Ga0373937_0492926 Ga0373937_0492926_360_878 139
45 3300031903 Ga0307407_10070427 Ga0307407_100704272 140
46 3300032005 Ga0307411_10395361 Ga0307411_103953612 140
47 3300049572 Ga0501036_0315791 Ga0501036_0315791_181_654 140
48 3300049575 Ga0501039_0239545 Ga0501039_0239545_14_487 140
49 3300049577 Ga0501041_0035231 Ga0501041_0035231_1116_1589 140
50 3300049579 Ga0501043_0717840 Ga0501043_0717840_111_584 140
51 3300049584 Ga0501068_0235145 Ga0501068_0235145_348_821 140
52 3300049742 Ga0501080_1716471 Ga0501080_1716471_20_493 140
53 3300049743 Ga0501081_0040253 Ga0501081_0040253_2715_3188 140
54 3300054114 Ga0501084_0570291 Ga0501084_0570291_424_897 140
55 3300014326 Ga0157380_10000875 Ga0157380_100008753 141
56 3300042461 Ga0439460_0049863 Ga0439460_0049863_452_928 141
57 3300042532 Ga0450893_0073115 Ga0450893_0073115_103_579 141
58 3300046537 Ga0495598_0078419 Ga0495598_0078419_174_656 141
59 3300049576 Ga0501040_0160614 Ga0501040_0160614_80_556 141
60 3300049578 Ga0501042_0634680 Ga0501042_0634680_103_579 141
61 3300049591 Ga0501075_0145481 Ga0501075_0145481_1231_1707 141
62 3300049592 Ga0501076_0129979 Ga0501076_0129979_26_502 141
63 3300049593 Ga0501077_0383243 Ga0501077_0383243_127_603 141
64 3300049741 Ga0501079_0087135 Ga0501079_0087135_1215_1691 141
65 3300049743 Ga0501081_0040598 Ga0501081_0040598_967_1443 141
66 3300049822 Ga0501035_0291320 Ga0501035_0291320_675_1151 141
67 3300060353 Ga0501082_0282932 Ga0501082_0282932_799_1275 141
68 3300061734 Ga0530510_0036224 Ga0530510_0036224_2563_3039 141
69 3300005327 Ga0070658_10017623 Ga0070658_100176234 142
70 3300005336 Ga0070680_100255550 Ga0070680_1002555502 142
71 3300005339 Ga0070660_100007313 Ga0070660_1000073132 142
72 3300005344 Ga0070661_100004250 Ga0070661_1000042502 142
73 3300005366 Ga0070659_100012507 Ga0070659_1000125073 142
74 3300005435 Ga0070714_100018613 Ga0070714_1000186138 142
75 3300005436 Ga0070713_100049434 Ga0070713_1000494342 142
76 3300005437 Ga0070710_10279780 Ga0070710_102797802 142
77 3300005458 Ga0070681_10106763 Ga0070681_101067632 142
78 3300005530 Ga0070679_100026536 Ga0070679_1000265362 142
79 3300005535 Ga0070684_100208130 Ga0070684_1002081302 142
80 3300005539 Ga0068853_100008824 Ga0068853_1000088249 142
81 3300005563 Ga0068855_100005356 Ga0068855_1000053567 142
82 3300005564 Ga0070664_100000563 Ga0070664_10000056315 142
83 3300005614 Ga0068856_100004757 Ga0068856_10000475712 142
84 3300005616 Ga0068852_100002071 Ga0068852_10000207114 142
85 3300009093 Ga0105240_10001484 Ga0105240_1000148429 142
86 3300009545 Ga0105237_10265184 Ga0105237_102651842 142
87 3300009551 Ga0105238_10007836 Ga0105238_100078367 142
88 3300013100 Ga0157373_10030058 Ga0157373_100300585 142
89 3300013104 Ga0157370_10040718 Ga0157370_100407184 142
90 3300013105 Ga0157369_10005068 Ga0157369_100050688 142
91 3300013296 Ga0157374_10272697 Ga0157374_102726973 142
92 3300013307 Ga0157372_10005517 Ga0157372_100055177 142
93 3300025321 Ga0207656_10082476 Ga0207656_100824762 142
94 3300025898 Ga0207692_10416819 Ga0207692_104168192 142
95 3300025909 Ga0207705_10147254 Ga0207705_101472543 142
96 3300025914 Ga0207671_10236949 Ga0207671_102369492 142
97 3300025917 Ga0207660_10172861 Ga0207660_101728612 142
98 3300025924 Ga0207694_10001424 Ga0207694_1000142418 142
99 3300025929 Ga0207664_10023189 Ga0207664_100231892 142
100 3300025932 Ga0207690_10028695 Ga0207690_100286953 142
101 3300025944 Ga0207661_10209733 Ga0207661_102097333 142
102 3300025945 Ga0207679_10026009 Ga0207679_100260092 142
103 3300025949 Ga0207667_10005999 Ga0207667_100059998 142
104 3300026041 Ga0207639_10173726 Ga0207639_101737262 142
105 3300026078 Ga0207702_10014826 Ga0207702_100148267 142
106 3300026116 Ga0207674_10000053 Ga0207674_1000005385 142
107 3300026142 Ga0207698_10007275 Ga0207698_100072754 142
108 3300049572 Ga0501036_0685384 Ga0501036_0685384_157_663 142
109 3300009094 Ga0111539_10567725 Ga0111539_105677251 144
110 3300009148 Ga0105243_10144052 Ga0105243_101440522 144
111 3300009177 Ga0105248_11215947 Ga0105248_112159471 144
112 3300013306 Ga0163162_10559869 Ga0163162_105598692 144
113 3300014325 Ga0163163_12080633 Ga0163163_120806331 144
114 3300014326 Ga0157380_10346758 Ga0157380_103467582 144
115 3300014968 Ga0157379_10081604 Ga0157379_100816044 144
116 3300035172 Ga0373955_0898358 Ga0373955_0898358_10_495 144
117 3300035691 Ga0373931_0537482 Ga0373931_0537482_32_517 144
118 3300046691 Ga0495670_0747784 Ga0495670_0747784_26_511 144
119 3300035241 Ga0373961_0087225 Ga0373961_0087225_270_770 145
120 3300049577 Ga0501041_0027145 Ga0501041_0027145_1293_1799 145
121 3300049578 Ga0501042_0075351 Ga0501042_0075351_1593_2099 145
122 3300049588 Ga0501072_0097666 Ga0501072_0097666_1125_1631 145
123 3300035207 Ga0373942_0008784 Ga0373942_0008784_1463_1969 146
124 3300049570 Ga0501033_0424517 Ga0501033_0424517_345_854 146
125 3300005341 Ga0070691_10041575 Ga0070691_100415752 147
126 3300005545 Ga0070695_100095000 Ga0070695_1000950002 147
127 3300026118 Ga0207675_101012982 Ga0207675_1010129822 147
128 3300005327 Ga0070658_10105219 Ga0070658_101052191 148
129 3300005336 Ga0070680_100239501 Ga0070680_1002395012 148
130 3300005339 Ga0070660_100023611 Ga0070660_1000236112 148
131 3300005563 Ga0068855_100111489 Ga0068855_1001114893 148
132 3300005844 Ga0068862_100961204 Ga0068862_1009612042 148
133 3300006846 Ga0075430_100008955 Ga0075430_1000089558 148
134 3300006847 Ga0075431_100368984 Ga0075431_1003689842 148
135 3300009551 Ga0105238_10069042 Ga0105238_100690423 148
136 3300013306 Ga0163162_11750397 Ga0163162_117503971 148
137 3300014326 Ga0157380_10670353 Ga0157380_106703532 148
138 3300025909 Ga0207705_10690870 Ga0207705_106908702 148
139 3300025913 Ga0207695_10780053 Ga0207695_107800532 148
140 3300025917 Ga0207660_10207380 Ga0207660_102073802 148
141 3300025921 Ga0207652_10256557 Ga0207652_102565572 148
142 3300025924 Ga0207694_10223716 Ga0207694_102237162 148
143 3300025931 Ga0207644_10213775 Ga0207644_102137752 148
144 3300025949 Ga0207667_11012527 Ga0207667_110125272 148
145 3300028380 Ga0268265_10912826 Ga0268265_109128262 148
146 3300041486 Ga0451807_1341561 Ga0451807_1341561_58_555 148
147 3300049661 Ga0501217_051871 Ga0501217_051871_388_876 148
148 3300050508 nmdc:mga09592_687876_c1 nmdc:mga09592_687876_c1_26_523 148
149 3300050509 nmdc:mga0qj67_23981_c1 nmdc:mga0qj67_23981_c1_2176_2673 148
150 3300009553 Ga0105249_10983254 Ga0105249_109832541 149
151 3300031548 Ga0307408_100297167 Ga0307408_1002971672 149
152 3300031824 Ga0307413_10398133 Ga0307413_103981332 149
153 3300031911 Ga0307412_11001323 Ga0307412_110013231 149
154 3300031995 Ga0307409_100023106 Ga0307409_1000231064 149
155 3300031995 Ga0307409_100072612 Ga0307409_1000726123 149
156 3300032002 Ga0307416_100299519 Ga0307416_1002995192 149
157 3300032005 Ga0307411_10095229 Ga0307411_100952292 149
158 3300049574 Ga0501038_0152916 Ga0501038_0152916_448_1002 149
159 3300049575 Ga0501039_0056625 Ga0501039_0056625_804_1358 149
160 3300049576 Ga0501040_0024943 Ga0501040_0024943_483_1037 149
161 3300049577 Ga0501041_0014647 Ga0501041_0014647_1205_1759 149
162 3300049580 Ga0501046_0051885 Ga0501046_0051885_2115_2669 149
163 3300049588 Ga0501072_0038612 Ga0501072_0038612_161_715 149
164 3300049591 Ga0501075_0000845 Ga0501075_0000845_11293_11847 149
165 3300049743 Ga0501081_0579191 Ga0501081_0579191_244_792 149
166 3300054114 Ga0501084_0048367 Ga0501084_0048367_284_838 149
167 3300060353 Ga0501082_0119241 Ga0501082_0119241_27_581 149
168 3300061734 Ga0530510_0004601 Ga0530510_0004601_644_1198 149
169 3300006852 Ga0075433_10110592 Ga0075433_101105922 150
170 3300007076 Ga0075435_100006615 Ga0075435_1000066158 150
171 3300009094 Ga0111539_10190681 Ga0111539_101906813 150
172 3300014326 Ga0157380_10614254 Ga0157380_106142542 150
173 3300032002 Ga0307416_101044880 Ga0307416_1010448802 150
174 3300049582 Ga0501048_0421314 Ga0501048_0421314_123_635 150
175 3300049593 Ga0501077_0253501 Ga0501077_0253501_116_628 150
176 3300049742 Ga0501080_0418076 Ga0501080_0418076_571_1083 150
177 3300049744 Ga0501083_0378931 Ga0501083_0378931_318_830 150
178 3300050511 nmdc:mga08y16_44771_c1 nmdc:mga08y16_44771_c1_227_733 150
179 3300050513 nmdc:mga0rr50_26340_c1 nmdc:mga0rr50_26340_c1_1771_2283 150
180 3300050515 nmdc:mga0a205_159404_c1 nmdc:mga0a205_159404_c1_968_1480 150
181 3300005328 Ga0070676_10014325 Ga0070676_100143254 151
182 3300005329 Ga0070683_101543511 Ga0070683_1015435111 151
183 3300005334 Ga0068869_100474259 Ga0068869_1004742592 151
184 3300005335 Ga0070666_10286263 Ga0070666_102862631 151
185 3300005336 Ga0070680_100071170 Ga0070680_1000711702 151
186 3300005339 Ga0070660_100066979 Ga0070660_1000669792 151
187 3300005339 Ga0070660_100375605 Ga0070660_1003756052 151
188 3300005339 Ga0070660_100839845 Ga0070660_1008398452 151
189 3300005344 Ga0070661_100185500 Ga0070661_1001855002 151
190 3300005345 Ga0070692_10109928 Ga0070692_101099282 151
191 3300005353 Ga0070669_100450731 Ga0070669_1004507312 151
192 3300005354 Ga0070675_100281842 Ga0070675_1002818422 151
193 3300005356 Ga0070674_100421142 Ga0070674_1004211421 151
194 3300005364 Ga0070673_100070921 Ga0070673_1000709212 151
195 3300005364 Ga0070673_100151764 Ga0070673_1001517642 151
196 3300005366 Ga0070659_100129150 Ga0070659_1001291502 151
197 3300005367 Ga0070667_100282438 Ga0070667_1002824382 151
198 3300005440 Ga0070705_100087187 Ga0070705_1000871872 151
199 3300005444 Ga0070694_100083162 Ga0070694_1000831622 151
200 3300005444 Ga0070694_100381309 Ga0070694_1003813092 151
201 3300005456 Ga0070678_100649930 Ga0070678_1006499302 151
202 3300005456 Ga0070678_100955075 Ga0070678_1009550752 151
203 3300005457 Ga0070662_100000736 Ga0070662_10000073620 151
204 3300005458 Ga0070681_10000525 Ga0070681_1000052524 151
205 3300005458 Ga0070681_10170304 Ga0070681_101703042 151
206 3300005459 Ga0068867_101229621 Ga0068867_1012296211 151
207 3300005468 Ga0070707_100089839 Ga0070707_1000898392 151
208 3300005530 Ga0070679_100125504 Ga0070679_1001255042 151
209 3300005530 Ga0070679_101530350 Ga0070679_1015303501 151
210 3300005539 Ga0068853_100001643 Ga0068853_1000016434 151
211 3300005545 Ga0070695_100607065 Ga0070695_1006070651 151
212 3300005546 Ga0070696_100242345 Ga0070696_1002423451 151
213 3300005547 Ga0070693_100653133 Ga0070693_1006531332 151
214 3300005549 Ga0070704_100007749 Ga0070704_1000077492 151
215 3300005549 Ga0070704_100008762 Ga0070704_1000087627 151
216 3300005549 Ga0070704_100012920 Ga0070704_1000129205 151
217 3300005549 Ga0070704_100134095 Ga0070704_1001340951 151
218 3300005563 Ga0068855_100709777 Ga0068855_1007097772 151
219 3300005577 Ga0068857_100391635 Ga0068857_1003916352 151
220 3300005577 Ga0068857_101006881 Ga0068857_1010068812 151
221 3300005578 Ga0068854_100640277 Ga0068854_1006402771 151
222 3300005614 Ga0068856_100000246 Ga0068856_10000024636 151
223 3300005841 Ga0068863_100489886 Ga0068863_1004898862 151
224 3300005844 Ga0068862_100271661 Ga0068862_1002716612 151
225 3300006844 Ga0075428_100032310 Ga0075428_1000323102 151
226 3300006844 Ga0075428_100252508 Ga0075428_1002525081 151
227 3300006847 Ga0075431_100028736 Ga0075431_1000287365 151
228 3300006847 Ga0075431_100757129 Ga0075431_1007571292 151
229 3300006881 Ga0068865_101172241 Ga0068865_1011722411 151
230 3300007265 Ga0099794_10130495 Ga0099794_101304952 151
231 3300007788 Ga0099795_10021429 Ga0099795_100214292 151
232 3300009094 Ga0111539_10546683 Ga0111539_105466832 151
233 3300009176 Ga0105242_12110272 Ga0105242_121102721 151
234 3300013100 Ga0157373_10001898 Ga0157373_100018983 151
235 3300013102 Ga0157371_10110570 Ga0157371_101105702 151
236 3300013105 Ga0157369_11627961 Ga0157369_116279612 151
237 3300013307 Ga0157372_10039943 Ga0157372_100399432 151
238 3300013307 Ga0157372_10158219 Ga0157372_101582193 151
239 3300025315 Ga0207697_10030825 Ga0207697_100308252 151
240 3300025321 Ga0207656_10145377 Ga0207656_101453772 151
241 3300025899 Ga0207642_10741368 Ga0207642_107413681 151
242 3300025903 Ga0207680_10128858 Ga0207680_101288582 151
243 3300025907 Ga0207645_10021346 Ga0207645_100213464 151
244 3300025908 Ga0207643_10097822 Ga0207643_100978222 151
245 3300025912 Ga0207707_10008578 Ga0207707_100085783 151
246 3300025912 Ga0207707_10088630 Ga0207707_100886302 151
247 3300025917 Ga0207660_10173780 Ga0207660_101737802 151
248 3300025917 Ga0207660_10419970 Ga0207660_104199702 151
249 3300025919 Ga0207657_10000260 Ga0207657_100002602 151
250 3300025919 Ga0207657_10340185 Ga0207657_103401852 151
251 3300025921 Ga0207652_10700038 Ga0207652_107000382 151
252 3300025921 Ga0207652_10752233 Ga0207652_107522331 151
253 3300025922 Ga0207646_10984727 Ga0207646_109847272 151
254 3300025923 Ga0207681_10293896 Ga0207681_102938962 151
255 3300025926 Ga0207659_10024536 Ga0207659_100245361 151
256 3300025932 Ga0207690_10010711 Ga0207690_100107114 151
257 3300025933 Ga0207706_10000190 Ga0207706_1000019013 151
258 3300025937 Ga0207669_11073840 Ga0207669_110738401 151
259 3300025940 Ga0207691_10042870 Ga0207691_100428703 151
260 3300025942 Ga0207689_10224033 Ga0207689_102240332 151
261 3300025944 Ga0207661_10676440 Ga0207661_106764401 151
262 3300025949 Ga0207667_10094804 Ga0207667_100948042 151
263 3300025960 Ga0207651_10021100 Ga0207651_100211003 151
264 3300025981 Ga0207640_10163270 Ga0207640_101632702 151
265 3300026041 Ga0207639_10128920 Ga0207639_101289202 151
266 3300026075 Ga0207708_10134264 Ga0207708_101342642 151
267 3300026075 Ga0207708_10465009 Ga0207708_104650091 151
268 3300026078 Ga0207702_10004336 Ga0207702_100043364 151
269 3300026116 Ga0207674_10293149 Ga0207674_102931492 151
270 3300026116 Ga0207674_10294974 Ga0207674_102949742 151
271 3300026118 Ga0207675_100526463 Ga0207675_1005264632 151
272 3300026121 Ga0207683_10236043 Ga0207683_102360432 151
273 3300027360 Ga0209969_1004121 Ga0209969_10041212 151
274 3300027364 Ga0209967_1021413 Ga0209967_10214132 151
275 3300027378 Ga0209981_1020994 Ga0209981_10209942 151
276 3300027395 Ga0209996_1007218 Ga0209996_10072182 151
277 3300027462 Ga0210000_1002742 Ga0210000_10027423 151
278 3300027526 Ga0209968_1018914 Ga0209968_10189141 151
279 3300027543 Ga0209999_1033974 Ga0209999_10339742 151
280 3300027552 Ga0209982_1020209 Ga0209982_10202092 151
281 3300027617 Ga0210002_1003831 Ga0210002_10038312 151
282 3300027665 Ga0209983_1011305 Ga0209983_10113052 151
283 3300027695 Ga0209966_1040488 Ga0209966_10404882 151
284 3300027876 Ga0209974_10000626 Ga0209974_100006264 151
285 3300028380 Ga0268265_10420929 Ga0268265_104209292 151
286 3300031548 Ga0307408_100004584 Ga0307408_1000045843 151
287 3300031548 Ga0307408_100303984 Ga0307408_1003039842 151
288 3300031665 Ga0316575_10040832 Ga0316575_100408322 151
289 3300031824 Ga0307413_10001161 Ga0307413_100011613 151
290 3300031852 Ga0307410_10001726 Ga0307410_1000172610 151
291 3300031901 Ga0307406_10004201 Ga0307406_100042017 151
292 3300031903 Ga0307407_10055414 Ga0307407_100554142 151
293 3300031911 Ga0307412_10025231 Ga0307412_100252312 151
294 3300031911 Ga0307412_11287226 Ga0307412_112872262 151
295 3300031995 Ga0307409_100039662 Ga0307409_1000396623 151
296 3300032002 Ga0307416_100008129 Ga0307416_1000081296 151
297 3300032002 Ga0307416_100121703 Ga0307416_1001217032 151
298 3300032004 Ga0307414_10821135 Ga0307414_108211352 151
299 3300032005 Ga0307411_10000419 Ga0307411_100004195 151
300 3300032126 Ga0307415_100003744 Ga0307415_1000037446 151
301 3300034816 Ga0373930_0069943 Ga0373930_0069943_243_749 151
302 3300035083 Ga0373926_0001761 Ga0373926_0001761_2106_2630 151
303 3300035089 Ga0373944_0002901 Ga0373944_0002901_227_751 151
304 3300035113 Ga0373936_0002101 Ga0373936_0002101_4677_5201 151
305 3300035116 Ga0373945_0001227 Ga0373945_0001227_1718_2242 151
306 3300035118 Ga0373954_0007183 Ga0373954_0007183_2452_3024 151
307 3300035121 Ga0373960_0061026 Ga0373960_0061026_372_878 151
308 3300035170 Ga0373943_0129637 Ga0373943_0129637_726_1250 151
309 3300035171 Ga0373946_0003237 Ga0373946_0003237_1948_2472 151
310 3300035410 Ga0373924_0130230 Ga0373924_0130230_226_750 151
311 3300035692 Ga0373935_0009698 Ga0373935_0009698_3810_4334 151
312 3300035692 Ga0373935_0376010 Ga0373935_0376010_185_691 151
313 3300035695 Ga0373927_0004974 Ga0373927_0004974_2627_3151 151
314 3300035725 Ga0373947_0190358 Ga0373947_0190358_459_983 151
315 3300041496 Ga0451839_1410063 Ga0451839_1410063_18_542 151
316 3300042436 Ga0439435_0068346 Ga0439435_0068346_264_770 151
317 3300045051 Ga0451576_0743992 Ga0451576_0743992_155_661 151
318 3300046454 Ga0495592_0830393 Ga0495592_0830393_25_537 151
319 3300046472 Ga0495580_0003258 Ga0495580_0003258_8012_8536 151
320 3300046499 Ga0495594_0038985 Ga0495594_0038985_1042_1566 151
321 3300046516 Ga0495628_0313466 Ga0495628_0313466_48_620 151
322 3300046526 Ga0495666_0005431 Ga0495666_0005431_2393_2917 151
323 3300046535 Ga0495586_0003330 Ga0495586_0003330_640_1164 151
324 3300046674 Ga0495588_0008086 Ga0495588_0008086_4271_4795 151
325 3300046681 Ga0495647_0001261 Ga0495647_0001261_779_1303 151
326 3300046683 Ga0495658_0001458 Ga0495658_0001458_7855_8379 151
327 3300047315 Ga0495581_0007160 Ga0495581_0007160_2719_3243 151
328 3300047318 Ga0495636_0004078 Ga0495636_0004078_4147_4656 151
329 3300047321 Ga0495676_0004858 Ga0495676_0004858_6810_7334 151
330 3300048906 Ga0496103_0246924 Ga0496103_0246924_541_1047 151
331 3300048909 Ga0496106_0000353 Ga0496106_0000353_26238_26744 151
332 3300048914 Ga0496111_0220598 Ga0496111_0220598_259_765 151
333 3300049514 Ga0501291_073183 Ga0501291_073183_110_619 151
334 3300049514 Ga0501291_116639 Ga0501291_116639_56_562 151
335 3300049522 Ga0501299_006374 Ga0501299_006374_347_853 151
336 3300049575 Ga0501039_0458469 Ga0501039_0458469_402_908 151
337 3300049577 Ga0501041_0102091 Ga0501041_0102091_148_654 151
338 3300049580 Ga0501046_0090876 Ga0501046_0090876_81_587 151
339 3300049587 Ga0501071_0150679 Ga0501071_0150679_673_1179 151
340 3300049592 Ga0501076_0390604 Ga0501076_0390604_44_550 151
341 3300049741 Ga0501079_0166055 Ga0501079_0166055_1173_1679 151
342 3300049824 Ga0501045_1120024 Ga0501045_1120024_51_557 151
343 3300050508 nmdc:mga09592_375490_c1 nmdc:mga09592_375490_c1_429_935 151
344 3300050510 nmdc:mga06r32_161293_c1 nmdc:mga06r32_161293_c1_318_824 151
345 3300050511 nmdc:mga08y16_439948_c1 nmdc:mga08y16_439948_c1_406_915 151
346 3300050511 nmdc:mga08y16_856284_c1 nmdc:mga08y16_856284_c1_328_837 151
347 3300053136 Ga0500559_0143142 Ga0500559_0143142_445_957 151
348 3300005842 Ga0068858_100541516 Ga0068858_1005415162 152
349 3300006852 Ga0075433_10168533 Ga0075433_101685331 152
350 3300006852 Ga0075433_11011523 Ga0075433_110115232 152
351 3300026035 Ga0207703_10416683 Ga0207703_104166832 152
352 3300026078 Ga0207702_10101643 Ga0207702_101016434 152
353 3300031731 Ga0307405_11113419 Ga0307405_111134191 152
354 3300032004 Ga0307414_10528267 Ga0307414_105282672 152
355 3300049519 Ga0501296_011586 Ga0501296_011586_102_611 152
356 3300050515 nmdc:mga0a205_417621_c1 nmdc:mga0a205_417621_c1_221_733 152
357 3300005289 Ga0065704_10367499 Ga0065704_103674992 153
358 3300005293 Ga0065715_10962985 Ga0065715_109629851 153
359 3300005295 Ga0065707_10173185 Ga0065707_101731852 153
360 3300005295 Ga0065707_10846835 Ga0065707_108468351 153
361 3300005328 Ga0070676_10001406 Ga0070676_100014062 153
362 3300005329 Ga0070683_100003515 Ga0070683_1000035152 153
363 3300005330 Ga0070690_100016568 Ga0070690_1000165682 153
364 3300005330 Ga0070690_100193928 Ga0070690_1001939282 153
365 3300005331 Ga0070670_100005195 Ga0070670_10000519510 153
366 3300005331 Ga0070670_100252819 Ga0070670_1002528192 153
367 3300005333 Ga0070677_10086386 Ga0070677_100863862 153
368 3300005333 Ga0070677_10125758 Ga0070677_101257582 153
369 3300005334 Ga0068869_100003269 Ga0068869_1000032698 153
370 3300005334 Ga0068869_100003339 Ga0068869_1000033394 153
371 3300005334 Ga0068869_100005842 Ga0068869_1000058423 153
372 3300005334 Ga0068869_100203016 Ga0068869_1002030162 153
373 3300005334 Ga0068869_101094994 Ga0068869_1010949941 153
374 3300005335 Ga0070666_10001532 Ga0070666_100015322 153
375 3300005335 Ga0070666_10027573 Ga0070666_100275732 153
376 3300005335 Ga0070666_10489697 Ga0070666_104896972 153
377 3300005337 Ga0070682_100329616 Ga0070682_1003296161 153
378 3300005338 Ga0068868_100003224 Ga0068868_1000032242 153
379 3300005338 Ga0068868_100003921 Ga0068868_1000039219 153
380 3300005338 Ga0068868_100150123 Ga0068868_1001501232 153
381 3300005340 Ga0070689_100030682 Ga0070689_1000306823 153
382 3300005340 Ga0070689_100499672 Ga0070689_1004996722 153
383 3300005341 Ga0070691_10228340 Ga0070691_102283402 153
384 3300005343 Ga0070687_100000139 Ga0070687_10000013924 153
385 3300005345 Ga0070692_10008048 Ga0070692_100080483 153
386 3300005347 Ga0070668_100000553 Ga0070668_10000055317 153
387 3300005347 Ga0070668_100001829 Ga0070668_1000018294 153
388 3300005347 Ga0070668_100027620 Ga0070668_1000276201 153
389 3300005347 Ga0070668_100233465 Ga0070668_1002334652 153
390 3300005347 Ga0070668_100288544 Ga0070668_1002885442 153
391 3300005347 Ga0070668_100705899 Ga0070668_1007058991 153
392 3300005353 Ga0070669_100011703 Ga0070669_1000117032 153
393 3300005353 Ga0070669_100113075 Ga0070669_1001130752 153
394 3300005354 Ga0070675_100012659 Ga0070675_1000126592 153
395 3300005354 Ga0070675_100107221 Ga0070675_1001072212 153
396 3300005355 Ga0070671_100012100 Ga0070671_1000121004 153
397 3300005355 Ga0070671_100123074 Ga0070671_1001230742 153
398 3300005355 Ga0070671_100259147 Ga0070671_1002591471 153
399 3300005356 Ga0070674_100148057 Ga0070674_1001480572 153
400 3300005356 Ga0070674_100160383 Ga0070674_1001603832 153
401 3300005356 Ga0070674_100286421 Ga0070674_1002864211 153
402 3300005356 Ga0070674_100865250 Ga0070674_1008652502 153
403 3300005364 Ga0070673_100004291 Ga0070673_1000042918 153
404 3300005364 Ga0070673_100519856 Ga0070673_1005198562 153
405 3300005364 Ga0070673_100719390 Ga0070673_1007193901 153
406 3300005365 Ga0070688_100066343 Ga0070688_1000663431 153
407 3300005366 Ga0070659_100444822 Ga0070659_1004448222 153
408 3300005367 Ga0070667_100009252 Ga0070667_1000092522 153
409 3300005367 Ga0070667_100026164 Ga0070667_1000261642 153
410 3300005406 Ga0070703_10004181 Ga0070703_100041815 153
411 3300005437 Ga0070710_10251153 Ga0070710_102511531 153
412 3300005438 Ga0070701_10138222 Ga0070701_101382222 153
413 3300005440 Ga0070705_100211272 Ga0070705_1002112722 153
414 3300005441 Ga0070700_100000374 Ga0070700_10000037420 153
415 3300005441 Ga0070700_100885364 Ga0070700_1008853641 153
416 3300005441 Ga0070700_101025582 Ga0070700_1010255821 153
417 3300005444 Ga0070694_100001221 Ga0070694_1000012219 153
418 3300005444 Ga0070694_100092518 Ga0070694_1000925183 153
419 3300005444 Ga0070694_100114246 Ga0070694_1001142462 153
420 3300005444 Ga0070694_100616602 Ga0070694_1006166022 153
421 3300005455 Ga0070663_100349509 Ga0070663_1003495092 153
422 3300005455 Ga0070663_100523116 Ga0070663_1005231162 153
423 3300005456 Ga0070678_100014335 Ga0070678_1000143354 153
424 3300005456 Ga0070678_100175237 Ga0070678_1001752372 153
425 3300005456 Ga0070678_101215715 Ga0070678_1012157151 153
426 3300005457 Ga0070662_100136103 Ga0070662_1001361032 153
427 3300005457 Ga0070662_100799200 Ga0070662_1007992001 153
428 3300005458 Ga0070681_10135653 Ga0070681_101356532 153
429 3300005459 Ga0068867_100002804 Ga0068867_1000028042 153
430 3300005459 Ga0068867_100026483 Ga0068867_1000264834 153
431 3300005459 Ga0068867_100108575 Ga0068867_1001085752 153
432 3300005459 Ga0068867_100176558 Ga0068867_1001765582 153
433 3300005459 Ga0068867_100217565 Ga0068867_1002175652 153
434 3300005459 Ga0068867_100752900 Ga0068867_1007529001 153
435 3300005459 Ga0068867_101023212 Ga0068867_1010232121 153
436 3300005466 Ga0070685_10297270 Ga0070685_102972702 153
437 3300005466 Ga0070685_10511738 Ga0070685_105117381 153
438 3300005467 Ga0070706_100429719 Ga0070706_1004297192 153
439 3300005468 Ga0070707_101442371 Ga0070707_1014423711 153
440 3300005471 Ga0070698_100992188 Ga0070698_1009921882 153
441 3300005471 Ga0070698_101465006 Ga0070698_1014650061 153
442 3300005518 Ga0070699_100457184 Ga0070699_1004571842 153
443 3300005530 Ga0070679_100025788 Ga0070679_1000257884 153
444 3300005535 Ga0070684_100192719 Ga0070684_1001927192 153
445 3300005539 Ga0068853_100140234 Ga0068853_1001402342 153
446 3300005543 Ga0070672_100004288 Ga0070672_1000042887 153
447 3300005543 Ga0070672_100055056 Ga0070672_1000550562 153
448 3300005543 Ga0070672_100094372 Ga0070672_1000943723 153
449 3300005544 Ga0070686_100017659 Ga0070686_1000176592 153
450 3300005544 Ga0070686_100027666 Ga0070686_1000276664 153
451 3300005545 Ga0070695_100011120 Ga0070695_1000111207 153
452 3300005545 Ga0070695_100138917 Ga0070695_1001389172 153
453 3300005545 Ga0070695_100592935 Ga0070695_1005929352 153
454 3300005546 Ga0070696_100009847 Ga0070696_1000098473 153
455 3300005546 Ga0070696_100022409 Ga0070696_1000224095 153
456 3300005546 Ga0070696_100413428 Ga0070696_1004134281 153
457 3300005546 Ga0070696_100463781 Ga0070696_1004637811 153
458 3300005546 Ga0070696_101146917 Ga0070696_1011469171 153
459 3300005548 Ga0070665_100013156 Ga0070665_10001315610 153
460 3300005548 Ga0070665_101117197 Ga0070665_1011171972 153
461 3300005549 Ga0070704_100006411 Ga0070704_1000064119 153
462 3300005549 Ga0070704_100019651 Ga0070704_1000196514 153
463 3300005549 Ga0070704_100056487 Ga0070704_1000564874 153
464 3300005563 Ga0068855_100011048 Ga0068855_1000110485 153
465 3300005563 Ga0068855_100483866 Ga0068855_1004838661 153
466 3300005564 Ga0070664_100484371 Ga0070664_1004843712 153
467 3300005564 Ga0070664_100727218 Ga0070664_1007272182 153
468 3300005564 Ga0070664_100844740 Ga0070664_1008447402 153
469 3300005577 Ga0068857_100227016 Ga0068857_1002270162 153
470 3300005578 Ga0068854_100048676 Ga0068854_1000486763 153
471 3300005614 Ga0068856_100065408 Ga0068856_1000654082 153
472 3300005615 Ga0070702_100007791 Ga0070702_1000077913 153
473 3300005615 Ga0070702_100334784 Ga0070702_1003347842 153
474 3300005616 Ga0068852_100915872 Ga0068852_1009158722 153
475 3300005617 Ga0068859_100019223 Ga0068859_1000192236 153
476 3300005617 Ga0068859_100051616 Ga0068859_1000516164 153
477 3300005617 Ga0068859_100106540 Ga0068859_1001065402 153
478 3300005617 Ga0068859_100320738 Ga0068859_1003207382 153
479 3300005617 Ga0068859_100369576 Ga0068859_1003695762 153
480 3300005617 Ga0068859_100420040 Ga0068859_1004200402 153
481 3300005618 Ga0068864_100010798 Ga0068864_1000107982 153
482 3300005618 Ga0068864_100014467 Ga0068864_1000144674 153
483 3300005618 Ga0068864_100056893 Ga0068864_1000568934 153
484 3300005618 Ga0068864_100356244 Ga0068864_1003562442 153
485 3300005718 Ga0068866_10001678 Ga0068866_100016782 153
486 3300005718 Ga0068866_10091197 Ga0068866_100911972 153
487 3300005719 Ga0068861_100081661 Ga0068861_1000816613 153
488 3300005719 Ga0068861_100504920 Ga0068861_1005049202 153
489 3300005719 Ga0068861_100678397 Ga0068861_1006783972 153
490 3300005840 Ga0068870_10030932 Ga0068870_100309323 153
491 3300005840 Ga0068870_10040091 Ga0068870_100400912 153
492 3300005841 Ga0068863_100002779 Ga0068863_1000027795 153
493 3300005841 Ga0068863_100029642 Ga0068863_1000296422 153
494 3300005841 Ga0068863_100095134 Ga0068863_1000951342 153
495 3300005841 Ga0068863_100104413 Ga0068863_1001044134 153
496 3300005841 Ga0068863_100681989 Ga0068863_1006819892 153
497 3300005841 Ga0068863_101153982 Ga0068863_1011539821 153
498 3300005842 Ga0068858_100006644 Ga0068858_10000664410 153
499 3300005842 Ga0068858_100022411 Ga0068858_1000224116 153
500 3300005842 Ga0068858_100140876 Ga0068858_1001408762 153
501 3300005842 Ga0068858_100189487 Ga0068858_1001894872 153
502 3300005843 Ga0068860_100016867 Ga0068860_1000168672 153
503 3300005843 Ga0068860_100017448 Ga0068860_1000174482 153
504 3300005843 Ga0068860_100205548 Ga0068860_1002055482 153
505 3300005843 Ga0068860_100492758 Ga0068860_1004927582 153
506 3300005843 Ga0068860_100576602 Ga0068860_1005766022 153
507 3300005843 Ga0068860_100750371 Ga0068860_1007503712 153
508 3300005843 Ga0068860_100992042 Ga0068860_1009920421 153
509 3300005844 Ga0068862_100018766 Ga0068862_1000187662 153
510 3300005844 Ga0068862_100128722 Ga0068862_1001287223 153
511 3300005844 Ga0068862_100128972 Ga0068862_1001289722 153
512 3300005844 Ga0068862_100173270 Ga0068862_1001732702 153
513 3300005844 Ga0068862_100196411 Ga0068862_1001964112 153
514 3300005844 Ga0068862_100209317 Ga0068862_1002093172 153
515 3300005844 Ga0068862_100399367 Ga0068862_1003993672 153
516 3300005844 Ga0068862_100406277 Ga0068862_1004062772 153
517 3300005844 Ga0068862_100744777 Ga0068862_1007447772 153
518 3300005844 Ga0068862_101279875 Ga0068862_1012798751 153
519 3300005844 Ga0068862_101404517 Ga0068862_1014045171 153
520 3300006195 Ga0075366_10016409 Ga0075366_100164093 153
521 3300006237 Ga0097621_100004433 Ga0097621_1000044338 153
522 3300006237 Ga0097621_100014655 Ga0097621_1000146552 153
523 3300006237 Ga0097621_100028572 Ga0097621_1000285723 153
524 3300006237 Ga0097621_100059139 Ga0097621_1000591394 153
525 3300006358 Ga0068871_100001217 Ga0068871_1000012174 153
526 3300006358 Ga0068871_100001947 Ga0068871_1000019472 153
527 3300006358 Ga0068871_100009329 Ga0068871_1000093297 153
528 3300006358 Ga0068871_100024471 Ga0068871_1000244715 153
529 3300006358 Ga0068871_100363427 Ga0068871_1003634272 153
530 3300006358 Ga0068871_100462541 Ga0068871_1004625412 153
531 3300006358 Ga0068871_101012900 Ga0068871_1010129002 153
532 3300006844 Ga0075428_100212084 Ga0075428_1002120842 153
533 3300006844 Ga0075428_101471643 Ga0075428_1014716432 153
534 3300006847 Ga0075431_100035634 Ga0075431_1000356343 153
535 3300006852 Ga0075433_10737483 Ga0075433_107374832 153
536 3300006880 Ga0075429_100729213 Ga0075429_1007292132 153
537 3300006881 Ga0068865_100006340 Ga0068865_1000063405 153
538 3300006881 Ga0068865_100103934 Ga0068865_1001039342 153
539 3300006881 Ga0068865_100321595 Ga0068865_1003215952 153
540 3300006931 Ga0097620_100019223 Ga0097620_1000192236 153
541 3300006931 Ga0097620_100051611 Ga0097620_1000516113 153
542 3300006931 Ga0097620_100106540 Ga0097620_1001065404 153
543 3300006931 Ga0097620_100320732 Ga0097620_1003207322 153
544 3300006931 Ga0097620_100369575 Ga0097620_1003695752 153
545 3300006931 Ga0097620_100420020 Ga0097620_1004200202 153
546 3300007076 Ga0075435_100295086 Ga0075435_1002950862 153
547 3300009094 Ga0111539_10578456 Ga0111539_105784561 153
548 3300009098 Ga0105245_10007955 Ga0105245_100079559 153
549 3300009098 Ga0105245_10140491 Ga0105245_101404912 153
550 3300009098 Ga0105245_10321831 Ga0105245_103218312 153
551 3300009098 Ga0105245_10473920 Ga0105245_104739202 153
552 3300009101 Ga0105247_10038720 Ga0105247_100387204 153
553 3300009147 Ga0114129_10059617 Ga0114129_100596177 153
554 3300009148 Ga0105243_10038478 Ga0105243_100384784 153
555 3300009148 Ga0105243_10093097 Ga0105243_100930972 153
556 3300009148 Ga0105243_10313230 Ga0105243_103132302 153
557 3300009148 Ga0105243_10331948 Ga0105243_103319482 153
558 3300009148 Ga0105243_10376513 Ga0105243_103765131 153
559 3300009174 Ga0105241_10067205 Ga0105241_100672053 153
560 3300009176 Ga0105242_10364006 Ga0105242_103640062 153
561 3300009176 Ga0105242_10871161 Ga0105242_108711612 153
562 3300009177 Ga0105248_10008149 Ga0105248_100081495 153
563 3300009177 Ga0105248_10014298 Ga0105248_100142984 153
564 3300009177 Ga0105248_10195035 Ga0105248_101950351 153
565 3300009177 Ga0105248_10301555 Ga0105248_103015552 153
566 3300009177 Ga0105248_10416896 Ga0105248_104168962 153
567 3300009177 Ga0105248_10919275 Ga0105248_109192752 153
568 3300009177 Ga0105248_11682742 Ga0105248_116827421 153
569 3300009553 Ga0105249_10010159 Ga0105249_100101592 153
570 3300009553 Ga0105249_10056270 Ga0105249_100562702 153
571 3300009553 Ga0105249_10941885 Ga0105249_109418852 153
572 3300010375 Ga0105239_10090003 Ga0105239_100900032 153
573 3300011119 Ga0105246_10930533 Ga0105246_109305331 153
574 3300013102 Ga0157371_10459264 Ga0157371_104592642 153
575 3300013296 Ga0157374_10229316 Ga0157374_102293162 153
576 3300013297 Ga0157378_10149000 Ga0157378_101490003 153
577 3300013297 Ga0157378_11445407 Ga0157378_114454072 153
578 3300013306 Ga0163162_10007370 Ga0163162_100073704 153
579 3300013306 Ga0163162_10187695 Ga0163162_101876953 153
580 3300013306 Ga0163162_10357833 Ga0163162_103578332 153
581 3300013306 Ga0163162_10398791 Ga0163162_103987912 153
582 3300013306 Ga0163162_11187131 Ga0163162_111871312 153
583 3300013308 Ga0157375_10005693 Ga0157375_100056936 153
584 3300013308 Ga0157375_10040255 Ga0157375_100402556 153
585 3300013308 Ga0157375_10042034 Ga0157375_100420342 153
586 3300013308 Ga0157375_10209989 Ga0157375_102099892 153
587 3300013308 Ga0157375_10453703 Ga0157375_104537032 153
588 3300013308 Ga0157375_11281319 Ga0157375_112813192 153
589 3300013308 Ga0157375_12204822 Ga0157375_122048221 153
590 3300014325 Ga0163163_10006010 Ga0163163_100060106 153
591 3300014325 Ga0163163_10292229 Ga0163163_102922292 153
592 3300014326 Ga0157380_10045305 Ga0157380_100453052 153
593 3300014326 Ga0157380_10112646 Ga0157380_101126462 153
594 3300014326 Ga0157380_10454974 Ga0157380_104549742 153
595 3300014326 Ga0157380_11050165 Ga0157380_110501652 153
596 3300014326 Ga0157380_11153498 Ga0157380_111534982 153
597 3300014745 Ga0157377_10232025 Ga0157377_102320252 153
598 3300014968 Ga0157379_10007045 Ga0157379_100070452 153
599 3300014968 Ga0157379_10040735 Ga0157379_100407354 153
600 3300014968 Ga0157379_11321797 Ga0157379_113217972 153
601 3300014968 Ga0157379_11610099 Ga0157379_116100991 153
602 3300014969 Ga0157376_10036486 Ga0157376_100364864 153
603 3300014969 Ga0157376_10353660 Ga0157376_103536602 153
604 3300017792 Ga0163161_10011147 Ga0163161_100111472 153
605 3300017792 Ga0163161_10024325 Ga0163161_100243254 153
606 3300017792 Ga0163161_11007443 Ga0163161_110074431 153
607 3300025271 Ga0207666_1008853 Ga0207666_10088532 153
608 3300025292 Ga0209676_1000214 Ga0209676_100021439 153
609 3300025315 Ga0207697_10005571 Ga0207697_100055712 153
610 3300025885 Ga0207653_10005279 Ga0207653_100052795 153
611 3300025899 Ga0207642_10014088 Ga0207642_100140883 153
612 3300025899 Ga0207642_10110526 Ga0207642_101105262 153
613 3300025901 Ga0207688_10095870 Ga0207688_100958702 153
614 3300025903 Ga0207680_10002705 Ga0207680_100027053 153
615 3300025903 Ga0207680_10023216 Ga0207680_100232161 153
616 3300025903 Ga0207680_10445824 Ga0207680_104458242 153
617 3300025907 Ga0207645_10001263 Ga0207645_1000126318 153
618 3300025907 Ga0207645_10073047 Ga0207645_100730472 153
619 3300025908 Ga0207643_10013531 Ga0207643_100135312 153
620 3300025908 Ga0207643_10161403 Ga0207643_101614032 153
621 3300025908 Ga0207643_10380375 Ga0207643_103803752 153
622 3300025910 Ga0207684_10663315 Ga0207684_106633152 153
623 3300025918 Ga0207662_10000214 Ga0207662_1000021425 153
624 3300025921 Ga0207652_10051030 Ga0207652_100510304 153
625 3300025922 Ga0207646_10103769 Ga0207646_101037692 153
626 3300025922 Ga0207646_11055183 Ga0207646_110551832 153
627 3300025923 Ga0207681_10024887 Ga0207681_100248874 153
628 3300025923 Ga0207681_10053714 Ga0207681_100537143 153
629 3300025923 Ga0207681_10064043 Ga0207681_100640433 153
630 3300025925 Ga0207650_10017437 Ga0207650_100174373 153
631 3300025925 Ga0207650_10054766 Ga0207650_100547663 153
632 3300025925 Ga0207650_10075623 Ga0207650_100756233 153
633 3300025925 Ga0207650_10081064 Ga0207650_100810642 153
634 3300025925 Ga0207650_10102176 Ga0207650_101021761 153
635 3300025926 Ga0207659_10001564 Ga0207659_100015644 153
636 3300025926 Ga0207659_10022668 Ga0207659_100226682 153
637 3300025926 Ga0207659_10077692 Ga0207659_100776924 153
638 3300025927 Ga0207687_10045463 Ga0207687_100454633 153
639 3300025931 Ga0207644_10017212 Ga0207644_100172124 153
640 3300025931 Ga0207644_10116540 Ga0207644_101165402 153
641 3300025931 Ga0207644_10156898 Ga0207644_101568983 153
642 3300025931 Ga0207644_10221443 Ga0207644_102214432 153
643 3300025932 Ga0207690_10871979 Ga0207690_108719792 153
644 3300025933 Ga0207706_10050841 Ga0207706_100508414 153
645 3300025934 Ga0207686_10019943 Ga0207686_100199434 153
646 3300025934 Ga0207686_10627266 Ga0207686_106272661 153
647 3300025935 Ga0207709_10195171 Ga0207709_101951711 153
648 3300025935 Ga0207709_10221923 Ga0207709_102219232 153
649 3300025935 Ga0207709_10249410 Ga0207709_102494102 153
650 3300025936 Ga0207670_10111012 Ga0207670_101110122 153
651 3300025936 Ga0207670_10342261 Ga0207670_103422611 153
652 3300025937 Ga0207669_10010050 Ga0207669_100100502 153
653 3300025937 Ga0207669_10216047 Ga0207669_102160472 153
654 3300025937 Ga0207669_10231575 Ga0207669_102315752 153
655 3300025938 Ga0207704_10047553 Ga0207704_100475532 153
656 3300025938 Ga0207704_10838160 Ga0207704_108381601 153
657 3300025939 Ga0207665_10086177 Ga0207665_100861772 153
658 3300025940 Ga0207691_10000486 Ga0207691_1000048627 153
659 3300025940 Ga0207691_10007762 Ga0207691_1000776212 153
660 3300025940 Ga0207691_10045827 Ga0207691_100458272 153
661 3300025940 Ga0207691_10052318 Ga0207691_100523183 153
662 3300025940 Ga0207691_10296198 Ga0207691_102961982 153
663 3300025940 Ga0207691_10522238 Ga0207691_105222382 153
664 3300025941 Ga0207711_10003467 Ga0207711_100034674 153
665 3300025941 Ga0207711_10186931 Ga0207711_101869313 153
666 3300025941 Ga0207711_10345933 Ga0207711_103459332 153
667 3300025941 Ga0207711_10604398 Ga0207711_106043982 153
668 3300025941 Ga0207711_10626640 Ga0207711_106266401 153
669 3300025942 Ga0207689_10001553 Ga0207689_100015535 153
670 3300025942 Ga0207689_10011895 Ga0207689_100118953 153
671 3300025942 Ga0207689_10014359 Ga0207689_100143595 153
672 3300025942 Ga0207689_10923284 Ga0207689_109232842 153
673 3300025949 Ga0207667_10082654 Ga0207667_100826544 153
674 3300025960 Ga0207651_10001328 Ga0207651_100013287 153
675 3300025960 Ga0207651_10082842 Ga0207651_100828422 153
676 3300025960 Ga0207651_10084257 Ga0207651_100842572 153
677 3300025961 Ga0207712_10046922 Ga0207712_100469222 153
678 3300025961 Ga0207712_10048193 Ga0207712_100481932 153
679 3300025961 Ga0207712_10677516 Ga0207712_106775161 153
680 3300025961 Ga0207712_10967381 Ga0207712_109673811 153
681 3300025972 Ga0207668_10002243 Ga0207668_100022438 153
682 3300025972 Ga0207668_10005311 Ga0207668_100053112 153
683 3300025972 Ga0207668_10039464 Ga0207668_100394642 153
684 3300025972 Ga0207668_10249450 Ga0207668_102494502 153
685 3300025972 Ga0207668_10269851 Ga0207668_102698512 153
686 3300025972 Ga0207668_10510622 Ga0207668_105106222 153
687 3300025972 Ga0207668_10704872 Ga0207668_107048721 153
688 3300025972 Ga0207668_10946098 Ga0207668_109460982 153
689 3300025981 Ga0207640_10091347 Ga0207640_100913472 153
690 3300025981 Ga0207640_10653989 Ga0207640_106539892 153
691 3300025986 Ga0207658_10025142 Ga0207658_100251422 153
692 3300025986 Ga0207658_10085263 Ga0207658_100852632 153
693 3300025986 Ga0207658_10292302 Ga0207658_102923022 153
694 3300026023 Ga0207677_10004025 Ga0207677_100040259 153
695 3300026023 Ga0207677_10302789 Ga0207677_103027892 153
696 3300026035 Ga0207703_10000559 Ga0207703_1000055933 153
697 3300026035 Ga0207703_10113356 Ga0207703_101133563 153
698 3300026035 Ga0207703_10274500 Ga0207703_102745002 153
699 3300026035 Ga0207703_10528531 Ga0207703_105285312 153
700 3300026035 Ga0207703_10902855 Ga0207703_109028552 153
701 3300026041 Ga0207639_10562146 Ga0207639_105621462 153
702 3300026067 Ga0207678_10169856 Ga0207678_101698562 153
703 3300026067 Ga0207678_10196589 Ga0207678_101965892 153
704 3300026075 Ga0207708_10016731 Ga0207708_100167314 153
705 3300026075 Ga0207708_10410773 Ga0207708_104107731 153
706 3300026078 Ga0207702_10059945 Ga0207702_100599452 153
707 3300026088 Ga0207641_10002817 Ga0207641_100028174 153
708 3300026088 Ga0207641_10041229 Ga0207641_100412293 153
709 3300026088 Ga0207641_10096415 Ga0207641_100964155 153
710 3300026088 Ga0207641_10619328 Ga0207641_106193281 153
711 3300026089 Ga0207648_10000567 Ga0207648_1000056722 153
712 3300026089 Ga0207648_10001585 Ga0207648_1000158523 153
713 3300026089 Ga0207648_10041382 Ga0207648_100413822 153
714 3300026089 Ga0207648_10127349 Ga0207648_101273492 153
715 3300026089 Ga0207648_10131429 Ga0207648_101314292 153
716 3300026089 Ga0207648_10463927 Ga0207648_104639272 153
717 3300026089 Ga0207648_10491727 Ga0207648_104917272 153
718 3300026089 Ga0207648_10522246 Ga0207648_105222462 153
719 3300026089 Ga0207648_10846219 Ga0207648_108462192 153
720 3300026095 Ga0207676_10030901 Ga0207676_100309012 153
721 3300026095 Ga0207676_10032345 Ga0207676_100323454 153
722 3300026095 Ga0207676_10783926 Ga0207676_107839262 153
723 3300026095 Ga0207676_11605391 Ga0207676_116053911 153
724 3300026116 Ga0207674_10011703 Ga0207674_100117039 153
725 3300026118 Ga0207675_100001190 Ga0207675_1000011904 153
726 3300026118 Ga0207675_100516759 Ga0207675_1005167592 153
727 3300026121 Ga0207683_10002530 Ga0207683_100025304 153
728 3300026121 Ga0207683_10012744 Ga0207683_100127446 153
729 3300026121 Ga0207683_10029332 Ga0207683_100293323 153
730 3300026121 Ga0207683_10094688 Ga0207683_100946883 153
731 3300026121 Ga0207683_10666622 Ga0207683_106666221 153
732 3300026142 Ga0207698_10658978 Ga0207698_106589782 153
733 3300026142 Ga0207698_10868640 Ga0207698_108686401 153
734 3300026142 Ga0207698_11104496 Ga0207698_111044961 153
735 3300027665 Ga0209983_1021656 Ga0209983_10216563 153
736 3300027907 Ga0207428_10038590 Ga0207428_100385902 153
737 3300028379 Ga0268266_10401163 Ga0268266_104011632 153
738 3300028380 Ga0268265_10019253 Ga0268265_100192533 153
739 3300028380 Ga0268265_10029417 Ga0268265_100294173 153
740 3300028380 Ga0268265_10158364 Ga0268265_101583642 153
741 3300028380 Ga0268265_10178046 Ga0268265_101780462 153
742 3300028380 Ga0268265_10288412 Ga0268265_102884122 153
743 3300028380 Ga0268265_10363799 Ga0268265_103637992 153
744 3300028380 Ga0268265_10388754 Ga0268265_103887542 153
745 3300028380 Ga0268265_10606922 Ga0268265_106069222 153
746 3300028380 Ga0268265_11334259 Ga0268265_113342592 153
747 3300028381 Ga0268264_10027956 Ga0268264_100279562 153
748 3300028381 Ga0268264_10044768 Ga0268264_100447682 153
749 3300028381 Ga0268264_10053029 Ga0268264_100530293 153
750 3300028381 Ga0268264_10153041 Ga0268264_101530413 153
751 3300028381 Ga0268264_10536929 Ga0268264_105369292 153
752 3300028381 Ga0268264_10838326 Ga0268264_108383262 153
753 3300028381 Ga0268264_10851676 Ga0268264_108516762 153
754 3300031901 Ga0307406_10402359 Ga0307406_104023592 153
755 3300032126 Ga0307415_100674385 Ga0307415_1006743852 153
756 3300035090 Ga0373949_0012467 Ga0373949_0012467_431_943 153
757 3300035092 Ga0373952_0007186 Ga0373952_0007186_1056_1568 153
758 3300035117 Ga0373953_0001098 Ga0373953_0001098_4306_4824 153
759 3300035118 Ga0373954_0000886 Ga0373954_0000886_788_1300 153
760 3300035118 Ga0373954_0000956 Ga0373954_0000956_5638_6156 153
761 3300035119 Ga0373956_0006046 Ga0373956_0006046_2843_3361 153
762 3300035120 Ga0373957_0008637 Ga0373957_0008637_1469_1987 153
763 3300035172 Ga0373955_0002788 Ga0373955_0002788_3250_3768 153
764 3300035242 Ga0373962_0285849 Ga0373962_0285849_39_551 153
765 3300035410 Ga0373924_0050301 Ga0373924_0050301_945_1457 153
766 3300035410 Ga0373924_0106831 Ga0373924_0106831_48_560 153
767 3300035692 Ga0373935_0003235 Ga0373935_0003235_802_1320 153
768 3300035692 Ga0373935_0020689 Ga0373935_0020689_2689_3201 153
769 3300035695 Ga0373927_0012033 Ga0373927_0012033_1909_2421 153
770 3300035724 Ga0373933_0093901 Ga0373933_0093901_1302_1820 153
771 3300036401 Ga0373937_0001375 Ga0373937_0001375_7107_7619 153
772 3300036401 Ga0373937_0116295 Ga0373937_0116295_1401_1919 153
773 3300037068 Ga0373925_0630283 Ga0373925_0630283_77_589 153
774 3300041413 Ga0439465_0221533 Ga0439465_0221533_49_567 153
775 3300041507 Ga0451851_0505296 Ga0451851_0505296_42_560 153
776 3300045051 Ga0451576_0015516 Ga0451576_0015516_5396_5908 153
777 3300046454 Ga0495592_0009555 Ga0495592_0009555_176_694 153
778 3300046462 Ga0495651_0007383 Ga0495651_0007383_623_1141 153
779 3300046463 Ga0495653_0052750 Ga0495653_0052750_35_553 153
780 3300046472 Ga0495580_0011647 Ga0495580_0011647_2004_2522 153
781 3300046475 Ga0495639_0003438 Ga0495639_0003438_2211_2729 153
782 3300046476 Ga0495662_0001381 Ga0495662_0001381_8797_9315 153
783 3300046477 Ga0495664_0015525 Ga0495664_0015525_1809_2327 153
784 3300046511 Ga0495608_0037927 Ga0495608_0037927_2329_2847 153
785 3300046511 Ga0495608_0064356 Ga0495608_0064356_806_1318 153
786 3300046514 Ga0495618_0014540 Ga0495618_0014540_1085_1603 153
787 3300046516 Ga0495628_0056593 Ga0495628_0056593_367_885 153
788 3300046516 Ga0495628_0058060 Ga0495628_0058060_822_1340 153
789 3300046516 Ga0495628_0729333 Ga0495628_0729333_160_678 153
790 3300046517 Ga0495630_0002652 Ga0495630_0002652_8877_9395 153
791 3300046517 Ga0495630_0307648 Ga0495630_0307648_383_895 153
792 3300046517 Ga0495630_0990167 Ga0495630_0990167_53_571 153
793 3300046529 Ga0495652_0383264 Ga0495652_0383264_459_977 153
794 3300046533 Ga0495640_0015829 Ga0495640_0015829_2300_2818 153
795 3300046533 Ga0495640_0329208 Ga0495640_0329208_106_624 153
796 3300046535 Ga0495586_0008942 Ga0495586_0008942_1821_2339 153
797 3300046535 Ga0495586_0201354 Ga0495586_0201354_18_536 153
798 3300046536 Ga0495587_0015110 Ga0495587_0015110_2801_3319 153
799 3300046539 Ga0495621_0045695 Ga0495621_0045695_702_1214 153
800 3300046557 Ga0495622_0022353 Ga0495622_0022353_795_1313 153
801 3300046559 Ga0495667_0007991 Ga0495667_0007991_3665_4183 153
802 3300046559 Ga0495667_0035573 Ga0495667_0035573_2159_2677 153
803 3300046559 Ga0495667_0315589 Ga0495667_0315589_180_692 153
804 3300046642 Ga0495634_0011268 Ga0495634_0011268_3843_4361 153
805 3300046663 Ga0495635_0043674 Ga0495635_0043674_1171_1689 153
806 3300046663 Ga0495635_0061937 Ga0495635_0061937_306_818 153
807 3300046664 Ga0495659_0084195 Ga0495659_0084195_674_1186 153
808 3300046675 Ga0495657_0015483 Ga0495657_0015483_1941_2459 153
809 3300046675 Ga0495657_0241703 Ga0495657_0241703_265_777 153
810 3300046678 Ga0495599_0202113 Ga0495599_0202113_423_941 153
811 3300046680 Ga0495646_0201361 Ga0495646_0201361_184_702 153
812 3300046683 Ga0495658_0023245 Ga0495658_0023245_1469_1987 153
813 3300046684 Ga0495669_0056633 Ga0495669_0056633_437_949 153
814 3300046689 Ga0495613_0032286 Ga0495613_0032286_943_1461 153
815 3300046809 Ga0495600_0009870 Ga0495600_0009870_1726_2244 153
816 3300047317 Ga0495604_0064137 Ga0495604_0064137_981_1499 153
817 3300047317 Ga0495604_0130988 Ga0495604_0130988_168_680 153
818 3300047319 Ga0495674_0005704 Ga0495674_0005704_9676_10194 153
819 3300047322 Ga0495680_0010363 Ga0495680_0010363_3032_3550 153
820 3300047322 Ga0495680_0449377 Ga0495680_0449377_289_801 153
821 3300047444 Ga0495675_0005938 Ga0495675_0005938_1393_1911 153
822 3300047471 Ga0495684_0009504 Ga0495684_0009504_3993_4511 153
823 3300047471 Ga0495684_0070548 Ga0495684_0070548_766_1284 153
824 3300048088 Ga0495602_0092121 Ga0495602_0092121_813_1325 153
825 3300048088 Ga0495602_0513574 Ga0495602_0513574_45_563 153
826 3300048905 Ga0496102_1027255 Ga0496102_1027255_152_670 153
827 3300048910 Ga0496107_0002903 Ga0496107_0002903_9259_9771 153
828 3300048911 Ga0496108_0155781 Ga0496108_0155781_540_1052 153
829 3300048911 Ga0496108_0472082 Ga0496108_0472082_403_921 153
830 3300048912 Ga0496109_0416451 Ga0496109_0416451_181_693 153
831 3300049569 Ga0501032_0268499 Ga0501032_0268499_446_961 153
832 3300049570 Ga0501033_0641057 Ga0501033_0641057_72_590 153
833 3300049574 Ga0501038_0935625 Ga0501038_0935625_89_604 153
834 3300049576 Ga0501040_0832380 Ga0501040_0832380_32_550 153
835 3300049578 Ga0501042_0424900 Ga0501042_0424900_242_772 153
836 3300049579 Ga0501043_0223851 Ga0501043_0223851_349_867 153
837 3300049582 Ga0501048_0202091 Ga0501048_0202091_131_649 153
838 3300049585 Ga0501069_0707338 Ga0501069_0707338_13_531 153
839 3300049587 Ga0501071_0310810 Ga0501071_0310810_279_809 153
840 3300049591 Ga0501075_0060907 Ga0501075_0060907_418_936 153
841 3300049591 Ga0501075_0425735 Ga0501075_0425735_85_603 153
842 3300049592 Ga0501076_0483859 Ga0501076_0483859_488_1006 153
843 3300049592 Ga0501076_1260927 Ga0501076_1260927_54_572 153
844 3300049741 Ga0501079_0094111 Ga0501079_0094111_1760_2278 153
845 3300049741 Ga0501079_0207874 Ga0501079_0207874_714_1232 153
846 3300049741 Ga0501079_0348137 Ga0501079_0348137_17_538 153
847 3300049822 Ga0501035_0680057 Ga0501035_0680057_157_675 153
848 3300049824 Ga0501045_0108212 Ga0501045_0108212_464_982 153
849 3300049824 Ga0501045_0663500 Ga0501045_0663500_47_565 153
850 3300050493 nmdc:mga0k408_37390_c1 nmdc:mga0k408_37390_c1_1961_2479 153
851 3300050493 nmdc:mga0k408_502170_c1 nmdc:mga0k408_502170_c1_121_639 153
852 3300050507 nmdc:mga05p37_25768_c1 nmdc:mga05p37_25768_c1_367_885 153
853 3300050508 nmdc:mga09592_62720_c1 nmdc:mga09592_62720_c1_368_886 153
854 3300050509 nmdc:mga0qj67_868092_c1 nmdc:mga0qj67_868092_c1_97_615 153
855 3300050510 nmdc:mga06r32_151518_c1 nmdc:mga06r32_151518_c1_1474_1992 153
856 3300050510 nmdc:mga06r32_214393_c1 nmdc:mga06r32_214393_c1_95_613 153
857 3300050510 nmdc:mga06r32_516349_c1 nmdc:mga06r32_516349_c1_74_592 153
858 3300050511 nmdc:mga08y16_1245586_c1 nmdc:mga08y16_1245586_c1_173_691 153
859 3300050511 nmdc:mga08y16_569702_c1 nmdc:mga08y16_569702_c1_404_922 153
860 3300050511 nmdc:mga08y16_78002_c1 nmdc:mga08y16_78002_c1_209_727 153
861 3300050513 nmdc:mga0rr50_56391_c2 nmdc:mga0rr50_56391_c2_735_1247 153
862 3300050515 nmdc:mga0a205_150917_c1 nmdc:mga0a205_150917_c1_1173_1691 153
863 3300053077 Ga0495601_0000899 Ga0495601_0000899_10517_11035 153
864 3300053084 Ga0495595_0035127 Ga0495595_0035127_793_1311 153
865 3300053085 Ga0495619_0123830 Ga0495619_0123830_462_980 153
866 3300053139 Ga0500568_0046010 Ga0500568_0046010_918_1487 153
867 3300054114 Ga0501084_0155327 Ga0501084_0155327_678_1196 153
868 3300061734 Ga0530510_0001525 Ga0530510_0001525_14397_14915 153
869 3300061734 Ga0530510_0371460 Ga0530510_0371460_525_1064 153
870 3300061734 Ga0530510_0608776 Ga0530510_0608776_177_695 153
871 3300061734 Ga0530510_0659178 Ga0530510_0659178_90_608 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

45

175

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wa8-assembly1.cif.gz_A solution structure of the cfp-10.esat-6 complex. major virulence determinants of pathogenic mycobacteria 0.6285 7 82
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.5681 8 129
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.5281 10 130
5j45-assembly1.cif.gz_A crystal structure of shrub, fly ortholog of snf7/chmp4b 0.5129 11 115
1wa8-assembly1.cif.gz_A solution structure of the cfp-10.esat-6 complex. major virulence determinants of pathogenic mycobacteria 0.4961 7 82
ID Description Score Start End Superfamily
af_Q8WVZ1_108_232_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7479 5 67 3.30.40.10
1wa8A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.6285 7 82 1.10.287.1060
af_K7KCR4_136_214_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6067 6 80 1.20.120.350
af_Q2THW0_116_241_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5757 5 94 3.30.40.10
af_Q84YJ9_78_550_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.5687 18 65 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A528B4F3-F1-model_v4 TRAP transporter small permease protein 0.6407 2 136 GO:0005886
GO:0015740
GO:0022857
AF-A0A154BSK7-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.6393 4 136 GO:0005886
GO:0015740
GO:0022857
AF-A0A0F7PQV4-F1-model_v4 TRAP transporter small permease protein 0.6365 3 136 GO:0005886
GO:0015740
GO:0022857
AF-A0A845GZJ1-F1-model_v4 deleted 0.6348 6 136
AF-A0A0U2W9A8-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.6341 5 136 GO:0005886
GO:0015740
GO:0022857

Feature Viewer

pLDDT pTM Quality
71.52 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map