F484188
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 340 | 871 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300026095|Ga0207676_11605391|Ga0207676_116053911 |
| Length | 190 |
| Sequence | MRGRRPPLAVGAPRMESPINPFFRKAGAWLHRRAENVAAGLLAAMFIAFVLQIFFRYVFNFPIGWTSELTVITWLWLVLWGAAFVVKESDEIRFDLLYSAAGRRARVVVGIVAAVSIIALYAASLPATISYVSFMKVEKTAYLKIRFDHLFSIYVIFAVAIIVRYVWILWRLLRDRKAADDDPTSVSSGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 206 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 207 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 232 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 234 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 235 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 236 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 237 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 290 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 291 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 292 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 338 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.69 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 98.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10367499 | 3300005289 | Bacteria | 789 |
| 2 | Ga0065715_10962985 | 3300005293 | Bacteria | 556 |
| 3 | Ga0065707_10173185 | 3300005295 | Bacteria | 1467 |
| 4 | Ga0065707_10846835 | 3300005295 | Unclassified | 581 |
| 5 | Ga0070658_10017623 | 3300005327 | Bacteria | 5713 |
| 6 | Ga0070658_10105219 | 3300005327 | Bacteria | 2335 |
| 7 | Ga0070676_10001406 | 3300005328 | Bacteria | 12138 |
| 8 | Ga0070676_10014325 | 3300005328 | Bacteria | 4359 |
| 9 | Ga0070683_100003515 | 3300005329 | Bacteria | 12748 |
| 10 | Ga0070683_101543511 | 3300005329 | Bacteria | 638 |
| 11 | Ga0070690_100016568 | 3300005330 | Bacteria | 4418 |
| 12 | Ga0070690_100193928 | 3300005330 | Bacteria | 1410 |
| 13 | Ga0070670_100005195 | 3300005331 | Bacteria | 10960 |
| 14 | Ga0070670_100252819 | 3300005331 | Bacteria | 1535 |
| 15 | Ga0070677_10086386 | 3300005333 | Bacteria | 1355 |
| 16 | Ga0070677_10125758 | 3300005333 | Bacteria | 1164 |
| 17 | Ga0068869_100003269 | 3300005334 | Bacteria | 9895 |
| 18 | Ga0068869_100003339 | 3300005334 | Bacteria | 9801 |
| 19 | Ga0068869_100005842 | 3300005334 | Bacteria | 7767 |
| 20 | Ga0068869_100203016 | 3300005334 | Bacteria | 1564 |
| 21 | Ga0068869_100474259 | 3300005334 | Bacteria | 1041 |
| 22 | Ga0068869_101094994 | 3300005334 | Unclassified | 697 |
| 23 | Ga0070666_10001532 | 3300005335 | Bacteria | 14033 |
| 24 | Ga0070666_10027573 | 3300005335 | Bacteria | 3721 |
| 25 | Ga0070666_10286263 | 3300005335 | Bacteria | 1172 |
| 26 | Ga0070666_10489697 | 3300005335 | Bacteria | 891 |
| 27 | Ga0070680_100071170 | 3300005336 | Bacteria | 2857 |
| 28 | Ga0070680_100239501 | 3300005336 | Bacteria | 1533 |
| 29 | Ga0070680_100255550 | 3300005336 | Bacteria | 1482 |
| 30 | Ga0070682_100329616 | 3300005337 | Bacteria | 1131 |
| 31 | Ga0068868_100003224 | 3300005338 | Bacteria | 11348 |
| 32 | Ga0068868_100003921 | 3300005338 | Bacteria | 10393 |
| 33 | Ga0068868_100150123 | 3300005338 | Bacteria | 1918 |
| 34 | Ga0070660_100007313 | 3300005339 | Bacteria | 7695 |
| 35 | Ga0070660_100023611 | 3300005339 | Bacteria | 4557 |
| 36 | Ga0070660_100066979 | 3300005339 | Bacteria | 2797 |
| 37 | Ga0070660_100375605 | 3300005339 | Bacteria | 1173 |
| 38 | Ga0070660_100839845 | 3300005339 | Bacteria | 773 |
| 39 | Ga0070689_100030682 | 3300005340 | Bacteria | 4081 |
| 40 | Ga0070689_100499672 | 3300005340 | Bacteria | 1042 |
| 41 | Ga0070691_10041575 | 3300005341 | Bacteria | 2174 |
| 42 | Ga0070691_10228340 | 3300005341 | Bacteria | 989 |
| 43 | Ga0070687_100000139 | 3300005343 | Bacteria | 25149 |
| 44 | Ga0070661_100004250 | 3300005344 | Bacteria | 9878 |
| 45 | Ga0070661_100185500 | 3300005344 | Bacteria | 1584 |
| 46 | Ga0070692_10008048 | 3300005345 | Bacteria | 4679 |
| 47 | Ga0070692_10109928 | 3300005345 | Bacteria | 1523 |
| 48 | Ga0070668_100000553 | 3300005347 | Bacteria | 24984 |
| 49 | Ga0070668_100001829 | 3300005347 | Bacteria | 15477 |
| 50 | Ga0070668_100027620 | 3300005347 | Bacteria | 4308 |
| 51 | Ga0070668_100233465 | 3300005347 | Bacteria | 1521 |
| 52 | Ga0070668_100288544 | 3300005347 | Bacteria | 1373 |
| 53 | Ga0070668_100705899 | 3300005347 | Bacteria | 890 |
| 54 | Ga0070669_100011703 | 3300005353 | Bacteria | 6223 |
| 55 | Ga0070669_100113075 | 3300005353 | Bacteria | 2062 |
| 56 | Ga0070669_100450731 | 3300005353 | Bacteria | 1060 |
| 57 | Ga0070675_100012659 | 3300005354 | Bacteria | 6617 |
| 58 | Ga0070675_100107221 | 3300005354 | Bacteria | 2359 |
| 59 | Ga0070675_100281842 | 3300005354 | Bacteria | 1461 |
| 60 | Ga0070671_100012100 | 3300005355 | Bacteria | 6943 |
| 61 | Ga0070671_100123074 | 3300005355 | Bacteria | 2183 |
| 62 | Ga0070671_100259147 | 3300005355 | Bacteria | 1478 |
| 63 | Ga0070674_100148057 | 3300005356 | Bacteria | 1769 |
| 64 | Ga0070674_100160383 | 3300005356 | Bacteria | 1706 |
| 65 | Ga0070674_100286421 | 3300005356 | Bacteria | 1308 |
| 66 | Ga0070674_100421142 | 3300005356 | Bacteria | 1096 |
| 67 | Ga0070674_100865250 | 3300005356 | Bacteria | 785 |
| 68 | Ga0070673_100004291 | 3300005364 | Bacteria | 9001 |
| 69 | Ga0070673_100070921 | 3300005364 | Bacteria | 2798 |
| 70 | Ga0070673_100151764 | 3300005364 | Bacteria | 1963 |
| 71 | Ga0070673_100519856 | 3300005364 | Bacteria | 1078 |
| 72 | Ga0070673_100719390 | 3300005364 | Bacteria | 918 |
| 73 | Ga0070688_100066343 | 3300005365 | Bacteria | 2296 |
| 74 | Ga0070659_100012507 | 3300005366 | Bacteria | 6293 |
| 75 | Ga0070659_100129150 | 3300005366 | Bacteria | 2051 |
| 76 | Ga0070659_100444822 | 3300005366 | Bacteria | 1099 |
| 77 | Ga0070667_100009252 | 3300005367 | Bacteria | 8162 |
| 78 | Ga0070667_100026164 | 3300005367 | Bacteria | 4853 |
| 79 | Ga0070667_100282438 | 3300005367 | Bacteria | 1491 |
| 80 | Ga0070703_10004181 | 3300005406 | Bacteria | 4065 |
| 81 | Ga0070714_100018613 | 3300005435 | Bacteria | 5645 |
| 82 | Ga0070713_100049434 | 3300005436 | Bacteria | 3469 |
| 83 | Ga0070710_10251153 | 3300005437 | Bacteria | 1137 |
| 84 | Ga0070710_10279780 | 3300005437 | Bacteria | 1082 |
| 85 | Ga0070701_10138222 | 3300005438 | Bacteria | 1390 |
| 86 | Ga0070705_100087187 | 3300005440 | Bacteria | 1934 |
| 87 | Ga0070705_100211272 | 3300005440 | Bacteria | 1338 |
| 88 | Ga0070700_100000374 | 3300005441 | Bacteria | 22955 |
| 89 | Ga0070700_100885364 | 3300005441 | Bacteria | 726 |
| 90 | Ga0070700_101025582 | 3300005441 | Unclassified | 680 |
| 91 | Ga0070694_100001221 | 3300005444 | Bacteria | 14849 |
| 92 | Ga0070694_100083162 | 3300005444 | Bacteria | 2230 |
| 93 | Ga0070694_100092518 | 3300005444 | Bacteria | 2124 |
| 94 | Ga0070694_100114246 | 3300005444 | Bacteria | 1928 |
| 95 | Ga0070694_100381309 | 3300005444 | Bacteria | 1100 |
| 96 | Ga0070694_100616602 | 3300005444 | Bacteria | 875 |
| 97 | Ga0070663_100349509 | 3300005455 | Bacteria | 1197 |
| 98 | Ga0070663_100523116 | 3300005455 | Bacteria | 988 |
| 99 | Ga0070678_100014335 | 3300005456 | Bacteria | 4998 |
| 100 | Ga0070678_100175237 | 3300005456 | Bacteria | 1750 |
| 101 | Ga0070678_100649930 | 3300005456 | Bacteria | 946 |
| 102 | Ga0070678_100955075 | 3300005456 | Bacteria | 786 |
| 103 | Ga0070678_101215715 | 3300005456 | Unclassified | 699 |
| 104 | Ga0070662_100000736 | 3300005457 | Bacteria | 20017 |
| 105 | Ga0070662_100136103 | 3300005457 | Bacteria | 1899 |
| 106 | Ga0070662_100799200 | 3300005457 | Bacteria | 802 |
| 107 | Ga0070681_10000525 | 3300005458 | Bacteria | 31394 |
| 108 | Ga0070681_10106763 | 3300005458 | Bacteria | 2742 |
| 109 | Ga0070681_10135653 | 3300005458 | Bacteria | 2392 |
| 110 | Ga0070681_10170304 | 3300005458 | Bacteria | 2099 |
| 111 | Ga0068867_100002804 | 3300005459 | Bacteria | 12256 |
| 112 | Ga0068867_100026483 | 3300005459 | Bacteria | 4164 |
| 113 | Ga0068867_100108575 | 3300005459 | Bacteria | 2128 |
| 114 | Ga0068867_100176558 | 3300005459 | Bacteria | 1695 |
| 115 | Ga0068867_100217565 | 3300005459 | Bacteria | 1537 |
| 116 | Ga0068867_100752900 | 3300005459 | Bacteria | 865 |
| 117 | Ga0068867_101023212 | 3300005459 | Bacteria | 750 |
| 118 | Ga0068867_101229621 | 3300005459 | Bacteria | 689 |
| 119 | Ga0070685_10297270 | 3300005466 | Bacteria | 1087 |
| 120 | Ga0070685_10511738 | 3300005466 | Bacteria | 851 |
| 121 | Ga0070706_100429719 | 3300005467 | Bacteria | 1229 |
| 122 | Ga0070707_100089839 | 3300005468 | Bacteria | 2973 |
| 123 | Ga0070707_101442371 | 3300005468 | Bacteria | 655 |
| 124 | Ga0070698_100992188 | 3300005471 | Bacteria | 787 |
| 125 | Ga0070698_101465006 | 3300005471 | Unclassified | 634 |
| 126 | Ga0070699_100457184 | 3300005518 | Bacteria | 1158 |
| 127 | Ga0070679_100025788 | 3300005530 | Bacteria | 5769 |
| 128 | Ga0070679_100026536 | 3300005530 | Bacteria | 5693 |
| 129 | Ga0070679_100125504 | 3300005530 | Bacteria | 2549 |
| 130 | Ga0070679_101530350 | 3300005530 | Bacteria | 614 |
| 131 | Ga0070684_100192719 | 3300005535 | Bacteria | 1855 |
| 132 | Ga0070684_100208130 | 3300005535 | Bacteria | 1783 |
| 133 | Ga0068853_100001643 | 3300005539 | Bacteria | 16346 |
| 134 | Ga0068853_100008824 | 3300005539 | Bacteria | 8110 |
| 135 | Ga0068853_100140234 | 3300005539 | Bacteria | 2170 |
| 136 | Ga0070672_100004288 | 3300005543 | Bacteria | 9324 |
| 137 | Ga0070672_100055056 | 3300005543 | Bacteria | 3115 |
| 138 | Ga0070672_100094372 | 3300005543 | Bacteria | 2418 |
| 139 | Ga0070686_100017659 | 3300005544 | Bacteria | 4172 |
| 140 | Ga0070686_100027666 | 3300005544 | Bacteria | 3433 |
| 141 | Ga0070695_100011120 | 3300005545 | Bacteria | 5379 |
| 142 | Ga0070695_100095000 | 3300005545 | Bacteria | 1997 |
| 143 | Ga0070695_100138917 | 3300005545 | Bacteria | 1682 |
| 144 | Ga0070695_100592935 | 3300005545 | Bacteria | 869 |
| 145 | Ga0070695_100607065 | 3300005545 | Bacteria | 859 |
| 146 | Ga0070696_100009847 | 3300005546 | Bacteria | 6393 |
| 147 | Ga0070696_100022409 | 3300005546 | Bacteria | 4290 |
| 148 | Ga0070696_100242345 | 3300005546 | Bacteria | 1360 |
| 149 | Ga0070696_100413428 | 3300005546 | Bacteria | 1058 |
| 150 | Ga0070696_100463781 | 3300005546 | Bacteria | 1002 |
| 151 | Ga0070696_101146917 | 3300005546 | Bacteria | 655 |
| 152 | Ga0070693_100653133 | 3300005547 | Bacteria | 765 |
| 153 | Ga0070665_100013156 | 3300005548 | Bacteria | 8334 |
| 154 | Ga0070665_101117197 | 3300005548 | Bacteria | 800 |
| 155 | Ga0070704_100006411 | 3300005549 | Bacteria | 6936 |
| 156 | Ga0070704_100007749 | 3300005549 | Bacteria | 6401 |
| 157 | Ga0070704_100008762 | 3300005549 | Bacteria | 6085 |
| 158 | Ga0070704_100012920 | 3300005549 | Bacteria | 5166 |
| 159 | Ga0070704_100019651 | 3300005549 | Bacteria | 4344 |
| 160 | Ga0070704_100056487 | 3300005549 | Bacteria | 2787 |
| 161 | Ga0070704_100134095 | 3300005549 | Bacteria | 1924 |
| 162 | Ga0068855_100005356 | 3300005563 | Bacteria | 15649 |
| 163 | Ga0068855_100011048 | 3300005563 | Bacteria | 10893 |
| 164 | Ga0068855_100111489 | 3300005563 | Bacteria | 3140 |
| 165 | Ga0068855_100483866 | 3300005563 | Bacteria | 1347 |
| 166 | Ga0068855_100709777 | 3300005563 | Bacteria | 1075 |
| 167 | Ga0070664_100000563 | 3300005564 | Bacteria | 28381 |
| 168 | Ga0070664_100484371 | 3300005564 | Bacteria | 1139 |
| 169 | Ga0070664_100727218 | 3300005564 | Bacteria | 926 |
| 170 | Ga0070664_100844740 | 3300005564 | Bacteria | 857 |
| 171 | Ga0068857_100227016 | 3300005577 | Bacteria | 1707 |
| 172 | Ga0068857_100391635 | 3300005577 | Bacteria | 1292 |
| 173 | Ga0068857_101006881 | 3300005577 | Bacteria | 802 |
| 174 | Ga0068854_100048676 | 3300005578 | Bacteria | 3025 |
| 175 | Ga0068854_100640277 | 3300005578 | Bacteria | 912 |
| 176 | Ga0068856_100000246 | 3300005614 | Bacteria | 59117 |
| 177 | Ga0068856_100004757 | 3300005614 | Bacteria | 13477 |
| 178 | Ga0068856_100065408 | 3300005614 | Bacteria | 3594 |
| 179 | Ga0070702_100007791 | 3300005615 | Bacteria | 5149 |
| 180 | Ga0070702_100334784 | 3300005615 | Bacteria | 1060 |
| 181 | Ga0068852_100002071 | 3300005616 | Bacteria | 13700 |
| 182 | Ga0068852_100915872 | 3300005616 | Bacteria | 894 |
| 183 | Ga0068859_100019223 | 3300005617 | Bacteria | 6863 |
| 184 | Ga0068859_100051616 | 3300005617 | Bacteria | 4134 |
| 185 | Ga0068859_100106540 | 3300005617 | Bacteria | 2862 |
| 186 | Ga0068859_100320738 | 3300005617 | Bacteria | 1643 |
| 187 | Ga0068859_100369576 | 3300005617 | Bacteria | 1530 |
| 188 | Ga0068859_100420040 | 3300005617 | Bacteria | 1434 |
| 189 | Ga0068864_100010798 | 3300005618 | Bacteria | 7548 |
| 190 | Ga0068864_100014467 | 3300005618 | Bacteria | 6554 |
| 191 | Ga0068864_100056893 | 3300005618 | Bacteria | 3378 |
| 192 | Ga0068864_100356244 | 3300005618 | Bacteria | 1382 |
| 193 | Ga0068866_10001678 | 3300005718 | Bacteria | 9328 |
| 194 | Ga0068866_10091197 | 3300005718 | Bacteria | 1660 |
| 195 | Ga0068861_100081661 | 3300005719 | Bacteria | 2531 |
| 196 | Ga0068861_100504920 | 3300005719 | Bacteria | 1094 |
| 197 | Ga0068861_100678397 | 3300005719 | Bacteria | 955 |
| 198 | Ga0068870_10030932 | 3300005840 | Bacteria | 2709 |
| 199 | Ga0068870_10040091 | 3300005840 | Bacteria | 2426 |
| 200 | Ga0068863_100002779 | 3300005841 | Bacteria | 17339 |
| 201 | Ga0068863_100029642 | 3300005841 | Bacteria | 5223 |
| 202 | Ga0068863_100095134 | 3300005841 | Bacteria | 2827 |
| 203 | Ga0068863_100104413 | 3300005841 | Bacteria | 2695 |
| 204 | Ga0068863_100489886 | 3300005841 | Bacteria | 1210 |
| 205 | Ga0068863_100681989 | 3300005841 | Bacteria | 1020 |
| 206 | Ga0068863_101153982 | 3300005841 | Bacteria | 780 |
| 207 | Ga0068858_100006644 | 3300005842 | Bacteria | 11248 |
| 208 | Ga0068858_100022411 | 3300005842 | Bacteria | 5895 |
| 209 | Ga0068858_100140876 | 3300005842 | Bacteria | 2264 |
| 210 | Ga0068858_100189487 | 3300005842 | Bacteria | 1943 |
| 211 | Ga0068858_100541516 | 3300005842 | Bacteria | 1127 |
| 212 | Ga0068860_100016867 | 3300005843 | Bacteria | 7119 |
| 213 | Ga0068860_100017448 | 3300005843 | Bacteria | 6994 |
| 214 | Ga0068860_100205548 | 3300005843 | Bacteria | 1909 |
| 215 | Ga0068860_100492758 | 3300005843 | Bacteria | 1223 |
| 216 | Ga0068860_100576602 | 3300005843 | Bacteria | 1129 |
| 217 | Ga0068860_100750371 | 3300005843 | Bacteria | 988 |
| 218 | Ga0068860_100992042 | 3300005843 | Bacteria | 857 |
| 219 | Ga0068862_100018766 | 3300005844 | Bacteria | 5763 |
| 220 | Ga0068862_100128722 | 3300005844 | Bacteria | 2238 |
| 221 | Ga0068862_100128972 | 3300005844 | Bacteria | 2235 |
| 222 | Ga0068862_100173270 | 3300005844 | Bacteria | 1933 |
| 223 | Ga0068862_100196411 | 3300005844 | Bacteria | 1818 |
| 224 | Ga0068862_100209317 | 3300005844 | Bacteria | 1762 |
| 225 | Ga0068862_100271661 | 3300005844 | Bacteria | 1551 |
| 226 | Ga0068862_100399367 | 3300005844 | Bacteria | 1286 |
| 227 | Ga0068862_100406277 | 3300005844 | Bacteria | 1275 |
| 228 | Ga0068862_100744777 | 3300005844 | Bacteria | 953 |
| 229 | Ga0068862_100961204 | 3300005844 | Bacteria | 843 |
| 230 | Ga0068862_101279875 | 3300005844 | Bacteria | 734 |
| 231 | Ga0068862_101404517 | 3300005844 | Bacteria | 701 |
| 232 | Ga0075366_10016409 | 3300006195 | Bacteria | 4256 |
| 233 | Ga0097621_100004433 | 3300006237 | Bacteria | 9772 |
| 234 | Ga0097621_100014655 | 3300006237 | Bacteria | 5874 |
| 235 | Ga0097621_100028572 | 3300006237 | Bacteria | 4396 |
| 236 | Ga0097621_100059139 | 3300006237 | Bacteria | 3136 |
| 237 | Ga0068871_100001217 | 3300006358 | Bacteria | 17173 |
| 238 | Ga0068871_100001947 | 3300006358 | Bacteria | 13973 |
| 239 | Ga0068871_100009329 | 3300006358 | Bacteria | 7103 |
| 240 | Ga0068871_100024471 | 3300006358 | Bacteria | 4684 |
| 241 | Ga0068871_100363427 | 3300006358 | Bacteria | 1282 |
| 242 | Ga0068871_100462541 | 3300006358 | Bacteria | 1139 |
| 243 | Ga0068871_101012900 | 3300006358 | Bacteria | 774 |
| 244 | Ga0075428_100004924 | 3300006844 | Bacteria | 14832 |
| 245 | Ga0075428_100032310 | 3300006844 | Bacteria | 5780 |
| 246 | Ga0075428_100212084 | 3300006844 | Bacteria | 2093 |
| 247 | Ga0075428_100252508 | 3300006844 | Bacteria | 1900 |
| 248 | Ga0075428_101471643 | 3300006844 | Unclassified | 714 |
| 249 | Ga0075430_100008955 | 3300006846 | Bacteria | 8454 |
| 250 | Ga0075431_100028736 | 3300006847 | Bacteria | 5717 |
| 251 | Ga0075431_100035634 | 3300006847 | Bacteria | 5123 |
| 252 | Ga0075431_100368984 | 3300006847 | Bacteria | 1441 |
| 253 | Ga0075431_100757129 | 3300006847 | Bacteria | 946 |
| 254 | Ga0075433_10110592 | 3300006852 | Bacteria | 2438 |
| 255 | Ga0075433_10168533 | 3300006852 | Bacteria | 1949 |
| 256 | Ga0075433_10737483 | 3300006852 | Bacteria | 862 |
| 257 | Ga0075433_11011523 | 3300006852 | Bacteria | 724 |
| 258 | Ga0075429_100048791 | 3300006880 | Bacteria | 3681 |
| 259 | Ga0075429_100729213 | 3300006880 | Bacteria | 868 |
| 260 | Ga0068865_100006340 | 3300006881 | Bacteria | 7208 |
| 261 | Ga0068865_100103934 | 3300006881 | Bacteria | 2084 |
| 262 | Ga0068865_100321595 | 3300006881 | Bacteria | 1245 |
| 263 | Ga0068865_101172241 | 3300006881 | Bacteria | 679 |
| 264 | Ga0097620_100019223 | 3300006931 | Bacteria | 6863 |
| 265 | Ga0097620_100051611 | 3300006931 | Bacteria | 4134 |
| 266 | Ga0097620_100106540 | 3300006931 | Bacteria | 2862 |
| 267 | Ga0097620_100320732 | 3300006931 | Bacteria | 1643 |
| 268 | Ga0097620_100369575 | 3300006931 | Bacteria | 1530 |
| 269 | Ga0097620_100420020 | 3300006931 | Bacteria | 1434 |
| 270 | Ga0075435_100006615 | 3300007076 | Bacteria | 8208 |
| 271 | Ga0075435_100295086 | 3300007076 | Bacteria | 1386 |
| 272 | Ga0099794_10130495 | 3300007265 | Bacteria | 1269 |
| 273 | Ga0099795_10021429 | 3300007788 | Bacteria | 2120 |
| 274 | Ga0105240_10001484 | 3300009093 | Bacteria | 39913 |
| 275 | Ga0111539_10190681 | 3300009094 | Bacteria | 2392 |
| 276 | Ga0111539_10546683 | 3300009094 | Bacteria | 1349 |
| 277 | Ga0111539_10567725 | 3300009094 | Bacteria | 1321 |
| 278 | Ga0111539_10578456 | 3300009094 | Bacteria | 1308 |
| 279 | Ga0105245_10007955 | 3300009098 | Bacteria | 9273 |
| 280 | Ga0105245_10140491 | 3300009098 | Bacteria | 2274 |
| 281 | Ga0105245_10321831 | 3300009098 | Bacteria | 1524 |
| 282 | Ga0105245_10473920 | 3300009098 | Bacteria | 1264 |
| 283 | Ga0105247_10038720 | 3300009101 | Bacteria | 2912 |
| 284 | Ga0114129_10059617 | 3300009147 | Bacteria | 5336 |
| 285 | Ga0105243_10038478 | 3300009148 | Bacteria | 3725 |
| 286 | Ga0105243_10093097 | 3300009148 | Bacteria | 2487 |
| 287 | Ga0105243_10144052 | 3300009148 | Bacteria | 2036 |
| 288 | Ga0105243_10313230 | 3300009148 | Bacteria | 1427 |
| 289 | Ga0105243_10331948 | 3300009148 | Bacteria | 1389 |
| 290 | Ga0105243_10376513 | 3300009148 | Bacteria | 1311 |
| 291 | Ga0105241_10067205 | 3300009174 | Bacteria | 2774 |
| 292 | Ga0105242_10364006 | 3300009176 | Bacteria | 1339 |
| 293 | Ga0105242_10871161 | 3300009176 | Unclassified | 898 |
| 294 | Ga0105242_12110272 | 3300009176 | Archaea | 607 |
| 295 | Ga0105248_10008149 | 3300009177 | Bacteria | 11507 |
| 296 | Ga0105248_10014298 | 3300009177 | Bacteria | 8737 |
| 297 | Ga0105248_10195035 | 3300009177 | Bacteria | 2282 |
| 298 | Ga0105248_10301555 | 3300009177 | Bacteria | 1804 |
| 299 | Ga0105248_10416896 | 3300009177 | Bacteria | 1512 |
| 300 | Ga0105248_10919275 | 3300009177 | Bacteria | 988 |
| 301 | Ga0105248_11215947 | 3300009177 | Bacteria | 852 |
| 302 | Ga0105248_11682742 | 3300009177 | Bacteria | 719 |
| 303 | Ga0105237_10265184 | 3300009545 | Bacteria | 1720 |
| 304 | Ga0105238_10007836 | 3300009551 | Bacteria | 10680 |
| 305 | Ga0105238_10069042 | 3300009551 | Bacteria | 3534 |
| 306 | Ga0105249_10010159 | 3300009553 | Bacteria | 8264 |
| 307 | Ga0105249_10056270 | 3300009553 | Bacteria | 3601 |
| 308 | Ga0105249_10941885 | 3300009553 | Bacteria | 931 |
| 309 | Ga0105249_10983254 | 3300009553 | Bacteria | 912 |
| 310 | Ga0105239_10090003 | 3300010375 | Bacteria | 3385 |
| 311 | Ga0105246_10930533 | 3300011119 | Bacteria | 782 |
| 312 | Ga0157373_10001898 | 3300013100 | Bacteria | 15867 |
| 313 | Ga0157373_10030058 | 3300013100 | Bacteria | 3910 |
| 314 | Ga0157371_10110570 | 3300013102 | Bacteria | 1950 |
| 315 | Ga0157371_10459264 | 3300013102 | Bacteria | 937 |
| 316 | Ga0157370_10040718 | 3300013104 | Bacteria | 4485 |
| 317 | Ga0157369_10005068 | 3300013105 | Bacteria | 15414 |
| 318 | Ga0157369_11627961 | 3300013105 | Bacteria | 656 |
| 319 | Ga0157374_10229316 | 3300013296 | Bacteria | 1824 |
| 320 | Ga0157374_10272697 | 3300013296 | Bacteria | 1668 |
| 321 | Ga0157378_10149000 | 3300013297 | Bacteria | 2179 |
| 322 | Ga0157378_11445407 | 3300013297 | Bacteria | 731 |
| 323 | Ga0163162_10007370 | 3300013306 | Bacteria | 10696 |
| 324 | Ga0163162_10187695 | 3300013306 | Bacteria | 2194 |
| 325 | Ga0163162_10357833 | 3300013306 | Bacteria | 1593 |
| 326 | Ga0163162_10398791 | 3300013306 | Bacteria | 1508 |
| 327 | Ga0163162_10559869 | 3300013306 | Bacteria | 1271 |
| 328 | Ga0163162_11187131 | 3300013306 | Bacteria | 866 |
| 329 | Ga0163162_11750397 | 3300013306 | Unclassified | 710 |
| 330 | Ga0157372_10005517 | 3300013307 | Bacteria | 13448 |
| 331 | Ga0157372_10039943 | 3300013307 | Bacteria | 5181 |
| 332 | Ga0157372_10158219 | 3300013307 | Bacteria | 2617 |
| 333 | Ga0157375_10005693 | 3300013308 | Bacteria | 10846 |
| 334 | Ga0157375_10040255 | 3300013308 | Bacteria | 4504 |
| 335 | Ga0157375_10042034 | 3300013308 | Bacteria | 4420 |
| 336 | Ga0157375_10209989 | 3300013308 | Bacteria | 2104 |
| 337 | Ga0157375_10453703 | 3300013308 | Bacteria | 1448 |
| 338 | Ga0157375_11281319 | 3300013308 | Bacteria | 861 |
| 339 | Ga0157375_12204822 | 3300013308 | Bacteria | 656 |
| 340 | Ga0163163_10006010 | 3300014325 | Bacteria | 10561 |
| 341 | Ga0163163_10292229 | 3300014325 | Bacteria | 1682 |
| 342 | Ga0163163_12080633 | 3300014325 | Unclassified | 627 |
| 343 | Ga0157380_10000875 | 3300014326 | Bacteria | 18931 |
| 344 | Ga0157380_10045305 | 3300014326 | Bacteria | 3451 |
| 345 | Ga0157380_10112646 | 3300014326 | Bacteria | 2289 |
| 346 | Ga0157380_10346758 | 3300014326 | Bacteria | 1388 |
| 347 | Ga0157380_10454974 | 3300014326 | Bacteria | 1230 |
| 348 | Ga0157380_10614254 | 3300014326 | Bacteria | 1078 |
| 349 | Ga0157380_10670353 | 3300014326 | Bacteria | 1037 |
| 350 | Ga0157380_11050165 | 3300014326 | Bacteria | 851 |
| 351 | Ga0157380_11153498 | 3300014326 | Bacteria | 816 |
| 352 | Ga0157377_10232025 | 3300014745 | Bacteria | 1187 |
| 353 | Ga0157379_10007045 | 3300014968 | Bacteria | 9716 |
| 354 | Ga0157379_10040735 | 3300014968 | Bacteria | 4146 |
| 355 | Ga0157379_10081604 | 3300014968 | Bacteria | 2897 |
| 356 | Ga0157379_11321797 | 3300014968 | Bacteria | 697 |
| 357 | Ga0157379_11610099 | 3300014968 | Unclassified | 634 |
| 358 | Ga0157376_10036486 | 3300014969 | Bacteria | 3983 |
| 359 | Ga0157376_10353660 | 3300014969 | Bacteria | 1407 |
| 360 | Ga0163161_10011147 | 3300017792 | Bacteria | 6229 |
| 361 | Ga0163161_10024325 | 3300017792 | Bacteria | 4278 |
| 362 | Ga0163161_11007443 | 3300017792 | Bacteria | 711 |
| 363 | Ga0207666_1008853 | 3300025271 | Bacteria | 1351 |
| 364 | Ga0209676_1000214 | 3300025292 | Bacteria | 127818 |
| 365 | Ga0207697_10005571 | 3300025315 | Bacteria | 5833 |
| 366 | Ga0207697_10030825 | 3300025315 | Bacteria | 2194 |
| 367 | Ga0207656_10082476 | 3300025321 | Bacteria | 1447 |
| 368 | Ga0207656_10145377 | 3300025321 | Bacteria | 1120 |
| 369 | Ga0207653_10005279 | 3300025885 | Bacteria | 4038 |
| 370 | Ga0207692_10416819 | 3300025898 | Unclassified | 840 |
| 371 | Ga0207642_10014088 | 3300025899 | Bacteria | 2939 |
| 372 | Ga0207642_10110526 | 3300025899 | Bacteria | 1398 |
| 373 | Ga0207642_10741368 | 3300025899 | Unclassified | 621 |
| 374 | Ga0207688_10095870 | 3300025901 | Bacteria | 1708 |
| 375 | Ga0207680_10002705 | 3300025903 | Bacteria | 8289 |
| 376 | Ga0207680_10023216 | 3300025903 | Bacteria | 3384 |
| 377 | Ga0207680_10128858 | 3300025903 | Bacteria | 1665 |
| 378 | Ga0207680_10445824 | 3300025903 | Bacteria | 918 |
| 379 | Ga0207645_10001263 | 3300025907 | Bacteria | 20825 |
| 380 | Ga0207645_10021346 | 3300025907 | Bacteria | 4223 |
| 381 | Ga0207645_10073047 | 3300025907 | Bacteria | 2196 |
| 382 | Ga0207643_10013531 | 3300025908 | Bacteria | 4420 |
| 383 | Ga0207643_10097822 | 3300025908 | Bacteria | 1718 |
| 384 | Ga0207643_10161403 | 3300025908 | Bacteria | 1349 |
| 385 | Ga0207643_10380375 | 3300025908 | Bacteria | 890 |
| 386 | Ga0207705_10147254 | 3300025909 | Bacteria | 1762 |
| 387 | Ga0207705_10690870 | 3300025909 | Bacteria | 793 |
| 388 | Ga0207684_10663315 | 3300025910 | Bacteria | 888 |
| 389 | Ga0207707_10008578 | 3300025912 | Bacteria | 8861 |
| 390 | Ga0207707_10088630 | 3300025912 | Bacteria | 2703 |
| 391 | Ga0207695_10780053 | 3300025913 | Bacteria | 836 |
| 392 | Ga0207671_10236949 | 3300025914 | Bacteria | 1433 |
| 393 | Ga0207660_10172861 | 3300025917 | Bacteria | 1673 |
| 394 | Ga0207660_10173780 | 3300025917 | Bacteria | 1669 |
| 395 | Ga0207660_10207380 | 3300025917 | Bacteria | 1533 |
| 396 | Ga0207660_10419970 | 3300025917 | Bacteria | 1079 |
| 397 | Ga0207662_10000214 | 3300025918 | Bacteria | 26908 |
| 398 | Ga0207657_10000260 | 3300025919 | Bacteria | 56097 |
| 399 | Ga0207657_10340185 | 3300025919 | Bacteria | 1184 |
| 400 | Ga0207652_10051030 | 3300025921 | Bacteria | 3545 |
| 401 | Ga0207652_10256557 | 3300025921 | Bacteria | 1577 |
| 402 | Ga0207652_10700038 | 3300025921 | Bacteria | 904 |
| 403 | Ga0207652_10752233 | 3300025921 | Bacteria | 867 |
| 404 | Ga0207646_10103769 | 3300025922 | Bacteria | 2550 |
| 405 | Ga0207646_10984727 | 3300025922 | Bacteria | 746 |
| 406 | Ga0207646_11055183 | 3300025922 | Bacteria | 716 |
| 407 | Ga0207681_10024887 | 3300025923 | Bacteria | 3845 |
| 408 | Ga0207681_10053714 | 3300025923 | Bacteria | 2736 |
| 409 | Ga0207681_10064043 | 3300025923 | Bacteria | 2537 |
| 410 | Ga0207681_10293896 | 3300025923 | Bacteria | 1283 |
| 411 | Ga0207694_10001424 | 3300025924 | Bacteria | 20507 |
| 412 | Ga0207694_10223716 | 3300025924 | Bacteria | 1536 |
| 413 | Ga0207650_10017437 | 3300025925 | Bacteria | 5029 |
| 414 | Ga0207650_10054766 | 3300025925 | Bacteria | 2960 |
| 415 | Ga0207650_10075623 | 3300025925 | Bacteria | 2542 |
| 416 | Ga0207650_10081064 | 3300025925 | Bacteria | 2461 |
| 417 | Ga0207650_10102176 | 3300025925 | Bacteria | 2208 |
| 418 | Ga0207659_10001564 | 3300025926 | Bacteria | 13583 |
| 419 | Ga0207659_10022668 | 3300025926 | Bacteria | 4183 |
| 420 | Ga0207659_10024536 | 3300025926 | Bacteria | 4041 |
| 421 | Ga0207659_10077692 | 3300025926 | Bacteria | 2444 |
| 422 | Ga0207687_10045463 | 3300025927 | Bacteria | 3035 |
| 423 | Ga0207664_10023189 | 3300025929 | Bacteria | 4647 |
| 424 | Ga0207644_10017212 | 3300025931 | Bacteria | 4876 |
| 425 | Ga0207644_10116540 | 3300025931 | Bacteria | 2027 |
| 426 | Ga0207644_10156898 | 3300025931 | Bacteria | 1766 |
| 427 | Ga0207644_10213775 | 3300025931 | Bacteria | 1526 |
| 428 | Ga0207644_10221443 | 3300025931 | Bacteria | 1500 |
| 429 | Ga0207690_10010711 | 3300025932 | Bacteria | 5464 |
| 430 | Ga0207690_10028695 | 3300025932 | Bacteria | 3529 |
| 431 | Ga0207690_10871979 | 3300025932 | Unclassified | 746 |
| 432 | Ga0207706_10000190 | 3300025933 | Bacteria | 68803 |
| 433 | Ga0207706_10050841 | 3300025933 | Bacteria | 3662 |
| 434 | Ga0207686_10019943 | 3300025934 | Bacteria | 3823 |
| 435 | Ga0207686_10627266 | 3300025934 | Bacteria | 848 |
| 436 | Ga0207709_10195171 | 3300025935 | Bacteria | 1441 |
| 437 | Ga0207709_10221923 | 3300025935 | Bacteria | 1364 |
| 438 | Ga0207709_10249410 | 3300025935 | Bacteria | 1296 |
| 439 | Ga0207670_10111012 | 3300025936 | Bacteria | 1976 |
| 440 | Ga0207670_10342261 | 3300025936 | Bacteria | 1182 |
| 441 | Ga0207669_10010050 | 3300025937 | Bacteria | 4540 |
| 442 | Ga0207669_10216047 | 3300025937 | Bacteria | 1403 |
| 443 | Ga0207669_10231575 | 3300025937 | Bacteria | 1363 |
| 444 | Ga0207669_11073840 | 3300025937 | Unclassified | 679 |
| 445 | Ga0207704_10047553 | 3300025938 | Bacteria | 2565 |
| 446 | Ga0207704_10838160 | 3300025938 | Unclassified | 770 |
| 447 | Ga0207665_10086177 | 3300025939 | Bacteria | 2169 |
| 448 | Ga0207691_10000486 | 3300025940 | Bacteria | 39361 |
| 449 | Ga0207691_10007762 | 3300025940 | Bacteria | 10333 |
| 450 | Ga0207691_10042870 | 3300025940 | Bacteria | 4171 |
| 451 | Ga0207691_10045827 | 3300025940 | Bacteria | 4019 |
| 452 | Ga0207691_10052318 | 3300025940 | Bacteria | 3730 |
| 453 | Ga0207691_10296198 | 3300025940 | Bacteria | 1391 |
| 454 | Ga0207691_10522238 | 3300025940 | Bacteria | 1007 |
| 455 | Ga0207711_10003467 | 3300025941 | Bacteria | 13656 |
| 456 | Ga0207711_10186931 | 3300025941 | Bacteria | 1886 |
| 457 | Ga0207711_10345933 | 3300025941 | Bacteria | 1376 |
| 458 | Ga0207711_10604398 | 3300025941 | Bacteria | 1023 |
| 459 | Ga0207711_10626640 | 3300025941 | Bacteria | 1003 |
| 460 | Ga0207689_10001553 | 3300025942 | Bacteria | 21776 |
| 461 | Ga0207689_10011895 | 3300025942 | Bacteria | 7456 |
| 462 | Ga0207689_10014359 | 3300025942 | Bacteria | 6737 |
| 463 | Ga0207689_10224033 | 3300025942 | Bacteria | 1554 |
| 464 | Ga0207689_10923284 | 3300025942 | Bacteria | 736 |
| 465 | Ga0207661_10209733 | 3300025944 | Bacteria | 1716 |
| 466 | Ga0207661_10676440 | 3300025944 | Bacteria | 949 |
| 467 | Ga0207679_10026009 | 3300025945 | Bacteria | 4031 |
| 468 | Ga0207667_10005999 | 3300025949 | Bacteria | 14784 |
| 469 | Ga0207667_10082654 | 3300025949 | Bacteria | 3326 |
| 470 | Ga0207667_10094804 | 3300025949 | Bacteria | 3081 |
| 471 | Ga0207667_11012527 | 3300025949 | Bacteria | 817 |
| 472 | Ga0207651_10001328 | 3300025960 | Bacteria | 11163 |
| 473 | Ga0207651_10021100 | 3300025960 | Bacteria | 3949 |
| 474 | Ga0207651_10082842 | 3300025960 | Bacteria | 2317 |
| 475 | Ga0207651_10084257 | 3300025960 | Bacteria | 2302 |
| 476 | Ga0207712_10046922 | 3300025961 | Bacteria | 2997 |
| 477 | Ga0207712_10048193 | 3300025961 | Bacteria | 2962 |
| 478 | Ga0207712_10677516 | 3300025961 | Bacteria | 898 |
| 479 | Ga0207712_10967381 | 3300025961 | Bacteria | 754 |
| 480 | Ga0207668_10002243 | 3300025972 | Bacteria | 11276 |
| 481 | Ga0207668_10005311 | 3300025972 | Bacteria | 7581 |
| 482 | Ga0207668_10039464 | 3300025972 | Bacteria | 3178 |
| 483 | Ga0207668_10249450 | 3300025972 | Bacteria | 1441 |
| 484 | Ga0207668_10269851 | 3300025972 | Bacteria | 1390 |
| 485 | Ga0207668_10510622 | 3300025972 | Bacteria | 1035 |
| 486 | Ga0207668_10704872 | 3300025972 | Bacteria | 887 |
| 487 | Ga0207668_10946098 | 3300025972 | Bacteria | 768 |
| 488 | Ga0207640_10091347 | 3300025981 | Bacteria | 2109 |
| 489 | Ga0207640_10163270 | 3300025981 | Bacteria | 1651 |
| 490 | Ga0207640_10653989 | 3300025981 | Bacteria | 896 |
| 491 | Ga0207658_10025142 | 3300025986 | Bacteria | 4168 |
| 492 | Ga0207658_10085263 | 3300025986 | Bacteria | 2433 |
| 493 | Ga0207658_10292302 | 3300025986 | Bacteria | 1401 |
| 494 | Ga0207677_10004025 | 3300026023 | Bacteria | 7844 |
| 495 | Ga0207677_10302789 | 3300026023 | Bacteria | 1321 |
| 496 | Ga0207703_10000559 | 3300026035 | Bacteria | 38247 |
| 497 | Ga0207703_10113356 | 3300026035 | Bacteria | 2317 |
| 498 | Ga0207703_10274500 | 3300026035 | Bacteria | 1528 |
| 499 | Ga0207703_10416683 | 3300026035 | Bacteria | 1249 |
| 500 | Ga0207703_10528531 | 3300026035 | Bacteria | 1110 |
| 501 | Ga0207703_10902855 | 3300026035 | Bacteria | 846 |
| 502 | Ga0207639_10128920 | 3300026041 | Bacteria | 2091 |
| 503 | Ga0207639_10173726 | 3300026041 | Bacteria | 1827 |
| 504 | Ga0207639_10562146 | 3300026041 | Bacteria | 1048 |
| 505 | Ga0207678_10169856 | 3300026067 | Bacteria | 1862 |
| 506 | Ga0207678_10196589 | 3300026067 | Bacteria | 1724 |
| 507 | Ga0207708_10016731 | 3300026075 | Bacteria | 5518 |
| 508 | Ga0207708_10134264 | 3300026075 | Bacteria | 1937 |
| 509 | Ga0207708_10410773 | 3300026075 | Bacteria | 1121 |
| 510 | Ga0207708_10465009 | 3300026075 | Bacteria | 1055 |
| 511 | Ga0207702_10004336 | 3300026078 | Bacteria | 12655 |
| 512 | Ga0207702_10014826 | 3300026078 | Bacteria | 6464 |
| 513 | Ga0207702_10059945 | 3300026078 | Bacteria | 3243 |
| 514 | Ga0207702_10101643 | 3300026078 | Bacteria | 2539 |
| 515 | Ga0207641_10002817 | 3300026088 | Bacteria | 15819 |
| 516 | Ga0207641_10041229 | 3300026088 | Bacteria | 3868 |
| 517 | Ga0207641_10096415 | 3300026088 | Bacteria | 2598 |
| 518 | Ga0207641_10619328 | 3300026088 | Bacteria | 1061 |
| 519 | Ga0207648_10000567 | 3300026089 | Bacteria | 41400 |
| 520 | Ga0207648_10001585 | 3300026089 | Bacteria | 24939 |
| 521 | Ga0207648_10041382 | 3300026089 | Bacteria | 4046 |
| 522 | Ga0207648_10127349 | 3300026089 | Bacteria | 2240 |
| 523 | Ga0207648_10131429 | 3300026089 | Bacteria | 2204 |
| 524 | Ga0207648_10463927 | 3300026089 | Bacteria | 1155 |
| 525 | Ga0207648_10491727 | 3300026089 | Bacteria | 1122 |
| 526 | Ga0207648_10522246 | 3300026089 | Bacteria | 1088 |
| 527 | Ga0207648_10846219 | 3300026089 | Bacteria | 853 |
| 528 | Ga0207676_10030901 | 3300026095 | Bacteria | 4024 |
| 529 | Ga0207676_10032345 | 3300026095 | Bacteria | 3941 |
| 530 | Ga0207676_10783926 | 3300026095 | Bacteria | 929 |
| 531 | Ga0207676_11605391 | 3300026095 | Bacteria | 648 |
| 532 | Ga0207674_10000053 | 3300026116 | Bacteria | 114437 |
| 533 | Ga0207674_10011703 | 3300026116 | Bacteria | 9848 |
| 534 | Ga0207674_10293149 | 3300026116 | Bacteria | 1575 |
| 535 | Ga0207674_10294974 | 3300026116 | Bacteria | 1570 |
| 536 | Ga0207675_100001190 | 3300026118 | Bacteria | 25909 |
| 537 | Ga0207675_100516759 | 3300026118 | Bacteria | 1190 |
| 538 | Ga0207675_100526463 | 3300026118 | Bacteria | 1179 |
| 539 | Ga0207675_101012982 | 3300026118 | Unclassified | 849 |
| 540 | Ga0207683_10002530 | 3300026121 | Bacteria | 15972 |
| 541 | Ga0207683_10012744 | 3300026121 | Bacteria | 7176 |
| 542 | Ga0207683_10029332 | 3300026121 | Bacteria | 4763 |
| 543 | Ga0207683_10094688 | 3300026121 | Bacteria | 2662 |
| 544 | Ga0207683_10236043 | 3300026121 | Bacteria | 1668 |
| 545 | Ga0207683_10666622 | 3300026121 | Bacteria | 964 |
| 546 | Ga0207698_10007275 | 3300026142 | Bacteria | 6936 |
| 547 | Ga0207698_10658978 | 3300026142 | Bacteria | 1038 |
| 548 | Ga0207698_10868640 | 3300026142 | Bacteria | 908 |
| 549 | Ga0207698_11104496 | 3300026142 | Bacteria | 806 |
| 550 | Ga0209969_1004121 | 3300027360 | Bacteria | 2032 |
| 551 | Ga0209967_1021413 | 3300027364 | Bacteria | 945 |
| 552 | Ga0209981_1020994 | 3300027378 | Bacteria | 933 |
| 553 | Ga0209996_1007218 | 3300027395 | Bacteria | 1445 |
| 554 | Ga0210000_1002742 | 3300027462 | Bacteria | 2513 |
| 555 | Ga0209968_1018914 | 3300027526 | Bacteria | 1107 |
| 556 | Ga0209999_1033974 | 3300027543 | Bacteria | 949 |
| 557 | Ga0209982_1020209 | 3300027552 | Bacteria | 1022 |
| 558 | Ga0210002_1003831 | 3300027617 | Bacteria | 2233 |
| 559 | Ga0209983_1011305 | 3300027665 | Bacteria | 1826 |
| 560 | Ga0209983_1021656 | 3300027665 | Bacteria | 1344 |
| 561 | Ga0209966_1040488 | 3300027695 | Archaea | 970 |
| 562 | Ga0209974_10000626 | 3300027876 | Bacteria | 11888 |
| 563 | Ga0207428_10038590 | 3300027907 | Bacteria | 3882 |
| 564 | Ga0268266_10401163 | 3300028379 | Bacteria | 1296 |
| 565 | Ga0268265_10019253 | 3300028380 | Bacteria | 4740 |
| 566 | Ga0268265_10029417 | 3300028380 | Bacteria | 3942 |
| 567 | Ga0268265_10158364 | 3300028380 | Bacteria | 1919 |
| 568 | Ga0268265_10178046 | 3300028380 | Bacteria | 1824 |
| 569 | Ga0268265_10288412 | 3300028380 | Bacteria | 1472 |
| 570 | Ga0268265_10363799 | 3300028380 | Bacteria | 1325 |
| 571 | Ga0268265_10388754 | 3300028380 | Bacteria | 1286 |
| 572 | Ga0268265_10420929 | 3300028380 | Bacteria | 1240 |
| 573 | Ga0268265_10606922 | 3300028380 | Bacteria | 1046 |
| 574 | Ga0268265_10912826 | 3300028380 | Bacteria | 863 |
| 575 | Ga0268265_11334259 | 3300028380 | Bacteria | 718 |
| 576 | Ga0268264_10027956 | 3300028381 | Bacteria | 4611 |
| 577 | Ga0268264_10044768 | 3300028381 | Bacteria | 3672 |
| 578 | Ga0268264_10053029 | 3300028381 | Bacteria | 3383 |
| 579 | Ga0268264_10153041 | 3300028381 | Bacteria | 2070 |
| 580 | Ga0268264_10536929 | 3300028381 | Bacteria | 1145 |
| 581 | Ga0268264_10838326 | 3300028381 | Bacteria | 920 |
| 582 | Ga0268264_10851676 | 3300028381 | Bacteria | 913 |
| 583 | Ga0307408_100004584 | 3300031548 | Bacteria | 9353 |
| 584 | Ga0307408_100297167 | 3300031548 | Bacteria | 1351 |
| 585 | Ga0307408_100303984 | 3300031548 | Bacteria | 1337 |
| 586 | Ga0307408_100454487 | 3300031548 | Bacteria | 1112 |
| 587 | Ga0316575_10040832 | 3300031665 | Bacteria | 1834 |
| 588 | Ga0307405_11113419 | 3300031731 | Bacteria | 679 |
| 589 | Ga0307413_10001161 | 3300031824 | Bacteria | 9678 |
| 590 | Ga0307413_10005126 | 3300031824 | Bacteria | 5803 |
| 591 | Ga0307413_10398133 | 3300031824 | Bacteria | 1078 |
| 592 | Ga0307410_10001726 | 3300031852 | Bacteria | 10093 |
| 593 | Ga0307410_10017001 | 3300031852 | Bacteria | 4355 |
| 594 | Ga0307406_10004201 | 3300031901 | Bacteria | 7841 |
| 595 | Ga0307406_10139061 | 3300031901 | Bacteria | 1716 |
| 596 | Ga0307406_10402359 | 3300031901 | Bacteria | 1086 |
| 597 | Ga0307407_10055414 | 3300031903 | Bacteria | 2291 |
| 598 | Ga0307407_10070427 | 3300031903 | Bacteria | 2079 |
| 599 | Ga0307412_10025231 | 3300031911 | Bacteria | 3679 |
| 600 | Ga0307412_11001323 | 3300031911 | Bacteria | 738 |
| 601 | Ga0307412_11287226 | 3300031911 | Bacteria | 658 |
| 602 | Ga0307409_100023106 | 3300031995 | Bacteria | 4301 |
| 603 | Ga0307409_100039662 | 3300031995 | Bacteria | 3497 |
| 604 | Ga0307409_100072612 | 3300031995 | Bacteria | 2741 |
| 605 | Ga0307416_100008129 | 3300032002 | Bacteria | 6737 |
| 606 | Ga0307416_100121703 | 3300032002 | Bacteria | 2327 |
| 607 | Ga0307416_100299519 | 3300032002 | Bacteria | 1597 |
| 608 | Ga0307416_101044880 | 3300032002 | Bacteria | 921 |
| 609 | Ga0307416_101372639 | 3300032002 | Bacteria | 812 |
| 610 | Ga0307414_10528267 | 3300032004 | Bacteria | 1048 |
| 611 | Ga0307414_10821135 | 3300032004 | Bacteria | 849 |
| 612 | Ga0307411_10000419 | 3300032005 | Bacteria | 14481 |
| 613 | Ga0307411_10095229 | 3300032005 | Bacteria | 2090 |
| 614 | Ga0307411_10395361 | 3300032005 | Bacteria | 1141 |
| 615 | Ga0307415_100003744 | 3300032126 | Bacteria | 7791 |
| 616 | Ga0307415_100674385 | 3300032126 | Bacteria | 930 |
| 617 | Ga0373930_0069943 | 3300034816 | Bacteria | 797 |
| 618 | Ga0373926_0001761 | 3300035083 | Bacteria | 6721 |
| 619 | Ga0373944_0002901 | 3300035089 | Bacteria | 4398 |
| 620 | Ga0373949_0012467 | 3300035090 | Bacteria | 1881 |
| 621 | Ga0373952_0007186 | 3300035092 | Bacteria | 2080 |
| 622 | Ga0373936_0002101 | 3300035113 | Bacteria | 7395 |
| 623 | Ga0373945_0001227 | 3300035116 | Bacteria | 7807 |
| 624 | Ga0373953_0001098 | 3300035117 | Bacteria | 7666 |
| 625 | Ga0373954_0000886 | 3300035118 | Bacteria | 11648 |
| 626 | Ga0373954_0000956 | 3300035118 | Bacteria | 11300 |
| 627 | Ga0373954_0007183 | 3300035118 | Bacteria | 4863 |
| 628 | Ga0373956_0006046 | 3300035119 | Bacteria | 4847 |
| 629 | Ga0373956_0040616 | 3300035119 | Bacteria | 2064 |
| 630 | Ga0373957_0008637 | 3300035120 | Bacteria | 3309 |
| 631 | Ga0373960_0061026 | 3300035121 | Bacteria | 1144 |
| 632 | Ga0373943_0129637 | 3300035170 | Bacteria | 1348 |
| 633 | Ga0373946_0003237 | 3300035171 | Bacteria | 5783 |
| 634 | Ga0373955_0002788 | 3300035172 | Bacteria | 7673 |
| 635 | Ga0373955_0205764 | 3300035172 | Bacteria | 1172 |
| 636 | Ga0373955_0898358 | 3300035172 | Bacteria | 545 |
| 637 | Ga0373942_0008784 | 3300035207 | Bacteria | 2360 |
| 638 | Ga0373961_0087225 | 3300035241 | Bacteria | 991 |
| 639 | Ga0373962_0285849 | 3300035242 | Unclassified | 581 |
| 640 | Ga0373924_0050301 | 3300035410 | Bacteria | 1726 |
| 641 | Ga0373924_0106831 | 3300035410 | Bacteria | 1207 |
| 642 | Ga0373924_0130230 | 3300035410 | Bacteria | 1094 |
| 643 | Ga0373931_0537482 | 3300035691 | Bacteria | 758 |
| 644 | Ga0373935_0003235 | 3300035692 | Bacteria | 9413 |
| 645 | Ga0373935_0009698 | 3300035692 | Bacteria | 5763 |
| 646 | Ga0373935_0020689 | 3300035692 | Bacteria | 4022 |
| 647 | Ga0373935_0376010 | 3300035692 | Bacteria | 1017 |
| 648 | Ga0373927_0004974 | 3300035695 | Bacteria | 9213 |
| 649 | Ga0373927_0012033 | 3300035695 | Bacteria | 5756 |
| 650 | Ga0373933_0005538 | 3300035724 | Bacteria | 6879 |
| 651 | Ga0373933_0093901 | 3300035724 | Bacteria | 1854 |
| 652 | Ga0373947_0190358 | 3300035725 | Bacteria | 1338 |
| 653 | Ga0373937_0001375 | 3300036401 | Bacteria | 20333 |
| 654 | Ga0373937_0018732 | 3300036401 | Bacteria | 6187 |
| 655 | Ga0373937_0116295 | 3300036401 | Bacteria | 2490 |
| 656 | Ga0373937_0492926 | 3300036401 | Bacteria | 1164 |
| 657 | Ga0373925_0630283 | 3300037068 | Bacteria | 883 |
| 658 | Ga0439465_0221533 | 3300041413 | Bacteria | 694 |
| 659 | Ga0451807_1341561 | 3300041486 | Bacteria | 692 |
| 660 | Ga0451839_1410063 | 3300041496 | Bacteria | 656 |
| 661 | Ga0451851_0505296 | 3300041507 | Bacteria | 1180 |
| 662 | Ga0439435_0068346 | 3300042436 | Unclassified | 1048 |
| 663 | Ga0439460_0049863 | 3300042461 | Bacteria | 1252 |
| 664 | Ga0450893_0073115 | 3300042532 | Bacteria | 668 |
| 665 | Ga0451576_0015516 | 3300045051 | Bacteria | 8434 |
| 666 | Ga0451576_0743992 | 3300045051 | Bacteria | 1030 |
| 667 | Ga0495592_0009555 | 3300046454 | Bacteria | 7296 |
| 668 | Ga0495592_0830393 | 3300046454 | Unclassified | 547 |
| 669 | Ga0495651_0007383 | 3300046462 | Bacteria | 8403 |
| 670 | Ga0495653_0052750 | 3300046463 | Bacteria | 3115 |
| 671 | Ga0495580_0003258 | 3300046472 | Bacteria | 13879 |
| 672 | Ga0495580_0011647 | 3300046472 | Bacteria | 6800 |
| 673 | Ga0495639_0003438 | 3300046475 | Bacteria | 6857 |
| 674 | Ga0495662_0001381 | 3300046476 | Bacteria | 12021 |
| 675 | Ga0495664_0015525 | 3300046477 | Bacteria | 4330 |
| 676 | Ga0495594_0038985 | 3300046499 | Bacteria | 2596 |
| 677 | Ga0495608_0037927 | 3300046511 | Bacteria | 3239 |
| 678 | Ga0495608_0064356 | 3300046511 | Bacteria | 2404 |
| 679 | Ga0495618_0014540 | 3300046514 | Bacteria | 4797 |
| 680 | Ga0495628_0056593 | 3300046516 | Bacteria | 3086 |
| 681 | Ga0495628_0058060 | 3300046516 | Bacteria | 3042 |
| 682 | Ga0495628_0313466 | 3300046516 | Bacteria | 1159 |
| 683 | Ga0495628_0729333 | 3300046516 | Bacteria | 698 |
| 684 | Ga0495630_0002652 | 3300046517 | Bacteria | 12386 |
| 685 | Ga0495630_0307648 | 3300046517 | Bacteria | 1211 |
| 686 | Ga0495630_0990167 | 3300046517 | Unclassified | 639 |
| 687 | Ga0495666_0005431 | 3300046526 | Bacteria | 6420 |
| 688 | Ga0495652_0383264 | 3300046529 | Bacteria | 999 |
| 689 | Ga0495640_0015829 | 3300046533 | Bacteria | 5660 |
| 690 | Ga0495640_0329208 | 3300046533 | Bacteria | 945 |
| 691 | Ga0495586_0003330 | 3300046535 | Bacteria | 8623 |
| 692 | Ga0495586_0008942 | 3300046535 | Bacteria | 5330 |
| 693 | Ga0495586_0201354 | 3300046535 | Bacteria | 1129 |
| 694 | Ga0495587_0015110 | 3300046536 | Bacteria | 4825 |
| 695 | Ga0495598_0078419 | 3300046537 | Bacteria | 1055 |
| 696 | Ga0495621_0045695 | 3300046539 | Bacteria | 1552 |
| 697 | Ga0495622_0022353 | 3300046557 | Bacteria | 2947 |
| 698 | Ga0495667_0007991 | 3300046559 | Bacteria | 7174 |
| 699 | Ga0495667_0035573 | 3300046559 | Bacteria | 3327 |
| 700 | Ga0495667_0315589 | 3300046559 | Bacteria | 989 |
| 701 | Ga0495634_0011268 | 3300046642 | Bacteria | 6512 |
| 702 | Ga0495635_0043674 | 3300046663 | Bacteria | 3093 |
| 703 | Ga0495635_0061937 | 3300046663 | Bacteria | 2569 |
| 704 | Ga0495659_0084195 | 3300046664 | Bacteria | 1212 |
| 705 | Ga0495588_0008086 | 3300046674 | Bacteria | 4811 |
| 706 | Ga0495657_0015483 | 3300046675 | Bacteria | 5580 |
| 707 | Ga0495657_0241703 | 3300046675 | Bacteria | 1089 |
| 708 | Ga0495657_0259439 | 3300046675 | Bacteria | 1044 |
| 709 | Ga0495599_0202113 | 3300046678 | Bacteria | 1220 |
| 710 | Ga0495646_0201361 | 3300046680 | Bacteria | 1084 |
| 711 | Ga0495647_0001261 | 3300046681 | Bacteria | 7809 |
| 712 | Ga0495658_0001458 | 3300046683 | Bacteria | 12454 |
| 713 | Ga0495658_0023245 | 3300046683 | Bacteria | 3288 |
| 714 | Ga0495669_0056633 | 3300046684 | Bacteria | 1767 |
| 715 | Ga0495613_0032286 | 3300046689 | Bacteria | 3888 |
| 716 | Ga0495670_0747784 | 3300046691 | Unclassified | 533 |
| 717 | Ga0495600_0009870 | 3300046809 | Bacteria | 5908 |
| 718 | Ga0495581_0007160 | 3300047315 | Bacteria | 6458 |
| 719 | Ga0495604_0064137 | 3300047317 | Bacteria | 2800 |
| 720 | Ga0495604_0130988 | 3300047317 | Bacteria | 1803 |
| 721 | Ga0495604_0241090 | 3300047317 | Bacteria | 1236 |
| 722 | Ga0495636_0004078 | 3300047318 | Bacteria | 5716 |
| 723 | Ga0495674_0005704 | 3300047319 | Bacteria | 11929 |
| 724 | Ga0495676_0004858 | 3300047321 | Bacteria | 12334 |
| 725 | Ga0495680_0010363 | 3300047322 | Bacteria | 8317 |
| 726 | Ga0495680_0449377 | 3300047322 | Bacteria | 882 |
| 727 | Ga0495675_0005938 | 3300047444 | Bacteria | 7462 |
| 728 | Ga0495684_0009504 | 3300047471 | Bacteria | 7502 |
| 729 | Ga0495684_0070548 | 3300047471 | Bacteria | 2656 |
| 730 | Ga0495602_0092121 | 3300048088 | Bacteria | 2512 |
| 731 | Ga0495602_0513574 | 3300048088 | Unclassified | 836 |
| 732 | Ga0496102_1027255 | 3300048905 | Bacteria | 745 |
| 733 | Ga0496103_0246924 | 3300048906 | Bacteria | 1148 |
| 734 | Ga0496106_0000353 | 3300048909 | Bacteria | 32583 |
| 735 | Ga0496107_0002903 | 3300048910 | Bacteria | 11327 |
| 736 | Ga0496108_0155781 | 3300048911 | Bacteria | 1973 |
| 737 | Ga0496108_0472082 | 3300048911 | Bacteria | 1096 |
| 738 | Ga0496109_0416451 | 3300048912 | Bacteria | 1269 |
| 739 | Ga0496111_0220598 | 3300048914 | Bacteria | 1409 |
| 740 | Ga0501291_073183 | 3300049514 | Bacteria | 668 |
| 741 | Ga0501291_116639 | 3300049514 | Archaea | 575 |
| 742 | Ga0501296_011586 | 3300049519 | Bacteria | 1057 |
| 743 | Ga0501299_006374 | 3300049522 | Bacteria | 1850 |
| 744 | Ga0501031_0006797 | 3300049568 | Bacteria | 7464 |
| 745 | Ga0501032_0268499 | 3300049569 | Bacteria | 1106 |
| 746 | Ga0501033_0020624 | 3300049570 | Bacteria | 4979 |
| 747 | Ga0501033_0424517 | 3300049570 | Bacteria | 926 |
| 748 | Ga0501033_0641057 | 3300049570 | Bacteria | 726 |
| 749 | Ga0501034_0080041 | 3300049571 | Bacteria | 3271 |
| 750 | Ga0501036_0315791 | 3300049572 | Bacteria | 1306 |
| 751 | Ga0501036_0685384 | 3300049572 | Bacteria | 847 |
| 752 | Ga0501037_0019241 | 3300049573 | Bacteria | 5033 |
| 753 | Ga0501038_0004889 | 3300049574 | Bacteria | 12446 |
| 754 | Ga0501038_0152916 | 3300049574 | Bacteria | 1880 |
| 755 | Ga0501038_0935625 | 3300049574 | Bacteria | 639 |
| 756 | Ga0501039_0001273 | 3300049575 | Bacteria | 18447 |
| 757 | Ga0501039_0056625 | 3300049575 | Bacteria | 3037 |
| 758 | Ga0501039_0239545 | 3300049575 | Bacteria | 1426 |
| 759 | Ga0501039_0458469 | 3300049575 | Bacteria | 1001 |
| 760 | Ga0501040_0024943 | 3300049576 | Bacteria | 4018 |
| 761 | Ga0501040_0160614 | 3300049576 | Bacteria | 1589 |
| 762 | Ga0501040_0832380 | 3300049576 | Bacteria | 668 |
| 763 | Ga0501041_0000677 | 3300049577 | Bacteria | 18046 |
| 764 | Ga0501041_0014647 | 3300049577 | Bacteria | 4656 |
| 765 | Ga0501041_0027145 | 3300049577 | Bacteria | 3450 |
| 766 | Ga0501041_0035231 | 3300049577 | Bacteria | 3033 |
| 767 | Ga0501041_0102091 | 3300049577 | Bacteria | 1776 |
| 768 | Ga0501042_0002778 | 3300049578 | Bacteria | 10817 |
| 769 | Ga0501042_0075351 | 3300049578 | Bacteria | 2415 |
| 770 | Ga0501042_0424900 | 3300049578 | Bacteria | 963 |
| 771 | Ga0501042_0634680 | 3300049578 | Bacteria | 777 |
| 772 | Ga0501043_0057487 | 3300049579 | Bacteria | 3054 |
| 773 | Ga0501043_0223851 | 3300049579 | Bacteria | 1455 |
| 774 | Ga0501043_0717840 | 3300049579 | Bacteria | 729 |
| 775 | Ga0501046_0007010 | 3300049580 | Bacteria | 9927 |
| 776 | Ga0501046_0051885 | 3300049580 | Bacteria | 3235 |
| 777 | Ga0501046_0090876 | 3300049580 | Bacteria | 2349 |
| 778 | Ga0501047_0475759 | 3300049581 | Bacteria | 1077 |
| 779 | Ga0501048_0004980 | 3300049582 | Bacteria | 10138 |
| 780 | Ga0501048_0202091 | 3300049582 | Bacteria | 1409 |
| 781 | Ga0501048_0421314 | 3300049582 | Bacteria | 955 |
| 782 | Ga0501068_0235145 | 3300049584 | Bacteria | 1166 |
| 783 | Ga0501069_0707338 | 3300049585 | Bacteria | 608 |
| 784 | Ga0501069_0867108 | 3300049585 | Bacteria | 549 |
| 785 | Ga0501070_0461423 | 3300049586 | Bacteria | 1023 |
| 786 | Ga0501071_0150679 | 3300049587 | Bacteria | 1735 |
| 787 | Ga0501071_0310810 | 3300049587 | Bacteria | 1196 |
| 788 | Ga0501071_0334838 | 3300049587 | Bacteria | 1150 |
| 789 | Ga0501072_0003828 | 3300049588 | Bacteria | 11366 |
| 790 | Ga0501072_0038612 | 3300049588 | Bacteria | 3747 |
| 791 | Ga0501072_0097666 | 3300049588 | Bacteria | 2335 |
| 792 | Ga0501073_0020297 | 3300049589 | Bacteria | 4794 |
| 793 | Ga0501074_0202053 | 3300049590 | Bacteria | 1416 |
| 794 | Ga0501075_0000845 | 3300049591 | Bacteria | 19255 |
| 795 | Ga0501075_0001572 | 3300049591 | Bacteria | 14926 |
| 796 | Ga0501075_0060907 | 3300049591 | Bacteria | 2843 |
| 797 | Ga0501075_0145481 | 3300049591 | Bacteria | 1806 |
| 798 | Ga0501075_0425735 | 3300049591 | Bacteria | 1012 |
| 799 | Ga0501076_0002762 | 3300049592 | Bacteria | 12152 |
| 800 | Ga0501076_0129979 | 3300049592 | Bacteria | 2042 |
| 801 | Ga0501076_0390604 | 3300049592 | Bacteria | 1144 |
| 802 | Ga0501076_0483859 | 3300049592 | Bacteria | 1020 |
| 803 | Ga0501076_1260927 | 3300049592 | Bacteria | 608 |
| 804 | Ga0501077_0000567 | 3300049593 | Bacteria | 22432 |
| 805 | Ga0501077_0253501 | 3300049593 | Bacteria | 1119 |
| 806 | Ga0501077_0383243 | 3300049593 | Bacteria | 898 |
| 807 | Ga0501217_051871 | 3300049661 | Bacteria | 1075 |
| 808 | Ga0501079_0001645 | 3300049741 | Bacteria | 15915 |
| 809 | Ga0501079_0087135 | 3300049741 | Bacteria | 2417 |
| 810 | Ga0501079_0094111 | 3300049741 | Bacteria | 2322 |
| 811 | Ga0501079_0166055 | 3300049741 | Bacteria | 1722 |
| 812 | Ga0501079_0207874 | 3300049741 | Bacteria | 1529 |
| 813 | Ga0501079_0348137 | 3300049741 | Bacteria | 1161 |
| 814 | Ga0501080_0005671 | 3300049742 | Bacteria | 11159 |
| 815 | Ga0501080_0418076 | 3300049742 | Bacteria | 1205 |
| 816 | Ga0501080_1716471 | 3300049742 | Bacteria | 529 |
| 817 | Ga0501081_0000144 | 3300049743 | Bacteria | 32232 |
| 818 | Ga0501081_0040253 | 3300049743 | Bacteria | 3200 |
| 819 | Ga0501081_0040598 | 3300049743 | Bacteria | 3186 |
| 820 | Ga0501081_0579191 | 3300049743 | Bacteria | 839 |
| 821 | Ga0501083_0378931 | 3300049744 | Bacteria | 920 |
| 822 | Ga0501035_0010183 | 3300049822 | Bacteria | 8727 |
| 823 | Ga0501035_0291320 | 3300049822 | Bacteria | 1378 |
| 824 | Ga0501035_0680057 | 3300049822 | Bacteria | 832 |
| 825 | Ga0501044_0359118 | 3300049823 | Bacteria | 1375 |
| 826 | Ga0501045_0003807 | 3300049824 | Bacteria | 10372 |
| 827 | Ga0501045_0108212 | 3300049824 | Bacteria | 2060 |
| 828 | Ga0501045_0663500 | 3300049824 | Bacteria | 770 |
| 829 | Ga0501045_1120024 | 3300049824 | Bacteria | 575 |
| 830 | nmdc:mga0k408_37390_c1 | 3300050493 | Bacteria | 2787 |
| 831 | nmdc:mga0k408_502170_c1 | 3300050493 | Bacteria | 719 |
| 832 | nmdc:mga05p37_25768_c1 | 3300050507 | Bacteria | 7152 |
| 833 | nmdc:mga09592_375490_c1 | 3300050508 | Bacteria | 1230 |
| 834 | nmdc:mga09592_62720_c1 | 3300050508 | Bacteria | 3145 |
| 835 | nmdc:mga09592_687876_c1 | 3300050508 | Bacteria | 871 |
| 836 | nmdc:mga0qj67_23981_c1 | 3300050509 | Bacteria | 4700 |
| 837 | nmdc:mga0qj67_868092_c1 | 3300050509 | Unclassified | 712 |
| 838 | nmdc:mga06r32_151518_c1 | 3300050510 | Bacteria | 2297 |
| 839 | nmdc:mga06r32_161293_c1 | 3300050510 | Bacteria | 2225 |
| 840 | nmdc:mga06r32_214393_c1 | 3300050510 | Bacteria | 1913 |
| 841 | nmdc:mga06r32_516349_c1 | 3300050510 | Bacteria | 1170 |
| 842 | nmdc:mga08y16_1245586_c1 | 3300050511 | Bacteria | 713 |
| 843 | nmdc:mga08y16_439948_c1 | 3300050511 | Bacteria | 1331 |
| 844 | nmdc:mga08y16_44771_c1 | 3300050511 | Bacteria | 4638 |
| 845 | nmdc:mga08y16_569702_c1 | 3300050511 | Bacteria | 1144 |
| 846 | nmdc:mga08y16_78002_c1 | 3300050511 | Bacteria | 3454 |
| 847 | nmdc:mga08y16_856284_c1 | 3300050511 | Bacteria | 898 |
| 848 | nmdc:mga0rr50_26340_c1 | 3300050513 | Bacteria | 4055 |
| 849 | nmdc:mga0rr50_56391_c2 | 3300050513 | Bacteria | 2371 |
| 850 | nmdc:mga0a205_150917_c1 | 3300050515 | Bacteria | 2223 |
| 851 | nmdc:mga0a205_159404_c1 | 3300050515 | Bacteria | 2154 |
| 852 | nmdc:mga0a205_417621_c1 | 3300050515 | Bacteria | 1204 |
| 853 | Ga0495601_0000899 | 3300053077 | Bacteria | 16237 |
| 854 | Ga0495595_0035127 | 3300053084 | Bacteria | 2270 |
| 855 | Ga0495619_0123830 | 3300053085 | Bacteria | 1773 |
| 856 | Ga0500559_0143142 | 3300053136 | Bacteria | 1120 |
| 857 | Ga0500568_0046010 | 3300053139 | Bacteria | 1734 |
| 858 | Ga0501084_0028985 | 3300054114 | Bacteria | 4628 |
| 859 | Ga0501084_0048367 | 3300054114 | Bacteria | 3560 |
| 860 | Ga0501084_0155327 | 3300054114 | Bacteria | 1929 |
| 861 | Ga0501084_0570291 | 3300054114 | Bacteria | 956 |
| 862 | Ga0501082_0001649 | 3300060353 | Bacteria | 19664 |
| 863 | Ga0501082_0119241 | 3300060353 | Bacteria | 2286 |
| 864 | Ga0501082_0282932 | 3300060353 | Bacteria | 1443 |
| 865 | Ga0530510_0001525 | 3300061734 | Bacteria | 15601 |
| 866 | Ga0530510_0003532 | 3300061734 | Bacteria | 10763 |
| 867 | Ga0530510_0004601 | 3300061734 | Bacteria | 9541 |
| 868 | Ga0530510_0036224 | 3300061734 | Bacteria | 3556 |
| 869 | Ga0530510_0371460 | 3300061734 | Bacteria | 1076 |
| 870 | Ga0530510_0608776 | 3300061734 | Bacteria | 831 |
| 871 | Ga0530510_0659178 | 3300061734 | Bacteria | 797 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006844 | Ga0075428_100004924 | Ga0075428_10000492415 | 136 |
| 2 | 3300006880 | Ga0075429_100048791 | Ga0075429_1000487912 | 136 |
| 3 | 3300035119 | Ga0373956_0040616 | Ga0373956_0040616_356_868 | 136 |
| 4 | 3300035172 | Ga0373955_0205764 | Ga0373955_0205764_133_645 | 136 |
| 5 | 3300035724 | Ga0373933_0005538 | Ga0373933_0005538_355_867 | 136 |
| 6 | 3300036401 | Ga0373937_0018732 | Ga0373937_0018732_4188_4700 | 136 |
| 7 | 3300046675 | Ga0495657_0259439 | Ga0495657_0259439_113_625 | 136 |
| 8 | 3300047317 | Ga0495604_0241090 | Ga0495604_0241090_555_1067 | 136 |
| 9 | 3300031824 | Ga0307413_10005126 | Ga0307413_100051265 | 137 |
| 10 | 3300031852 | Ga0307410_10017001 | Ga0307410_100170013 | 137 |
| 11 | 3300031901 | Ga0307406_10139061 | Ga0307406_101390612 | 137 |
| 12 | 3300031548 | Ga0307408_100454487 | Ga0307408_1004544872 | 138 |
| 13 | 3300032002 | Ga0307416_101372639 | Ga0307416_1013726392 | 138 |
| 14 | 3300049568 | Ga0501031_0006797 | Ga0501031_0006797_5685_6152 | 138 |
| 15 | 3300049570 | Ga0501033_0020624 | Ga0501033_0020624_3776_4243 | 138 |
| 16 | 3300049571 | Ga0501034_0080041 | Ga0501034_0080041_2770_3237 | 138 |
| 17 | 3300049573 | Ga0501037_0019241 | Ga0501037_0019241_3532_3999 | 138 |
| 18 | 3300049574 | Ga0501038_0004889 | Ga0501038_0004889_10169_10636 | 138 |
| 19 | 3300049575 | Ga0501039_0001273 | Ga0501039_0001273_10546_11013 | 138 |
| 20 | 3300049577 | Ga0501041_0000677 | Ga0501041_0000677_16262_16729 | 138 |
| 21 | 3300049578 | Ga0501042_0002778 | Ga0501042_0002778_7871_8338 | 138 |
| 22 | 3300049579 | Ga0501043_0057487 | Ga0501043_0057487_1293_1760 | 138 |
| 23 | 3300049580 | Ga0501046_0007010 | Ga0501046_0007010_7152_7619 | 138 |
| 24 | 3300049581 | Ga0501047_0475759 | Ga0501047_0475759_124_591 | 138 |
| 25 | 3300049582 | Ga0501048_0004980 | Ga0501048_0004980_633_1100 | 138 |
| 26 | 3300049585 | Ga0501069_0867108 | Ga0501069_0867108_65_532 | 138 |
| 27 | 3300049586 | Ga0501070_0461423 | Ga0501070_0461423_275_742 | 138 |
| 28 | 3300049587 | Ga0501071_0334838 | Ga0501071_0334838_661_1128 | 138 |
| 29 | 3300049588 | Ga0501072_0003828 | Ga0501072_0003828_3590_4057 | 138 |
| 30 | 3300049589 | Ga0501073_0020297 | Ga0501073_0020297_3975_4442 | 138 |
| 31 | 3300049590 | Ga0501074_0202053 | Ga0501074_0202053_381_848 | 138 |
| 32 | 3300049591 | Ga0501075_0001572 | Ga0501075_0001572_3710_4177 | 138 |
| 33 | 3300049592 | Ga0501076_0002762 | Ga0501076_0002762_730_1197 | 138 |
| 34 | 3300049593 | Ga0501077_0000567 | Ga0501077_0000567_7261_7728 | 138 |
| 35 | 3300049741 | Ga0501079_0001645 | Ga0501079_0001645_1318_1785 | 138 |
| 36 | 3300049742 | Ga0501080_0005671 | Ga0501080_0005671_6900_7367 | 138 |
| 37 | 3300049743 | Ga0501081_0000144 | Ga0501081_0000144_14104_14571 | 138 |
| 38 | 3300049822 | Ga0501035_0010183 | Ga0501035_0010183_2696_3163 | 138 |
| 39 | 3300049823 | Ga0501044_0359118 | Ga0501044_0359118_457_924 | 138 |
| 40 | 3300049824 | Ga0501045_0003807 | Ga0501045_0003807_2596_3063 | 138 |
| 41 | 3300054114 | Ga0501084_0028985 | Ga0501084_0028985_3436_3903 | 138 |
| 42 | 3300060353 | Ga0501082_0001649 | Ga0501082_0001649_1213_1680 | 138 |
| 43 | 3300061734 | Ga0530510_0003532 | Ga0530510_0003532_7835_8302 | 138 |
| 44 | 3300036401 | Ga0373937_0492926 | Ga0373937_0492926_360_878 | 139 |
| 45 | 3300031903 | Ga0307407_10070427 | Ga0307407_100704272 | 140 |
| 46 | 3300032005 | Ga0307411_10395361 | Ga0307411_103953612 | 140 |
| 47 | 3300049572 | Ga0501036_0315791 | Ga0501036_0315791_181_654 | 140 |
| 48 | 3300049575 | Ga0501039_0239545 | Ga0501039_0239545_14_487 | 140 |
| 49 | 3300049577 | Ga0501041_0035231 | Ga0501041_0035231_1116_1589 | 140 |
| 50 | 3300049579 | Ga0501043_0717840 | Ga0501043_0717840_111_584 | 140 |
| 51 | 3300049584 | Ga0501068_0235145 | Ga0501068_0235145_348_821 | 140 |
| 52 | 3300049742 | Ga0501080_1716471 | Ga0501080_1716471_20_493 | 140 |
| 53 | 3300049743 | Ga0501081_0040253 | Ga0501081_0040253_2715_3188 | 140 |
| 54 | 3300054114 | Ga0501084_0570291 | Ga0501084_0570291_424_897 | 140 |
| 55 | 3300014326 | Ga0157380_10000875 | Ga0157380_100008753 | 141 |
| 56 | 3300042461 | Ga0439460_0049863 | Ga0439460_0049863_452_928 | 141 |
| 57 | 3300042532 | Ga0450893_0073115 | Ga0450893_0073115_103_579 | 141 |
| 58 | 3300046537 | Ga0495598_0078419 | Ga0495598_0078419_174_656 | 141 |
| 59 | 3300049576 | Ga0501040_0160614 | Ga0501040_0160614_80_556 | 141 |
| 60 | 3300049578 | Ga0501042_0634680 | Ga0501042_0634680_103_579 | 141 |
| 61 | 3300049591 | Ga0501075_0145481 | Ga0501075_0145481_1231_1707 | 141 |
| 62 | 3300049592 | Ga0501076_0129979 | Ga0501076_0129979_26_502 | 141 |
| 63 | 3300049593 | Ga0501077_0383243 | Ga0501077_0383243_127_603 | 141 |
| 64 | 3300049741 | Ga0501079_0087135 | Ga0501079_0087135_1215_1691 | 141 |
| 65 | 3300049743 | Ga0501081_0040598 | Ga0501081_0040598_967_1443 | 141 |
| 66 | 3300049822 | Ga0501035_0291320 | Ga0501035_0291320_675_1151 | 141 |
| 67 | 3300060353 | Ga0501082_0282932 | Ga0501082_0282932_799_1275 | 141 |
| 68 | 3300061734 | Ga0530510_0036224 | Ga0530510_0036224_2563_3039 | 141 |
| 69 | 3300005327 | Ga0070658_10017623 | Ga0070658_100176234 | 142 |
| 70 | 3300005336 | Ga0070680_100255550 | Ga0070680_1002555502 | 142 |
| 71 | 3300005339 | Ga0070660_100007313 | Ga0070660_1000073132 | 142 |
| 72 | 3300005344 | Ga0070661_100004250 | Ga0070661_1000042502 | 142 |
| 73 | 3300005366 | Ga0070659_100012507 | Ga0070659_1000125073 | 142 |
| 74 | 3300005435 | Ga0070714_100018613 | Ga0070714_1000186138 | 142 |
| 75 | 3300005436 | Ga0070713_100049434 | Ga0070713_1000494342 | 142 |
| 76 | 3300005437 | Ga0070710_10279780 | Ga0070710_102797802 | 142 |
| 77 | 3300005458 | Ga0070681_10106763 | Ga0070681_101067632 | 142 |
| 78 | 3300005530 | Ga0070679_100026536 | Ga0070679_1000265362 | 142 |
| 79 | 3300005535 | Ga0070684_100208130 | Ga0070684_1002081302 | 142 |
| 80 | 3300005539 | Ga0068853_100008824 | Ga0068853_1000088249 | 142 |
| 81 | 3300005563 | Ga0068855_100005356 | Ga0068855_1000053567 | 142 |
| 82 | 3300005564 | Ga0070664_100000563 | Ga0070664_10000056315 | 142 |
| 83 | 3300005614 | Ga0068856_100004757 | Ga0068856_10000475712 | 142 |
| 84 | 3300005616 | Ga0068852_100002071 | Ga0068852_10000207114 | 142 |
| 85 | 3300009093 | Ga0105240_10001484 | Ga0105240_1000148429 | 142 |
| 86 | 3300009545 | Ga0105237_10265184 | Ga0105237_102651842 | 142 |
| 87 | 3300009551 | Ga0105238_10007836 | Ga0105238_100078367 | 142 |
| 88 | 3300013100 | Ga0157373_10030058 | Ga0157373_100300585 | 142 |
| 89 | 3300013104 | Ga0157370_10040718 | Ga0157370_100407184 | 142 |
| 90 | 3300013105 | Ga0157369_10005068 | Ga0157369_100050688 | 142 |
| 91 | 3300013296 | Ga0157374_10272697 | Ga0157374_102726973 | 142 |
| 92 | 3300013307 | Ga0157372_10005517 | Ga0157372_100055177 | 142 |
| 93 | 3300025321 | Ga0207656_10082476 | Ga0207656_100824762 | 142 |
| 94 | 3300025898 | Ga0207692_10416819 | Ga0207692_104168192 | 142 |
| 95 | 3300025909 | Ga0207705_10147254 | Ga0207705_101472543 | 142 |
| 96 | 3300025914 | Ga0207671_10236949 | Ga0207671_102369492 | 142 |
| 97 | 3300025917 | Ga0207660_10172861 | Ga0207660_101728612 | 142 |
| 98 | 3300025924 | Ga0207694_10001424 | Ga0207694_1000142418 | 142 |
| 99 | 3300025929 | Ga0207664_10023189 | Ga0207664_100231892 | 142 |
| 100 | 3300025932 | Ga0207690_10028695 | Ga0207690_100286953 | 142 |
| 101 | 3300025944 | Ga0207661_10209733 | Ga0207661_102097333 | 142 |
| 102 | 3300025945 | Ga0207679_10026009 | Ga0207679_100260092 | 142 |
| 103 | 3300025949 | Ga0207667_10005999 | Ga0207667_100059998 | 142 |
| 104 | 3300026041 | Ga0207639_10173726 | Ga0207639_101737262 | 142 |
| 105 | 3300026078 | Ga0207702_10014826 | Ga0207702_100148267 | 142 |
| 106 | 3300026116 | Ga0207674_10000053 | Ga0207674_1000005385 | 142 |
| 107 | 3300026142 | Ga0207698_10007275 | Ga0207698_100072754 | 142 |
| 108 | 3300049572 | Ga0501036_0685384 | Ga0501036_0685384_157_663 | 142 |
| 109 | 3300009094 | Ga0111539_10567725 | Ga0111539_105677251 | 144 |
| 110 | 3300009148 | Ga0105243_10144052 | Ga0105243_101440522 | 144 |
| 111 | 3300009177 | Ga0105248_11215947 | Ga0105248_112159471 | 144 |
| 112 | 3300013306 | Ga0163162_10559869 | Ga0163162_105598692 | 144 |
| 113 | 3300014325 | Ga0163163_12080633 | Ga0163163_120806331 | 144 |
| 114 | 3300014326 | Ga0157380_10346758 | Ga0157380_103467582 | 144 |
| 115 | 3300014968 | Ga0157379_10081604 | Ga0157379_100816044 | 144 |
| 116 | 3300035172 | Ga0373955_0898358 | Ga0373955_0898358_10_495 | 144 |
| 117 | 3300035691 | Ga0373931_0537482 | Ga0373931_0537482_32_517 | 144 |
| 118 | 3300046691 | Ga0495670_0747784 | Ga0495670_0747784_26_511 | 144 |
| 119 | 3300035241 | Ga0373961_0087225 | Ga0373961_0087225_270_770 | 145 |
| 120 | 3300049577 | Ga0501041_0027145 | Ga0501041_0027145_1293_1799 | 145 |
| 121 | 3300049578 | Ga0501042_0075351 | Ga0501042_0075351_1593_2099 | 145 |
| 122 | 3300049588 | Ga0501072_0097666 | Ga0501072_0097666_1125_1631 | 145 |
| 123 | 3300035207 | Ga0373942_0008784 | Ga0373942_0008784_1463_1969 | 146 |
| 124 | 3300049570 | Ga0501033_0424517 | Ga0501033_0424517_345_854 | 146 |
| 125 | 3300005341 | Ga0070691_10041575 | Ga0070691_100415752 | 147 |
| 126 | 3300005545 | Ga0070695_100095000 | Ga0070695_1000950002 | 147 |
| 127 | 3300026118 | Ga0207675_101012982 | Ga0207675_1010129822 | 147 |
| 128 | 3300005327 | Ga0070658_10105219 | Ga0070658_101052191 | 148 |
| 129 | 3300005336 | Ga0070680_100239501 | Ga0070680_1002395012 | 148 |
| 130 | 3300005339 | Ga0070660_100023611 | Ga0070660_1000236112 | 148 |
| 131 | 3300005563 | Ga0068855_100111489 | Ga0068855_1001114893 | 148 |
| 132 | 3300005844 | Ga0068862_100961204 | Ga0068862_1009612042 | 148 |
| 133 | 3300006846 | Ga0075430_100008955 | Ga0075430_1000089558 | 148 |
| 134 | 3300006847 | Ga0075431_100368984 | Ga0075431_1003689842 | 148 |
| 135 | 3300009551 | Ga0105238_10069042 | Ga0105238_100690423 | 148 |
| 136 | 3300013306 | Ga0163162_11750397 | Ga0163162_117503971 | 148 |
| 137 | 3300014326 | Ga0157380_10670353 | Ga0157380_106703532 | 148 |
| 138 | 3300025909 | Ga0207705_10690870 | Ga0207705_106908702 | 148 |
| 139 | 3300025913 | Ga0207695_10780053 | Ga0207695_107800532 | 148 |
| 140 | 3300025917 | Ga0207660_10207380 | Ga0207660_102073802 | 148 |
| 141 | 3300025921 | Ga0207652_10256557 | Ga0207652_102565572 | 148 |
| 142 | 3300025924 | Ga0207694_10223716 | Ga0207694_102237162 | 148 |
| 143 | 3300025931 | Ga0207644_10213775 | Ga0207644_102137752 | 148 |
| 144 | 3300025949 | Ga0207667_11012527 | Ga0207667_110125272 | 148 |
| 145 | 3300028380 | Ga0268265_10912826 | Ga0268265_109128262 | 148 |
| 146 | 3300041486 | Ga0451807_1341561 | Ga0451807_1341561_58_555 | 148 |
| 147 | 3300049661 | Ga0501217_051871 | Ga0501217_051871_388_876 | 148 |
| 148 | 3300050508 | nmdc:mga09592_687876_c1 | nmdc:mga09592_687876_c1_26_523 | 148 |
| 149 | 3300050509 | nmdc:mga0qj67_23981_c1 | nmdc:mga0qj67_23981_c1_2176_2673 | 148 |
| 150 | 3300009553 | Ga0105249_10983254 | Ga0105249_109832541 | 149 |
| 151 | 3300031548 | Ga0307408_100297167 | Ga0307408_1002971672 | 149 |
| 152 | 3300031824 | Ga0307413_10398133 | Ga0307413_103981332 | 149 |
| 153 | 3300031911 | Ga0307412_11001323 | Ga0307412_110013231 | 149 |
| 154 | 3300031995 | Ga0307409_100023106 | Ga0307409_1000231064 | 149 |
| 155 | 3300031995 | Ga0307409_100072612 | Ga0307409_1000726123 | 149 |
| 156 | 3300032002 | Ga0307416_100299519 | Ga0307416_1002995192 | 149 |
| 157 | 3300032005 | Ga0307411_10095229 | Ga0307411_100952292 | 149 |
| 158 | 3300049574 | Ga0501038_0152916 | Ga0501038_0152916_448_1002 | 149 |
| 159 | 3300049575 | Ga0501039_0056625 | Ga0501039_0056625_804_1358 | 149 |
| 160 | 3300049576 | Ga0501040_0024943 | Ga0501040_0024943_483_1037 | 149 |
| 161 | 3300049577 | Ga0501041_0014647 | Ga0501041_0014647_1205_1759 | 149 |
| 162 | 3300049580 | Ga0501046_0051885 | Ga0501046_0051885_2115_2669 | 149 |
| 163 | 3300049588 | Ga0501072_0038612 | Ga0501072_0038612_161_715 | 149 |
| 164 | 3300049591 | Ga0501075_0000845 | Ga0501075_0000845_11293_11847 | 149 |
| 165 | 3300049743 | Ga0501081_0579191 | Ga0501081_0579191_244_792 | 149 |
| 166 | 3300054114 | Ga0501084_0048367 | Ga0501084_0048367_284_838 | 149 |
| 167 | 3300060353 | Ga0501082_0119241 | Ga0501082_0119241_27_581 | 149 |
| 168 | 3300061734 | Ga0530510_0004601 | Ga0530510_0004601_644_1198 | 149 |
| 169 | 3300006852 | Ga0075433_10110592 | Ga0075433_101105922 | 150 |
| 170 | 3300007076 | Ga0075435_100006615 | Ga0075435_1000066158 | 150 |
| 171 | 3300009094 | Ga0111539_10190681 | Ga0111539_101906813 | 150 |
| 172 | 3300014326 | Ga0157380_10614254 | Ga0157380_106142542 | 150 |
| 173 | 3300032002 | Ga0307416_101044880 | Ga0307416_1010448802 | 150 |
| 174 | 3300049582 | Ga0501048_0421314 | Ga0501048_0421314_123_635 | 150 |
| 175 | 3300049593 | Ga0501077_0253501 | Ga0501077_0253501_116_628 | 150 |
| 176 | 3300049742 | Ga0501080_0418076 | Ga0501080_0418076_571_1083 | 150 |
| 177 | 3300049744 | Ga0501083_0378931 | Ga0501083_0378931_318_830 | 150 |
| 178 | 3300050511 | nmdc:mga08y16_44771_c1 | nmdc:mga08y16_44771_c1_227_733 | 150 |
| 179 | 3300050513 | nmdc:mga0rr50_26340_c1 | nmdc:mga0rr50_26340_c1_1771_2283 | 150 |
| 180 | 3300050515 | nmdc:mga0a205_159404_c1 | nmdc:mga0a205_159404_c1_968_1480 | 150 |
| 181 | 3300005328 | Ga0070676_10014325 | Ga0070676_100143254 | 151 |
| 182 | 3300005329 | Ga0070683_101543511 | Ga0070683_1015435111 | 151 |
| 183 | 3300005334 | Ga0068869_100474259 | Ga0068869_1004742592 | 151 |
| 184 | 3300005335 | Ga0070666_10286263 | Ga0070666_102862631 | 151 |
| 185 | 3300005336 | Ga0070680_100071170 | Ga0070680_1000711702 | 151 |
| 186 | 3300005339 | Ga0070660_100066979 | Ga0070660_1000669792 | 151 |
| 187 | 3300005339 | Ga0070660_100375605 | Ga0070660_1003756052 | 151 |
| 188 | 3300005339 | Ga0070660_100839845 | Ga0070660_1008398452 | 151 |
| 189 | 3300005344 | Ga0070661_100185500 | Ga0070661_1001855002 | 151 |
| 190 | 3300005345 | Ga0070692_10109928 | Ga0070692_101099282 | 151 |
| 191 | 3300005353 | Ga0070669_100450731 | Ga0070669_1004507312 | 151 |
| 192 | 3300005354 | Ga0070675_100281842 | Ga0070675_1002818422 | 151 |
| 193 | 3300005356 | Ga0070674_100421142 | Ga0070674_1004211421 | 151 |
| 194 | 3300005364 | Ga0070673_100070921 | Ga0070673_1000709212 | 151 |
| 195 | 3300005364 | Ga0070673_100151764 | Ga0070673_1001517642 | 151 |
| 196 | 3300005366 | Ga0070659_100129150 | Ga0070659_1001291502 | 151 |
| 197 | 3300005367 | Ga0070667_100282438 | Ga0070667_1002824382 | 151 |
| 198 | 3300005440 | Ga0070705_100087187 | Ga0070705_1000871872 | 151 |
| 199 | 3300005444 | Ga0070694_100083162 | Ga0070694_1000831622 | 151 |
| 200 | 3300005444 | Ga0070694_100381309 | Ga0070694_1003813092 | 151 |
| 201 | 3300005456 | Ga0070678_100649930 | Ga0070678_1006499302 | 151 |
| 202 | 3300005456 | Ga0070678_100955075 | Ga0070678_1009550752 | 151 |
| 203 | 3300005457 | Ga0070662_100000736 | Ga0070662_10000073620 | 151 |
| 204 | 3300005458 | Ga0070681_10000525 | Ga0070681_1000052524 | 151 |
| 205 | 3300005458 | Ga0070681_10170304 | Ga0070681_101703042 | 151 |
| 206 | 3300005459 | Ga0068867_101229621 | Ga0068867_1012296211 | 151 |
| 207 | 3300005468 | Ga0070707_100089839 | Ga0070707_1000898392 | 151 |
| 208 | 3300005530 | Ga0070679_100125504 | Ga0070679_1001255042 | 151 |
| 209 | 3300005530 | Ga0070679_101530350 | Ga0070679_1015303501 | 151 |
| 210 | 3300005539 | Ga0068853_100001643 | Ga0068853_1000016434 | 151 |
| 211 | 3300005545 | Ga0070695_100607065 | Ga0070695_1006070651 | 151 |
| 212 | 3300005546 | Ga0070696_100242345 | Ga0070696_1002423451 | 151 |
| 213 | 3300005547 | Ga0070693_100653133 | Ga0070693_1006531332 | 151 |
| 214 | 3300005549 | Ga0070704_100007749 | Ga0070704_1000077492 | 151 |
| 215 | 3300005549 | Ga0070704_100008762 | Ga0070704_1000087627 | 151 |
| 216 | 3300005549 | Ga0070704_100012920 | Ga0070704_1000129205 | 151 |
| 217 | 3300005549 | Ga0070704_100134095 | Ga0070704_1001340951 | 151 |
| 218 | 3300005563 | Ga0068855_100709777 | Ga0068855_1007097772 | 151 |
| 219 | 3300005577 | Ga0068857_100391635 | Ga0068857_1003916352 | 151 |
| 220 | 3300005577 | Ga0068857_101006881 | Ga0068857_1010068812 | 151 |
| 221 | 3300005578 | Ga0068854_100640277 | Ga0068854_1006402771 | 151 |
| 222 | 3300005614 | Ga0068856_100000246 | Ga0068856_10000024636 | 151 |
| 223 | 3300005841 | Ga0068863_100489886 | Ga0068863_1004898862 | 151 |
| 224 | 3300005844 | Ga0068862_100271661 | Ga0068862_1002716612 | 151 |
| 225 | 3300006844 | Ga0075428_100032310 | Ga0075428_1000323102 | 151 |
| 226 | 3300006844 | Ga0075428_100252508 | Ga0075428_1002525081 | 151 |
| 227 | 3300006847 | Ga0075431_100028736 | Ga0075431_1000287365 | 151 |
| 228 | 3300006847 | Ga0075431_100757129 | Ga0075431_1007571292 | 151 |
| 229 | 3300006881 | Ga0068865_101172241 | Ga0068865_1011722411 | 151 |
| 230 | 3300007265 | Ga0099794_10130495 | Ga0099794_101304952 | 151 |
| 231 | 3300007788 | Ga0099795_10021429 | Ga0099795_100214292 | 151 |
| 232 | 3300009094 | Ga0111539_10546683 | Ga0111539_105466832 | 151 |
| 233 | 3300009176 | Ga0105242_12110272 | Ga0105242_121102721 | 151 |
| 234 | 3300013100 | Ga0157373_10001898 | Ga0157373_100018983 | 151 |
| 235 | 3300013102 | Ga0157371_10110570 | Ga0157371_101105702 | 151 |
| 236 | 3300013105 | Ga0157369_11627961 | Ga0157369_116279612 | 151 |
| 237 | 3300013307 | Ga0157372_10039943 | Ga0157372_100399432 | 151 |
| 238 | 3300013307 | Ga0157372_10158219 | Ga0157372_101582193 | 151 |
| 239 | 3300025315 | Ga0207697_10030825 | Ga0207697_100308252 | 151 |
| 240 | 3300025321 | Ga0207656_10145377 | Ga0207656_101453772 | 151 |
| 241 | 3300025899 | Ga0207642_10741368 | Ga0207642_107413681 | 151 |
| 242 | 3300025903 | Ga0207680_10128858 | Ga0207680_101288582 | 151 |
| 243 | 3300025907 | Ga0207645_10021346 | Ga0207645_100213464 | 151 |
| 244 | 3300025908 | Ga0207643_10097822 | Ga0207643_100978222 | 151 |
| 245 | 3300025912 | Ga0207707_10008578 | Ga0207707_100085783 | 151 |
| 246 | 3300025912 | Ga0207707_10088630 | Ga0207707_100886302 | 151 |
| 247 | 3300025917 | Ga0207660_10173780 | Ga0207660_101737802 | 151 |
| 248 | 3300025917 | Ga0207660_10419970 | Ga0207660_104199702 | 151 |
| 249 | 3300025919 | Ga0207657_10000260 | Ga0207657_100002602 | 151 |
| 250 | 3300025919 | Ga0207657_10340185 | Ga0207657_103401852 | 151 |
| 251 | 3300025921 | Ga0207652_10700038 | Ga0207652_107000382 | 151 |
| 252 | 3300025921 | Ga0207652_10752233 | Ga0207652_107522331 | 151 |
| 253 | 3300025922 | Ga0207646_10984727 | Ga0207646_109847272 | 151 |
| 254 | 3300025923 | Ga0207681_10293896 | Ga0207681_102938962 | 151 |
| 255 | 3300025926 | Ga0207659_10024536 | Ga0207659_100245361 | 151 |
| 256 | 3300025932 | Ga0207690_10010711 | Ga0207690_100107114 | 151 |
| 257 | 3300025933 | Ga0207706_10000190 | Ga0207706_1000019013 | 151 |
| 258 | 3300025937 | Ga0207669_11073840 | Ga0207669_110738401 | 151 |
| 259 | 3300025940 | Ga0207691_10042870 | Ga0207691_100428703 | 151 |
| 260 | 3300025942 | Ga0207689_10224033 | Ga0207689_102240332 | 151 |
| 261 | 3300025944 | Ga0207661_10676440 | Ga0207661_106764401 | 151 |
| 262 | 3300025949 | Ga0207667_10094804 | Ga0207667_100948042 | 151 |
| 263 | 3300025960 | Ga0207651_10021100 | Ga0207651_100211003 | 151 |
| 264 | 3300025981 | Ga0207640_10163270 | Ga0207640_101632702 | 151 |
| 265 | 3300026041 | Ga0207639_10128920 | Ga0207639_101289202 | 151 |
| 266 | 3300026075 | Ga0207708_10134264 | Ga0207708_101342642 | 151 |
| 267 | 3300026075 | Ga0207708_10465009 | Ga0207708_104650091 | 151 |
| 268 | 3300026078 | Ga0207702_10004336 | Ga0207702_100043364 | 151 |
| 269 | 3300026116 | Ga0207674_10293149 | Ga0207674_102931492 | 151 |
| 270 | 3300026116 | Ga0207674_10294974 | Ga0207674_102949742 | 151 |
| 271 | 3300026118 | Ga0207675_100526463 | Ga0207675_1005264632 | 151 |
| 272 | 3300026121 | Ga0207683_10236043 | Ga0207683_102360432 | 151 |
| 273 | 3300027360 | Ga0209969_1004121 | Ga0209969_10041212 | 151 |
| 274 | 3300027364 | Ga0209967_1021413 | Ga0209967_10214132 | 151 |
| 275 | 3300027378 | Ga0209981_1020994 | Ga0209981_10209942 | 151 |
| 276 | 3300027395 | Ga0209996_1007218 | Ga0209996_10072182 | 151 |
| 277 | 3300027462 | Ga0210000_1002742 | Ga0210000_10027423 | 151 |
| 278 | 3300027526 | Ga0209968_1018914 | Ga0209968_10189141 | 151 |
| 279 | 3300027543 | Ga0209999_1033974 | Ga0209999_10339742 | 151 |
| 280 | 3300027552 | Ga0209982_1020209 | Ga0209982_10202092 | 151 |
| 281 | 3300027617 | Ga0210002_1003831 | Ga0210002_10038312 | 151 |
| 282 | 3300027665 | Ga0209983_1011305 | Ga0209983_10113052 | 151 |
| 283 | 3300027695 | Ga0209966_1040488 | Ga0209966_10404882 | 151 |
| 284 | 3300027876 | Ga0209974_10000626 | Ga0209974_100006264 | 151 |
| 285 | 3300028380 | Ga0268265_10420929 | Ga0268265_104209292 | 151 |
| 286 | 3300031548 | Ga0307408_100004584 | Ga0307408_1000045843 | 151 |
| 287 | 3300031548 | Ga0307408_100303984 | Ga0307408_1003039842 | 151 |
| 288 | 3300031665 | Ga0316575_10040832 | Ga0316575_100408322 | 151 |
| 289 | 3300031824 | Ga0307413_10001161 | Ga0307413_100011613 | 151 |
| 290 | 3300031852 | Ga0307410_10001726 | Ga0307410_1000172610 | 151 |
| 291 | 3300031901 | Ga0307406_10004201 | Ga0307406_100042017 | 151 |
| 292 | 3300031903 | Ga0307407_10055414 | Ga0307407_100554142 | 151 |
| 293 | 3300031911 | Ga0307412_10025231 | Ga0307412_100252312 | 151 |
| 294 | 3300031911 | Ga0307412_11287226 | Ga0307412_112872262 | 151 |
| 295 | 3300031995 | Ga0307409_100039662 | Ga0307409_1000396623 | 151 |
| 296 | 3300032002 | Ga0307416_100008129 | Ga0307416_1000081296 | 151 |
| 297 | 3300032002 | Ga0307416_100121703 | Ga0307416_1001217032 | 151 |
| 298 | 3300032004 | Ga0307414_10821135 | Ga0307414_108211352 | 151 |
| 299 | 3300032005 | Ga0307411_10000419 | Ga0307411_100004195 | 151 |
| 300 | 3300032126 | Ga0307415_100003744 | Ga0307415_1000037446 | 151 |
| 301 | 3300034816 | Ga0373930_0069943 | Ga0373930_0069943_243_749 | 151 |
| 302 | 3300035083 | Ga0373926_0001761 | Ga0373926_0001761_2106_2630 | 151 |
| 303 | 3300035089 | Ga0373944_0002901 | Ga0373944_0002901_227_751 | 151 |
| 304 | 3300035113 | Ga0373936_0002101 | Ga0373936_0002101_4677_5201 | 151 |
| 305 | 3300035116 | Ga0373945_0001227 | Ga0373945_0001227_1718_2242 | 151 |
| 306 | 3300035118 | Ga0373954_0007183 | Ga0373954_0007183_2452_3024 | 151 |
| 307 | 3300035121 | Ga0373960_0061026 | Ga0373960_0061026_372_878 | 151 |
| 308 | 3300035170 | Ga0373943_0129637 | Ga0373943_0129637_726_1250 | 151 |
| 309 | 3300035171 | Ga0373946_0003237 | Ga0373946_0003237_1948_2472 | 151 |
| 310 | 3300035410 | Ga0373924_0130230 | Ga0373924_0130230_226_750 | 151 |
| 311 | 3300035692 | Ga0373935_0009698 | Ga0373935_0009698_3810_4334 | 151 |
| 312 | 3300035692 | Ga0373935_0376010 | Ga0373935_0376010_185_691 | 151 |
| 313 | 3300035695 | Ga0373927_0004974 | Ga0373927_0004974_2627_3151 | 151 |
| 314 | 3300035725 | Ga0373947_0190358 | Ga0373947_0190358_459_983 | 151 |
| 315 | 3300041496 | Ga0451839_1410063 | Ga0451839_1410063_18_542 | 151 |
| 316 | 3300042436 | Ga0439435_0068346 | Ga0439435_0068346_264_770 | 151 |
| 317 | 3300045051 | Ga0451576_0743992 | Ga0451576_0743992_155_661 | 151 |
| 318 | 3300046454 | Ga0495592_0830393 | Ga0495592_0830393_25_537 | 151 |
| 319 | 3300046472 | Ga0495580_0003258 | Ga0495580_0003258_8012_8536 | 151 |
| 320 | 3300046499 | Ga0495594_0038985 | Ga0495594_0038985_1042_1566 | 151 |
| 321 | 3300046516 | Ga0495628_0313466 | Ga0495628_0313466_48_620 | 151 |
| 322 | 3300046526 | Ga0495666_0005431 | Ga0495666_0005431_2393_2917 | 151 |
| 323 | 3300046535 | Ga0495586_0003330 | Ga0495586_0003330_640_1164 | 151 |
| 324 | 3300046674 | Ga0495588_0008086 | Ga0495588_0008086_4271_4795 | 151 |
| 325 | 3300046681 | Ga0495647_0001261 | Ga0495647_0001261_779_1303 | 151 |
| 326 | 3300046683 | Ga0495658_0001458 | Ga0495658_0001458_7855_8379 | 151 |
| 327 | 3300047315 | Ga0495581_0007160 | Ga0495581_0007160_2719_3243 | 151 |
| 328 | 3300047318 | Ga0495636_0004078 | Ga0495636_0004078_4147_4656 | 151 |
| 329 | 3300047321 | Ga0495676_0004858 | Ga0495676_0004858_6810_7334 | 151 |
| 330 | 3300048906 | Ga0496103_0246924 | Ga0496103_0246924_541_1047 | 151 |
| 331 | 3300048909 | Ga0496106_0000353 | Ga0496106_0000353_26238_26744 | 151 |
| 332 | 3300048914 | Ga0496111_0220598 | Ga0496111_0220598_259_765 | 151 |
| 333 | 3300049514 | Ga0501291_073183 | Ga0501291_073183_110_619 | 151 |
| 334 | 3300049514 | Ga0501291_116639 | Ga0501291_116639_56_562 | 151 |
| 335 | 3300049522 | Ga0501299_006374 | Ga0501299_006374_347_853 | 151 |
| 336 | 3300049575 | Ga0501039_0458469 | Ga0501039_0458469_402_908 | 151 |
| 337 | 3300049577 | Ga0501041_0102091 | Ga0501041_0102091_148_654 | 151 |
| 338 | 3300049580 | Ga0501046_0090876 | Ga0501046_0090876_81_587 | 151 |
| 339 | 3300049587 | Ga0501071_0150679 | Ga0501071_0150679_673_1179 | 151 |
| 340 | 3300049592 | Ga0501076_0390604 | Ga0501076_0390604_44_550 | 151 |
| 341 | 3300049741 | Ga0501079_0166055 | Ga0501079_0166055_1173_1679 | 151 |
| 342 | 3300049824 | Ga0501045_1120024 | Ga0501045_1120024_51_557 | 151 |
| 343 | 3300050508 | nmdc:mga09592_375490_c1 | nmdc:mga09592_375490_c1_429_935 | 151 |
| 344 | 3300050510 | nmdc:mga06r32_161293_c1 | nmdc:mga06r32_161293_c1_318_824 | 151 |
| 345 | 3300050511 | nmdc:mga08y16_439948_c1 | nmdc:mga08y16_439948_c1_406_915 | 151 |
| 346 | 3300050511 | nmdc:mga08y16_856284_c1 | nmdc:mga08y16_856284_c1_328_837 | 151 |
| 347 | 3300053136 | Ga0500559_0143142 | Ga0500559_0143142_445_957 | 151 |
| 348 | 3300005842 | Ga0068858_100541516 | Ga0068858_1005415162 | 152 |
| 349 | 3300006852 | Ga0075433_10168533 | Ga0075433_101685331 | 152 |
| 350 | 3300006852 | Ga0075433_11011523 | Ga0075433_110115232 | 152 |
| 351 | 3300026035 | Ga0207703_10416683 | Ga0207703_104166832 | 152 |
| 352 | 3300026078 | Ga0207702_10101643 | Ga0207702_101016434 | 152 |
| 353 | 3300031731 | Ga0307405_11113419 | Ga0307405_111134191 | 152 |
| 354 | 3300032004 | Ga0307414_10528267 | Ga0307414_105282672 | 152 |
| 355 | 3300049519 | Ga0501296_011586 | Ga0501296_011586_102_611 | 152 |
| 356 | 3300050515 | nmdc:mga0a205_417621_c1 | nmdc:mga0a205_417621_c1_221_733 | 152 |
| 357 | 3300005289 | Ga0065704_10367499 | Ga0065704_103674992 | 153 |
| 358 | 3300005293 | Ga0065715_10962985 | Ga0065715_109629851 | 153 |
| 359 | 3300005295 | Ga0065707_10173185 | Ga0065707_101731852 | 153 |
| 360 | 3300005295 | Ga0065707_10846835 | Ga0065707_108468351 | 153 |
| 361 | 3300005328 | Ga0070676_10001406 | Ga0070676_100014062 | 153 |
| 362 | 3300005329 | Ga0070683_100003515 | Ga0070683_1000035152 | 153 |
| 363 | 3300005330 | Ga0070690_100016568 | Ga0070690_1000165682 | 153 |
| 364 | 3300005330 | Ga0070690_100193928 | Ga0070690_1001939282 | 153 |
| 365 | 3300005331 | Ga0070670_100005195 | Ga0070670_10000519510 | 153 |
| 366 | 3300005331 | Ga0070670_100252819 | Ga0070670_1002528192 | 153 |
| 367 | 3300005333 | Ga0070677_10086386 | Ga0070677_100863862 | 153 |
| 368 | 3300005333 | Ga0070677_10125758 | Ga0070677_101257582 | 153 |
| 369 | 3300005334 | Ga0068869_100003269 | Ga0068869_1000032698 | 153 |
| 370 | 3300005334 | Ga0068869_100003339 | Ga0068869_1000033394 | 153 |
| 371 | 3300005334 | Ga0068869_100005842 | Ga0068869_1000058423 | 153 |
| 372 | 3300005334 | Ga0068869_100203016 | Ga0068869_1002030162 | 153 |
| 373 | 3300005334 | Ga0068869_101094994 | Ga0068869_1010949941 | 153 |
| 374 | 3300005335 | Ga0070666_10001532 | Ga0070666_100015322 | 153 |
| 375 | 3300005335 | Ga0070666_10027573 | Ga0070666_100275732 | 153 |
| 376 | 3300005335 | Ga0070666_10489697 | Ga0070666_104896972 | 153 |
| 377 | 3300005337 | Ga0070682_100329616 | Ga0070682_1003296161 | 153 |
| 378 | 3300005338 | Ga0068868_100003224 | Ga0068868_1000032242 | 153 |
| 379 | 3300005338 | Ga0068868_100003921 | Ga0068868_1000039219 | 153 |
| 380 | 3300005338 | Ga0068868_100150123 | Ga0068868_1001501232 | 153 |
| 381 | 3300005340 | Ga0070689_100030682 | Ga0070689_1000306823 | 153 |
| 382 | 3300005340 | Ga0070689_100499672 | Ga0070689_1004996722 | 153 |
| 383 | 3300005341 | Ga0070691_10228340 | Ga0070691_102283402 | 153 |
| 384 | 3300005343 | Ga0070687_100000139 | Ga0070687_10000013924 | 153 |
| 385 | 3300005345 | Ga0070692_10008048 | Ga0070692_100080483 | 153 |
| 386 | 3300005347 | Ga0070668_100000553 | Ga0070668_10000055317 | 153 |
| 387 | 3300005347 | Ga0070668_100001829 | Ga0070668_1000018294 | 153 |
| 388 | 3300005347 | Ga0070668_100027620 | Ga0070668_1000276201 | 153 |
| 389 | 3300005347 | Ga0070668_100233465 | Ga0070668_1002334652 | 153 |
| 390 | 3300005347 | Ga0070668_100288544 | Ga0070668_1002885442 | 153 |
| 391 | 3300005347 | Ga0070668_100705899 | Ga0070668_1007058991 | 153 |
| 392 | 3300005353 | Ga0070669_100011703 | Ga0070669_1000117032 | 153 |
| 393 | 3300005353 | Ga0070669_100113075 | Ga0070669_1001130752 | 153 |
| 394 | 3300005354 | Ga0070675_100012659 | Ga0070675_1000126592 | 153 |
| 395 | 3300005354 | Ga0070675_100107221 | Ga0070675_1001072212 | 153 |
| 396 | 3300005355 | Ga0070671_100012100 | Ga0070671_1000121004 | 153 |
| 397 | 3300005355 | Ga0070671_100123074 | Ga0070671_1001230742 | 153 |
| 398 | 3300005355 | Ga0070671_100259147 | Ga0070671_1002591471 | 153 |
| 399 | 3300005356 | Ga0070674_100148057 | Ga0070674_1001480572 | 153 |
| 400 | 3300005356 | Ga0070674_100160383 | Ga0070674_1001603832 | 153 |
| 401 | 3300005356 | Ga0070674_100286421 | Ga0070674_1002864211 | 153 |
| 402 | 3300005356 | Ga0070674_100865250 | Ga0070674_1008652502 | 153 |
| 403 | 3300005364 | Ga0070673_100004291 | Ga0070673_1000042918 | 153 |
| 404 | 3300005364 | Ga0070673_100519856 | Ga0070673_1005198562 | 153 |
| 405 | 3300005364 | Ga0070673_100719390 | Ga0070673_1007193901 | 153 |
| 406 | 3300005365 | Ga0070688_100066343 | Ga0070688_1000663431 | 153 |
| 407 | 3300005366 | Ga0070659_100444822 | Ga0070659_1004448222 | 153 |
| 408 | 3300005367 | Ga0070667_100009252 | Ga0070667_1000092522 | 153 |
| 409 | 3300005367 | Ga0070667_100026164 | Ga0070667_1000261642 | 153 |
| 410 | 3300005406 | Ga0070703_10004181 | Ga0070703_100041815 | 153 |
| 411 | 3300005437 | Ga0070710_10251153 | Ga0070710_102511531 | 153 |
| 412 | 3300005438 | Ga0070701_10138222 | Ga0070701_101382222 | 153 |
| 413 | 3300005440 | Ga0070705_100211272 | Ga0070705_1002112722 | 153 |
| 414 | 3300005441 | Ga0070700_100000374 | Ga0070700_10000037420 | 153 |
| 415 | 3300005441 | Ga0070700_100885364 | Ga0070700_1008853641 | 153 |
| 416 | 3300005441 | Ga0070700_101025582 | Ga0070700_1010255821 | 153 |
| 417 | 3300005444 | Ga0070694_100001221 | Ga0070694_1000012219 | 153 |
| 418 | 3300005444 | Ga0070694_100092518 | Ga0070694_1000925183 | 153 |
| 419 | 3300005444 | Ga0070694_100114246 | Ga0070694_1001142462 | 153 |
| 420 | 3300005444 | Ga0070694_100616602 | Ga0070694_1006166022 | 153 |
| 421 | 3300005455 | Ga0070663_100349509 | Ga0070663_1003495092 | 153 |
| 422 | 3300005455 | Ga0070663_100523116 | Ga0070663_1005231162 | 153 |
| 423 | 3300005456 | Ga0070678_100014335 | Ga0070678_1000143354 | 153 |
| 424 | 3300005456 | Ga0070678_100175237 | Ga0070678_1001752372 | 153 |
| 425 | 3300005456 | Ga0070678_101215715 | Ga0070678_1012157151 | 153 |
| 426 | 3300005457 | Ga0070662_100136103 | Ga0070662_1001361032 | 153 |
| 427 | 3300005457 | Ga0070662_100799200 | Ga0070662_1007992001 | 153 |
| 428 | 3300005458 | Ga0070681_10135653 | Ga0070681_101356532 | 153 |
| 429 | 3300005459 | Ga0068867_100002804 | Ga0068867_1000028042 | 153 |
| 430 | 3300005459 | Ga0068867_100026483 | Ga0068867_1000264834 | 153 |
| 431 | 3300005459 | Ga0068867_100108575 | Ga0068867_1001085752 | 153 |
| 432 | 3300005459 | Ga0068867_100176558 | Ga0068867_1001765582 | 153 |
| 433 | 3300005459 | Ga0068867_100217565 | Ga0068867_1002175652 | 153 |
| 434 | 3300005459 | Ga0068867_100752900 | Ga0068867_1007529001 | 153 |
| 435 | 3300005459 | Ga0068867_101023212 | Ga0068867_1010232121 | 153 |
| 436 | 3300005466 | Ga0070685_10297270 | Ga0070685_102972702 | 153 |
| 437 | 3300005466 | Ga0070685_10511738 | Ga0070685_105117381 | 153 |
| 438 | 3300005467 | Ga0070706_100429719 | Ga0070706_1004297192 | 153 |
| 439 | 3300005468 | Ga0070707_101442371 | Ga0070707_1014423711 | 153 |
| 440 | 3300005471 | Ga0070698_100992188 | Ga0070698_1009921882 | 153 |
| 441 | 3300005471 | Ga0070698_101465006 | Ga0070698_1014650061 | 153 |
| 442 | 3300005518 | Ga0070699_100457184 | Ga0070699_1004571842 | 153 |
| 443 | 3300005530 | Ga0070679_100025788 | Ga0070679_1000257884 | 153 |
| 444 | 3300005535 | Ga0070684_100192719 | Ga0070684_1001927192 | 153 |
| 445 | 3300005539 | Ga0068853_100140234 | Ga0068853_1001402342 | 153 |
| 446 | 3300005543 | Ga0070672_100004288 | Ga0070672_1000042887 | 153 |
| 447 | 3300005543 | Ga0070672_100055056 | Ga0070672_1000550562 | 153 |
| 448 | 3300005543 | Ga0070672_100094372 | Ga0070672_1000943723 | 153 |
| 449 | 3300005544 | Ga0070686_100017659 | Ga0070686_1000176592 | 153 |
| 450 | 3300005544 | Ga0070686_100027666 | Ga0070686_1000276664 | 153 |
| 451 | 3300005545 | Ga0070695_100011120 | Ga0070695_1000111207 | 153 |
| 452 | 3300005545 | Ga0070695_100138917 | Ga0070695_1001389172 | 153 |
| 453 | 3300005545 | Ga0070695_100592935 | Ga0070695_1005929352 | 153 |
| 454 | 3300005546 | Ga0070696_100009847 | Ga0070696_1000098473 | 153 |
| 455 | 3300005546 | Ga0070696_100022409 | Ga0070696_1000224095 | 153 |
| 456 | 3300005546 | Ga0070696_100413428 | Ga0070696_1004134281 | 153 |
| 457 | 3300005546 | Ga0070696_100463781 | Ga0070696_1004637811 | 153 |
| 458 | 3300005546 | Ga0070696_101146917 | Ga0070696_1011469171 | 153 |
| 459 | 3300005548 | Ga0070665_100013156 | Ga0070665_10001315610 | 153 |
| 460 | 3300005548 | Ga0070665_101117197 | Ga0070665_1011171972 | 153 |
| 461 | 3300005549 | Ga0070704_100006411 | Ga0070704_1000064119 | 153 |
| 462 | 3300005549 | Ga0070704_100019651 | Ga0070704_1000196514 | 153 |
| 463 | 3300005549 | Ga0070704_100056487 | Ga0070704_1000564874 | 153 |
| 464 | 3300005563 | Ga0068855_100011048 | Ga0068855_1000110485 | 153 |
| 465 | 3300005563 | Ga0068855_100483866 | Ga0068855_1004838661 | 153 |
| 466 | 3300005564 | Ga0070664_100484371 | Ga0070664_1004843712 | 153 |
| 467 | 3300005564 | Ga0070664_100727218 | Ga0070664_1007272182 | 153 |
| 468 | 3300005564 | Ga0070664_100844740 | Ga0070664_1008447402 | 153 |
| 469 | 3300005577 | Ga0068857_100227016 | Ga0068857_1002270162 | 153 |
| 470 | 3300005578 | Ga0068854_100048676 | Ga0068854_1000486763 | 153 |
| 471 | 3300005614 | Ga0068856_100065408 | Ga0068856_1000654082 | 153 |
| 472 | 3300005615 | Ga0070702_100007791 | Ga0070702_1000077913 | 153 |
| 473 | 3300005615 | Ga0070702_100334784 | Ga0070702_1003347842 | 153 |
| 474 | 3300005616 | Ga0068852_100915872 | Ga0068852_1009158722 | 153 |
| 475 | 3300005617 | Ga0068859_100019223 | Ga0068859_1000192236 | 153 |
| 476 | 3300005617 | Ga0068859_100051616 | Ga0068859_1000516164 | 153 |
| 477 | 3300005617 | Ga0068859_100106540 | Ga0068859_1001065402 | 153 |
| 478 | 3300005617 | Ga0068859_100320738 | Ga0068859_1003207382 | 153 |
| 479 | 3300005617 | Ga0068859_100369576 | Ga0068859_1003695762 | 153 |
| 480 | 3300005617 | Ga0068859_100420040 | Ga0068859_1004200402 | 153 |
| 481 | 3300005618 | Ga0068864_100010798 | Ga0068864_1000107982 | 153 |
| 482 | 3300005618 | Ga0068864_100014467 | Ga0068864_1000144674 | 153 |
| 483 | 3300005618 | Ga0068864_100056893 | Ga0068864_1000568934 | 153 |
| 484 | 3300005618 | Ga0068864_100356244 | Ga0068864_1003562442 | 153 |
| 485 | 3300005718 | Ga0068866_10001678 | Ga0068866_100016782 | 153 |
| 486 | 3300005718 | Ga0068866_10091197 | Ga0068866_100911972 | 153 |
| 487 | 3300005719 | Ga0068861_100081661 | Ga0068861_1000816613 | 153 |
| 488 | 3300005719 | Ga0068861_100504920 | Ga0068861_1005049202 | 153 |
| 489 | 3300005719 | Ga0068861_100678397 | Ga0068861_1006783972 | 153 |
| 490 | 3300005840 | Ga0068870_10030932 | Ga0068870_100309323 | 153 |
| 491 | 3300005840 | Ga0068870_10040091 | Ga0068870_100400912 | 153 |
| 492 | 3300005841 | Ga0068863_100002779 | Ga0068863_1000027795 | 153 |
| 493 | 3300005841 | Ga0068863_100029642 | Ga0068863_1000296422 | 153 |
| 494 | 3300005841 | Ga0068863_100095134 | Ga0068863_1000951342 | 153 |
| 495 | 3300005841 | Ga0068863_100104413 | Ga0068863_1001044134 | 153 |
| 496 | 3300005841 | Ga0068863_100681989 | Ga0068863_1006819892 | 153 |
| 497 | 3300005841 | Ga0068863_101153982 | Ga0068863_1011539821 | 153 |
| 498 | 3300005842 | Ga0068858_100006644 | Ga0068858_10000664410 | 153 |
| 499 | 3300005842 | Ga0068858_100022411 | Ga0068858_1000224116 | 153 |
| 500 | 3300005842 | Ga0068858_100140876 | Ga0068858_1001408762 | 153 |
| 501 | 3300005842 | Ga0068858_100189487 | Ga0068858_1001894872 | 153 |
| 502 | 3300005843 | Ga0068860_100016867 | Ga0068860_1000168672 | 153 |
| 503 | 3300005843 | Ga0068860_100017448 | Ga0068860_1000174482 | 153 |
| 504 | 3300005843 | Ga0068860_100205548 | Ga0068860_1002055482 | 153 |
| 505 | 3300005843 | Ga0068860_100492758 | Ga0068860_1004927582 | 153 |
| 506 | 3300005843 | Ga0068860_100576602 | Ga0068860_1005766022 | 153 |
| 507 | 3300005843 | Ga0068860_100750371 | Ga0068860_1007503712 | 153 |
| 508 | 3300005843 | Ga0068860_100992042 | Ga0068860_1009920421 | 153 |
| 509 | 3300005844 | Ga0068862_100018766 | Ga0068862_1000187662 | 153 |
| 510 | 3300005844 | Ga0068862_100128722 | Ga0068862_1001287223 | 153 |
| 511 | 3300005844 | Ga0068862_100128972 | Ga0068862_1001289722 | 153 |
| 512 | 3300005844 | Ga0068862_100173270 | Ga0068862_1001732702 | 153 |
| 513 | 3300005844 | Ga0068862_100196411 | Ga0068862_1001964112 | 153 |
| 514 | 3300005844 | Ga0068862_100209317 | Ga0068862_1002093172 | 153 |
| 515 | 3300005844 | Ga0068862_100399367 | Ga0068862_1003993672 | 153 |
| 516 | 3300005844 | Ga0068862_100406277 | Ga0068862_1004062772 | 153 |
| 517 | 3300005844 | Ga0068862_100744777 | Ga0068862_1007447772 | 153 |
| 518 | 3300005844 | Ga0068862_101279875 | Ga0068862_1012798751 | 153 |
| 519 | 3300005844 | Ga0068862_101404517 | Ga0068862_1014045171 | 153 |
| 520 | 3300006195 | Ga0075366_10016409 | Ga0075366_100164093 | 153 |
| 521 | 3300006237 | Ga0097621_100004433 | Ga0097621_1000044338 | 153 |
| 522 | 3300006237 | Ga0097621_100014655 | Ga0097621_1000146552 | 153 |
| 523 | 3300006237 | Ga0097621_100028572 | Ga0097621_1000285723 | 153 |
| 524 | 3300006237 | Ga0097621_100059139 | Ga0097621_1000591394 | 153 |
| 525 | 3300006358 | Ga0068871_100001217 | Ga0068871_1000012174 | 153 |
| 526 | 3300006358 | Ga0068871_100001947 | Ga0068871_1000019472 | 153 |
| 527 | 3300006358 | Ga0068871_100009329 | Ga0068871_1000093297 | 153 |
| 528 | 3300006358 | Ga0068871_100024471 | Ga0068871_1000244715 | 153 |
| 529 | 3300006358 | Ga0068871_100363427 | Ga0068871_1003634272 | 153 |
| 530 | 3300006358 | Ga0068871_100462541 | Ga0068871_1004625412 | 153 |
| 531 | 3300006358 | Ga0068871_101012900 | Ga0068871_1010129002 | 153 |
| 532 | 3300006844 | Ga0075428_100212084 | Ga0075428_1002120842 | 153 |
| 533 | 3300006844 | Ga0075428_101471643 | Ga0075428_1014716432 | 153 |
| 534 | 3300006847 | Ga0075431_100035634 | Ga0075431_1000356343 | 153 |
| 535 | 3300006852 | Ga0075433_10737483 | Ga0075433_107374832 | 153 |
| 536 | 3300006880 | Ga0075429_100729213 | Ga0075429_1007292132 | 153 |
| 537 | 3300006881 | Ga0068865_100006340 | Ga0068865_1000063405 | 153 |
| 538 | 3300006881 | Ga0068865_100103934 | Ga0068865_1001039342 | 153 |
| 539 | 3300006881 | Ga0068865_100321595 | Ga0068865_1003215952 | 153 |
| 540 | 3300006931 | Ga0097620_100019223 | Ga0097620_1000192236 | 153 |
| 541 | 3300006931 | Ga0097620_100051611 | Ga0097620_1000516113 | 153 |
| 542 | 3300006931 | Ga0097620_100106540 | Ga0097620_1001065404 | 153 |
| 543 | 3300006931 | Ga0097620_100320732 | Ga0097620_1003207322 | 153 |
| 544 | 3300006931 | Ga0097620_100369575 | Ga0097620_1003695752 | 153 |
| 545 | 3300006931 | Ga0097620_100420020 | Ga0097620_1004200202 | 153 |
| 546 | 3300007076 | Ga0075435_100295086 | Ga0075435_1002950862 | 153 |
| 547 | 3300009094 | Ga0111539_10578456 | Ga0111539_105784561 | 153 |
| 548 | 3300009098 | Ga0105245_10007955 | Ga0105245_100079559 | 153 |
| 549 | 3300009098 | Ga0105245_10140491 | Ga0105245_101404912 | 153 |
| 550 | 3300009098 | Ga0105245_10321831 | Ga0105245_103218312 | 153 |
| 551 | 3300009098 | Ga0105245_10473920 | Ga0105245_104739202 | 153 |
| 552 | 3300009101 | Ga0105247_10038720 | Ga0105247_100387204 | 153 |
| 553 | 3300009147 | Ga0114129_10059617 | Ga0114129_100596177 | 153 |
| 554 | 3300009148 | Ga0105243_10038478 | Ga0105243_100384784 | 153 |
| 555 | 3300009148 | Ga0105243_10093097 | Ga0105243_100930972 | 153 |
| 556 | 3300009148 | Ga0105243_10313230 | Ga0105243_103132302 | 153 |
| 557 | 3300009148 | Ga0105243_10331948 | Ga0105243_103319482 | 153 |
| 558 | 3300009148 | Ga0105243_10376513 | Ga0105243_103765131 | 153 |
| 559 | 3300009174 | Ga0105241_10067205 | Ga0105241_100672053 | 153 |
| 560 | 3300009176 | Ga0105242_10364006 | Ga0105242_103640062 | 153 |
| 561 | 3300009176 | Ga0105242_10871161 | Ga0105242_108711612 | 153 |
| 562 | 3300009177 | Ga0105248_10008149 | Ga0105248_100081495 | 153 |
| 563 | 3300009177 | Ga0105248_10014298 | Ga0105248_100142984 | 153 |
| 564 | 3300009177 | Ga0105248_10195035 | Ga0105248_101950351 | 153 |
| 565 | 3300009177 | Ga0105248_10301555 | Ga0105248_103015552 | 153 |
| 566 | 3300009177 | Ga0105248_10416896 | Ga0105248_104168962 | 153 |
| 567 | 3300009177 | Ga0105248_10919275 | Ga0105248_109192752 | 153 |
| 568 | 3300009177 | Ga0105248_11682742 | Ga0105248_116827421 | 153 |
| 569 | 3300009553 | Ga0105249_10010159 | Ga0105249_100101592 | 153 |
| 570 | 3300009553 | Ga0105249_10056270 | Ga0105249_100562702 | 153 |
| 571 | 3300009553 | Ga0105249_10941885 | Ga0105249_109418852 | 153 |
| 572 | 3300010375 | Ga0105239_10090003 | Ga0105239_100900032 | 153 |
| 573 | 3300011119 | Ga0105246_10930533 | Ga0105246_109305331 | 153 |
| 574 | 3300013102 | Ga0157371_10459264 | Ga0157371_104592642 | 153 |
| 575 | 3300013296 | Ga0157374_10229316 | Ga0157374_102293162 | 153 |
| 576 | 3300013297 | Ga0157378_10149000 | Ga0157378_101490003 | 153 |
| 577 | 3300013297 | Ga0157378_11445407 | Ga0157378_114454072 | 153 |
| 578 | 3300013306 | Ga0163162_10007370 | Ga0163162_100073704 | 153 |
| 579 | 3300013306 | Ga0163162_10187695 | Ga0163162_101876953 | 153 |
| 580 | 3300013306 | Ga0163162_10357833 | Ga0163162_103578332 | 153 |
| 581 | 3300013306 | Ga0163162_10398791 | Ga0163162_103987912 | 153 |
| 582 | 3300013306 | Ga0163162_11187131 | Ga0163162_111871312 | 153 |
| 583 | 3300013308 | Ga0157375_10005693 | Ga0157375_100056936 | 153 |
| 584 | 3300013308 | Ga0157375_10040255 | Ga0157375_100402556 | 153 |
| 585 | 3300013308 | Ga0157375_10042034 | Ga0157375_100420342 | 153 |
| 586 | 3300013308 | Ga0157375_10209989 | Ga0157375_102099892 | 153 |
| 587 | 3300013308 | Ga0157375_10453703 | Ga0157375_104537032 | 153 |
| 588 | 3300013308 | Ga0157375_11281319 | Ga0157375_112813192 | 153 |
| 589 | 3300013308 | Ga0157375_12204822 | Ga0157375_122048221 | 153 |
| 590 | 3300014325 | Ga0163163_10006010 | Ga0163163_100060106 | 153 |
| 591 | 3300014325 | Ga0163163_10292229 | Ga0163163_102922292 | 153 |
| 592 | 3300014326 | Ga0157380_10045305 | Ga0157380_100453052 | 153 |
| 593 | 3300014326 | Ga0157380_10112646 | Ga0157380_101126462 | 153 |
| 594 | 3300014326 | Ga0157380_10454974 | Ga0157380_104549742 | 153 |
| 595 | 3300014326 | Ga0157380_11050165 | Ga0157380_110501652 | 153 |
| 596 | 3300014326 | Ga0157380_11153498 | Ga0157380_111534982 | 153 |
| 597 | 3300014745 | Ga0157377_10232025 | Ga0157377_102320252 | 153 |
| 598 | 3300014968 | Ga0157379_10007045 | Ga0157379_100070452 | 153 |
| 599 | 3300014968 | Ga0157379_10040735 | Ga0157379_100407354 | 153 |
| 600 | 3300014968 | Ga0157379_11321797 | Ga0157379_113217972 | 153 |
| 601 | 3300014968 | Ga0157379_11610099 | Ga0157379_116100991 | 153 |
| 602 | 3300014969 | Ga0157376_10036486 | Ga0157376_100364864 | 153 |
| 603 | 3300014969 | Ga0157376_10353660 | Ga0157376_103536602 | 153 |
| 604 | 3300017792 | Ga0163161_10011147 | Ga0163161_100111472 | 153 |
| 605 | 3300017792 | Ga0163161_10024325 | Ga0163161_100243254 | 153 |
| 606 | 3300017792 | Ga0163161_11007443 | Ga0163161_110074431 | 153 |
| 607 | 3300025271 | Ga0207666_1008853 | Ga0207666_10088532 | 153 |
| 608 | 3300025292 | Ga0209676_1000214 | Ga0209676_100021439 | 153 |
| 609 | 3300025315 | Ga0207697_10005571 | Ga0207697_100055712 | 153 |
| 610 | 3300025885 | Ga0207653_10005279 | Ga0207653_100052795 | 153 |
| 611 | 3300025899 | Ga0207642_10014088 | Ga0207642_100140883 | 153 |
| 612 | 3300025899 | Ga0207642_10110526 | Ga0207642_101105262 | 153 |
| 613 | 3300025901 | Ga0207688_10095870 | Ga0207688_100958702 | 153 |
| 614 | 3300025903 | Ga0207680_10002705 | Ga0207680_100027053 | 153 |
| 615 | 3300025903 | Ga0207680_10023216 | Ga0207680_100232161 | 153 |
| 616 | 3300025903 | Ga0207680_10445824 | Ga0207680_104458242 | 153 |
| 617 | 3300025907 | Ga0207645_10001263 | Ga0207645_1000126318 | 153 |
| 618 | 3300025907 | Ga0207645_10073047 | Ga0207645_100730472 | 153 |
| 619 | 3300025908 | Ga0207643_10013531 | Ga0207643_100135312 | 153 |
| 620 | 3300025908 | Ga0207643_10161403 | Ga0207643_101614032 | 153 |
| 621 | 3300025908 | Ga0207643_10380375 | Ga0207643_103803752 | 153 |
| 622 | 3300025910 | Ga0207684_10663315 | Ga0207684_106633152 | 153 |
| 623 | 3300025918 | Ga0207662_10000214 | Ga0207662_1000021425 | 153 |
| 624 | 3300025921 | Ga0207652_10051030 | Ga0207652_100510304 | 153 |
| 625 | 3300025922 | Ga0207646_10103769 | Ga0207646_101037692 | 153 |
| 626 | 3300025922 | Ga0207646_11055183 | Ga0207646_110551832 | 153 |
| 627 | 3300025923 | Ga0207681_10024887 | Ga0207681_100248874 | 153 |
| 628 | 3300025923 | Ga0207681_10053714 | Ga0207681_100537143 | 153 |
| 629 | 3300025923 | Ga0207681_10064043 | Ga0207681_100640433 | 153 |
| 630 | 3300025925 | Ga0207650_10017437 | Ga0207650_100174373 | 153 |
| 631 | 3300025925 | Ga0207650_10054766 | Ga0207650_100547663 | 153 |
| 632 | 3300025925 | Ga0207650_10075623 | Ga0207650_100756233 | 153 |
| 633 | 3300025925 | Ga0207650_10081064 | Ga0207650_100810642 | 153 |
| 634 | 3300025925 | Ga0207650_10102176 | Ga0207650_101021761 | 153 |
| 635 | 3300025926 | Ga0207659_10001564 | Ga0207659_100015644 | 153 |
| 636 | 3300025926 | Ga0207659_10022668 | Ga0207659_100226682 | 153 |
| 637 | 3300025926 | Ga0207659_10077692 | Ga0207659_100776924 | 153 |
| 638 | 3300025927 | Ga0207687_10045463 | Ga0207687_100454633 | 153 |
| 639 | 3300025931 | Ga0207644_10017212 | Ga0207644_100172124 | 153 |
| 640 | 3300025931 | Ga0207644_10116540 | Ga0207644_101165402 | 153 |
| 641 | 3300025931 | Ga0207644_10156898 | Ga0207644_101568983 | 153 |
| 642 | 3300025931 | Ga0207644_10221443 | Ga0207644_102214432 | 153 |
| 643 | 3300025932 | Ga0207690_10871979 | Ga0207690_108719792 | 153 |
| 644 | 3300025933 | Ga0207706_10050841 | Ga0207706_100508414 | 153 |
| 645 | 3300025934 | Ga0207686_10019943 | Ga0207686_100199434 | 153 |
| 646 | 3300025934 | Ga0207686_10627266 | Ga0207686_106272661 | 153 |
| 647 | 3300025935 | Ga0207709_10195171 | Ga0207709_101951711 | 153 |
| 648 | 3300025935 | Ga0207709_10221923 | Ga0207709_102219232 | 153 |
| 649 | 3300025935 | Ga0207709_10249410 | Ga0207709_102494102 | 153 |
| 650 | 3300025936 | Ga0207670_10111012 | Ga0207670_101110122 | 153 |
| 651 | 3300025936 | Ga0207670_10342261 | Ga0207670_103422611 | 153 |
| 652 | 3300025937 | Ga0207669_10010050 | Ga0207669_100100502 | 153 |
| 653 | 3300025937 | Ga0207669_10216047 | Ga0207669_102160472 | 153 |
| 654 | 3300025937 | Ga0207669_10231575 | Ga0207669_102315752 | 153 |
| 655 | 3300025938 | Ga0207704_10047553 | Ga0207704_100475532 | 153 |
| 656 | 3300025938 | Ga0207704_10838160 | Ga0207704_108381601 | 153 |
| 657 | 3300025939 | Ga0207665_10086177 | Ga0207665_100861772 | 153 |
| 658 | 3300025940 | Ga0207691_10000486 | Ga0207691_1000048627 | 153 |
| 659 | 3300025940 | Ga0207691_10007762 | Ga0207691_1000776212 | 153 |
| 660 | 3300025940 | Ga0207691_10045827 | Ga0207691_100458272 | 153 |
| 661 | 3300025940 | Ga0207691_10052318 | Ga0207691_100523183 | 153 |
| 662 | 3300025940 | Ga0207691_10296198 | Ga0207691_102961982 | 153 |
| 663 | 3300025940 | Ga0207691_10522238 | Ga0207691_105222382 | 153 |
| 664 | 3300025941 | Ga0207711_10003467 | Ga0207711_100034674 | 153 |
| 665 | 3300025941 | Ga0207711_10186931 | Ga0207711_101869313 | 153 |
| 666 | 3300025941 | Ga0207711_10345933 | Ga0207711_103459332 | 153 |
| 667 | 3300025941 | Ga0207711_10604398 | Ga0207711_106043982 | 153 |
| 668 | 3300025941 | Ga0207711_10626640 | Ga0207711_106266401 | 153 |
| 669 | 3300025942 | Ga0207689_10001553 | Ga0207689_100015535 | 153 |
| 670 | 3300025942 | Ga0207689_10011895 | Ga0207689_100118953 | 153 |
| 671 | 3300025942 | Ga0207689_10014359 | Ga0207689_100143595 | 153 |
| 672 | 3300025942 | Ga0207689_10923284 | Ga0207689_109232842 | 153 |
| 673 | 3300025949 | Ga0207667_10082654 | Ga0207667_100826544 | 153 |
| 674 | 3300025960 | Ga0207651_10001328 | Ga0207651_100013287 | 153 |
| 675 | 3300025960 | Ga0207651_10082842 | Ga0207651_100828422 | 153 |
| 676 | 3300025960 | Ga0207651_10084257 | Ga0207651_100842572 | 153 |
| 677 | 3300025961 | Ga0207712_10046922 | Ga0207712_100469222 | 153 |
| 678 | 3300025961 | Ga0207712_10048193 | Ga0207712_100481932 | 153 |
| 679 | 3300025961 | Ga0207712_10677516 | Ga0207712_106775161 | 153 |
| 680 | 3300025961 | Ga0207712_10967381 | Ga0207712_109673811 | 153 |
| 681 | 3300025972 | Ga0207668_10002243 | Ga0207668_100022438 | 153 |
| 682 | 3300025972 | Ga0207668_10005311 | Ga0207668_100053112 | 153 |
| 683 | 3300025972 | Ga0207668_10039464 | Ga0207668_100394642 | 153 |
| 684 | 3300025972 | Ga0207668_10249450 | Ga0207668_102494502 | 153 |
| 685 | 3300025972 | Ga0207668_10269851 | Ga0207668_102698512 | 153 |
| 686 | 3300025972 | Ga0207668_10510622 | Ga0207668_105106222 | 153 |
| 687 | 3300025972 | Ga0207668_10704872 | Ga0207668_107048721 | 153 |
| 688 | 3300025972 | Ga0207668_10946098 | Ga0207668_109460982 | 153 |
| 689 | 3300025981 | Ga0207640_10091347 | Ga0207640_100913472 | 153 |
| 690 | 3300025981 | Ga0207640_10653989 | Ga0207640_106539892 | 153 |
| 691 | 3300025986 | Ga0207658_10025142 | Ga0207658_100251422 | 153 |
| 692 | 3300025986 | Ga0207658_10085263 | Ga0207658_100852632 | 153 |
| 693 | 3300025986 | Ga0207658_10292302 | Ga0207658_102923022 | 153 |
| 694 | 3300026023 | Ga0207677_10004025 | Ga0207677_100040259 | 153 |
| 695 | 3300026023 | Ga0207677_10302789 | Ga0207677_103027892 | 153 |
| 696 | 3300026035 | Ga0207703_10000559 | Ga0207703_1000055933 | 153 |
| 697 | 3300026035 | Ga0207703_10113356 | Ga0207703_101133563 | 153 |
| 698 | 3300026035 | Ga0207703_10274500 | Ga0207703_102745002 | 153 |
| 699 | 3300026035 | Ga0207703_10528531 | Ga0207703_105285312 | 153 |
| 700 | 3300026035 | Ga0207703_10902855 | Ga0207703_109028552 | 153 |
| 701 | 3300026041 | Ga0207639_10562146 | Ga0207639_105621462 | 153 |
| 702 | 3300026067 | Ga0207678_10169856 | Ga0207678_101698562 | 153 |
| 703 | 3300026067 | Ga0207678_10196589 | Ga0207678_101965892 | 153 |
| 704 | 3300026075 | Ga0207708_10016731 | Ga0207708_100167314 | 153 |
| 705 | 3300026075 | Ga0207708_10410773 | Ga0207708_104107731 | 153 |
| 706 | 3300026078 | Ga0207702_10059945 | Ga0207702_100599452 | 153 |
| 707 | 3300026088 | Ga0207641_10002817 | Ga0207641_100028174 | 153 |
| 708 | 3300026088 | Ga0207641_10041229 | Ga0207641_100412293 | 153 |
| 709 | 3300026088 | Ga0207641_10096415 | Ga0207641_100964155 | 153 |
| 710 | 3300026088 | Ga0207641_10619328 | Ga0207641_106193281 | 153 |
| 711 | 3300026089 | Ga0207648_10000567 | Ga0207648_1000056722 | 153 |
| 712 | 3300026089 | Ga0207648_10001585 | Ga0207648_1000158523 | 153 |
| 713 | 3300026089 | Ga0207648_10041382 | Ga0207648_100413822 | 153 |
| 714 | 3300026089 | Ga0207648_10127349 | Ga0207648_101273492 | 153 |
| 715 | 3300026089 | Ga0207648_10131429 | Ga0207648_101314292 | 153 |
| 716 | 3300026089 | Ga0207648_10463927 | Ga0207648_104639272 | 153 |
| 717 | 3300026089 | Ga0207648_10491727 | Ga0207648_104917272 | 153 |
| 718 | 3300026089 | Ga0207648_10522246 | Ga0207648_105222462 | 153 |
| 719 | 3300026089 | Ga0207648_10846219 | Ga0207648_108462192 | 153 |
| 720 | 3300026095 | Ga0207676_10030901 | Ga0207676_100309012 | 153 |
| 721 | 3300026095 | Ga0207676_10032345 | Ga0207676_100323454 | 153 |
| 722 | 3300026095 | Ga0207676_10783926 | Ga0207676_107839262 | 153 |
| 723 | 3300026095 | Ga0207676_11605391 | Ga0207676_116053911 | 153 |
| 724 | 3300026116 | Ga0207674_10011703 | Ga0207674_100117039 | 153 |
| 725 | 3300026118 | Ga0207675_100001190 | Ga0207675_1000011904 | 153 |
| 726 | 3300026118 | Ga0207675_100516759 | Ga0207675_1005167592 | 153 |
| 727 | 3300026121 | Ga0207683_10002530 | Ga0207683_100025304 | 153 |
| 728 | 3300026121 | Ga0207683_10012744 | Ga0207683_100127446 | 153 |
| 729 | 3300026121 | Ga0207683_10029332 | Ga0207683_100293323 | 153 |
| 730 | 3300026121 | Ga0207683_10094688 | Ga0207683_100946883 | 153 |
| 731 | 3300026121 | Ga0207683_10666622 | Ga0207683_106666221 | 153 |
| 732 | 3300026142 | Ga0207698_10658978 | Ga0207698_106589782 | 153 |
| 733 | 3300026142 | Ga0207698_10868640 | Ga0207698_108686401 | 153 |
| 734 | 3300026142 | Ga0207698_11104496 | Ga0207698_111044961 | 153 |
| 735 | 3300027665 | Ga0209983_1021656 | Ga0209983_10216563 | 153 |
| 736 | 3300027907 | Ga0207428_10038590 | Ga0207428_100385902 | 153 |
| 737 | 3300028379 | Ga0268266_10401163 | Ga0268266_104011632 | 153 |
| 738 | 3300028380 | Ga0268265_10019253 | Ga0268265_100192533 | 153 |
| 739 | 3300028380 | Ga0268265_10029417 | Ga0268265_100294173 | 153 |
| 740 | 3300028380 | Ga0268265_10158364 | Ga0268265_101583642 | 153 |
| 741 | 3300028380 | Ga0268265_10178046 | Ga0268265_101780462 | 153 |
| 742 | 3300028380 | Ga0268265_10288412 | Ga0268265_102884122 | 153 |
| 743 | 3300028380 | Ga0268265_10363799 | Ga0268265_103637992 | 153 |
| 744 | 3300028380 | Ga0268265_10388754 | Ga0268265_103887542 | 153 |
| 745 | 3300028380 | Ga0268265_10606922 | Ga0268265_106069222 | 153 |
| 746 | 3300028380 | Ga0268265_11334259 | Ga0268265_113342592 | 153 |
| 747 | 3300028381 | Ga0268264_10027956 | Ga0268264_100279562 | 153 |
| 748 | 3300028381 | Ga0268264_10044768 | Ga0268264_100447682 | 153 |
| 749 | 3300028381 | Ga0268264_10053029 | Ga0268264_100530293 | 153 |
| 750 | 3300028381 | Ga0268264_10153041 | Ga0268264_101530413 | 153 |
| 751 | 3300028381 | Ga0268264_10536929 | Ga0268264_105369292 | 153 |
| 752 | 3300028381 | Ga0268264_10838326 | Ga0268264_108383262 | 153 |
| 753 | 3300028381 | Ga0268264_10851676 | Ga0268264_108516762 | 153 |
| 754 | 3300031901 | Ga0307406_10402359 | Ga0307406_104023592 | 153 |
| 755 | 3300032126 | Ga0307415_100674385 | Ga0307415_1006743852 | 153 |
| 756 | 3300035090 | Ga0373949_0012467 | Ga0373949_0012467_431_943 | 153 |
| 757 | 3300035092 | Ga0373952_0007186 | Ga0373952_0007186_1056_1568 | 153 |
| 758 | 3300035117 | Ga0373953_0001098 | Ga0373953_0001098_4306_4824 | 153 |
| 759 | 3300035118 | Ga0373954_0000886 | Ga0373954_0000886_788_1300 | 153 |
| 760 | 3300035118 | Ga0373954_0000956 | Ga0373954_0000956_5638_6156 | 153 |
| 761 | 3300035119 | Ga0373956_0006046 | Ga0373956_0006046_2843_3361 | 153 |
| 762 | 3300035120 | Ga0373957_0008637 | Ga0373957_0008637_1469_1987 | 153 |
| 763 | 3300035172 | Ga0373955_0002788 | Ga0373955_0002788_3250_3768 | 153 |
| 764 | 3300035242 | Ga0373962_0285849 | Ga0373962_0285849_39_551 | 153 |
| 765 | 3300035410 | Ga0373924_0050301 | Ga0373924_0050301_945_1457 | 153 |
| 766 | 3300035410 | Ga0373924_0106831 | Ga0373924_0106831_48_560 | 153 |
| 767 | 3300035692 | Ga0373935_0003235 | Ga0373935_0003235_802_1320 | 153 |
| 768 | 3300035692 | Ga0373935_0020689 | Ga0373935_0020689_2689_3201 | 153 |
| 769 | 3300035695 | Ga0373927_0012033 | Ga0373927_0012033_1909_2421 | 153 |
| 770 | 3300035724 | Ga0373933_0093901 | Ga0373933_0093901_1302_1820 | 153 |
| 771 | 3300036401 | Ga0373937_0001375 | Ga0373937_0001375_7107_7619 | 153 |
| 772 | 3300036401 | Ga0373937_0116295 | Ga0373937_0116295_1401_1919 | 153 |
| 773 | 3300037068 | Ga0373925_0630283 | Ga0373925_0630283_77_589 | 153 |
| 774 | 3300041413 | Ga0439465_0221533 | Ga0439465_0221533_49_567 | 153 |
| 775 | 3300041507 | Ga0451851_0505296 | Ga0451851_0505296_42_560 | 153 |
| 776 | 3300045051 | Ga0451576_0015516 | Ga0451576_0015516_5396_5908 | 153 |
| 777 | 3300046454 | Ga0495592_0009555 | Ga0495592_0009555_176_694 | 153 |
| 778 | 3300046462 | Ga0495651_0007383 | Ga0495651_0007383_623_1141 | 153 |
| 779 | 3300046463 | Ga0495653_0052750 | Ga0495653_0052750_35_553 | 153 |
| 780 | 3300046472 | Ga0495580_0011647 | Ga0495580_0011647_2004_2522 | 153 |
| 781 | 3300046475 | Ga0495639_0003438 | Ga0495639_0003438_2211_2729 | 153 |
| 782 | 3300046476 | Ga0495662_0001381 | Ga0495662_0001381_8797_9315 | 153 |
| 783 | 3300046477 | Ga0495664_0015525 | Ga0495664_0015525_1809_2327 | 153 |
| 784 | 3300046511 | Ga0495608_0037927 | Ga0495608_0037927_2329_2847 | 153 |
| 785 | 3300046511 | Ga0495608_0064356 | Ga0495608_0064356_806_1318 | 153 |
| 786 | 3300046514 | Ga0495618_0014540 | Ga0495618_0014540_1085_1603 | 153 |
| 787 | 3300046516 | Ga0495628_0056593 | Ga0495628_0056593_367_885 | 153 |
| 788 | 3300046516 | Ga0495628_0058060 | Ga0495628_0058060_822_1340 | 153 |
| 789 | 3300046516 | Ga0495628_0729333 | Ga0495628_0729333_160_678 | 153 |
| 790 | 3300046517 | Ga0495630_0002652 | Ga0495630_0002652_8877_9395 | 153 |
| 791 | 3300046517 | Ga0495630_0307648 | Ga0495630_0307648_383_895 | 153 |
| 792 | 3300046517 | Ga0495630_0990167 | Ga0495630_0990167_53_571 | 153 |
| 793 | 3300046529 | Ga0495652_0383264 | Ga0495652_0383264_459_977 | 153 |
| 794 | 3300046533 | Ga0495640_0015829 | Ga0495640_0015829_2300_2818 | 153 |
| 795 | 3300046533 | Ga0495640_0329208 | Ga0495640_0329208_106_624 | 153 |
| 796 | 3300046535 | Ga0495586_0008942 | Ga0495586_0008942_1821_2339 | 153 |
| 797 | 3300046535 | Ga0495586_0201354 | Ga0495586_0201354_18_536 | 153 |
| 798 | 3300046536 | Ga0495587_0015110 | Ga0495587_0015110_2801_3319 | 153 |
| 799 | 3300046539 | Ga0495621_0045695 | Ga0495621_0045695_702_1214 | 153 |
| 800 | 3300046557 | Ga0495622_0022353 | Ga0495622_0022353_795_1313 | 153 |
| 801 | 3300046559 | Ga0495667_0007991 | Ga0495667_0007991_3665_4183 | 153 |
| 802 | 3300046559 | Ga0495667_0035573 | Ga0495667_0035573_2159_2677 | 153 |
| 803 | 3300046559 | Ga0495667_0315589 | Ga0495667_0315589_180_692 | 153 |
| 804 | 3300046642 | Ga0495634_0011268 | Ga0495634_0011268_3843_4361 | 153 |
| 805 | 3300046663 | Ga0495635_0043674 | Ga0495635_0043674_1171_1689 | 153 |
| 806 | 3300046663 | Ga0495635_0061937 | Ga0495635_0061937_306_818 | 153 |
| 807 | 3300046664 | Ga0495659_0084195 | Ga0495659_0084195_674_1186 | 153 |
| 808 | 3300046675 | Ga0495657_0015483 | Ga0495657_0015483_1941_2459 | 153 |
| 809 | 3300046675 | Ga0495657_0241703 | Ga0495657_0241703_265_777 | 153 |
| 810 | 3300046678 | Ga0495599_0202113 | Ga0495599_0202113_423_941 | 153 |
| 811 | 3300046680 | Ga0495646_0201361 | Ga0495646_0201361_184_702 | 153 |
| 812 | 3300046683 | Ga0495658_0023245 | Ga0495658_0023245_1469_1987 | 153 |
| 813 | 3300046684 | Ga0495669_0056633 | Ga0495669_0056633_437_949 | 153 |
| 814 | 3300046689 | Ga0495613_0032286 | Ga0495613_0032286_943_1461 | 153 |
| 815 | 3300046809 | Ga0495600_0009870 | Ga0495600_0009870_1726_2244 | 153 |
| 816 | 3300047317 | Ga0495604_0064137 | Ga0495604_0064137_981_1499 | 153 |
| 817 | 3300047317 | Ga0495604_0130988 | Ga0495604_0130988_168_680 | 153 |
| 818 | 3300047319 | Ga0495674_0005704 | Ga0495674_0005704_9676_10194 | 153 |
| 819 | 3300047322 | Ga0495680_0010363 | Ga0495680_0010363_3032_3550 | 153 |
| 820 | 3300047322 | Ga0495680_0449377 | Ga0495680_0449377_289_801 | 153 |
| 821 | 3300047444 | Ga0495675_0005938 | Ga0495675_0005938_1393_1911 | 153 |
| 822 | 3300047471 | Ga0495684_0009504 | Ga0495684_0009504_3993_4511 | 153 |
| 823 | 3300047471 | Ga0495684_0070548 | Ga0495684_0070548_766_1284 | 153 |
| 824 | 3300048088 | Ga0495602_0092121 | Ga0495602_0092121_813_1325 | 153 |
| 825 | 3300048088 | Ga0495602_0513574 | Ga0495602_0513574_45_563 | 153 |
| 826 | 3300048905 | Ga0496102_1027255 | Ga0496102_1027255_152_670 | 153 |
| 827 | 3300048910 | Ga0496107_0002903 | Ga0496107_0002903_9259_9771 | 153 |
| 828 | 3300048911 | Ga0496108_0155781 | Ga0496108_0155781_540_1052 | 153 |
| 829 | 3300048911 | Ga0496108_0472082 | Ga0496108_0472082_403_921 | 153 |
| 830 | 3300048912 | Ga0496109_0416451 | Ga0496109_0416451_181_693 | 153 |
| 831 | 3300049569 | Ga0501032_0268499 | Ga0501032_0268499_446_961 | 153 |
| 832 | 3300049570 | Ga0501033_0641057 | Ga0501033_0641057_72_590 | 153 |
| 833 | 3300049574 | Ga0501038_0935625 | Ga0501038_0935625_89_604 | 153 |
| 834 | 3300049576 | Ga0501040_0832380 | Ga0501040_0832380_32_550 | 153 |
| 835 | 3300049578 | Ga0501042_0424900 | Ga0501042_0424900_242_772 | 153 |
| 836 | 3300049579 | Ga0501043_0223851 | Ga0501043_0223851_349_867 | 153 |
| 837 | 3300049582 | Ga0501048_0202091 | Ga0501048_0202091_131_649 | 153 |
| 838 | 3300049585 | Ga0501069_0707338 | Ga0501069_0707338_13_531 | 153 |
| 839 | 3300049587 | Ga0501071_0310810 | Ga0501071_0310810_279_809 | 153 |
| 840 | 3300049591 | Ga0501075_0060907 | Ga0501075_0060907_418_936 | 153 |
| 841 | 3300049591 | Ga0501075_0425735 | Ga0501075_0425735_85_603 | 153 |
| 842 | 3300049592 | Ga0501076_0483859 | Ga0501076_0483859_488_1006 | 153 |
| 843 | 3300049592 | Ga0501076_1260927 | Ga0501076_1260927_54_572 | 153 |
| 844 | 3300049741 | Ga0501079_0094111 | Ga0501079_0094111_1760_2278 | 153 |
| 845 | 3300049741 | Ga0501079_0207874 | Ga0501079_0207874_714_1232 | 153 |
| 846 | 3300049741 | Ga0501079_0348137 | Ga0501079_0348137_17_538 | 153 |
| 847 | 3300049822 | Ga0501035_0680057 | Ga0501035_0680057_157_675 | 153 |
| 848 | 3300049824 | Ga0501045_0108212 | Ga0501045_0108212_464_982 | 153 |
| 849 | 3300049824 | Ga0501045_0663500 | Ga0501045_0663500_47_565 | 153 |
| 850 | 3300050493 | nmdc:mga0k408_37390_c1 | nmdc:mga0k408_37390_c1_1961_2479 | 153 |
| 851 | 3300050493 | nmdc:mga0k408_502170_c1 | nmdc:mga0k408_502170_c1_121_639 | 153 |
| 852 | 3300050507 | nmdc:mga05p37_25768_c1 | nmdc:mga05p37_25768_c1_367_885 | 153 |
| 853 | 3300050508 | nmdc:mga09592_62720_c1 | nmdc:mga09592_62720_c1_368_886 | 153 |
| 854 | 3300050509 | nmdc:mga0qj67_868092_c1 | nmdc:mga0qj67_868092_c1_97_615 | 153 |
| 855 | 3300050510 | nmdc:mga06r32_151518_c1 | nmdc:mga06r32_151518_c1_1474_1992 | 153 |
| 856 | 3300050510 | nmdc:mga06r32_214393_c1 | nmdc:mga06r32_214393_c1_95_613 | 153 |
| 857 | 3300050510 | nmdc:mga06r32_516349_c1 | nmdc:mga06r32_516349_c1_74_592 | 153 |
| 858 | 3300050511 | nmdc:mga08y16_1245586_c1 | nmdc:mga08y16_1245586_c1_173_691 | 153 |
| 859 | 3300050511 | nmdc:mga08y16_569702_c1 | nmdc:mga08y16_569702_c1_404_922 | 153 |
| 860 | 3300050511 | nmdc:mga08y16_78002_c1 | nmdc:mga08y16_78002_c1_209_727 | 153 |
| 861 | 3300050513 | nmdc:mga0rr50_56391_c2 | nmdc:mga0rr50_56391_c2_735_1247 | 153 |
| 862 | 3300050515 | nmdc:mga0a205_150917_c1 | nmdc:mga0a205_150917_c1_1173_1691 | 153 |
| 863 | 3300053077 | Ga0495601_0000899 | Ga0495601_0000899_10517_11035 | 153 |
| 864 | 3300053084 | Ga0495595_0035127 | Ga0495595_0035127_793_1311 | 153 |
| 865 | 3300053085 | Ga0495619_0123830 | Ga0495619_0123830_462_980 | 153 |
| 866 | 3300053139 | Ga0500568_0046010 | Ga0500568_0046010_918_1487 | 153 |
| 867 | 3300054114 | Ga0501084_0155327 | Ga0501084_0155327_678_1196 | 153 |
| 868 | 3300061734 | Ga0530510_0001525 | Ga0530510_0001525_14397_14915 | 153 |
| 869 | 3300061734 | Ga0530510_0371460 | Ga0530510_0371460_525_1064 | 153 |
| 870 | 3300061734 | Ga0530510_0608776 | Ga0530510_0608776_177_695 | 153 |
| 871 | 3300061734 | Ga0530510_0659178 | Ga0530510_0659178_90_608 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wa8-assembly1.cif.gz_A | solution structure of the cfp-10.esat-6 complex. major virulence determinants of pathogenic mycobacteria | 0.6285 | 7 | 82 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.5681 | 8 | 129 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.5281 | 10 | 130 |
| 5j45-assembly1.cif.gz_A | crystal structure of shrub, fly ortholog of snf7/chmp4b | 0.5129 | 11 | 115 |
| 1wa8-assembly1.cif.gz_A | solution structure of the cfp-10.esat-6 complex. major virulence determinants of pathogenic mycobacteria | 0.4961 | 7 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8WVZ1_108_232_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7479 | 5 | 67 | 3.30.40.10 |
| 1wa8A00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like | 0.6285 | 7 | 82 | 1.10.287.1060 |
| af_K7KCR4_136_214_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.6067 | 6 | 80 | 1.20.120.350 |
| af_Q2THW0_116_241_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.5757 | 5 | 94 | 3.30.40.10 |
| af_Q84YJ9_78_550_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.5687 | 18 | 65 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528B4F3-F1-model_v4 | TRAP transporter small permease protein | 0.6407 | 2 | 136 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A154BSK7-F1-model_v4 | C4-dicarboxylate ABC transporter permease | 0.6393 | 4 | 136 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A0F7PQV4-F1-model_v4 | TRAP transporter small permease protein | 0.6365 | 3 | 136 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A845GZJ1-F1-model_v4 | deleted | 0.6348 | 6 | 136 |
|
| AF-A0A0U2W9A8-F1-model_v4 | Tripartite tricarboxylate transporter family receptor | 0.6341 | 5 | 136 |
GO:0005886
GO:0015740 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar