F484187
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 244 | 871 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300025933|Ga0207706_10107453|Ga0207706_101074531 |
| Length | 274 |
| Sequence | MILAIDAGNTNLVFALVDKGEIKARWRIATDPRRTADQYSVWLHQLLELEGFSRDQIDGVIIGTVVPRALHNLEVLSEKYFRKTPVIAGQGAAEWPLQLDVDEPHNVGADRALNAIAAHAKYPGDLLIIDFGTATTFDVVSASGAYTGGIIAPGINLSLDALVNAAAKLPRIAIETPATNSVIGRTTASQMIIGIYWGYVAMLEGLTERIKSEVGRPVTVVATGLGHGDDVTRICVEHTDPAKHESSVIDCKTARVVKKLLRSPDAHDSGVNTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 81 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 179 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 180 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 181 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 182 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 183 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 184 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 185 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 186 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 187 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 188 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 189 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 190 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 193 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 210 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 211 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 218 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 219 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 220 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 221 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 222 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 223 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 224 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 225 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 226 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 227 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 228 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 231 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 232 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 233 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 234 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 236 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 237 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 238 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 239 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 240 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 241 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 243 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.23 |
| Nodule | 0 |
| Rhizoplane | 4.59 |
| Rhizosphere | 93.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3748052 | 2162886007 | Bacteria | 1346 |
| 2 | JGI24741J21665_1000692 | 3300001915 | Bacteria | 10187 |
| 3 | JGI24740J21852_10002149 | 3300001979 | Bacteria | 9011 |
| 4 | JGI24740J21852_10003759 | 3300001979 | Bacteria | 6608 |
| 5 | JGI24740J21852_10021057 | 3300001979 | Bacteria | 2265 |
| 6 | JGI24739J22299_10000252 | 3300001989 | Bacteria | 18058 |
| 7 | JGI24739J22299_10001180 | 3300001989 | Bacteria | 9776 |
| 8 | JGI24737J22298_10002295 | 3300001990 | Bacteria | 6798 |
| 9 | JGI24737J22298_10005205 | 3300001990 | Bacteria | 4500 |
| 10 | JGI24737J22298_10006259 | 3300001990 | Bacteria | 4074 |
| 11 | JGI24737J22298_10022606 | 3300001990 | Bacteria | 1999 |
| 12 | JGI24735J21928_10001159 | 3300002067 | Bacteria | 9419 |
| 13 | JGI24735J21928_10012860 | 3300002067 | Bacteria | 2642 |
| 14 | JGI24738J21930_10000674 | 3300002075 | Bacteria | 9899 |
| 15 | JGI24738J21930_10001019 | 3300002075 | Bacteria | 8002 |
| 16 | JGI24744J21845_10001866 | 3300002077 | Bacteria | 4234 |
| 17 | Ga0065704_10073918 | 3300005289 | Bacteria | 6672 |
| 18 | Ga0065707_10010189 | 3300005295 | Bacteria | 2281 |
| 19 | Ga0070658_10069755 | 3300005327 | Bacteria | 2876 |
| 20 | Ga0070658_10079929 | 3300005327 | Bacteria | 2685 |
| 21 | Ga0070658_10133947 | 3300005327 | Bacteria | 2066 |
| 22 | Ga0070658_10146879 | 3300005327 | Bacteria | 1972 |
| 23 | Ga0070658_10159219 | 3300005327 | Bacteria | 1894 |
| 24 | Ga0070658_10206277 | 3300005327 | Bacteria | 1660 |
| 25 | Ga0070658_10240928 | 3300005327 | Bacteria | 1533 |
| 26 | Ga0070658_10344516 | 3300005327 | Bacteria | 1275 |
| 27 | Ga0070658_10377692 | 3300005327 | Bacteria | 1215 |
| 28 | Ga0070676_10003269 | 3300005328 | Bacteria | 8417 |
| 29 | Ga0070676_10196259 | 3300005328 | Bacteria | 1321 |
| 30 | Ga0070676_10240914 | 3300005328 | Bacteria | 1203 |
| 31 | Ga0070676_10245316 | 3300005328 | Bacteria | 1193 |
| 32 | Ga0070676_10405803 | 3300005328 | Bacteria | 949 |
| 33 | Ga0070676_10442032 | 3300005328 | Bacteria | 913 |
| 34 | Ga0070683_100019454 | 3300005329 | Bacteria | 6031 |
| 35 | Ga0070683_100024802 | 3300005329 | Bacteria | 5377 |
| 36 | Ga0070683_100141403 | 3300005329 | Bacteria | 2280 |
| 37 | Ga0070683_100255802 | 3300005329 | Bacteria | 1666 |
| 38 | Ga0070690_100015646 | 3300005330 | Bacteria | 4531 |
| 39 | Ga0070690_100025806 | 3300005330 | Bacteria | 3620 |
| 40 | Ga0070690_100096383 | 3300005330 | Bacteria | 1955 |
| 41 | Ga0070670_100000807 | 3300005331 | Bacteria | 24382 |
| 42 | Ga0070670_100008121 | 3300005331 | Bacteria | 8932 |
| 43 | Ga0070670_100014557 | 3300005331 | Bacteria | 6754 |
| 44 | Ga0070670_100031408 | 3300005331 | Bacteria | 4573 |
| 45 | Ga0070670_100031539 | 3300005331 | Bacteria | 4565 |
| 46 | Ga0070677_10023752 | 3300005333 | Bacteria | 2273 |
| 47 | Ga0070677_10088434 | 3300005333 | Bacteria | 1342 |
| 48 | Ga0068869_100024538 | 3300005334 | Bacteria | 4176 |
| 49 | Ga0070666_10002658 | 3300005335 | Bacteria | 10780 |
| 50 | Ga0070666_10003092 | 3300005335 | Bacteria | 10102 |
| 51 | Ga0070666_10013352 | 3300005335 | Bacteria | 5208 |
| 52 | Ga0070666_10032530 | 3300005335 | Bacteria | 3445 |
| 53 | Ga0070666_10246778 | 3300005335 | Bacteria | 1263 |
| 54 | Ga0070680_100003695 | 3300005336 | Bacteria | 11429 |
| 55 | Ga0070680_100012588 | 3300005336 | Bacteria | 6577 |
| 56 | Ga0070682_100013647 | 3300005337 | Bacteria | 4680 |
| 57 | Ga0070682_100145211 | 3300005337 | Bacteria | 1622 |
| 58 | Ga0068868_100001893 | 3300005338 | Bacteria | 14366 |
| 59 | Ga0068868_100009974 | 3300005338 | Bacteria | 6861 |
| 60 | Ga0068868_100013938 | 3300005338 | Bacteria | 5913 |
| 61 | Ga0068868_100169491 | 3300005338 | Bacteria | 1807 |
| 62 | Ga0068868_100560811 | 3300005338 | Bacteria | 1008 |
| 63 | Ga0070660_100006064 | 3300005339 | Bacteria | 8358 |
| 64 | Ga0070660_100014880 | 3300005339 | Bacteria | 5615 |
| 65 | Ga0070660_100021606 | 3300005339 | Bacteria | 4749 |
| 66 | Ga0070660_100029285 | 3300005339 | Bacteria | 4125 |
| 67 | Ga0070660_100035865 | 3300005339 | Bacteria | 3754 |
| 68 | Ga0070660_100038635 | 3300005339 | Bacteria | 3624 |
| 69 | Ga0070660_100042108 | 3300005339 | Bacteria | 3484 |
| 70 | Ga0070660_100093260 | 3300005339 | Bacteria | 2377 |
| 71 | Ga0070660_100134033 | 3300005339 | Bacteria | 1984 |
| 72 | Ga0070660_100393123 | 3300005339 | Bacteria | 1146 |
| 73 | Ga0070689_100006805 | 3300005340 | Bacteria | 7951 |
| 74 | Ga0070689_100247015 | 3300005340 | Bacteria | 1471 |
| 75 | Ga0070691_10098103 | 3300005341 | Bacteria | 1452 |
| 76 | Ga0070661_100009704 | 3300005344 | Bacteria | 6676 |
| 77 | Ga0070661_100014744 | 3300005344 | Bacteria | 5512 |
| 78 | Ga0070661_100037391 | 3300005344 | Bacteria | 3531 |
| 79 | Ga0070661_100094213 | 3300005344 | Bacteria | 2219 |
| 80 | Ga0070661_100105175 | 3300005344 | Bacteria | 2103 |
| 81 | Ga0070661_100120518 | 3300005344 | Bacteria | 1964 |
| 82 | Ga0070661_100122744 | 3300005344 | Bacteria | 1946 |
| 83 | Ga0070661_100182420 | 3300005344 | Bacteria | 1597 |
| 84 | Ga0070661_100361200 | 3300005344 | Bacteria | 1141 |
| 85 | Ga0070668_100124876 | 3300005347 | Bacteria | 2061 |
| 86 | Ga0070668_100148459 | 3300005347 | Bacteria | 1894 |
| 87 | Ga0070669_100001260 | 3300005353 | Bacteria | 18380 |
| 88 | Ga0070675_100104855 | 3300005354 | Bacteria | 2385 |
| 89 | Ga0070675_100163269 | 3300005354 | Bacteria | 1917 |
| 90 | Ga0070671_100000927 | 3300005355 | Bacteria | 21442 |
| 91 | Ga0070671_100002825 | 3300005355 | Bacteria | 13490 |
| 92 | Ga0070671_100011596 | 3300005355 | Bacteria | 7092 |
| 93 | Ga0070671_100012260 | 3300005355 | Bacteria | 6897 |
| 94 | Ga0070671_100028280 | 3300005355 | Bacteria | 4616 |
| 95 | Ga0070671_100089917 | 3300005355 | Bacteria | 2570 |
| 96 | Ga0070671_100273666 | 3300005355 | Bacteria | 1435 |
| 97 | Ga0070671_100328366 | 3300005355 | Bacteria | 1304 |
| 98 | Ga0070674_100023242 | 3300005356 | Bacteria | 4010 |
| 99 | Ga0070674_100041914 | 3300005356 | Bacteria | 3106 |
| 100 | Ga0070674_100179089 | 3300005356 | Bacteria | 1622 |
| 101 | Ga0070673_100001674 | 3300005364 | Bacteria | 13140 |
| 102 | Ga0070673_100002345 | 3300005364 | Bacteria | 11503 |
| 103 | Ga0070673_100020014 | 3300005364 | Bacteria | 4819 |
| 104 | Ga0070673_100049184 | 3300005364 | Bacteria | 3291 |
| 105 | Ga0070673_100054226 | 3300005364 | Bacteria | 3153 |
| 106 | Ga0070673_100076667 | 3300005364 | Bacteria | 2700 |
| 107 | Ga0070673_100455939 | 3300005364 | Bacteria | 1151 |
| 108 | Ga0070659_100001267 | 3300005366 | Bacteria | 18320 |
| 109 | Ga0070659_100018346 | 3300005366 | Bacteria | 5281 |
| 110 | Ga0070659_100039254 | 3300005366 | Bacteria | 3695 |
| 111 | Ga0070659_100044004 | 3300005366 | Bacteria | 3494 |
| 112 | Ga0070659_100045903 | 3300005366 | Bacteria | 3424 |
| 113 | Ga0070659_100250544 | 3300005366 | Bacteria | 1468 |
| 114 | Ga0070659_100268103 | 3300005366 | Bacteria | 1418 |
| 115 | Ga0070667_100004545 | 3300005367 | Bacteria | 11676 |
| 116 | Ga0070667_100005246 | 3300005367 | Bacteria | 10834 |
| 117 | Ga0070667_100021218 | 3300005367 | Bacteria | 5397 |
| 118 | Ga0070667_100192796 | 3300005367 | Bacteria | 1806 |
| 119 | Ga0070667_100233717 | 3300005367 | Bacteria | 1640 |
| 120 | Ga0070667_100401331 | 3300005367 | Bacteria | 1248 |
| 121 | Ga0070667_100411854 | 3300005367 | Bacteria | 1231 |
| 122 | Ga0070714_100020265 | 3300005435 | Bacteria | 5428 |
| 123 | Ga0070714_100098350 | 3300005435 | Bacteria | 2574 |
| 124 | Ga0070714_100374956 | 3300005435 | Bacteria | 1340 |
| 125 | Ga0070714_100401194 | 3300005435 | Bacteria | 1296 |
| 126 | Ga0070714_100857313 | 3300005435 | Bacteria | 881 |
| 127 | Ga0070663_100014152 | 3300005455 | Bacteria | 5113 |
| 128 | Ga0070663_100029638 | 3300005455 | Bacteria | 3742 |
| 129 | Ga0070663_100089109 | 3300005455 | Bacteria | 2282 |
| 130 | Ga0070663_100153030 | 3300005455 | Bacteria | 1770 |
| 131 | Ga0070678_100009697 | 3300005456 | Bacteria | 5851 |
| 132 | Ga0070678_100053016 | 3300005456 | Bacteria | 2948 |
| 133 | Ga0070678_100098312 | 3300005456 | Bacteria | 2263 |
| 134 | Ga0070678_100202114 | 3300005456 | Bacteria | 1641 |
| 135 | Ga0070678_100554340 | 3300005456 | Bacteria | 1021 |
| 136 | Ga0070662_100001203 | 3300005457 | Bacteria | 15912 |
| 137 | Ga0070662_100034885 | 3300005457 | Bacteria | 3549 |
| 138 | Ga0070662_100078224 | 3300005457 | Bacteria | 2456 |
| 139 | Ga0070662_100135123 | 3300005457 | Bacteria | 1906 |
| 140 | Ga0070662_100140977 | 3300005457 | Bacteria | 1868 |
| 141 | Ga0070662_100165462 | 3300005457 | Bacteria | 1733 |
| 142 | Ga0070662_100336784 | 3300005457 | Bacteria | 1233 |
| 143 | Ga0070681_10044346 | 3300005458 | Bacteria | 4451 |
| 144 | Ga0070681_10303661 | 3300005458 | Bacteria | 1505 |
| 145 | Ga0068867_100005599 | 3300005459 | Bacteria | 8900 |
| 146 | Ga0068867_100018721 | 3300005459 | Bacteria | 4924 |
| 147 | Ga0068867_100052268 | 3300005459 | Bacteria | 3015 |
| 148 | Ga0070685_10461159 | 3300005466 | Bacteria | 892 |
| 149 | Ga0070679_100022016 | 3300005530 | Bacteria | 6226 |
| 150 | Ga0070679_100071652 | 3300005530 | Bacteria | 3456 |
| 151 | Ga0070684_100002726 | 3300005535 | Bacteria | 13054 |
| 152 | Ga0070684_100011882 | 3300005535 | Bacteria | 6952 |
| 153 | Ga0070684_100225611 | 3300005535 | Bacteria | 1710 |
| 154 | Ga0068853_100002144 | 3300005539 | Bacteria | 14696 |
| 155 | Ga0068853_100119051 | 3300005539 | Bacteria | 2353 |
| 156 | Ga0068853_100137438 | 3300005539 | Bacteria | 2191 |
| 157 | Ga0068853_100217507 | 3300005539 | Bacteria | 1743 |
| 158 | Ga0068853_100251837 | 3300005539 | Bacteria | 1621 |
| 159 | Ga0070672_100015078 | 3300005543 | Bacteria | 5493 |
| 160 | Ga0070672_100015719 | 3300005543 | Bacteria | 5404 |
| 161 | Ga0070672_100096027 | 3300005543 | Bacteria | 2397 |
| 162 | Ga0070672_100350488 | 3300005543 | Bacteria | 1258 |
| 163 | Ga0070696_100007378 | 3300005546 | Bacteria | 7345 |
| 164 | Ga0070665_100001208 | 3300005548 | Bacteria | 31486 |
| 165 | Ga0070665_100004742 | 3300005548 | Bacteria | 14155 |
| 166 | Ga0070665_100012842 | 3300005548 | Bacteria | 8431 |
| 167 | Ga0070665_100034005 | 3300005548 | Bacteria | 5126 |
| 168 | Ga0068855_100002638 | 3300005563 | Bacteria | 22114 |
| 169 | Ga0068855_100113573 | 3300005563 | Bacteria | 3107 |
| 170 | Ga0068855_100193123 | 3300005563 | Bacteria | 2295 |
| 171 | Ga0068855_100199919 | 3300005563 | Bacteria | 2250 |
| 172 | Ga0068855_100353041 | 3300005563 | Bacteria | 1619 |
| 173 | Ga0070664_100000446 | 3300005564 | Bacteria | 31189 |
| 174 | Ga0070664_100003398 | 3300005564 | Bacteria | 12850 |
| 175 | Ga0070664_100012233 | 3300005564 | Bacteria | 6974 |
| 176 | Ga0070664_100048375 | 3300005564 | Bacteria | 3594 |
| 177 | Ga0070664_100074362 | 3300005564 | Bacteria | 2916 |
| 178 | Ga0070664_100076084 | 3300005564 | Bacteria | 2883 |
| 179 | Ga0070664_100097431 | 3300005564 | Bacteria | 2553 |
| 180 | Ga0070664_100146716 | 3300005564 | Bacteria | 2081 |
| 181 | Ga0070664_100573006 | 3300005564 | Bacteria | 1045 |
| 182 | Ga0068857_100001517 | 3300005577 | Bacteria | 18537 |
| 183 | Ga0068857_100003065 | 3300005577 | Bacteria | 13816 |
| 184 | Ga0068857_100004069 | 3300005577 | Bacteria | 12310 |
| 185 | Ga0068857_100304739 | 3300005577 | Bacteria | 1469 |
| 186 | Ga0068854_100003147 | 3300005578 | Bacteria | 10280 |
| 187 | Ga0068854_100008221 | 3300005578 | Bacteria | 6697 |
| 188 | Ga0068854_100023884 | 3300005578 | Bacteria | 4179 |
| 189 | Ga0068854_100080461 | 3300005578 | Bacteria | 2404 |
| 190 | Ga0068854_100106470 | 3300005578 | Bacteria | 2110 |
| 191 | Ga0068854_100144622 | 3300005578 | Bacteria | 1828 |
| 192 | Ga0068854_100343546 | 3300005578 | Bacteria | 1219 |
| 193 | Ga0068854_100520284 | 3300005578 | Bacteria | 1005 |
| 194 | Ga0068854_100674101 | 3300005578 | Bacteria | 890 |
| 195 | Ga0068856_100015113 | 3300005614 | Bacteria | 7458 |
| 196 | Ga0068856_100040080 | 3300005614 | Bacteria | 4599 |
| 197 | Ga0068856_100050336 | 3300005614 | Bacteria | 4107 |
| 198 | Ga0068856_100078153 | 3300005614 | Bacteria | 3280 |
| 199 | Ga0070702_100269258 | 3300005615 | Bacteria | 1164 |
| 200 | Ga0068852_100000461 | 3300005616 | Bacteria | 26890 |
| 201 | Ga0068852_100019867 | 3300005616 | Bacteria | 5329 |
| 202 | Ga0068852_100029627 | 3300005616 | Bacteria | 4499 |
| 203 | Ga0068852_100116814 | 3300005616 | Bacteria | 2435 |
| 204 | Ga0068852_100126481 | 3300005616 | Bacteria | 2348 |
| 205 | Ga0068852_100494035 | 3300005616 | Bacteria | 1218 |
| 206 | Ga0068852_101081768 | 3300005616 | Bacteria | 822 |
| 207 | Ga0068859_100008534 | 3300005617 | Bacteria | 10365 |
| 208 | Ga0068859_100009839 | 3300005617 | Bacteria | 9652 |
| 209 | Ga0068859_100050360 | 3300005617 | Bacteria | 4184 |
| 210 | Ga0068859_100243805 | 3300005617 | Bacteria | 1887 |
| 211 | Ga0068864_100003315 | 3300005618 | Bacteria | 13307 |
| 212 | Ga0068864_100020883 | 3300005618 | Bacteria | 5481 |
| 213 | Ga0068864_100064482 | 3300005618 | Bacteria | 3177 |
| 214 | Ga0068864_100118776 | 3300005618 | Bacteria | 2361 |
| 215 | Ga0068864_100254766 | 3300005618 | Bacteria | 1631 |
| 216 | Ga0068866_10056715 | 3300005718 | Bacteria | 2015 |
| 217 | Ga0068861_100000052 | 3300005719 | Bacteria | 54577 |
| 218 | Ga0068861_100216662 | 3300005719 | Bacteria | 1616 |
| 219 | Ga0068851_10006913 | 3300005834 | Bacteria | 5202 |
| 220 | Ga0068851_10018291 | 3300005834 | Bacteria | 3375 |
| 221 | Ga0068851_10215039 | 3300005834 | Bacteria | 1078 |
| 222 | Ga0068851_10230068 | 3300005834 | Bacteria | 1045 |
| 223 | Ga0068870_10136484 | 3300005840 | Bacteria | 1431 |
| 224 | Ga0068863_100003487 | 3300005841 | Bacteria | 15520 |
| 225 | Ga0068863_100008185 | 3300005841 | Bacteria | 10213 |
| 226 | Ga0068863_100009190 | 3300005841 | Bacteria | 9642 |
| 227 | Ga0068863_100012720 | 3300005841 | Bacteria | 8116 |
| 228 | Ga0068863_100036906 | 3300005841 | Bacteria | 4653 |
| 229 | Ga0068863_100057339 | 3300005841 | Bacteria | 3686 |
| 230 | Ga0068858_100008071 | 3300005842 | Bacteria | 10138 |
| 231 | Ga0068858_100017583 | 3300005842 | Bacteria | 6704 |
| 232 | Ga0068858_100136500 | 3300005842 | Bacteria | 2301 |
| 233 | Ga0068858_100157035 | 3300005842 | Bacteria | 2140 |
| 234 | Ga0068860_100003073 | 3300005843 | Bacteria | 17251 |
| 235 | Ga0068860_100036352 | 3300005843 | Bacteria | 4720 |
| 236 | Ga0068860_100064032 | 3300005843 | Bacteria | 3492 |
| 237 | Ga0068862_100018707 | 3300005844 | Bacteria | 5770 |
| 238 | Ga0068862_100492483 | 3300005844 | Bacteria | 1162 |
| 239 | Ga0081539_10188094 | 3300005985 | Bacteria | 963 |
| 240 | Ga0070716_100084000 | 3300006173 | Bacteria | 1908 |
| 241 | Ga0097621_100003754 | 3300006237 | Bacteria | 10526 |
| 242 | Ga0097621_100080112 | 3300006237 | Bacteria | 2716 |
| 243 | Ga0097621_100558030 | 3300006237 | Bacteria | 1043 |
| 244 | Ga0068871_100019567 | 3300006358 | Bacteria | 5171 |
| 245 | Ga0068871_100373963 | 3300006358 | Bacteria | 1264 |
| 246 | Ga0068865_100005997 | 3300006881 | Bacteria | 7401 |
| 247 | Ga0068865_100025297 | 3300006881 | Bacteria | 3903 |
| 248 | Ga0068865_100078208 | 3300006881 | Bacteria | 2366 |
| 249 | Ga0097620_100008534 | 3300006931 | Bacteria | 10365 |
| 250 | Ga0097620_100009839 | 3300006931 | Bacteria | 9652 |
| 251 | Ga0097620_100050361 | 3300006931 | Bacteria | 4184 |
| 252 | Ga0097620_100243789 | 3300006931 | Bacteria | 1887 |
| 253 | Ga0105251_10026917 | 3300009011 | Bacteria | 2922 |
| 254 | Ga0105251_10104757 | 3300009011 | Bacteria | 1291 |
| 255 | Ga0105240_10044466 | 3300009093 | Bacteria | 5643 |
| 256 | Ga0105240_10460880 | 3300009093 | Bacteria | 1420 |
| 257 | Ga0105240_10584971 | 3300009093 | Bacteria | 1231 |
| 258 | Ga0105240_10867517 | 3300009093 | Bacteria | 973 |
| 259 | Ga0105245_10001667 | 3300009098 | Bacteria | 20219 |
| 260 | Ga0105247_10450826 | 3300009101 | Bacteria | 927 |
| 261 | Ga0105241_10007878 | 3300009174 | Bacteria | 7831 |
| 262 | Ga0105241_10041880 | 3300009174 | Bacteria | 3462 |
| 263 | Ga0105242_10012800 | 3300009176 | Bacteria | 6463 |
| 264 | Ga0105248_10000096 | 3300009177 | Bacteria | 97519 |
| 265 | Ga0105248_10001577 | 3300009177 | Bacteria | 25361 |
| 266 | Ga0105248_10006141 | 3300009177 | Bacteria | 13173 |
| 267 | Ga0105248_10006863 | 3300009177 | Bacteria | 12484 |
| 268 | Ga0105248_10006890 | 3300009177 | Bacteria | 12456 |
| 269 | Ga0105248_10332047 | 3300009177 | Bacteria | 1712 |
| 270 | Ga0105248_10681055 | 3300009177 | Bacteria | 1160 |
| 271 | Ga0105237_10015281 | 3300009545 | Bacteria | 7996 |
| 272 | Ga0105237_10079942 | 3300009545 | Bacteria | 3259 |
| 273 | Ga0105237_10149808 | 3300009545 | Bacteria | 2329 |
| 274 | Ga0105237_10151641 | 3300009545 | Bacteria | 2314 |
| 275 | Ga0105238_10039716 | 3300009551 | Bacteria | 4772 |
| 276 | Ga0105238_10191208 | 3300009551 | Bacteria | 2023 |
| 277 | Ga0105238_10226369 | 3300009551 | Bacteria | 1847 |
| 278 | Ga0105249_10198579 | 3300009553 | Bacteria | 1962 |
| 279 | Ga0105148_100202 | 3300009978 | Bacteria | 8692 |
| 280 | Ga0105147_105299 | 3300009982 | Bacteria | 1083 |
| 281 | Ga0105239_10117373 | 3300010375 | Bacteria | 2953 |
| 282 | Ga0105246_10022077 | 3300011119 | Bacteria | 4104 |
| 283 | Ga0105246_10040645 | 3300011119 | Bacteria | 3140 |
| 284 | Ga0105246_10275590 | 3300011119 | Bacteria | 1347 |
| 285 | Ga0157373_10007215 | 3300013100 | Bacteria | 8288 |
| 286 | Ga0157373_10017921 | 3300013100 | Bacteria | 5156 |
| 287 | Ga0157373_10039257 | 3300013100 | Bacteria | 3390 |
| 288 | Ga0157373_10081485 | 3300013100 | Bacteria | 2281 |
| 289 | Ga0157373_10122166 | 3300013100 | Bacteria | 1830 |
| 290 | Ga0157373_10129123 | 3300013100 | Bacteria | 1777 |
| 291 | Ga0157373_10155107 | 3300013100 | Bacteria | 1611 |
| 292 | Ga0157371_10003770 | 3300013102 | Bacteria | 13565 |
| 293 | Ga0157371_10022992 | 3300013102 | Bacteria | 4558 |
| 294 | Ga0157371_10040657 | 3300013102 | Bacteria | 3320 |
| 295 | Ga0157371_10076634 | 3300013102 | Bacteria | 2368 |
| 296 | Ga0157371_10114766 | 3300013102 | Bacteria | 1913 |
| 297 | Ga0157371_10132648 | 3300013102 | Bacteria | 1773 |
| 298 | Ga0157371_10135588 | 3300013102 | Bacteria | 1753 |
| 299 | Ga0157371_10197728 | 3300013102 | Bacteria | 1441 |
| 300 | Ga0157370_10102505 | 3300013104 | Bacteria | 2680 |
| 301 | Ga0157370_10382552 | 3300013104 | Bacteria | 1296 |
| 302 | Ga0157370_10532422 | 3300013104 | Bacteria | 1078 |
| 303 | Ga0157369_10122804 | 3300013105 | Bacteria | 2755 |
| 304 | Ga0157369_10139262 | 3300013105 | Bacteria | 2568 |
| 305 | Ga0157369_10193603 | 3300013105 | Bacteria | 2136 |
| 306 | Ga0157369_10214579 | 3300013105 | Bacteria | 2016 |
| 307 | Ga0157369_10980573 | 3300013105 | Bacteria | 865 |
| 308 | Ga0157374_10009229 | 3300013296 | Bacteria | 8456 |
| 309 | Ga0157374_10117607 | 3300013296 | Bacteria | 2562 |
| 310 | Ga0157378_10001776 | 3300013297 | Bacteria | 19365 |
| 311 | Ga0157378_10142034 | 3300013297 | Bacteria | 2230 |
| 312 | Ga0163162_10048501 | 3300013306 | Bacteria | 4255 |
| 313 | Ga0163162_10158044 | 3300013306 | Bacteria | 2388 |
| 314 | Ga0157372_10068574 | 3300013307 | Bacteria | 3988 |
| 315 | Ga0157372_10103884 | 3300013307 | Bacteria | 3247 |
| 316 | Ga0157372_10230095 | 3300013307 | Bacteria | 2149 |
| 317 | Ga0157372_10269475 | 3300013307 | Bacteria | 1978 |
| 318 | Ga0157372_10302866 | 3300013307 | Bacteria | 1859 |
| 319 | Ga0157372_10795999 | 3300013307 | Bacteria | 1098 |
| 320 | Ga0157372_10853167 | 3300013307 | Bacteria | 1057 |
| 321 | Ga0157375_10003831 | 3300013308 | Bacteria | 13044 |
| 322 | Ga0157375_10026239 | 3300013308 | Bacteria | 5426 |
| 323 | Ga0163163_10019009 | 3300014325 | Bacteria | 6446 |
| 324 | Ga0163163_10034122 | 3300014325 | Bacteria | 4926 |
| 325 | Ga0163163_10120482 | 3300014325 | Bacteria | 2658 |
| 326 | Ga0163163_10721089 | 3300014325 | Bacteria | 1061 |
| 327 | Ga0157379_10006317 | 3300014968 | Bacteria | 10205 |
| 328 | Ga0157379_10368662 | 3300014968 | Bacteria | 1317 |
| 329 | Ga0163161_10013697 | 3300017792 | Bacteria | 5647 |
| 330 | Ga0207673_1019010 | 3300025290 | Bacteria | 922 |
| 331 | Ga0207697_10001060 | 3300025315 | Bacteria | 15193 |
| 332 | Ga0207697_10003608 | 3300025315 | Bacteria | 7588 |
| 333 | Ga0207697_10013963 | 3300025315 | Bacteria | 3343 |
| 334 | Ga0207697_10015837 | 3300025315 | Bacteria | 3110 |
| 335 | Ga0207656_10011903 | 3300025321 | Bacteria | 3296 |
| 336 | Ga0207656_10028906 | 3300025321 | Bacteria | 2279 |
| 337 | Ga0207656_10086913 | 3300025321 | Bacteria | 1414 |
| 338 | Ga0207656_10151540 | 3300025321 | Bacteria | 1098 |
| 339 | Ga0207682_10028455 | 3300025893 | Bacteria | 2230 |
| 340 | Ga0207642_10253517 | 3300025899 | Bacteria | 1000 |
| 341 | Ga0207688_10002178 | 3300025901 | Bacteria | 10550 |
| 342 | Ga0207688_10005414 | 3300025901 | Bacteria | 6938 |
| 343 | Ga0207680_10007785 | 3300025903 | Bacteria | 5236 |
| 344 | Ga0207680_10008339 | 3300025903 | Bacteria | 5080 |
| 345 | Ga0207680_10028080 | 3300025903 | Bacteria | 3143 |
| 346 | Ga0207680_10101677 | 3300025903 | Bacteria | 1848 |
| 347 | Ga0207680_10165735 | 3300025903 | Bacteria | 1485 |
| 348 | Ga0207647_10000153 | 3300025904 | Bacteria | 54496 |
| 349 | Ga0207647_10001078 | 3300025904 | Bacteria | 21029 |
| 350 | Ga0207647_10005438 | 3300025904 | Bacteria | 9335 |
| 351 | Ga0207647_10007591 | 3300025904 | Bacteria | 7815 |
| 352 | Ga0207647_10009600 | 3300025904 | Bacteria | 6869 |
| 353 | Ga0207647_10020279 | 3300025904 | Bacteria | 4459 |
| 354 | Ga0207647_10237091 | 3300025904 | Bacteria | 1048 |
| 355 | Ga0207645_10003786 | 3300025907 | Bacteria | 11356 |
| 356 | Ga0207645_10019133 | 3300025907 | Bacteria | 4496 |
| 357 | Ga0207645_10066206 | 3300025907 | Bacteria | 2309 |
| 358 | Ga0207645_10192331 | 3300025907 | Bacteria | 1341 |
| 359 | Ga0207645_10252235 | 3300025907 | Bacteria | 1167 |
| 360 | Ga0207645_10395103 | 3300025907 | Bacteria | 929 |
| 361 | Ga0207643_10016175 | 3300025908 | Bacteria | 4067 |
| 362 | Ga0207705_10007304 | 3300025909 | Bacteria | 8125 |
| 363 | Ga0207705_10009311 | 3300025909 | Bacteria | 7143 |
| 364 | Ga0207705_10041020 | 3300025909 | Bacteria | 3320 |
| 365 | Ga0207705_10071335 | 3300025909 | Bacteria | 2518 |
| 366 | Ga0207705_10073108 | 3300025909 | Bacteria | 2487 |
| 367 | Ga0207705_10105175 | 3300025909 | Bacteria | 2080 |
| 368 | Ga0207705_10299638 | 3300025909 | Bacteria | 1233 |
| 369 | Ga0207705_10382995 | 3300025909 | Bacteria | 1086 |
| 370 | Ga0207654_10021779 | 3300025911 | Bacteria | 3412 |
| 371 | Ga0207654_10084466 | 3300025911 | Bacteria | 1919 |
| 372 | Ga0207654_10132718 | 3300025911 | Bacteria | 1578 |
| 373 | Ga0207654_10147794 | 3300025911 | Bacteria | 1505 |
| 374 | Ga0207707_10130129 | 3300025912 | Bacteria | 2201 |
| 375 | Ga0207707_10413934 | 3300025912 | Bacteria | 1156 |
| 376 | Ga0207695_10014240 | 3300025913 | Bacteria | 9433 |
| 377 | Ga0207695_10089367 | 3300025913 | Bacteria | 3098 |
| 378 | Ga0207695_10489827 | 3300025913 | Bacteria | 1112 |
| 379 | Ga0207695_10581297 | 3300025913 | Bacteria | 1001 |
| 380 | Ga0207695_10604420 | 3300025913 | Bacteria | 978 |
| 381 | Ga0207671_10016290 | 3300025914 | Bacteria | 5782 |
| 382 | Ga0207671_10430501 | 3300025914 | Bacteria | 1050 |
| 383 | Ga0207693_10043480 | 3300025915 | Bacteria | 3534 |
| 384 | Ga0207660_10040596 | 3300025917 | Bacteria | 3258 |
| 385 | Ga0207660_10153568 | 3300025917 | Bacteria | 1771 |
| 386 | Ga0207660_10164361 | 3300025917 | Bacteria | 1715 |
| 387 | Ga0207657_10000924 | 3300025919 | Bacteria | 31097 |
| 388 | Ga0207657_10002827 | 3300025919 | Bacteria | 18655 |
| 389 | Ga0207657_10005125 | 3300025919 | Bacteria | 13731 |
| 390 | Ga0207657_10005183 | 3300025919 | Bacteria | 13672 |
| 391 | Ga0207657_10008828 | 3300025919 | Bacteria | 10195 |
| 392 | Ga0207657_10010444 | 3300025919 | Bacteria | 9266 |
| 393 | Ga0207657_10025691 | 3300025919 | Bacteria | 5425 |
| 394 | Ga0207657_10027595 | 3300025919 | Bacteria | 5198 |
| 395 | Ga0207657_10042191 | 3300025919 | Bacteria | 4027 |
| 396 | Ga0207657_10047659 | 3300025919 | Bacteria | 3745 |
| 397 | Ga0207657_10048576 | 3300025919 | Bacteria | 3704 |
| 398 | Ga0207657_10064335 | 3300025919 | Bacteria | 3131 |
| 399 | Ga0207657_10082175 | 3300025919 | Bacteria | 2705 |
| 400 | Ga0207657_10157225 | 3300025919 | Bacteria | 1848 |
| 401 | Ga0207657_10190417 | 3300025919 | Bacteria | 1655 |
| 402 | Ga0207657_10377541 | 3300025919 | Bacteria | 1116 |
| 403 | Ga0207649_10008713 | 3300025920 | Bacteria | 5538 |
| 404 | Ga0207649_10032395 | 3300025920 | Bacteria | 3116 |
| 405 | Ga0207649_10068043 | 3300025920 | Bacteria | 2263 |
| 406 | Ga0207649_10077508 | 3300025920 | Bacteria | 2142 |
| 407 | Ga0207649_10107548 | 3300025920 | Bacteria | 1857 |
| 408 | Ga0207649_10249720 | 3300025920 | Bacteria | 1277 |
| 409 | Ga0207649_10398560 | 3300025920 | Bacteria | 1029 |
| 410 | Ga0207652_10028892 | 3300025921 | Bacteria | 4629 |
| 411 | Ga0207681_10009549 | 3300025923 | Bacteria | 5927 |
| 412 | Ga0207681_10030101 | 3300025923 | Bacteria | 3536 |
| 413 | Ga0207681_10538046 | 3300025923 | Bacteria | 960 |
| 414 | Ga0207694_10063156 | 3300025924 | Bacteria | 2885 |
| 415 | Ga0207694_10146573 | 3300025924 | Bacteria | 1900 |
| 416 | Ga0207694_10170950 | 3300025924 | Bacteria | 1759 |
| 417 | Ga0207650_10017927 | 3300025925 | Bacteria | 4961 |
| 418 | Ga0207650_10020206 | 3300025925 | Bacteria | 4694 |
| 419 | Ga0207659_10014238 | 3300025926 | Bacteria | 5120 |
| 420 | Ga0207659_10016588 | 3300025926 | Bacteria | 4796 |
| 421 | Ga0207659_10115517 | 3300025926 | Bacteria | 2047 |
| 422 | Ga0207659_10243662 | 3300025926 | Bacteria | 1456 |
| 423 | Ga0207687_10009029 | 3300025927 | Bacteria | 6515 |
| 424 | Ga0207700_10033241 | 3300025928 | Bacteria | 3689 |
| 425 | Ga0207664_10082708 | 3300025929 | Bacteria | 2616 |
| 426 | Ga0207664_10109568 | 3300025929 | Bacteria | 2294 |
| 427 | Ga0207644_10000235 | 3300025931 | Bacteria | 38139 |
| 428 | Ga0207644_10002554 | 3300025931 | Bacteria | 11714 |
| 429 | Ga0207644_10002568 | 3300025931 | Bacteria | 11682 |
| 430 | Ga0207644_10005217 | 3300025931 | Bacteria | 8482 |
| 431 | Ga0207644_10005419 | 3300025931 | Bacteria | 8320 |
| 432 | Ga0207644_10005961 | 3300025931 | Bacteria | 7946 |
| 433 | Ga0207644_10283154 | 3300025931 | Bacteria | 1331 |
| 434 | Ga0207644_10485879 | 3300025931 | Bacteria | 1017 |
| 435 | Ga0207690_10003079 | 3300025932 | Bacteria | 10047 |
| 436 | Ga0207690_10008443 | 3300025932 | Bacteria | 6115 |
| 437 | Ga0207690_10084295 | 3300025932 | Bacteria | 2227 |
| 438 | Ga0207690_10087872 | 3300025932 | Bacteria | 2188 |
| 439 | Ga0207690_10145420 | 3300025932 | Bacteria | 1752 |
| 440 | Ga0207690_10349098 | 3300025932 | Bacteria | 1169 |
| 441 | Ga0207706_10000194 | 3300025933 | Bacteria | 67452 |
| 442 | Ga0207706_10001656 | 3300025933 | Bacteria | 22037 |
| 443 | Ga0207706_10002630 | 3300025933 | Bacteria | 17485 |
| 444 | Ga0207706_10004866 | 3300025933 | Bacteria | 12574 |
| 445 | Ga0207706_10039419 | 3300025933 | Bacteria | 4188 |
| 446 | Ga0207706_10040372 | 3300025933 | Bacteria | 4136 |
| 447 | Ga0207706_10073264 | 3300025933 | Bacteria | 3012 |
| 448 | Ga0207706_10107453 | 3300025933 | Bacteria | 2456 |
| 449 | Ga0207706_10109764 | 3300025933 | Bacteria | 2428 |
| 450 | Ga0207706_10166146 | 3300025933 | Bacteria | 1939 |
| 451 | Ga0207706_10178117 | 3300025933 | Bacteria | 1867 |
| 452 | Ga0207706_10191207 | 3300025933 | Bacteria | 1797 |
| 453 | Ga0207706_10440076 | 3300025933 | Bacteria | 1128 |
| 454 | Ga0207686_10094562 | 3300025934 | Bacteria | 1981 |
| 455 | Ga0207709_10040229 | 3300025935 | Bacteria | 2798 |
| 456 | Ga0207670_10025140 | 3300025936 | Bacteria | 3734 |
| 457 | Ga0207669_10018762 | 3300025937 | Bacteria | 3585 |
| 458 | Ga0207669_10063789 | 3300025937 | Bacteria | 2276 |
| 459 | Ga0207669_10161006 | 3300025937 | Bacteria | 1585 |
| 460 | Ga0207669_10241389 | 3300025937 | Bacteria | 1339 |
| 461 | Ga0207704_10007493 | 3300025938 | Bacteria | 5160 |
| 462 | Ga0207704_10039589 | 3300025938 | Bacteria | 2747 |
| 463 | Ga0207704_10052721 | 3300025938 | Bacteria | 2467 |
| 464 | Ga0207665_10007628 | 3300025939 | Bacteria | 7145 |
| 465 | Ga0207665_10082057 | 3300025939 | Bacteria | 2221 |
| 466 | Ga0207691_10002330 | 3300025940 | Bacteria | 18590 |
| 467 | Ga0207691_10003389 | 3300025940 | Bacteria | 15500 |
| 468 | Ga0207691_10003584 | 3300025940 | Bacteria | 15103 |
| 469 | Ga0207691_10009649 | 3300025940 | Bacteria | 9260 |
| 470 | Ga0207691_10015795 | 3300025940 | Bacteria | 7175 |
| 471 | Ga0207691_10114565 | 3300025940 | Bacteria | 2395 |
| 472 | Ga0207711_10001137 | 3300025941 | Bacteria | 25387 |
| 473 | Ga0207711_10002848 | 3300025941 | Bacteria | 15174 |
| 474 | Ga0207711_10006288 | 3300025941 | Bacteria | 10020 |
| 475 | Ga0207711_10038127 | 3300025941 | Bacteria | 4086 |
| 476 | Ga0207711_10052245 | 3300025941 | Bacteria | 3502 |
| 477 | Ga0207711_10054929 | 3300025941 | Bacteria | 3418 |
| 478 | Ga0207711_10069349 | 3300025941 | Bacteria | 3056 |
| 479 | Ga0207711_10333410 | 3300025941 | Bacteria | 1403 |
| 480 | Ga0207689_10000094 | 3300025942 | Bacteria | 71733 |
| 481 | Ga0207689_10033567 | 3300025942 | Bacteria | 4264 |
| 482 | Ga0207689_10046212 | 3300025942 | Bacteria | 3599 |
| 483 | Ga0207661_10009081 | 3300025944 | Bacteria | 7123 |
| 484 | Ga0207661_10043473 | 3300025944 | Bacteria | 3545 |
| 485 | Ga0207661_10296046 | 3300025944 | Bacteria | 1449 |
| 486 | Ga0207679_10003846 | 3300025945 | Bacteria | 9310 |
| 487 | Ga0207679_10021663 | 3300025945 | Bacteria | 4362 |
| 488 | Ga0207679_10021775 | 3300025945 | Bacteria | 4353 |
| 489 | Ga0207679_10030202 | 3300025945 | Bacteria | 3782 |
| 490 | Ga0207679_10042727 | 3300025945 | Bacteria | 3259 |
| 491 | Ga0207679_10043122 | 3300025945 | Bacteria | 3246 |
| 492 | Ga0207679_10092676 | 3300025945 | Bacteria | 2341 |
| 493 | Ga0207679_10100608 | 3300025945 | Bacteria | 2259 |
| 494 | Ga0207679_10375934 | 3300025945 | Bacteria | 1244 |
| 495 | Ga0207679_10410373 | 3300025945 | Bacteria | 1193 |
| 496 | Ga0207667_10008988 | 3300025949 | Bacteria | 11821 |
| 497 | Ga0207667_10077422 | 3300025949 | Bacteria | 3449 |
| 498 | Ga0207667_10089753 | 3300025949 | Bacteria | 3176 |
| 499 | Ga0207667_10092395 | 3300025949 | Bacteria | 3125 |
| 500 | Ga0207667_10111308 | 3300025949 | Bacteria | 2824 |
| 501 | Ga0207667_10128792 | 3300025949 | Bacteria | 2607 |
| 502 | Ga0207667_10361204 | 3300025949 | Bacteria | 1481 |
| 503 | Ga0207651_10002269 | 3300025960 | Bacteria | 9129 |
| 504 | Ga0207651_10003286 | 3300025960 | Bacteria | 7914 |
| 505 | Ga0207651_10008767 | 3300025960 | Bacteria | 5487 |
| 506 | Ga0207651_10304423 | 3300025960 | Bacteria | 1327 |
| 507 | Ga0207668_10134838 | 3300025972 | Bacteria | 1890 |
| 508 | Ga0207668_10544855 | 3300025972 | Bacteria | 1004 |
| 509 | Ga0207640_10095937 | 3300025981 | Bacteria | 2066 |
| 510 | Ga0207640_10128274 | 3300025981 | Bacteria | 1829 |
| 511 | Ga0207640_10237090 | 3300025981 | Bacteria | 1407 |
| 512 | Ga0207640_10443266 | 3300025981 | Bacteria | 1068 |
| 513 | Ga0207640_10468516 | 3300025981 | Bacteria | 1042 |
| 514 | Ga0207640_10595373 | 3300025981 | Bacteria | 935 |
| 515 | Ga0207658_10006765 | 3300025986 | Bacteria | 7807 |
| 516 | Ga0207658_10020303 | 3300025986 | Bacteria | 4600 |
| 517 | Ga0207658_10257990 | 3300025986 | Bacteria | 1484 |
| 518 | Ga0207658_10353296 | 3300025986 | Bacteria | 1280 |
| 519 | Ga0207658_10384618 | 3300025986 | Bacteria | 1230 |
| 520 | Ga0207658_10548157 | 3300025986 | Bacteria | 1034 |
| 521 | Ga0207677_10004013 | 3300026023 | Bacteria | 7853 |
| 522 | Ga0207677_10004145 | 3300026023 | Bacteria | 7757 |
| 523 | Ga0207677_10006879 | 3300026023 | Bacteria | 6251 |
| 524 | Ga0207677_10036404 | 3300026023 | Bacteria | 3207 |
| 525 | Ga0207677_10119855 | 3300026023 | Bacteria | 1977 |
| 526 | Ga0207677_10141931 | 3300026023 | Bacteria | 1840 |
| 527 | Ga0207677_10431258 | 3300026023 | Bacteria | 1125 |
| 528 | Ga0207703_10003160 | 3300026035 | Bacteria | 13896 |
| 529 | Ga0207703_10023759 | 3300026035 | Bacteria | 4821 |
| 530 | Ga0207703_10032326 | 3300026035 | Bacteria | 4141 |
| 531 | Ga0207703_10101622 | 3300026035 | Bacteria | 2438 |
| 532 | Ga0207703_10356362 | 3300026035 | Bacteria | 1348 |
| 533 | Ga0207639_10001213 | 3300026041 | Bacteria | 17498 |
| 534 | Ga0207639_10007329 | 3300026041 | Bacteria | 7515 |
| 535 | Ga0207639_10097249 | 3300026041 | Bacteria | 2370 |
| 536 | Ga0207639_10227943 | 3300026041 | Bacteria | 1613 |
| 537 | Ga0207639_10254757 | 3300026041 | Bacteria | 1532 |
| 538 | Ga0207639_10278082 | 3300026041 | Bacteria | 1471 |
| 539 | Ga0207639_10483742 | 3300026041 | Bacteria | 1129 |
| 540 | Ga0207678_10000716 | 3300026067 | Bacteria | 30304 |
| 541 | Ga0207678_10007209 | 3300026067 | Bacteria | 9857 |
| 542 | Ga0207678_10019180 | 3300026067 | Bacteria | 6004 |
| 543 | Ga0207678_10020789 | 3300026067 | Bacteria | 5753 |
| 544 | Ga0207678_10034705 | 3300026067 | Bacteria | 4393 |
| 545 | Ga0207678_10051209 | 3300026067 | Bacteria | 3565 |
| 546 | Ga0207678_10177581 | 3300026067 | Bacteria | 1818 |
| 547 | Ga0207678_10338726 | 3300026067 | Bacteria | 1296 |
| 548 | Ga0207678_10382268 | 3300026067 | Bacteria | 1217 |
| 549 | Ga0207678_10395635 | 3300026067 | Bacteria | 1196 |
| 550 | Ga0207678_10579443 | 3300026067 | Bacteria | 983 |
| 551 | Ga0207702_10015322 | 3300026078 | Bacteria | 6355 |
| 552 | Ga0207702_10016918 | 3300026078 | Bacteria | 6035 |
| 553 | Ga0207702_10130877 | 3300026078 | Bacteria | 2258 |
| 554 | Ga0207702_10819984 | 3300026078 | Bacteria | 920 |
| 555 | Ga0207641_10012223 | 3300026088 | Bacteria | 7045 |
| 556 | Ga0207641_10042134 | 3300026088 | Bacteria | 3828 |
| 557 | Ga0207641_10043133 | 3300026088 | Bacteria | 3786 |
| 558 | Ga0207641_10165150 | 3300026088 | Bacteria | 2015 |
| 559 | Ga0207641_10279949 | 3300026088 | Bacteria | 1568 |
| 560 | Ga0207648_10000104 | 3300026089 | Bacteria | 81717 |
| 561 | Ga0207648_10003117 | 3300026089 | Bacteria | 17506 |
| 562 | Ga0207648_10013745 | 3300026089 | Bacteria | 7514 |
| 563 | Ga0207648_10058958 | 3300026089 | Bacteria | 3348 |
| 564 | Ga0207648_10264045 | 3300026089 | Bacteria | 1537 |
| 565 | Ga0207676_10004148 | 3300026095 | Bacteria | 10231 |
| 566 | Ga0207676_10010419 | 3300026095 | Bacteria | 6617 |
| 567 | Ga0207676_10026266 | 3300026095 | Bacteria | 4330 |
| 568 | Ga0207676_10033212 | 3300026095 | Bacteria | 3897 |
| 569 | Ga0207676_10035753 | 3300026095 | Bacteria | 3773 |
| 570 | Ga0207676_10319868 | 3300026095 | Bacteria | 1424 |
| 571 | Ga0207674_10000345 | 3300026116 | Bacteria | 59803 |
| 572 | Ga0207674_10001057 | 3300026116 | Bacteria | 35856 |
| 573 | Ga0207674_10001571 | 3300026116 | Bacteria | 29407 |
| 574 | Ga0207674_10003098 | 3300026116 | Bacteria | 20546 |
| 575 | Ga0207674_10003125 | 3300026116 | Bacteria | 20421 |
| 576 | Ga0207674_10016803 | 3300026116 | Bacteria | 7998 |
| 577 | Ga0207674_10049649 | 3300026116 | Bacteria | 4290 |
| 578 | Ga0207675_100000035 | 3300026118 | Bacteria | 95190 |
| 579 | Ga0207675_100346828 | 3300026118 | Bacteria | 1454 |
| 580 | Ga0207683_10001980 | 3300026121 | Bacteria | 18118 |
| 581 | Ga0207683_10004221 | 3300026121 | Bacteria | 12412 |
| 582 | Ga0207683_10011385 | 3300026121 | Bacteria | 7591 |
| 583 | Ga0207683_10086278 | 3300026121 | Bacteria | 2790 |
| 584 | Ga0207698_10003964 | 3300026142 | Bacteria | 8973 |
| 585 | Ga0207698_10005650 | 3300026142 | Bacteria | 7743 |
| 586 | Ga0207698_10010338 | 3300026142 | Bacteria | 5987 |
| 587 | Ga0207698_10014787 | 3300026142 | Bacteria | 5201 |
| 588 | Ga0207698_10035580 | 3300026142 | Bacteria | 3645 |
| 589 | Ga0207698_10066036 | 3300026142 | Bacteria | 2846 |
| 590 | Ga0207698_10073695 | 3300026142 | Bacteria | 2720 |
| 591 | Ga0207698_10086869 | 3300026142 | Bacteria | 2545 |
| 592 | Ga0207698_10184453 | 3300026142 | Bacteria | 1852 |
| 593 | Ga0207698_10615438 | 3300026142 | Bacteria | 1072 |
| 594 | Ga0209970_1013361 | 3300027614 | Bacteria | 1361 |
| 595 | Ga0209974_10000337 | 3300027876 | Bacteria | 15344 |
| 596 | Ga0268266_10000133 | 3300028379 | Bacteria | 143210 |
| 597 | Ga0268266_10004030 | 3300028379 | Bacteria | 14202 |
| 598 | Ga0268266_10162059 | 3300028379 | Bacteria | 2024 |
| 599 | Ga0268266_10805455 | 3300028379 | Bacteria | 907 |
| 600 | Ga0268265_10107245 | 3300028380 | Bacteria | 2271 |
| 601 | Ga0268265_10179747 | 3300028380 | Bacteria | 1816 |
| 602 | Ga0268264_10072608 | 3300028381 | Bacteria | 2918 |
| 603 | Ga0268264_10224758 | 3300028381 | Bacteria | 1730 |
| 604 | Ga0268264_10353904 | 3300028381 | Bacteria | 1399 |
| 605 | Ga0307408_100090974 | 3300031548 | Bacteria | 2303 |
| 606 | Ga0307408_100265206 | 3300031548 | Bacteria | 1423 |
| 607 | Ga0307408_100360594 | 3300031548 | Bacteria | 1236 |
| 608 | Ga0307408_100620507 | 3300031548 | Bacteria | 963 |
| 609 | Ga0307405_10044659 | 3300031731 | Bacteria | 2711 |
| 610 | Ga0307405_10160507 | 3300031731 | Bacteria | 1591 |
| 611 | Ga0307405_10183488 | 3300031731 | Bacteria | 1504 |
| 612 | Ga0307405_10189402 | 3300031731 | Bacteria | 1484 |
| 613 | Ga0307405_10405255 | 3300031731 | Bacteria | 1069 |
| 614 | Ga0307413_10077439 | 3300031824 | Bacteria | 2117 |
| 615 | Ga0307413_10102054 | 3300031824 | Bacteria | 1898 |
| 616 | Ga0307413_10296963 | 3300031824 | Bacteria | 1223 |
| 617 | Ga0307410_10004817 | 3300031852 | Bacteria | 7047 |
| 618 | Ga0307410_10012174 | 3300031852 | Bacteria | 4959 |
| 619 | Ga0307410_10012813 | 3300031852 | Bacteria | 4866 |
| 620 | Ga0307410_10048944 | 3300031852 | Bacteria | 2835 |
| 621 | Ga0307410_10057491 | 3300031852 | Bacteria | 2649 |
| 622 | Ga0307410_10255265 | 3300031852 | Bacteria | 1365 |
| 623 | Ga0307410_10359737 | 3300031852 | Bacteria | 1165 |
| 624 | Ga0307406_10012522 | 3300031901 | Bacteria | 4835 |
| 625 | Ga0307406_10151833 | 3300031901 | Bacteria | 1653 |
| 626 | Ga0307406_10180289 | 3300031901 | Bacteria | 1537 |
| 627 | Ga0307406_10246744 | 3300031901 | Bacteria | 1342 |
| 628 | Ga0307407_10008669 | 3300031903 | Bacteria | 4682 |
| 629 | Ga0307407_10037907 | 3300031903 | Bacteria | 2667 |
| 630 | Ga0307407_10052099 | 3300031903 | Bacteria | 2349 |
| 631 | Ga0307407_10140408 | 3300031903 | Bacteria | 1558 |
| 632 | Ga0307407_10151008 | 3300031903 | Bacteria | 1509 |
| 633 | Ga0307412_10001044 | 3300031911 | Bacteria | 15823 |
| 634 | Ga0307412_10043424 | 3300031911 | Bacteria | 2927 |
| 635 | Ga0307412_10245438 | 3300031911 | Bacteria | 1387 |
| 636 | Ga0307412_10265673 | 3300031911 | Bacteria | 1340 |
| 637 | Ga0307409_100016559 | 3300031995 | Bacteria | 4881 |
| 638 | Ga0307409_100102146 | 3300031995 | Bacteria | 2381 |
| 639 | Ga0307409_100133004 | 3300031995 | Bacteria | 2129 |
| 640 | Ga0307409_100162156 | 3300031995 | Bacteria | 1957 |
| 641 | Ga0307409_100196810 | 3300031995 | Bacteria | 1799 |
| 642 | Ga0307409_100275523 | 3300031995 | Bacteria | 1552 |
| 643 | Ga0307416_100001404 | 3300032002 | Bacteria | 13051 |
| 644 | Ga0307416_100047175 | 3300032002 | Bacteria | 3407 |
| 645 | Ga0307416_100108083 | 3300032002 | Bacteria | 2443 |
| 646 | Ga0307416_100113208 | 3300032002 | Bacteria | 2397 |
| 647 | Ga0307416_100121541 | 3300032002 | Bacteria | 2329 |
| 648 | Ga0307414_10000144 | 3300032004 | Bacteria | 48442 |
| 649 | Ga0307414_10045909 | 3300032004 | Bacteria | 2994 |
| 650 | Ga0307414_10046156 | 3300032004 | Bacteria | 2988 |
| 651 | Ga0307414_10050673 | 3300032004 | Bacteria | 2877 |
| 652 | Ga0307414_10061562 | 3300032004 | Bacteria | 2659 |
| 653 | Ga0307411_10013445 | 3300032005 | Bacteria | 4517 |
| 654 | Ga0307411_10031954 | 3300032005 | Bacteria | 3246 |
| 655 | Ga0307411_10077934 | 3300032005 | Bacteria | 2270 |
| 656 | Ga0307411_10399639 | 3300032005 | Bacteria | 1135 |
| 657 | Ga0307411_10558978 | 3300032005 | Bacteria | 977 |
| 658 | Ga0307415_100008803 | 3300032126 | Bacteria | 5618 |
| 659 | Ga0307415_100207401 | 3300032126 | Bacteria | 1560 |
| 660 | Ga0307415_100402528 | 3300032126 | Bacteria | 1169 |
| 661 | Ga0373943_0029968 | 3300035170 | Bacteria | 2573 |
| 662 | Ga0395899_0000225 | 3300037312 | Bacteria | 76673 |
| 663 | Ga0395899_0000804 | 3300037312 | Bacteria | 30745 |
| 664 | Ga0395899_0000911 | 3300037312 | Bacteria | 27806 |
| 665 | Ga0395899_0001269 | 3300037312 | Bacteria | 21956 |
| 666 | Ga0395899_0002669 | 3300037312 | Bacteria | 14380 |
| 667 | Ga0395899_0012431 | 3300037312 | Bacteria | 6522 |
| 668 | Ga0395899_0029775 | 3300037312 | Bacteria | 4106 |
| 669 | Ga0395899_0059726 | 3300037312 | Bacteria | 2811 |
| 670 | Ga0395899_0064303 | 3300037312 | Bacteria | 2697 |
| 671 | Ga0395899_0109598 | 3300037312 | Bacteria | 1986 |
| 672 | Ga0395899_0189680 | 3300037312 | Bacteria | 1439 |
| 673 | Ga0395899_0204422 | 3300037312 | Bacteria | 1375 |
| 674 | Ga0395899_0223569 | 3300037312 | Bacteria | 1303 |
| 675 | Ga0395899_0233151 | 3300037312 | Bacteria | 1270 |
| 676 | Ga0395899_0245653 | 3300037312 | Bacteria | 1230 |
| 677 | Ga0395899_0308089 | 3300037312 | Bacteria | 1070 |
| 678 | Ga0395900_0000911 | 3300037418 | Bacteria | 38912 |
| 679 | Ga0395900_0001255 | 3300037418 | Bacteria | 31098 |
| 680 | Ga0395900_0002300 | 3300037418 | Bacteria | 21222 |
| 681 | Ga0395900_0002356 | 3300037418 | Bacteria | 20915 |
| 682 | Ga0395900_0009730 | 3300037418 | Bacteria | 9846 |
| 683 | Ga0395900_0012076 | 3300037418 | Bacteria | 8825 |
| 684 | Ga0395900_0013567 | 3300037418 | Bacteria | 8324 |
| 685 | Ga0395900_0048295 | 3300037418 | Bacteria | 4384 |
| 686 | Ga0395900_0056921 | 3300037418 | Bacteria | 4025 |
| 687 | Ga0395900_0066499 | 3300037418 | Bacteria | 3703 |
| 688 | Ga0395900_0098392 | 3300037418 | Bacteria | 3006 |
| 689 | Ga0395900_0118616 | 3300037418 | Bacteria | 2715 |
| 690 | Ga0395900_0147207 | 3300037418 | Bacteria | 2408 |
| 691 | Ga0395900_0150794 | 3300037418 | Bacteria | 2375 |
| 692 | Ga0395900_0165283 | 3300037418 | Bacteria | 2255 |
| 693 | Ga0395900_0424005 | 3300037418 | Bacteria | 1291 |
| 694 | Ga0395900_0489819 | 3300037418 | Bacteria | 1181 |
| 695 | Ga0395900_0544508 | 3300037418 | Bacteria | 1106 |
| 696 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 697 | Ga0395898_0001464 | 3300037466 | Bacteria | 33283 |
| 698 | Ga0395898_0001496 | 3300037466 | Bacteria | 32433 |
| 699 | Ga0395898_0007069 | 3300037466 | Bacteria | 11922 |
| 700 | Ga0395898_0027288 | 3300037466 | Bacteria | 5734 |
| 701 | Ga0395898_0036361 | 3300037466 | Bacteria | 4889 |
| 702 | Ga0395898_0111649 | 3300037466 | Bacteria | 2620 |
| 703 | Ga0395898_0342748 | 3300037466 | Bacteria | 1425 |
| 704 | Ga0395898_0782832 | 3300037466 | Bacteria | 894 |
| 705 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 706 | Ga0395905_0000193 | 3300037471 | Bacteria | 96667 |
| 707 | Ga0395905_0000546 | 3300037471 | Bacteria | 51378 |
| 708 | Ga0395905_0001063 | 3300037471 | Bacteria | 34650 |
| 709 | Ga0395905_0001765 | 3300037471 | Bacteria | 25140 |
| 710 | Ga0395905_0003104 | 3300037471 | Bacteria | 17940 |
| 711 | Ga0395905_0005749 | 3300037471 | Bacteria | 12610 |
| 712 | Ga0395905_0005835 | 3300037471 | Bacteria | 12513 |
| 713 | Ga0395905_0008283 | 3300037471 | Bacteria | 10263 |
| 714 | Ga0395905_0013279 | 3300037471 | Bacteria | 7901 |
| 715 | Ga0395905_0015356 | 3300037471 | Bacteria | 7278 |
| 716 | Ga0395905_0021076 | 3300037471 | Bacteria | 6171 |
| 717 | Ga0395905_0046031 | 3300037471 | Bacteria | 4091 |
| 718 | Ga0395905_0048606 | 3300037471 | Bacteria | 3975 |
| 719 | Ga0395905_0048956 | 3300037471 | Bacteria | 3960 |
| 720 | Ga0395905_0050664 | 3300037471 | Bacteria | 3889 |
| 721 | Ga0395905_0053660 | 3300037471 | Bacteria | 3772 |
| 722 | Ga0395905_0055189 | 3300037471 | Bacteria | 3718 |
| 723 | Ga0395905_0055532 | 3300037471 | Bacteria | 3706 |
| 724 | Ga0395905_0078477 | 3300037471 | Bacteria | 3094 |
| 725 | Ga0395905_0093819 | 3300037471 | Bacteria | 2815 |
| 726 | Ga0395905_0188729 | 3300037471 | Bacteria | 1934 |
| 727 | Ga0395905_0200783 | 3300037471 | Bacteria | 1869 |
| 728 | Ga0395905_0201534 | 3300037471 | Bacteria | 1866 |
| 729 | Ga0395905_0203973 | 3300037471 | Bacteria | 1853 |
| 730 | Ga0395905_0219816 | 3300037471 | Bacteria | 1778 |
| 731 | Ga0395905_0223035 | 3300037471 | Bacteria | 1764 |
| 732 | Ga0395905_0231094 | 3300037471 | Bacteria | 1729 |
| 733 | Ga0395905_0271373 | 3300037471 | Bacteria | 1582 |
| 734 | Ga0395905_0337631 | 3300037471 | Bacteria | 1397 |
| 735 | Ga0395905_0386152 | 3300037471 | Bacteria | 1294 |
| 736 | Ga0395905_0492578 | 3300037471 | Bacteria | 1125 |
| 737 | Ga0395905_0512240 | 3300037471 | Bacteria | 1100 |
| 738 | Ga0395901_0000681 | 3300038443 | Bacteria | 39074 |
| 739 | Ga0395901_0005736 | 3300038443 | Bacteria | 12573 |
| 740 | Ga0395901_0008542 | 3300038443 | Bacteria | 10349 |
| 741 | Ga0395901_0015982 | 3300038443 | Bacteria | 7647 |
| 742 | Ga0395901_0028300 | 3300038443 | Bacteria | 5764 |
| 743 | Ga0395901_0033758 | 3300038443 | Bacteria | 5283 |
| 744 | Ga0395901_0042606 | 3300038443 | Bacteria | 4707 |
| 745 | Ga0395901_0074461 | 3300038443 | Bacteria | 3542 |
| 746 | Ga0395901_0080587 | 3300038443 | Bacteria | 3399 |
| 747 | Ga0395901_0130958 | 3300038443 | Bacteria | 2636 |
| 748 | Ga0395901_0137581 | 3300038443 | Bacteria | 2567 |
| 749 | Ga0395901_0154848 | 3300038443 | Bacteria | 2407 |
| 750 | Ga0395901_0174454 | 3300038443 | Bacteria | 2255 |
| 751 | Ga0395901_0353907 | 3300038443 | Bacteria | 1515 |
| 752 | Ga0395901_0394821 | 3300038443 | Bacteria | 1422 |
| 753 | Ga0395901_0585738 | 3300038443 | Bacteria | 1126 |
| 754 | Ga0436365_1429874 | 3300039437 | Bacteria | 7327 |
| 755 | Ga0436363_0375547 | 3300039450 | Bacteria | 1144 |
| 756 | Ga0439465_0040698 | 3300041413 | Bacteria | 1503 |
| 757 | Ga0439448_0024486 | 3300042005 | Bacteria | 1888 |
| 758 | Ga0439432_002187 | 3300042006 | Bacteria | 7386 |
| 759 | Ga0439432_087363 | 3300042006 | Bacteria | 940 |
| 760 | Ga0439449_0009979 | 3300042007 | Bacteria | 3593 |
| 761 | Ga0439455_0022907 | 3300042012 | Bacteria | 1501 |
| 762 | Ga0439458_0000485 | 3300042157 | Bacteria | 10187 |
| 763 | Ga0439458_0000555 | 3300042157 | Bacteria | 9619 |
| 764 | Ga0466969_0010344 | 3300044656 | Bacteria | 4947 |
| 765 | Ga0466965_0219959 | 3300044683 | Bacteria | 1012 |
| 766 | Ga0466966_0020358 | 3300044684 | Bacteria | 4364 |
| 767 | Ga0466966_0041616 | 3300044684 | Bacteria | 2952 |
| 768 | Ga0466966_0134013 | 3300044684 | Bacteria | 1515 |
| 769 | Ga0466961_0041219 | 3300044693 | Bacteria | 2960 |
| 770 | Ga0466961_0157766 | 3300044693 | Bacteria | 1415 |
| 771 | Ga0466961_0212996 | 3300044693 | Bacteria | 1192 |
| 772 | Ga0466964_0026443 | 3300044706 | Bacteria | 2271 |
| 773 | Ga0466971_0021142 | 3300044719 | Bacteria | 2895 |
| 774 | Ga0466970_0073946 | 3300044765 | Bacteria | 1834 |
| 775 | Ga0466957_0152655 | 3300044842 | Bacteria | 1495 |
| 776 | Ga0466957_0234604 | 3300044842 | Bacteria | 1216 |
| 777 | Ga0466960_0036388 | 3300044901 | Bacteria | 2305 |
| 778 | Ga0466960_0115483 | 3300044901 | Bacteria | 1400 |
| 779 | Ga0466959_0033313 | 3300045049 | Bacteria | 3810 |
| 780 | Ga0466959_0052324 | 3300045049 | Bacteria | 2991 |
| 781 | Ga0466959_0115492 | 3300045049 | Bacteria | 1912 |
| 782 | Ga0466959_0145087 | 3300045049 | Bacteria | 1675 |
| 783 | Ga0466959_0200741 | 3300045049 | Bacteria | 1388 |
| 784 | Ga0466959_0206900 | 3300045049 | Bacteria | 1365 |
| 785 | Ga0466958_0108300 | 3300045836 | Bacteria | 1733 |
| 786 | Ga0466958_0141047 | 3300045836 | Bacteria | 1517 |
| 787 | Ga0466958_0152369 | 3300045836 | Bacteria | 1458 |
| 788 | Ga0466958_0221850 | 3300045836 | Bacteria | 1206 |
| 789 | Ga0466958_0301766 | 3300045836 | Bacteria | 1028 |
| 790 | Ga0466967_0132961 | 3300045976 | Bacteria | 2311 |
| 791 | Ga0495627_000617 | 3300046453 | Bacteria | 28261 |
| 792 | Ga0495629_0131801 | 3300046459 | Bacteria | 1741 |
| 793 | Ga0495648_0005005 | 3300046524 | Bacteria | 11134 |
| 794 | Ga0495621_0007156 | 3300046539 | Bacteria | 3292 |
| 795 | Ga0495633_0099960 | 3300046558 | Bacteria | 1346 |
| 796 | Ga0495669_0006980 | 3300046684 | Bacteria | 4730 |
| 797 | Ga0495669_0091413 | 3300046684 | Bacteria | 1405 |
| 798 | Ga0495671_0043469 | 3300046692 | Bacteria | 2255 |
| 799 | Ga0496100_0116257 | 3300048903 | Bacteria | 1866 |
| 800 | Ga0496100_0273315 | 3300048903 | Bacteria | 1257 |
| 801 | Ga0496101_0001762 | 3300048904 | Bacteria | 12986 |
| 802 | Ga0496102_0057117 | 3300048905 | Bacteria | 3562 |
| 803 | Ga0496102_0310938 | 3300048905 | Bacteria | 1485 |
| 804 | Ga0496102_0457590 | 3300048905 | Bacteria | 1197 |
| 805 | Ga0496103_0072289 | 3300048906 | Bacteria | 2160 |
| 806 | Ga0496103_0455452 | 3300048906 | Unclassified | 820 |
| 807 | Ga0496104_0603531 | 3300048907 | Bacteria | 1008 |
| 808 | Ga0496105_0024862 | 3300048908 | Bacteria | 4868 |
| 809 | Ga0496106_0019188 | 3300048909 | Bacteria | 5070 |
| 810 | Ga0496106_0087328 | 3300048909 | Bacteria | 2403 |
| 811 | Ga0496107_0014597 | 3300048910 | Bacteria | 5498 |
| 812 | Ga0496107_0071018 | 3300048910 | Bacteria | 2529 |
| 813 | Ga0496107_0215234 | 3300048910 | Bacteria | 1429 |
| 814 | Ga0496107_0566249 | 3300048910 | Bacteria | 841 |
| 815 | Ga0496108_0003987 | 3300048911 | Bacteria | 11847 |
| 816 | Ga0496108_0007034 | 3300048911 | Bacteria | 9111 |
| 817 | Ga0496108_0031482 | 3300048911 | Bacteria | 4402 |
| 818 | Ga0496108_0067422 | 3300048911 | Bacteria | 3018 |
| 819 | Ga0496108_0127890 | 3300048911 | Bacteria | 2182 |
| 820 | Ga0496109_0005615 | 3300048912 | Bacteria | 10497 |
| 821 | Ga0496109_0007592 | 3300048912 | Bacteria | 9193 |
| 822 | Ga0496109_0044858 | 3300048912 | Bacteria | 4011 |
| 823 | Ga0496109_0117395 | 3300048912 | Bacteria | 2477 |
| 824 | Ga0496110_0016179 | 3300048913 | Bacteria | 6221 |
| 825 | Ga0496110_0023577 | 3300048913 | Bacteria | 5236 |
| 826 | Ga0496111_0027369 | 3300048914 | Bacteria | 4033 |
| 827 | Ga0496111_0036464 | 3300048914 | Bacteria | 3516 |
| 828 | Ga0496111_0037180 | 3300048914 | Bacteria | 3484 |
| 829 | Ga0496111_0052175 | 3300048914 | Bacteria | 2952 |
| 830 | Ga0496112_0019765 | 3300048915 | Bacteria | 6367 |
| 831 | Ga0496112_0020281 | 3300048915 | Bacteria | 6297 |
| 832 | Ga0496112_0040436 | 3300048915 | Bacteria | 4558 |
| 833 | Ga0496112_0074840 | 3300048915 | Bacteria | 3349 |
| 834 | Ga0496113_0006306 | 3300048916 | Bacteria | 7502 |
| 835 | Ga0496113_0013166 | 3300048916 | Bacteria | 5590 |
| 836 | Ga0496113_0177204 | 3300048916 | Bacteria | 1689 |
| 837 | Ga0496114_0000130 | 3300048917 | Bacteria | 54437 |
| 838 | Ga0496114_0466878 | 3300048917 | Bacteria | 1117 |
| 839 | Ga0496116_0044039 | 3300048919 | Bacteria | 3035 |
| 840 | Ga0496121_0006069 | 3300048924 | Bacteria | 15210 |
| 841 | Ga0496122_0006730 | 3300048925 | Bacteria | 13083 |
| 842 | Ga0496123_0005339 | 3300048926 | Bacteria | 12988 |
| 843 | Ga0496124_0007058 | 3300048927 | Bacteria | 12033 |
| 844 | Ga0496124_0042588 | 3300048927 | Bacteria | 3908 |
| 845 | Ga0496125_0002768 | 3300048928 | Bacteria | 22192 |
| 846 | Ga0496125_0010066 | 3300048928 | Bacteria | 9595 |
| 847 | Ga0496126_0015740 | 3300048929 | Bacteria | 7600 |
| 848 | Ga0501298_022284 | 3300049521 | Bacteria | 1193 |
| 849 | Ga0501216_004767 | 3300049660 | Bacteria | 2023 |
| 850 | Ga0501223_000066 | 3300049663 | Bacteria | 33567 |
| 851 | Ga0501223_013803 | 3300049663 | Bacteria | 1606 |
| 852 | Ga0501233_023952 | 3300049668 | Bacteria | 1331 |
| 853 | Ga0501235_007871 | 3300049669 | Bacteria | 2323 |
| 854 | Ga0501235_023392 | 3300049669 | Bacteria | 1377 |
| 855 | Ga0501257_054131 | 3300049686 | Bacteria | 1005 |
| 856 | Ga0501258_005296 | 3300049687 | Bacteria | 1247 |
| 857 | Ga0501221_014696 | 3300049704 | Bacteria | 1459 |
| 858 | Ga0501225_0000137 | 3300049705 | Bacteria | 22173 |
| 859 | Ga0501225_0001770 | 3300049705 | Bacteria | 6756 |
| 860 | Ga0501225_0030860 | 3300049705 | Bacteria | 1475 |
| 861 | Ga0501225_0044171 | 3300049705 | Bacteria | 1232 |
| 862 | Ga0501229_003871 | 3300049706 | Bacteria | 1809 |
| 863 | Ga0501262_005207 | 3300049759 | Bacteria | 1531 |
| 864 | Ga0501263_002869 | 3300049760 | Bacteria | 1799 |
| 865 | Ga0501268_001988 | 3300049765 | Bacteria | 2629 |
| 866 | Ga0501272_003433 | 3300049769 | Bacteria | 1611 |
| 867 | Ga0501273_001227 | 3300049770 | Bacteria | 2386 |
| 868 | Ga0495655_0005326 | 3300053083 | Bacteria | 2267 |
| 869 | Ga0500594_0001515 | 3300053118 | Bacteria | 5051 |
| 870 | Ga0500559_0013126 | 3300053136 | Bacteria | 3512 |
| 871 | Ga0466962_0108377 | 3300061719 | Bacteria | 1336 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026067 | Ga0207678_10019180 | Ga0207678_100191806 | 211 |
| 2 | 3300005339 | Ga0070660_100021606 | Ga0070660_1000216064 | 239 |
| 3 | 3300025919 | Ga0207657_10027595 | Ga0207657_100275953 | 239 |
| 4 | 3300025933 | Ga0207706_10107453 | Ga0207706_101074531 | 251 |
| 5 | 3300025909 | Ga0207705_10299638 | Ga0207705_102996382 | 256 |
| 6 | 3300005340 | Ga0070689_100247015 | Ga0070689_1002470151 | 258 |
| 7 | 3300025911 | Ga0207654_10132718 | Ga0207654_101327183 | 258 |
| 8 | 3300031548 | Ga0307408_100620507 | Ga0307408_1006205071 | 258 |
| 9 | 3300031824 | Ga0307413_10296963 | Ga0307413_102969632 | 258 |
| 10 | 3300032002 | Ga0307416_100108083 | Ga0307416_1001080831 | 258 |
| 11 | 3300032002 | Ga0307416_100121541 | Ga0307416_1001215413 | 258 |
| 12 | 3300032126 | Ga0307415_100402528 | Ga0307415_1004025281 | 258 |
| 13 | 3300048912 | Ga0496109_0117395 | Ga0496109_0117395_131_907 | 258 |
| 14 | 2162886007 | SwRhRL2b_contig_3748052 | SwRhRL2b_0784.00004870 | 259 |
| 15 | 3300001915 | JGI24741J21665_1000692 | JGI24741J21665_10006924 | 259 |
| 16 | 3300001979 | JGI24740J21852_10002149 | JGI24740J21852_100021495 | 259 |
| 17 | 3300001979 | JGI24740J21852_10003759 | JGI24740J21852_100037593 | 259 |
| 18 | 3300001979 | JGI24740J21852_10021057 | JGI24740J21852_100210572 | 259 |
| 19 | 3300001989 | JGI24739J22299_10000252 | JGI24739J22299_100002527 | 259 |
| 20 | 3300001989 | JGI24739J22299_10001180 | JGI24739J22299_100011805 | 259 |
| 21 | 3300001990 | JGI24737J22298_10002295 | JGI24737J22298_100022955 | 259 |
| 22 | 3300001990 | JGI24737J22298_10005205 | JGI24737J22298_100052054 | 259 |
| 23 | 3300001990 | JGI24737J22298_10006259 | JGI24737J22298_100062591 | 259 |
| 24 | 3300001990 | JGI24737J22298_10022606 | JGI24737J22298_100226063 | 259 |
| 25 | 3300002067 | JGI24735J21928_10001159 | JGI24735J21928_100011595 | 259 |
| 26 | 3300002067 | JGI24735J21928_10012860 | JGI24735J21928_100128602 | 259 |
| 27 | 3300002075 | JGI24738J21930_10000674 | JGI24738J21930_100006749 | 259 |
| 28 | 3300002075 | JGI24738J21930_10001019 | JGI24738J21930_100010194 | 259 |
| 29 | 3300002077 | JGI24744J21845_10001866 | JGI24744J21845_100018662 | 259 |
| 30 | 3300005289 | Ga0065704_10073918 | Ga0065704_100739184 | 259 |
| 31 | 3300005295 | Ga0065707_10010189 | Ga0065707_100101892 | 259 |
| 32 | 3300005327 | Ga0070658_10069755 | Ga0070658_100697554 | 259 |
| 33 | 3300005327 | Ga0070658_10079929 | Ga0070658_100799292 | 259 |
| 34 | 3300005327 | Ga0070658_10133947 | Ga0070658_101339472 | 259 |
| 35 | 3300005327 | Ga0070658_10146879 | Ga0070658_101468792 | 259 |
| 36 | 3300005327 | Ga0070658_10159219 | Ga0070658_101592192 | 259 |
| 37 | 3300005327 | Ga0070658_10206277 | Ga0070658_102062772 | 259 |
| 38 | 3300005327 | Ga0070658_10240928 | Ga0070658_102409282 | 259 |
| 39 | 3300005327 | Ga0070658_10344516 | Ga0070658_103445161 | 259 |
| 40 | 3300005327 | Ga0070658_10377692 | Ga0070658_103776922 | 259 |
| 41 | 3300005328 | Ga0070676_10003269 | Ga0070676_100032693 | 259 |
| 42 | 3300005328 | Ga0070676_10196259 | Ga0070676_101962591 | 259 |
| 43 | 3300005328 | Ga0070676_10240914 | Ga0070676_102409142 | 259 |
| 44 | 3300005328 | Ga0070676_10245316 | Ga0070676_102453162 | 259 |
| 45 | 3300005328 | Ga0070676_10405803 | Ga0070676_104058031 | 259 |
| 46 | 3300005328 | Ga0070676_10442032 | Ga0070676_104420321 | 259 |
| 47 | 3300005329 | Ga0070683_100019454 | Ga0070683_1000194542 | 259 |
| 48 | 3300005329 | Ga0070683_100024802 | Ga0070683_1000248022 | 259 |
| 49 | 3300005329 | Ga0070683_100141403 | Ga0070683_1001414032 | 259 |
| 50 | 3300005329 | Ga0070683_100255802 | Ga0070683_1002558022 | 259 |
| 51 | 3300005330 | Ga0070690_100015646 | Ga0070690_1000156464 | 259 |
| 52 | 3300005330 | Ga0070690_100025806 | Ga0070690_1000258063 | 259 |
| 53 | 3300005330 | Ga0070690_100096383 | Ga0070690_1000963832 | 259 |
| 54 | 3300005331 | Ga0070670_100000807 | Ga0070670_10000080713 | 259 |
| 55 | 3300005331 | Ga0070670_100008121 | Ga0070670_1000081212 | 259 |
| 56 | 3300005331 | Ga0070670_100014557 | Ga0070670_1000145575 | 259 |
| 57 | 3300005331 | Ga0070670_100031408 | Ga0070670_1000314082 | 259 |
| 58 | 3300005331 | Ga0070670_100031539 | Ga0070670_1000315394 | 259 |
| 59 | 3300005333 | Ga0070677_10023752 | Ga0070677_100237522 | 259 |
| 60 | 3300005333 | Ga0070677_10088434 | Ga0070677_100884342 | 259 |
| 61 | 3300005334 | Ga0068869_100024538 | Ga0068869_1000245382 | 259 |
| 62 | 3300005335 | Ga0070666_10002658 | Ga0070666_100026585 | 259 |
| 63 | 3300005335 | Ga0070666_10003092 | Ga0070666_100030923 | 259 |
| 64 | 3300005335 | Ga0070666_10013352 | Ga0070666_100133521 | 259 |
| 65 | 3300005335 | Ga0070666_10032530 | Ga0070666_100325304 | 259 |
| 66 | 3300005335 | Ga0070666_10246778 | Ga0070666_102467782 | 259 |
| 67 | 3300005336 | Ga0070680_100003695 | Ga0070680_1000036958 | 259 |
| 68 | 3300005336 | Ga0070680_100012588 | Ga0070680_1000125885 | 259 |
| 69 | 3300005337 | Ga0070682_100013647 | Ga0070682_1000136472 | 259 |
| 70 | 3300005337 | Ga0070682_100145211 | Ga0070682_1001452112 | 259 |
| 71 | 3300005338 | Ga0068868_100001893 | Ga0068868_1000018937 | 259 |
| 72 | 3300005338 | Ga0068868_100009974 | Ga0068868_1000099744 | 259 |
| 73 | 3300005338 | Ga0068868_100013938 | Ga0068868_1000139385 | 259 |
| 74 | 3300005338 | Ga0068868_100169491 | Ga0068868_1001694912 | 259 |
| 75 | 3300005338 | Ga0068868_100560811 | Ga0068868_1005608111 | 259 |
| 76 | 3300005339 | Ga0070660_100006064 | Ga0070660_1000060644 | 259 |
| 77 | 3300005339 | Ga0070660_100014880 | Ga0070660_1000148806 | 259 |
| 78 | 3300005339 | Ga0070660_100029285 | Ga0070660_1000292854 | 259 |
| 79 | 3300005339 | Ga0070660_100035865 | Ga0070660_1000358654 | 259 |
| 80 | 3300005339 | Ga0070660_100038635 | Ga0070660_1000386353 | 259 |
| 81 | 3300005339 | Ga0070660_100042108 | Ga0070660_1000421084 | 259 |
| 82 | 3300005339 | Ga0070660_100093260 | Ga0070660_1000932602 | 259 |
| 83 | 3300005339 | Ga0070660_100134033 | Ga0070660_1001340332 | 259 |
| 84 | 3300005339 | Ga0070660_100393123 | Ga0070660_1003931232 | 259 |
| 85 | 3300005340 | Ga0070689_100006805 | Ga0070689_1000068052 | 259 |
| 86 | 3300005341 | Ga0070691_10098103 | Ga0070691_100981031 | 259 |
| 87 | 3300005344 | Ga0070661_100009704 | Ga0070661_1000097044 | 259 |
| 88 | 3300005344 | Ga0070661_100014744 | Ga0070661_1000147442 | 259 |
| 89 | 3300005344 | Ga0070661_100037391 | Ga0070661_1000373912 | 259 |
| 90 | 3300005344 | Ga0070661_100094213 | Ga0070661_1000942132 | 259 |
| 91 | 3300005344 | Ga0070661_100105175 | Ga0070661_1001051752 | 259 |
| 92 | 3300005344 | Ga0070661_100120518 | Ga0070661_1001205181 | 259 |
| 93 | 3300005344 | Ga0070661_100122744 | Ga0070661_1001227443 | 259 |
| 94 | 3300005344 | Ga0070661_100182420 | Ga0070661_1001824201 | 259 |
| 95 | 3300005344 | Ga0070661_100361200 | Ga0070661_1003612002 | 259 |
| 96 | 3300005347 | Ga0070668_100124876 | Ga0070668_1001248761 | 259 |
| 97 | 3300005347 | Ga0070668_100148459 | Ga0070668_1001484592 | 259 |
| 98 | 3300005353 | Ga0070669_100001260 | Ga0070669_10000126013 | 259 |
| 99 | 3300005354 | Ga0070675_100104855 | Ga0070675_1001048552 | 259 |
| 100 | 3300005354 | Ga0070675_100163269 | Ga0070675_1001632691 | 259 |
| 101 | 3300005355 | Ga0070671_100000927 | Ga0070671_10000092711 | 259 |
| 102 | 3300005355 | Ga0070671_100002825 | Ga0070671_10000282511 | 259 |
| 103 | 3300005355 | Ga0070671_100011596 | Ga0070671_1000115964 | 259 |
| 104 | 3300005355 | Ga0070671_100012260 | Ga0070671_1000122601 | 259 |
| 105 | 3300005355 | Ga0070671_100028280 | Ga0070671_1000282802 | 259 |
| 106 | 3300005355 | Ga0070671_100089917 | Ga0070671_1000899173 | 259 |
| 107 | 3300005355 | Ga0070671_100273666 | Ga0070671_1002736662 | 259 |
| 108 | 3300005355 | Ga0070671_100328366 | Ga0070671_1003283662 | 259 |
| 109 | 3300005356 | Ga0070674_100023242 | Ga0070674_1000232424 | 259 |
| 110 | 3300005356 | Ga0070674_100041914 | Ga0070674_1000419142 | 259 |
| 111 | 3300005356 | Ga0070674_100179089 | Ga0070674_1001790891 | 259 |
| 112 | 3300005364 | Ga0070673_100001674 | Ga0070673_1000016742 | 259 |
| 113 | 3300005364 | Ga0070673_100002345 | Ga0070673_1000023458 | 259 |
| 114 | 3300005364 | Ga0070673_100020014 | Ga0070673_1000200143 | 259 |
| 115 | 3300005364 | Ga0070673_100049184 | Ga0070673_1000491844 | 259 |
| 116 | 3300005364 | Ga0070673_100054226 | Ga0070673_1000542263 | 259 |
| 117 | 3300005364 | Ga0070673_100076667 | Ga0070673_1000766671 | 259 |
| 118 | 3300005364 | Ga0070673_100455939 | Ga0070673_1004559392 | 259 |
| 119 | 3300005366 | Ga0070659_100001267 | Ga0070659_10000126716 | 259 |
| 120 | 3300005366 | Ga0070659_100018346 | Ga0070659_1000183462 | 259 |
| 121 | 3300005366 | Ga0070659_100039254 | Ga0070659_1000392544 | 259 |
| 122 | 3300005366 | Ga0070659_100044004 | Ga0070659_1000440042 | 259 |
| 123 | 3300005366 | Ga0070659_100045903 | Ga0070659_1000459032 | 259 |
| 124 | 3300005366 | Ga0070659_100250544 | Ga0070659_1002505441 | 259 |
| 125 | 3300005366 | Ga0070659_100268103 | Ga0070659_1002681032 | 259 |
| 126 | 3300005367 | Ga0070667_100004545 | Ga0070667_1000045452 | 259 |
| 127 | 3300005367 | Ga0070667_100005246 | Ga0070667_1000052464 | 259 |
| 128 | 3300005367 | Ga0070667_100021218 | Ga0070667_1000212182 | 259 |
| 129 | 3300005367 | Ga0070667_100192796 | Ga0070667_1001927962 | 259 |
| 130 | 3300005367 | Ga0070667_100233717 | Ga0070667_1002337171 | 259 |
| 131 | 3300005367 | Ga0070667_100401331 | Ga0070667_1004013311 | 259 |
| 132 | 3300005367 | Ga0070667_100411854 | Ga0070667_1004118542 | 259 |
| 133 | 3300005435 | Ga0070714_100020265 | Ga0070714_1000202652 | 259 |
| 134 | 3300005435 | Ga0070714_100098350 | Ga0070714_1000983502 | 259 |
| 135 | 3300005435 | Ga0070714_100374956 | Ga0070714_1003749562 | 259 |
| 136 | 3300005435 | Ga0070714_100401194 | Ga0070714_1004011942 | 259 |
| 137 | 3300005435 | Ga0070714_100857313 | Ga0070714_1008573131 | 259 |
| 138 | 3300005455 | Ga0070663_100014152 | Ga0070663_1000141523 | 259 |
| 139 | 3300005455 | Ga0070663_100029638 | Ga0070663_1000296382 | 259 |
| 140 | 3300005455 | Ga0070663_100089109 | Ga0070663_1000891091 | 259 |
| 141 | 3300005455 | Ga0070663_100153030 | Ga0070663_1001530302 | 259 |
| 142 | 3300005456 | Ga0070678_100009697 | Ga0070678_1000096974 | 259 |
| 143 | 3300005456 | Ga0070678_100053016 | Ga0070678_1000530162 | 259 |
| 144 | 3300005456 | Ga0070678_100098312 | Ga0070678_1000983122 | 259 |
| 145 | 3300005456 | Ga0070678_100202114 | Ga0070678_1002021142 | 259 |
| 146 | 3300005456 | Ga0070678_100554340 | Ga0070678_1005543401 | 259 |
| 147 | 3300005457 | Ga0070662_100001203 | Ga0070662_10000120313 | 259 |
| 148 | 3300005457 | Ga0070662_100034885 | Ga0070662_1000348853 | 259 |
| 149 | 3300005457 | Ga0070662_100078224 | Ga0070662_1000782242 | 259 |
| 150 | 3300005457 | Ga0070662_100135123 | Ga0070662_1001351231 | 259 |
| 151 | 3300005457 | Ga0070662_100140977 | Ga0070662_1001409771 | 259 |
| 152 | 3300005457 | Ga0070662_100165462 | Ga0070662_1001654622 | 259 |
| 153 | 3300005457 | Ga0070662_100336784 | Ga0070662_1003367842 | 259 |
| 154 | 3300005458 | Ga0070681_10044346 | Ga0070681_100443464 | 259 |
| 155 | 3300005458 | Ga0070681_10303661 | Ga0070681_103036611 | 259 |
| 156 | 3300005459 | Ga0068867_100005599 | Ga0068867_1000055995 | 259 |
| 157 | 3300005459 | Ga0068867_100018721 | Ga0068867_1000187213 | 259 |
| 158 | 3300005459 | Ga0068867_100052268 | Ga0068867_1000522682 | 259 |
| 159 | 3300005466 | Ga0070685_10461159 | Ga0070685_104611591 | 259 |
| 160 | 3300005530 | Ga0070679_100022016 | Ga0070679_1000220162 | 259 |
| 161 | 3300005530 | Ga0070679_100071652 | Ga0070679_1000716523 | 259 |
| 162 | 3300005535 | Ga0070684_100002726 | Ga0070684_1000027265 | 259 |
| 163 | 3300005535 | Ga0070684_100011882 | Ga0070684_1000118823 | 259 |
| 164 | 3300005535 | Ga0070684_100225611 | Ga0070684_1002256112 | 259 |
| 165 | 3300005539 | Ga0068853_100002144 | Ga0068853_10000214411 | 259 |
| 166 | 3300005539 | Ga0068853_100119051 | Ga0068853_1001190512 | 259 |
| 167 | 3300005539 | Ga0068853_100137438 | Ga0068853_1001374382 | 259 |
| 168 | 3300005539 | Ga0068853_100217507 | Ga0068853_1002175072 | 259 |
| 169 | 3300005539 | Ga0068853_100251837 | Ga0068853_1002518372 | 259 |
| 170 | 3300005543 | Ga0070672_100015078 | Ga0070672_1000150785 | 259 |
| 171 | 3300005543 | Ga0070672_100015719 | Ga0070672_1000157195 | 259 |
| 172 | 3300005543 | Ga0070672_100096027 | Ga0070672_1000960272 | 259 |
| 173 | 3300005543 | Ga0070672_100350488 | Ga0070672_1003504882 | 259 |
| 174 | 3300005546 | Ga0070696_100007378 | Ga0070696_1000073786 | 259 |
| 175 | 3300005548 | Ga0070665_100001208 | Ga0070665_10000120820 | 259 |
| 176 | 3300005548 | Ga0070665_100004742 | Ga0070665_1000047425 | 259 |
| 177 | 3300005548 | Ga0070665_100012842 | Ga0070665_1000128423 | 259 |
| 178 | 3300005548 | Ga0070665_100034005 | Ga0070665_1000340055 | 259 |
| 179 | 3300005563 | Ga0068855_100002638 | Ga0068855_10000263811 | 259 |
| 180 | 3300005563 | Ga0068855_100113573 | Ga0068855_1001135732 | 259 |
| 181 | 3300005563 | Ga0068855_100193123 | Ga0068855_1001931232 | 259 |
| 182 | 3300005563 | Ga0068855_100199919 | Ga0068855_1001999193 | 259 |
| 183 | 3300005563 | Ga0068855_100353041 | Ga0068855_1003530412 | 259 |
| 184 | 3300005564 | Ga0070664_100000446 | Ga0070664_10000044620 | 259 |
| 185 | 3300005564 | Ga0070664_100003398 | Ga0070664_10000339811 | 259 |
| 186 | 3300005564 | Ga0070664_100012233 | Ga0070664_1000122332 | 259 |
| 187 | 3300005564 | Ga0070664_100048375 | Ga0070664_1000483753 | 259 |
| 188 | 3300005564 | Ga0070664_100074362 | Ga0070664_1000743622 | 259 |
| 189 | 3300005564 | Ga0070664_100076084 | Ga0070664_1000760843 | 259 |
| 190 | 3300005564 | Ga0070664_100097431 | Ga0070664_1000974311 | 259 |
| 191 | 3300005564 | Ga0070664_100146716 | Ga0070664_1001467162 | 259 |
| 192 | 3300005564 | Ga0070664_100573006 | Ga0070664_1005730062 | 259 |
| 193 | 3300005577 | Ga0068857_100001517 | Ga0068857_1000015178 | 259 |
| 194 | 3300005577 | Ga0068857_100003065 | Ga0068857_1000030657 | 259 |
| 195 | 3300005577 | Ga0068857_100004069 | Ga0068857_1000040696 | 259 |
| 196 | 3300005577 | Ga0068857_100304739 | Ga0068857_1003047392 | 259 |
| 197 | 3300005578 | Ga0068854_100003147 | Ga0068854_1000031476 | 259 |
| 198 | 3300005578 | Ga0068854_100008221 | Ga0068854_1000082212 | 259 |
| 199 | 3300005578 | Ga0068854_100023884 | Ga0068854_1000238843 | 259 |
| 200 | 3300005578 | Ga0068854_100080461 | Ga0068854_1000804613 | 259 |
| 201 | 3300005578 | Ga0068854_100106470 | Ga0068854_1001064702 | 259 |
| 202 | 3300005578 | Ga0068854_100144622 | Ga0068854_1001446222 | 259 |
| 203 | 3300005578 | Ga0068854_100343546 | Ga0068854_1003435462 | 259 |
| 204 | 3300005578 | Ga0068854_100520284 | Ga0068854_1005202842 | 259 |
| 205 | 3300005578 | Ga0068854_100674101 | Ga0068854_1006741011 | 259 |
| 206 | 3300005614 | Ga0068856_100015113 | Ga0068856_1000151131 | 259 |
| 207 | 3300005614 | Ga0068856_100040080 | Ga0068856_1000400802 | 259 |
| 208 | 3300005614 | Ga0068856_100050336 | Ga0068856_1000503361 | 259 |
| 209 | 3300005614 | Ga0068856_100078153 | Ga0068856_1000781532 | 259 |
| 210 | 3300005615 | Ga0070702_100269258 | Ga0070702_1002692581 | 259 |
| 211 | 3300005616 | Ga0068852_100000461 | Ga0068852_10000046112 | 259 |
| 212 | 3300005616 | Ga0068852_100019867 | Ga0068852_1000198674 | 259 |
| 213 | 3300005616 | Ga0068852_100029627 | Ga0068852_1000296272 | 259 |
| 214 | 3300005616 | Ga0068852_100116814 | Ga0068852_1001168143 | 259 |
| 215 | 3300005616 | Ga0068852_100126481 | Ga0068852_1001264812 | 259 |
| 216 | 3300005616 | Ga0068852_100494035 | Ga0068852_1004940351 | 259 |
| 217 | 3300005616 | Ga0068852_101081768 | Ga0068852_1010817681 | 259 |
| 218 | 3300005617 | Ga0068859_100008534 | Ga0068859_1000085345 | 259 |
| 219 | 3300005617 | Ga0068859_100009839 | Ga0068859_1000098392 | 259 |
| 220 | 3300005617 | Ga0068859_100050360 | Ga0068859_1000503604 | 259 |
| 221 | 3300005617 | Ga0068859_100243805 | Ga0068859_1002438052 | 259 |
| 222 | 3300005618 | Ga0068864_100003315 | Ga0068864_1000033154 | 259 |
| 223 | 3300005618 | Ga0068864_100020883 | Ga0068864_1000208835 | 259 |
| 224 | 3300005618 | Ga0068864_100064482 | Ga0068864_1000644824 | 259 |
| 225 | 3300005618 | Ga0068864_100118776 | Ga0068864_1001187762 | 259 |
| 226 | 3300005618 | Ga0068864_100254766 | Ga0068864_1002547662 | 259 |
| 227 | 3300005718 | Ga0068866_10056715 | Ga0068866_100567152 | 259 |
| 228 | 3300005719 | Ga0068861_100000052 | Ga0068861_10000005241 | 259 |
| 229 | 3300005719 | Ga0068861_100216662 | Ga0068861_1002166622 | 259 |
| 230 | 3300005834 | Ga0068851_10006913 | Ga0068851_100069132 | 259 |
| 231 | 3300005834 | Ga0068851_10018291 | Ga0068851_100182912 | 259 |
| 232 | 3300005834 | Ga0068851_10215039 | Ga0068851_102150392 | 259 |
| 233 | 3300005834 | Ga0068851_10230068 | Ga0068851_102300682 | 259 |
| 234 | 3300005840 | Ga0068870_10136484 | Ga0068870_101364842 | 259 |
| 235 | 3300005841 | Ga0068863_100003487 | Ga0068863_10000348710 | 259 |
| 236 | 3300005841 | Ga0068863_100008185 | Ga0068863_1000081852 | 259 |
| 237 | 3300005841 | Ga0068863_100009190 | Ga0068863_1000091906 | 259 |
| 238 | 3300005841 | Ga0068863_100012720 | Ga0068863_1000127204 | 259 |
| 239 | 3300005841 | Ga0068863_100036906 | Ga0068863_1000369064 | 259 |
| 240 | 3300005841 | Ga0068863_100057339 | Ga0068863_1000573392 | 259 |
| 241 | 3300005842 | Ga0068858_100008071 | Ga0068858_1000080717 | 259 |
| 242 | 3300005842 | Ga0068858_100017583 | Ga0068858_1000175834 | 259 |
| 243 | 3300005842 | Ga0068858_100136500 | Ga0068858_1001365002 | 259 |
| 244 | 3300005842 | Ga0068858_100157035 | Ga0068858_1001570352 | 259 |
| 245 | 3300005843 | Ga0068860_100003073 | Ga0068860_1000030736 | 259 |
| 246 | 3300005843 | Ga0068860_100036352 | Ga0068860_1000363522 | 259 |
| 247 | 3300005843 | Ga0068860_100064032 | Ga0068860_1000640324 | 259 |
| 248 | 3300005844 | Ga0068862_100018707 | Ga0068862_1000187073 | 259 |
| 249 | 3300005844 | Ga0068862_100492483 | Ga0068862_1004924832 | 259 |
| 250 | 3300005985 | Ga0081539_10188094 | Ga0081539_101880941 | 259 |
| 251 | 3300006173 | Ga0070716_100084000 | Ga0070716_1000840001 | 259 |
| 252 | 3300006237 | Ga0097621_100003754 | Ga0097621_1000037547 | 259 |
| 253 | 3300006237 | Ga0097621_100080112 | Ga0097621_1000801122 | 259 |
| 254 | 3300006237 | Ga0097621_100558030 | Ga0097621_1005580302 | 259 |
| 255 | 3300006358 | Ga0068871_100019567 | Ga0068871_1000195675 | 259 |
| 256 | 3300006358 | Ga0068871_100373963 | Ga0068871_1003739632 | 259 |
| 257 | 3300006881 | Ga0068865_100005997 | Ga0068865_1000059974 | 259 |
| 258 | 3300006881 | Ga0068865_100025297 | Ga0068865_1000252972 | 259 |
| 259 | 3300006881 | Ga0068865_100078208 | Ga0068865_1000782082 | 259 |
| 260 | 3300006931 | Ga0097620_100008534 | Ga0097620_1000085345 | 259 |
| 261 | 3300006931 | Ga0097620_100009839 | Ga0097620_1000098398 | 259 |
| 262 | 3300006931 | Ga0097620_100050361 | Ga0097620_1000503614 | 259 |
| 263 | 3300006931 | Ga0097620_100243789 | Ga0097620_1002437892 | 259 |
| 264 | 3300009011 | Ga0105251_10026917 | Ga0105251_100269172 | 259 |
| 265 | 3300009011 | Ga0105251_10104757 | Ga0105251_101047572 | 259 |
| 266 | 3300009093 | Ga0105240_10044466 | Ga0105240_100444664 | 259 |
| 267 | 3300009093 | Ga0105240_10460880 | Ga0105240_104608802 | 259 |
| 268 | 3300009093 | Ga0105240_10584971 | Ga0105240_105849712 | 259 |
| 269 | 3300009093 | Ga0105240_10867517 | Ga0105240_108675171 | 259 |
| 270 | 3300009098 | Ga0105245_10001667 | Ga0105245_100016678 | 259 |
| 271 | 3300009101 | Ga0105247_10450826 | Ga0105247_104508262 | 259 |
| 272 | 3300009174 | Ga0105241_10007878 | Ga0105241_100078785 | 259 |
| 273 | 3300009174 | Ga0105241_10041880 | Ga0105241_100418802 | 259 |
| 274 | 3300009176 | Ga0105242_10012800 | Ga0105242_100128004 | 259 |
| 275 | 3300009177 | Ga0105248_10000096 | Ga0105248_1000009619 | 259 |
| 276 | 3300009177 | Ga0105248_10001577 | Ga0105248_1000157710 | 259 |
| 277 | 3300009177 | Ga0105248_10006141 | Ga0105248_100061419 | 259 |
| 278 | 3300009177 | Ga0105248_10006863 | Ga0105248_100068633 | 259 |
| 279 | 3300009177 | Ga0105248_10006890 | Ga0105248_100068907 | 259 |
| 280 | 3300009177 | Ga0105248_10332047 | Ga0105248_103320472 | 259 |
| 281 | 3300009177 | Ga0105248_10681055 | Ga0105248_106810552 | 259 |
| 282 | 3300009545 | Ga0105237_10015281 | Ga0105237_100152814 | 259 |
| 283 | 3300009545 | Ga0105237_10079942 | Ga0105237_100799422 | 259 |
| 284 | 3300009545 | Ga0105237_10149808 | Ga0105237_101498083 | 259 |
| 285 | 3300009545 | Ga0105237_10151641 | Ga0105237_101516412 | 259 |
| 286 | 3300009551 | Ga0105238_10039716 | Ga0105238_100397164 | 259 |
| 287 | 3300009551 | Ga0105238_10191208 | Ga0105238_101912082 | 259 |
| 288 | 3300009551 | Ga0105238_10226369 | Ga0105238_102263692 | 259 |
| 289 | 3300009553 | Ga0105249_10198579 | Ga0105249_101985791 | 259 |
| 290 | 3300009978 | Ga0105148_100202 | Ga0105148_1002023 | 259 |
| 291 | 3300009982 | Ga0105147_105299 | Ga0105147_1052991 | 259 |
| 292 | 3300010375 | Ga0105239_10117373 | Ga0105239_101173732 | 259 |
| 293 | 3300011119 | Ga0105246_10022077 | Ga0105246_100220773 | 259 |
| 294 | 3300011119 | Ga0105246_10040645 | Ga0105246_100406454 | 259 |
| 295 | 3300011119 | Ga0105246_10275590 | Ga0105246_102755902 | 259 |
| 296 | 3300013100 | Ga0157373_10007215 | Ga0157373_100072151 | 259 |
| 297 | 3300013100 | Ga0157373_10017921 | Ga0157373_100179215 | 259 |
| 298 | 3300013100 | Ga0157373_10039257 | Ga0157373_100392573 | 259 |
| 299 | 3300013100 | Ga0157373_10081485 | Ga0157373_100814853 | 259 |
| 300 | 3300013100 | Ga0157373_10122166 | Ga0157373_101221662 | 259 |
| 301 | 3300013100 | Ga0157373_10129123 | Ga0157373_101291232 | 259 |
| 302 | 3300013100 | Ga0157373_10155107 | Ga0157373_101551072 | 259 |
| 303 | 3300013102 | Ga0157371_10003770 | Ga0157371_100037708 | 259 |
| 304 | 3300013102 | Ga0157371_10022992 | Ga0157371_100229924 | 259 |
| 305 | 3300013102 | Ga0157371_10040657 | Ga0157371_100406572 | 259 |
| 306 | 3300013102 | Ga0157371_10076634 | Ga0157371_100766342 | 259 |
| 307 | 3300013102 | Ga0157371_10114766 | Ga0157371_101147662 | 259 |
| 308 | 3300013102 | Ga0157371_10132648 | Ga0157371_101326483 | 259 |
| 309 | 3300013102 | Ga0157371_10135588 | Ga0157371_101355883 | 259 |
| 310 | 3300013102 | Ga0157371_10197728 | Ga0157371_101977281 | 259 |
| 311 | 3300013104 | Ga0157370_10102505 | Ga0157370_101025053 | 259 |
| 312 | 3300013104 | Ga0157370_10382552 | Ga0157370_103825522 | 259 |
| 313 | 3300013104 | Ga0157370_10532422 | Ga0157370_105324222 | 259 |
| 314 | 3300013105 | Ga0157369_10122804 | Ga0157369_101228043 | 259 |
| 315 | 3300013105 | Ga0157369_10139262 | Ga0157369_101392622 | 259 |
| 316 | 3300013105 | Ga0157369_10193603 | Ga0157369_101936032 | 259 |
| 317 | 3300013105 | Ga0157369_10214579 | Ga0157369_102145792 | 259 |
| 318 | 3300013105 | Ga0157369_10980573 | Ga0157369_109805731 | 259 |
| 319 | 3300013296 | Ga0157374_10009229 | Ga0157374_100092292 | 259 |
| 320 | 3300013296 | Ga0157374_10117607 | Ga0157374_101176072 | 259 |
| 321 | 3300013297 | Ga0157378_10001776 | Ga0157378_100017767 | 259 |
| 322 | 3300013297 | Ga0157378_10142034 | Ga0157378_101420342 | 259 |
| 323 | 3300013306 | Ga0163162_10048501 | Ga0163162_100485012 | 259 |
| 324 | 3300013306 | Ga0163162_10158044 | Ga0163162_101580442 | 259 |
| 325 | 3300013307 | Ga0157372_10068574 | Ga0157372_100685742 | 259 |
| 326 | 3300013307 | Ga0157372_10103884 | Ga0157372_101038843 | 259 |
| 327 | 3300013307 | Ga0157372_10230095 | Ga0157372_102300951 | 259 |
| 328 | 3300013307 | Ga0157372_10269475 | Ga0157372_102694752 | 259 |
| 329 | 3300013307 | Ga0157372_10302866 | Ga0157372_103028662 | 259 |
| 330 | 3300013307 | Ga0157372_10795999 | Ga0157372_107959991 | 259 |
| 331 | 3300013307 | Ga0157372_10853167 | Ga0157372_108531672 | 259 |
| 332 | 3300013308 | Ga0157375_10003831 | Ga0157375_100038314 | 259 |
| 333 | 3300013308 | Ga0157375_10026239 | Ga0157375_100262395 | 259 |
| 334 | 3300014325 | Ga0163163_10019009 | Ga0163163_100190095 | 259 |
| 335 | 3300014325 | Ga0163163_10034122 | Ga0163163_100341224 | 259 |
| 336 | 3300014325 | Ga0163163_10120482 | Ga0163163_101204822 | 259 |
| 337 | 3300014325 | Ga0163163_10721089 | Ga0163163_107210892 | 259 |
| 338 | 3300014968 | Ga0157379_10006317 | Ga0157379_100063172 | 259 |
| 339 | 3300014968 | Ga0157379_10368662 | Ga0157379_103686622 | 259 |
| 340 | 3300017792 | Ga0163161_10013697 | Ga0163161_100136975 | 259 |
| 341 | 3300025290 | Ga0207673_1019010 | Ga0207673_10190102 | 259 |
| 342 | 3300025315 | Ga0207697_10001060 | Ga0207697_1000106011 | 259 |
| 343 | 3300025315 | Ga0207697_10003608 | Ga0207697_100036084 | 259 |
| 344 | 3300025315 | Ga0207697_10013963 | Ga0207697_100139634 | 259 |
| 345 | 3300025315 | Ga0207697_10015837 | Ga0207697_100158372 | 259 |
| 346 | 3300025321 | Ga0207656_10011903 | Ga0207656_100119032 | 259 |
| 347 | 3300025321 | Ga0207656_10028906 | Ga0207656_100289063 | 259 |
| 348 | 3300025321 | Ga0207656_10086913 | Ga0207656_100869132 | 259 |
| 349 | 3300025321 | Ga0207656_10151540 | Ga0207656_101515402 | 259 |
| 350 | 3300025893 | Ga0207682_10028455 | Ga0207682_100284553 | 259 |
| 351 | 3300025899 | Ga0207642_10253517 | Ga0207642_102535172 | 259 |
| 352 | 3300025901 | Ga0207688_10002178 | Ga0207688_100021787 | 259 |
| 353 | 3300025901 | Ga0207688_10005414 | Ga0207688_100054145 | 259 |
| 354 | 3300025903 | Ga0207680_10007785 | Ga0207680_100077854 | 259 |
| 355 | 3300025903 | Ga0207680_10008339 | Ga0207680_100083391 | 259 |
| 356 | 3300025903 | Ga0207680_10028080 | Ga0207680_100280802 | 259 |
| 357 | 3300025903 | Ga0207680_10101677 | Ga0207680_101016771 | 259 |
| 358 | 3300025903 | Ga0207680_10165735 | Ga0207680_101657352 | 259 |
| 359 | 3300025904 | Ga0207647_10000153 | Ga0207647_100001535 | 259 |
| 360 | 3300025904 | Ga0207647_10001078 | Ga0207647_100010787 | 259 |
| 361 | 3300025904 | Ga0207647_10005438 | Ga0207647_100054385 | 259 |
| 362 | 3300025904 | Ga0207647_10007591 | Ga0207647_100075914 | 259 |
| 363 | 3300025904 | Ga0207647_10009600 | Ga0207647_100096005 | 259 |
| 364 | 3300025904 | Ga0207647_10020279 | Ga0207647_100202792 | 259 |
| 365 | 3300025904 | Ga0207647_10237091 | Ga0207647_102370912 | 259 |
| 366 | 3300025907 | Ga0207645_10003786 | Ga0207645_100037865 | 259 |
| 367 | 3300025907 | Ga0207645_10019133 | Ga0207645_100191334 | 259 |
| 368 | 3300025907 | Ga0207645_10066206 | Ga0207645_100662062 | 259 |
| 369 | 3300025907 | Ga0207645_10192331 | Ga0207645_101923312 | 259 |
| 370 | 3300025907 | Ga0207645_10252235 | Ga0207645_102522352 | 259 |
| 371 | 3300025907 | Ga0207645_10395103 | Ga0207645_103951031 | 259 |
| 372 | 3300025908 | Ga0207643_10016175 | Ga0207643_100161754 | 259 |
| 373 | 3300025909 | Ga0207705_10007304 | Ga0207705_100073048 | 259 |
| 374 | 3300025909 | Ga0207705_10009311 | Ga0207705_100093114 | 259 |
| 375 | 3300025909 | Ga0207705_10041020 | Ga0207705_100410203 | 259 |
| 376 | 3300025909 | Ga0207705_10071335 | Ga0207705_100713352 | 259 |
| 377 | 3300025909 | Ga0207705_10073108 | Ga0207705_100731082 | 259 |
| 378 | 3300025909 | Ga0207705_10105175 | Ga0207705_101051752 | 259 |
| 379 | 3300025909 | Ga0207705_10382995 | Ga0207705_103829951 | 259 |
| 380 | 3300025911 | Ga0207654_10021779 | Ga0207654_100217792 | 259 |
| 381 | 3300025911 | Ga0207654_10084466 | Ga0207654_100844662 | 259 |
| 382 | 3300025911 | Ga0207654_10147794 | Ga0207654_101477942 | 259 |
| 383 | 3300025912 | Ga0207707_10130129 | Ga0207707_101301292 | 259 |
| 384 | 3300025912 | Ga0207707_10413934 | Ga0207707_104139342 | 259 |
| 385 | 3300025913 | Ga0207695_10014240 | Ga0207695_100142408 | 259 |
| 386 | 3300025913 | Ga0207695_10089367 | Ga0207695_100893673 | 259 |
| 387 | 3300025913 | Ga0207695_10489827 | Ga0207695_104898272 | 259 |
| 388 | 3300025913 | Ga0207695_10581297 | Ga0207695_105812972 | 259 |
| 389 | 3300025913 | Ga0207695_10604420 | Ga0207695_106044201 | 259 |
| 390 | 3300025914 | Ga0207671_10016290 | Ga0207671_100162902 | 259 |
| 391 | 3300025914 | Ga0207671_10430501 | Ga0207671_104305012 | 259 |
| 392 | 3300025915 | Ga0207693_10043480 | Ga0207693_100434802 | 259 |
| 393 | 3300025917 | Ga0207660_10040596 | Ga0207660_100405962 | 259 |
| 394 | 3300025917 | Ga0207660_10153568 | Ga0207660_101535682 | 259 |
| 395 | 3300025917 | Ga0207660_10164361 | Ga0207660_101643612 | 259 |
| 396 | 3300025919 | Ga0207657_10000924 | Ga0207657_100009244 | 259 |
| 397 | 3300025919 | Ga0207657_10002827 | Ga0207657_100028278 | 259 |
| 398 | 3300025919 | Ga0207657_10005125 | Ga0207657_100051259 | 259 |
| 399 | 3300025919 | Ga0207657_10005183 | Ga0207657_1000518312 | 259 |
| 400 | 3300025919 | Ga0207657_10008828 | Ga0207657_100088289 | 259 |
| 401 | 3300025919 | Ga0207657_10010444 | Ga0207657_100104446 | 259 |
| 402 | 3300025919 | Ga0207657_10025691 | Ga0207657_100256915 | 259 |
| 403 | 3300025919 | Ga0207657_10042191 | Ga0207657_100421913 | 259 |
| 404 | 3300025919 | Ga0207657_10047659 | Ga0207657_100476592 | 259 |
| 405 | 3300025919 | Ga0207657_10048576 | Ga0207657_100485764 | 259 |
| 406 | 3300025919 | Ga0207657_10064335 | Ga0207657_100643351 | 259 |
| 407 | 3300025919 | Ga0207657_10082175 | Ga0207657_100821753 | 259 |
| 408 | 3300025919 | Ga0207657_10157225 | Ga0207657_101572252 | 259 |
| 409 | 3300025919 | Ga0207657_10190417 | Ga0207657_101904172 | 259 |
| 410 | 3300025919 | Ga0207657_10377541 | Ga0207657_103775411 | 259 |
| 411 | 3300025920 | Ga0207649_10008713 | Ga0207649_100087135 | 259 |
| 412 | 3300025920 | Ga0207649_10032395 | Ga0207649_100323952 | 259 |
| 413 | 3300025920 | Ga0207649_10068043 | Ga0207649_100680432 | 259 |
| 414 | 3300025920 | Ga0207649_10077508 | Ga0207649_100775082 | 259 |
| 415 | 3300025920 | Ga0207649_10107548 | Ga0207649_101075482 | 259 |
| 416 | 3300025920 | Ga0207649_10249720 | Ga0207649_102497202 | 259 |
| 417 | 3300025920 | Ga0207649_10398560 | Ga0207649_103985602 | 259 |
| 418 | 3300025921 | Ga0207652_10028892 | Ga0207652_100288924 | 259 |
| 419 | 3300025923 | Ga0207681_10009549 | Ga0207681_100095492 | 259 |
| 420 | 3300025923 | Ga0207681_10030101 | Ga0207681_100301013 | 259 |
| 421 | 3300025923 | Ga0207681_10538046 | Ga0207681_105380461 | 259 |
| 422 | 3300025924 | Ga0207694_10063156 | Ga0207694_100631562 | 259 |
| 423 | 3300025924 | Ga0207694_10146573 | Ga0207694_101465732 | 259 |
| 424 | 3300025924 | Ga0207694_10170950 | Ga0207694_101709502 | 259 |
| 425 | 3300025925 | Ga0207650_10017927 | Ga0207650_100179275 | 259 |
| 426 | 3300025925 | Ga0207650_10020206 | Ga0207650_100202064 | 259 |
| 427 | 3300025926 | Ga0207659_10014238 | Ga0207659_100142384 | 259 |
| 428 | 3300025926 | Ga0207659_10016588 | Ga0207659_100165883 | 259 |
| 429 | 3300025926 | Ga0207659_10115517 | Ga0207659_101155171 | 259 |
| 430 | 3300025926 | Ga0207659_10243662 | Ga0207659_102436621 | 259 |
| 431 | 3300025927 | Ga0207687_10009029 | Ga0207687_100090296 | 259 |
| 432 | 3300025928 | Ga0207700_10033241 | Ga0207700_100332412 | 259 |
| 433 | 3300025929 | Ga0207664_10082708 | Ga0207664_100827083 | 259 |
| 434 | 3300025929 | Ga0207664_10109568 | Ga0207664_101095682 | 259 |
| 435 | 3300025931 | Ga0207644_10000235 | Ga0207644_100002356 | 259 |
| 436 | 3300025931 | Ga0207644_10002554 | Ga0207644_100025544 | 259 |
| 437 | 3300025931 | Ga0207644_10002568 | Ga0207644_100025689 | 259 |
| 438 | 3300025931 | Ga0207644_10005217 | Ga0207644_100052175 | 259 |
| 439 | 3300025931 | Ga0207644_10005419 | Ga0207644_100054196 | 259 |
| 440 | 3300025931 | Ga0207644_10005961 | Ga0207644_100059616 | 259 |
| 441 | 3300025931 | Ga0207644_10283154 | Ga0207644_102831542 | 259 |
| 442 | 3300025931 | Ga0207644_10485879 | Ga0207644_104858792 | 259 |
| 443 | 3300025932 | Ga0207690_10003079 | Ga0207690_100030795 | 259 |
| 444 | 3300025932 | Ga0207690_10008443 | Ga0207690_100084432 | 259 |
| 445 | 3300025932 | Ga0207690_10084295 | Ga0207690_100842952 | 259 |
| 446 | 3300025932 | Ga0207690_10087872 | Ga0207690_100878722 | 259 |
| 447 | 3300025932 | Ga0207690_10145420 | Ga0207690_101454202 | 259 |
| 448 | 3300025932 | Ga0207690_10349098 | Ga0207690_103490982 | 259 |
| 449 | 3300025933 | Ga0207706_10000194 | Ga0207706_1000019456 | 259 |
| 450 | 3300025933 | Ga0207706_10001656 | Ga0207706_100016562 | 259 |
| 451 | 3300025933 | Ga0207706_10002630 | Ga0207706_100026308 | 259 |
| 452 | 3300025933 | Ga0207706_10004866 | Ga0207706_100048663 | 259 |
| 453 | 3300025933 | Ga0207706_10039419 | Ga0207706_100394194 | 259 |
| 454 | 3300025933 | Ga0207706_10040372 | Ga0207706_100403724 | 259 |
| 455 | 3300025933 | Ga0207706_10073264 | Ga0207706_100732642 | 259 |
| 456 | 3300025933 | Ga0207706_10109764 | Ga0207706_101097642 | 259 |
| 457 | 3300025933 | Ga0207706_10166146 | Ga0207706_101661463 | 259 |
| 458 | 3300025933 | Ga0207706_10178117 | Ga0207706_101781172 | 259 |
| 459 | 3300025933 | Ga0207706_10191207 | Ga0207706_101912073 | 259 |
| 460 | 3300025933 | Ga0207706_10440076 | Ga0207706_104400762 | 259 |
| 461 | 3300025934 | Ga0207686_10094562 | Ga0207686_100945622 | 259 |
| 462 | 3300025935 | Ga0207709_10040229 | Ga0207709_100402292 | 259 |
| 463 | 3300025936 | Ga0207670_10025140 | Ga0207670_100251403 | 259 |
| 464 | 3300025937 | Ga0207669_10018762 | Ga0207669_100187621 | 259 |
| 465 | 3300025937 | Ga0207669_10063789 | Ga0207669_100637893 | 259 |
| 466 | 3300025937 | Ga0207669_10161006 | Ga0207669_101610062 | 259 |
| 467 | 3300025937 | Ga0207669_10241389 | Ga0207669_102413892 | 259 |
| 468 | 3300025938 | Ga0207704_10007493 | Ga0207704_100074934 | 259 |
| 469 | 3300025938 | Ga0207704_10039589 | Ga0207704_100395892 | 259 |
| 470 | 3300025938 | Ga0207704_10052721 | Ga0207704_100527212 | 259 |
| 471 | 3300025939 | Ga0207665_10007628 | Ga0207665_100076284 | 259 |
| 472 | 3300025939 | Ga0207665_10082057 | Ga0207665_100820572 | 259 |
| 473 | 3300025940 | Ga0207691_10002330 | Ga0207691_100023309 | 259 |
| 474 | 3300025940 | Ga0207691_10003389 | Ga0207691_100033892 | 259 |
| 475 | 3300025940 | Ga0207691_10003584 | Ga0207691_100035844 | 259 |
| 476 | 3300025940 | Ga0207691_10009649 | Ga0207691_100096493 | 259 |
| 477 | 3300025940 | Ga0207691_10015795 | Ga0207691_100157952 | 259 |
| 478 | 3300025940 | Ga0207691_10114565 | Ga0207691_101145653 | 259 |
| 479 | 3300025941 | Ga0207711_10001137 | Ga0207711_1000113722 | 259 |
| 480 | 3300025941 | Ga0207711_10002848 | Ga0207711_1000284812 | 259 |
| 481 | 3300025941 | Ga0207711_10006288 | Ga0207711_100062885 | 259 |
| 482 | 3300025941 | Ga0207711_10038127 | Ga0207711_100381272 | 259 |
| 483 | 3300025941 | Ga0207711_10052245 | Ga0207711_100522452 | 259 |
| 484 | 3300025941 | Ga0207711_10054929 | Ga0207711_100549294 | 259 |
| 485 | 3300025941 | Ga0207711_10069349 | Ga0207711_100693492 | 259 |
| 486 | 3300025941 | Ga0207711_10333410 | Ga0207711_103334103 | 259 |
| 487 | 3300025942 | Ga0207689_10000094 | Ga0207689_1000009424 | 259 |
| 488 | 3300025942 | Ga0207689_10033567 | Ga0207689_100335673 | 259 |
| 489 | 3300025942 | Ga0207689_10046212 | Ga0207689_100462122 | 259 |
| 490 | 3300025944 | Ga0207661_10009081 | Ga0207661_100090814 | 259 |
| 491 | 3300025944 | Ga0207661_10043473 | Ga0207661_100434732 | 259 |
| 492 | 3300025944 | Ga0207661_10296046 | Ga0207661_102960462 | 259 |
| 493 | 3300025945 | Ga0207679_10003846 | Ga0207679_100038465 | 259 |
| 494 | 3300025945 | Ga0207679_10021663 | Ga0207679_100216632 | 259 |
| 495 | 3300025945 | Ga0207679_10021775 | Ga0207679_100217752 | 259 |
| 496 | 3300025945 | Ga0207679_10030202 | Ga0207679_100302024 | 259 |
| 497 | 3300025945 | Ga0207679_10042727 | Ga0207679_100427272 | 259 |
| 498 | 3300025945 | Ga0207679_10043122 | Ga0207679_100431223 | 259 |
| 499 | 3300025945 | Ga0207679_10092676 | Ga0207679_100926763 | 259 |
| 500 | 3300025945 | Ga0207679_10100608 | Ga0207679_101006082 | 259 |
| 501 | 3300025945 | Ga0207679_10375934 | Ga0207679_103759342 | 259 |
| 502 | 3300025945 | Ga0207679_10410373 | Ga0207679_104103732 | 259 |
| 503 | 3300025949 | Ga0207667_10008988 | Ga0207667_1000898811 | 259 |
| 504 | 3300025949 | Ga0207667_10077422 | Ga0207667_100774222 | 259 |
| 505 | 3300025949 | Ga0207667_10089753 | Ga0207667_100897534 | 259 |
| 506 | 3300025949 | Ga0207667_10092395 | Ga0207667_100923953 | 259 |
| 507 | 3300025949 | Ga0207667_10111308 | Ga0207667_101113083 | 259 |
| 508 | 3300025949 | Ga0207667_10128792 | Ga0207667_101287922 | 259 |
| 509 | 3300025949 | Ga0207667_10361204 | Ga0207667_103612042 | 259 |
| 510 | 3300025960 | Ga0207651_10002269 | Ga0207651_100022696 | 259 |
| 511 | 3300025960 | Ga0207651_10003286 | Ga0207651_100032863 | 259 |
| 512 | 3300025960 | Ga0207651_10008767 | Ga0207651_100087675 | 259 |
| 513 | 3300025960 | Ga0207651_10304423 | Ga0207651_103044232 | 259 |
| 514 | 3300025972 | Ga0207668_10134838 | Ga0207668_101348382 | 259 |
| 515 | 3300025972 | Ga0207668_10544855 | Ga0207668_105448551 | 259 |
| 516 | 3300025981 | Ga0207640_10095937 | Ga0207640_100959372 | 259 |
| 517 | 3300025981 | Ga0207640_10128274 | Ga0207640_101282743 | 259 |
| 518 | 3300025981 | Ga0207640_10237090 | Ga0207640_102370901 | 259 |
| 519 | 3300025981 | Ga0207640_10443266 | Ga0207640_104432662 | 259 |
| 520 | 3300025981 | Ga0207640_10468516 | Ga0207640_104685161 | 259 |
| 521 | 3300025981 | Ga0207640_10595373 | Ga0207640_105953731 | 259 |
| 522 | 3300025986 | Ga0207658_10006765 | Ga0207658_100067652 | 259 |
| 523 | 3300025986 | Ga0207658_10020303 | Ga0207658_100203032 | 259 |
| 524 | 3300025986 | Ga0207658_10257990 | Ga0207658_102579903 | 259 |
| 525 | 3300025986 | Ga0207658_10353296 | Ga0207658_103532962 | 259 |
| 526 | 3300025986 | Ga0207658_10384618 | Ga0207658_103846182 | 259 |
| 527 | 3300025986 | Ga0207658_10548157 | Ga0207658_105481571 | 259 |
| 528 | 3300026023 | Ga0207677_10004013 | Ga0207677_100040136 | 259 |
| 529 | 3300026023 | Ga0207677_10004145 | Ga0207677_100041456 | 259 |
| 530 | 3300026023 | Ga0207677_10006879 | Ga0207677_100068795 | 259 |
| 531 | 3300026023 | Ga0207677_10036404 | Ga0207677_100364044 | 259 |
| 532 | 3300026023 | Ga0207677_10119855 | Ga0207677_101198552 | 259 |
| 533 | 3300026023 | Ga0207677_10141931 | Ga0207677_101419312 | 259 |
| 534 | 3300026023 | Ga0207677_10431258 | Ga0207677_104312582 | 259 |
| 535 | 3300026035 | Ga0207703_10003160 | Ga0207703_100031609 | 259 |
| 536 | 3300026035 | Ga0207703_10023759 | Ga0207703_100237592 | 259 |
| 537 | 3300026035 | Ga0207703_10032326 | Ga0207703_100323262 | 259 |
| 538 | 3300026035 | Ga0207703_10101622 | Ga0207703_101016222 | 259 |
| 539 | 3300026035 | Ga0207703_10356362 | Ga0207703_103563622 | 259 |
| 540 | 3300026041 | Ga0207639_10001213 | Ga0207639_100012135 | 259 |
| 541 | 3300026041 | Ga0207639_10007329 | Ga0207639_100073293 | 259 |
| 542 | 3300026041 | Ga0207639_10097249 | Ga0207639_100972493 | 259 |
| 543 | 3300026041 | Ga0207639_10227943 | Ga0207639_102279432 | 259 |
| 544 | 3300026041 | Ga0207639_10254757 | Ga0207639_102547572 | 259 |
| 545 | 3300026041 | Ga0207639_10278082 | Ga0207639_102780822 | 259 |
| 546 | 3300026041 | Ga0207639_10483742 | Ga0207639_104837421 | 259 |
| 547 | 3300026067 | Ga0207678_10000716 | Ga0207678_1000071621 | 259 |
| 548 | 3300026067 | Ga0207678_10007209 | Ga0207678_100072095 | 259 |
| 549 | 3300026067 | Ga0207678_10020789 | Ga0207678_100207892 | 259 |
| 550 | 3300026067 | Ga0207678_10034705 | Ga0207678_100347053 | 259 |
| 551 | 3300026067 | Ga0207678_10051209 | Ga0207678_100512094 | 259 |
| 552 | 3300026067 | Ga0207678_10177581 | Ga0207678_101775812 | 259 |
| 553 | 3300026067 | Ga0207678_10338726 | Ga0207678_103387262 | 259 |
| 554 | 3300026067 | Ga0207678_10382268 | Ga0207678_103822681 | 259 |
| 555 | 3300026067 | Ga0207678_10395635 | Ga0207678_103956352 | 259 |
| 556 | 3300026067 | Ga0207678_10579443 | Ga0207678_105794431 | 259 |
| 557 | 3300026078 | Ga0207702_10015322 | Ga0207702_100153225 | 259 |
| 558 | 3300026078 | Ga0207702_10016918 | Ga0207702_100169182 | 259 |
| 559 | 3300026078 | Ga0207702_10130877 | Ga0207702_101308772 | 259 |
| 560 | 3300026078 | Ga0207702_10819984 | Ga0207702_108199841 | 259 |
| 561 | 3300026088 | Ga0207641_10012223 | Ga0207641_100122232 | 259 |
| 562 | 3300026088 | Ga0207641_10042134 | Ga0207641_100421343 | 259 |
| 563 | 3300026088 | Ga0207641_10043133 | Ga0207641_100431333 | 259 |
| 564 | 3300026088 | Ga0207641_10165150 | Ga0207641_101651502 | 259 |
| 565 | 3300026088 | Ga0207641_10279949 | Ga0207641_102799492 | 259 |
| 566 | 3300026089 | Ga0207648_10000104 | Ga0207648_1000010414 | 259 |
| 567 | 3300026089 | Ga0207648_10003117 | Ga0207648_100031174 | 259 |
| 568 | 3300026089 | Ga0207648_10013745 | Ga0207648_100137453 | 259 |
| 569 | 3300026089 | Ga0207648_10058958 | Ga0207648_100589582 | 259 |
| 570 | 3300026089 | Ga0207648_10264045 | Ga0207648_102640452 | 259 |
| 571 | 3300026095 | Ga0207676_10004148 | Ga0207676_100041483 | 259 |
| 572 | 3300026095 | Ga0207676_10010419 | Ga0207676_100104196 | 259 |
| 573 | 3300026095 | Ga0207676_10026266 | Ga0207676_100262662 | 259 |
| 574 | 3300026095 | Ga0207676_10033212 | Ga0207676_100332124 | 259 |
| 575 | 3300026095 | Ga0207676_10035753 | Ga0207676_100357534 | 259 |
| 576 | 3300026095 | Ga0207676_10319868 | Ga0207676_103198682 | 259 |
| 577 | 3300026116 | Ga0207674_10000345 | Ga0207674_100003458 | 259 |
| 578 | 3300026116 | Ga0207674_10001057 | Ga0207674_1000105737 | 259 |
| 579 | 3300026116 | Ga0207674_10001571 | Ga0207674_100015715 | 259 |
| 580 | 3300026116 | Ga0207674_10003098 | Ga0207674_1000309811 | 259 |
| 581 | 3300026116 | Ga0207674_10003125 | Ga0207674_1000312510 | 259 |
| 582 | 3300026116 | Ga0207674_10016803 | Ga0207674_100168034 | 259 |
| 583 | 3300026116 | Ga0207674_10049649 | Ga0207674_100496494 | 259 |
| 584 | 3300026118 | Ga0207675_100000035 | Ga0207675_10000003558 | 259 |
| 585 | 3300026118 | Ga0207675_100346828 | Ga0207675_1003468282 | 259 |
| 586 | 3300026121 | Ga0207683_10001980 | Ga0207683_1000198014 | 259 |
| 587 | 3300026121 | Ga0207683_10004221 | Ga0207683_100042217 | 259 |
| 588 | 3300026121 | Ga0207683_10011385 | Ga0207683_100113856 | 259 |
| 589 | 3300026121 | Ga0207683_10086278 | Ga0207683_100862782 | 259 |
| 590 | 3300026142 | Ga0207698_10003964 | Ga0207698_100039643 | 259 |
| 591 | 3300026142 | Ga0207698_10005650 | Ga0207698_100056502 | 259 |
| 592 | 3300026142 | Ga0207698_10010338 | Ga0207698_100103385 | 259 |
| 593 | 3300026142 | Ga0207698_10014787 | Ga0207698_100147875 | 259 |
| 594 | 3300026142 | Ga0207698_10035580 | Ga0207698_100355803 | 259 |
| 595 | 3300026142 | Ga0207698_10066036 | Ga0207698_100660363 | 259 |
| 596 | 3300026142 | Ga0207698_10073695 | Ga0207698_100736952 | 259 |
| 597 | 3300026142 | Ga0207698_10086869 | Ga0207698_100868692 | 259 |
| 598 | 3300026142 | Ga0207698_10184453 | Ga0207698_101844532 | 259 |
| 599 | 3300026142 | Ga0207698_10615438 | Ga0207698_106154381 | 259 |
| 600 | 3300027614 | Ga0209970_1013361 | Ga0209970_10133612 | 259 |
| 601 | 3300027876 | Ga0209974_10000337 | Ga0209974_1000033711 | 259 |
| 602 | 3300028379 | Ga0268266_10000133 | Ga0268266_10000133124 | 259 |
| 603 | 3300028379 | Ga0268266_10004030 | Ga0268266_100040308 | 259 |
| 604 | 3300028379 | Ga0268266_10162059 | Ga0268266_101620592 | 259 |
| 605 | 3300028379 | Ga0268266_10805455 | Ga0268266_108054551 | 259 |
| 606 | 3300028380 | Ga0268265_10107245 | Ga0268265_101072452 | 259 |
| 607 | 3300028380 | Ga0268265_10179747 | Ga0268265_101797471 | 259 |
| 608 | 3300028381 | Ga0268264_10072608 | Ga0268264_100726082 | 259 |
| 609 | 3300028381 | Ga0268264_10224758 | Ga0268264_102247582 | 259 |
| 610 | 3300028381 | Ga0268264_10353904 | Ga0268264_103539041 | 259 |
| 611 | 3300031548 | Ga0307408_100090974 | Ga0307408_1000909742 | 259 |
| 612 | 3300031548 | Ga0307408_100265206 | Ga0307408_1002652062 | 259 |
| 613 | 3300031548 | Ga0307408_100360594 | Ga0307408_1003605942 | 259 |
| 614 | 3300031731 | Ga0307405_10044659 | Ga0307405_100446592 | 259 |
| 615 | 3300031731 | Ga0307405_10160507 | Ga0307405_101605072 | 259 |
| 616 | 3300031731 | Ga0307405_10183488 | Ga0307405_101834882 | 259 |
| 617 | 3300031731 | Ga0307405_10189402 | Ga0307405_101894022 | 259 |
| 618 | 3300031731 | Ga0307405_10405255 | Ga0307405_104052552 | 259 |
| 619 | 3300031824 | Ga0307413_10077439 | Ga0307413_100774392 | 259 |
| 620 | 3300031824 | Ga0307413_10102054 | Ga0307413_101020542 | 259 |
| 621 | 3300031852 | Ga0307410_10004817 | Ga0307410_100048176 | 259 |
| 622 | 3300031852 | Ga0307410_10012174 | Ga0307410_100121742 | 259 |
| 623 | 3300031852 | Ga0307410_10012813 | Ga0307410_100128134 | 259 |
| 624 | 3300031852 | Ga0307410_10048944 | Ga0307410_100489442 | 259 |
| 625 | 3300031852 | Ga0307410_10057491 | Ga0307410_100574912 | 259 |
| 626 | 3300031852 | Ga0307410_10255265 | Ga0307410_102552652 | 259 |
| 627 | 3300031852 | Ga0307410_10359737 | Ga0307410_103597372 | 259 |
| 628 | 3300031901 | Ga0307406_10012522 | Ga0307406_100125222 | 259 |
| 629 | 3300031901 | Ga0307406_10151833 | Ga0307406_101518332 | 259 |
| 630 | 3300031901 | Ga0307406_10180289 | Ga0307406_101802892 | 259 |
| 631 | 3300031901 | Ga0307406_10246744 | Ga0307406_102467442 | 259 |
| 632 | 3300031903 | Ga0307407_10008669 | Ga0307407_100086695 | 259 |
| 633 | 3300031903 | Ga0307407_10037907 | Ga0307407_100379073 | 259 |
| 634 | 3300031903 | Ga0307407_10052099 | Ga0307407_100520992 | 259 |
| 635 | 3300031903 | Ga0307407_10140408 | Ga0307407_101404082 | 259 |
| 636 | 3300031903 | Ga0307407_10151008 | Ga0307407_101510082 | 259 |
| 637 | 3300031911 | Ga0307412_10001044 | Ga0307412_100010442 | 259 |
| 638 | 3300031911 | Ga0307412_10043424 | Ga0307412_100434243 | 259 |
| 639 | 3300031911 | Ga0307412_10245438 | Ga0307412_102454382 | 259 |
| 640 | 3300031911 | Ga0307412_10265673 | Ga0307412_102656732 | 259 |
| 641 | 3300031995 | Ga0307409_100016559 | Ga0307409_1000165594 | 259 |
| 642 | 3300031995 | Ga0307409_100102146 | Ga0307409_1001021461 | 259 |
| 643 | 3300031995 | Ga0307409_100133004 | Ga0307409_1001330042 | 259 |
| 644 | 3300031995 | Ga0307409_100162156 | Ga0307409_1001621562 | 259 |
| 645 | 3300031995 | Ga0307409_100196810 | Ga0307409_1001968103 | 259 |
| 646 | 3300031995 | Ga0307409_100275523 | Ga0307409_1002755232 | 259 |
| 647 | 3300032002 | Ga0307416_100001404 | Ga0307416_1000014042 | 259 |
| 648 | 3300032002 | Ga0307416_100047175 | Ga0307416_1000471753 | 259 |
| 649 | 3300032002 | Ga0307416_100113208 | Ga0307416_1001132082 | 259 |
| 650 | 3300032004 | Ga0307414_10000144 | Ga0307414_1000014444 | 259 |
| 651 | 3300032004 | Ga0307414_10045909 | Ga0307414_100459092 | 259 |
| 652 | 3300032004 | Ga0307414_10046156 | Ga0307414_100461561 | 259 |
| 653 | 3300032004 | Ga0307414_10050673 | Ga0307414_100506732 | 259 |
| 654 | 3300032004 | Ga0307414_10061562 | Ga0307414_100615622 | 259 |
| 655 | 3300032005 | Ga0307411_10013445 | Ga0307411_100134455 | 259 |
| 656 | 3300032005 | Ga0307411_10031954 | Ga0307411_100319542 | 259 |
| 657 | 3300032005 | Ga0307411_10077934 | Ga0307411_100779342 | 259 |
| 658 | 3300032005 | Ga0307411_10399639 | Ga0307411_103996392 | 259 |
| 659 | 3300032005 | Ga0307411_10558978 | Ga0307411_105589782 | 259 |
| 660 | 3300032126 | Ga0307415_100008803 | Ga0307415_1000088032 | 259 |
| 661 | 3300032126 | Ga0307415_100207401 | Ga0307415_1002074012 | 259 |
| 662 | 3300035170 | Ga0373943_0029968 | Ga0373943_0029968_1421_2206 | 259 |
| 663 | 3300037312 | Ga0395899_0000225 | Ga0395899_0000225_63123_63908 | 259 |
| 664 | 3300037312 | Ga0395899_0000804 | Ga0395899_0000804_7049_7834 | 259 |
| 665 | 3300037312 | Ga0395899_0000911 | Ga0395899_0000911_14854_15639 | 259 |
| 666 | 3300037312 | Ga0395899_0001269 | Ga0395899_0001269_12178_12963 | 259 |
| 667 | 3300037312 | Ga0395899_0002669 | Ga0395899_0002669_6777_7562 | 259 |
| 668 | 3300037312 | Ga0395899_0012431 | Ga0395899_0012431_5252_6058 | 259 |
| 669 | 3300037312 | Ga0395899_0029775 | Ga0395899_0029775_2006_2791 | 259 |
| 670 | 3300037312 | Ga0395899_0059726 | Ga0395899_0059726_90_875 | 259 |
| 671 | 3300037312 | Ga0395899_0064303 | Ga0395899_0064303_71_856 | 259 |
| 672 | 3300037312 | Ga0395899_0109598 | Ga0395899_0109598_1007_1792 | 259 |
| 673 | 3300037312 | Ga0395899_0189680 | Ga0395899_0189680_599_1381 | 259 |
| 674 | 3300037312 | Ga0395899_0204422 | Ga0395899_0204422_197_976 | 259 |
| 675 | 3300037312 | Ga0395899_0223569 | Ga0395899_0223569_398_1183 | 259 |
| 676 | 3300037312 | Ga0395899_0233151 | Ga0395899_0233151_372_1157 | 259 |
| 677 | 3300037312 | Ga0395899_0245653 | Ga0395899_0245653_141_926 | 259 |
| 678 | 3300037312 | Ga0395899_0308089 | Ga0395899_0308089_112_897 | 259 |
| 679 | 3300037418 | Ga0395900_0000911 | Ga0395900_0000911_23897_24682 | 259 |
| 680 | 3300037418 | Ga0395900_0001255 | Ga0395900_0001255_23891_24676 | 259 |
| 681 | 3300037418 | Ga0395900_0002300 | Ga0395900_0002300_16376_17161 | 259 |
| 682 | 3300037418 | Ga0395900_0002356 | Ga0395900_0002356_6972_7757 | 259 |
| 683 | 3300037418 | Ga0395900_0009730 | Ga0395900_0009730_6496_7281 | 259 |
| 684 | 3300037418 | Ga0395900_0012076 | Ga0395900_0012076_4511_5296 | 259 |
| 685 | 3300037418 | Ga0395900_0013567 | Ga0395900_0013567_376_1161 | 259 |
| 686 | 3300037418 | Ga0395900_0048295 | Ga0395900_0048295_1276_2058 | 259 |
| 687 | 3300037418 | Ga0395900_0056921 | Ga0395900_0056921_2498_3283 | 259 |
| 688 | 3300037418 | Ga0395900_0066499 | Ga0395900_0066499_490_1275 | 259 |
| 689 | 3300037418 | Ga0395900_0098392 | Ga0395900_0098392_38_823 | 259 |
| 690 | 3300037418 | Ga0395900_0118616 | Ga0395900_0118616_1276_2058 | 259 |
| 691 | 3300037418 | Ga0395900_0147207 | Ga0395900_0147207_1165_1947 | 259 |
| 692 | 3300037418 | Ga0395900_0150794 | Ga0395900_0150794_1110_1895 | 259 |
| 693 | 3300037418 | Ga0395900_0165283 | Ga0395900_0165283_675_1460 | 259 |
| 694 | 3300037418 | Ga0395900_0424005 | Ga0395900_0424005_58_840 | 259 |
| 695 | 3300037418 | Ga0395900_0489819 | Ga0395900_0489819_73_858 | 259 |
| 696 | 3300037418 | Ga0395900_0544508 | Ga0395900_0544508_202_987 | 259 |
| 697 | 3300037466 | Ga0395898_0000021 | Ga0395898_0000021_115218_116003 | 259 |
| 698 | 3300037466 | Ga0395898_0001464 | Ga0395898_0001464_8667_9452 | 259 |
| 699 | 3300037466 | Ga0395898_0001496 | Ga0395898_0001496_25816_26601 | 259 |
| 700 | 3300037466 | Ga0395898_0007069 | Ga0395898_0007069_632_1417 | 259 |
| 701 | 3300037466 | Ga0395898_0027288 | Ga0395898_0027288_2730_3515 | 259 |
| 702 | 3300037466 | Ga0395898_0036361 | Ga0395898_0036361_2885_3670 | 259 |
| 703 | 3300037466 | Ga0395898_0111649 | Ga0395898_0111649_656_1441 | 259 |
| 704 | 3300037466 | Ga0395898_0342748 | Ga0395898_0342748_351_1133 | 259 |
| 705 | 3300037466 | Ga0395898_0782832 | Ga0395898_0782832_71_856 | 259 |
| 706 | 3300037471 | Ga0395905_0000006 | Ga0395905_0000006_331470_332255 | 259 |
| 707 | 3300037471 | Ga0395905_0000193 | Ga0395905_0000193_30750_31535 | 259 |
| 708 | 3300037471 | Ga0395905_0000546 | Ga0395905_0000546_29546_30331 | 259 |
| 709 | 3300037471 | Ga0395905_0001063 | Ga0395905_0001063_32433_33218 | 259 |
| 710 | 3300037471 | Ga0395905_0001765 | Ga0395905_0001765_18644_19429 | 259 |
| 711 | 3300037471 | Ga0395905_0003104 | Ga0395905_0003104_13750_14535 | 259 |
| 712 | 3300037471 | Ga0395905_0005749 | Ga0395905_0005749_1665_2450 | 259 |
| 713 | 3300037471 | Ga0395905_0005835 | Ga0395905_0005835_4126_4911 | 259 |
| 714 | 3300037471 | Ga0395905_0008283 | Ga0395905_0008283_9059_9844 | 259 |
| 715 | 3300037471 | Ga0395905_0013279 | Ga0395905_0013279_4483_5268 | 259 |
| 716 | 3300037471 | Ga0395905_0015356 | Ga0395905_0015356_5334_6119 | 259 |
| 717 | 3300037471 | Ga0395905_0021076 | Ga0395905_0021076_3627_4412 | 259 |
| 718 | 3300037471 | Ga0395905_0046031 | Ga0395905_0046031_1212_1991 | 259 |
| 719 | 3300037471 | Ga0395905_0048606 | Ga0395905_0048606_2150_2935 | 259 |
| 720 | 3300037471 | Ga0395905_0048956 | Ga0395905_0048956_2679_3464 | 259 |
| 721 | 3300037471 | Ga0395905_0050664 | Ga0395905_0050664_1016_1801 | 259 |
| 722 | 3300037471 | Ga0395905_0053660 | Ga0395905_0053660_2801_3586 | 259 |
| 723 | 3300037471 | Ga0395905_0055189 | Ga0395905_0055189_1955_2740 | 259 |
| 724 | 3300037471 | Ga0395905_0055532 | Ga0395905_0055532_1112_1897 | 259 |
| 725 | 3300037471 | Ga0395905_0078477 | Ga0395905_0078477_63_845 | 259 |
| 726 | 3300037471 | Ga0395905_0093819 | Ga0395905_0093819_427_1212 | 259 |
| 727 | 3300037471 | Ga0395905_0188729 | Ga0395905_0188729_567_1349 | 259 |
| 728 | 3300037471 | Ga0395905_0200783 | Ga0395905_0200783_488_1294 | 259 |
| 729 | 3300037471 | Ga0395905_0201534 | Ga0395905_0201534_248_1033 | 259 |
| 730 | 3300037471 | Ga0395905_0203973 | Ga0395905_0203973_21_800 | 259 |
| 731 | 3300037471 | Ga0395905_0219816 | Ga0395905_0219816_587_1372 | 259 |
| 732 | 3300037471 | Ga0395905_0223035 | Ga0395905_0223035_145_930 | 259 |
| 733 | 3300037471 | Ga0395905_0231094 | Ga0395905_0231094_510_1289 | 259 |
| 734 | 3300037471 | Ga0395905_0271373 | Ga0395905_0271373_534_1316 | 259 |
| 735 | 3300037471 | Ga0395905_0337631 | Ga0395905_0337631_542_1327 | 259 |
| 736 | 3300037471 | Ga0395905_0386152 | Ga0395905_0386152_104_889 | 259 |
| 737 | 3300037471 | Ga0395905_0492578 | Ga0395905_0492578_297_1076 | 259 |
| 738 | 3300037471 | Ga0395905_0512240 | Ga0395905_0512240_173_958 | 259 |
| 739 | 3300038443 | Ga0395901_0000681 | Ga0395901_0000681_12755_13540 | 259 |
| 740 | 3300038443 | Ga0395901_0005736 | Ga0395901_0005736_3566_4351 | 259 |
| 741 | 3300038443 | Ga0395901_0008542 | Ga0395901_0008542_6280_7065 | 259 |
| 742 | 3300038443 | Ga0395901_0015982 | Ga0395901_0015982_4437_5222 | 259 |
| 743 | 3300038443 | Ga0395901_0028300 | Ga0395901_0028300_3970_4755 | 259 |
| 744 | 3300038443 | Ga0395901_0033758 | Ga0395901_0033758_197_982 | 259 |
| 745 | 3300038443 | Ga0395901_0042606 | Ga0395901_0042606_1859_2644 | 259 |
| 746 | 3300038443 | Ga0395901_0074461 | Ga0395901_0074461_1272_2057 | 259 |
| 747 | 3300038443 | Ga0395901_0080587 | Ga0395901_0080587_2145_2930 | 259 |
| 748 | 3300038443 | Ga0395901_0130958 | Ga0395901_0130958_1093_1878 | 259 |
| 749 | 3300038443 | Ga0395901_0137581 | Ga0395901_0137581_1672_2457 | 259 |
| 750 | 3300038443 | Ga0395901_0154848 | Ga0395901_0154848_1316_2101 | 259 |
| 751 | 3300038443 | Ga0395901_0174454 | Ga0395901_0174454_1203_1988 | 259 |
| 752 | 3300038443 | Ga0395901_0353907 | Ga0395901_0353907_357_1142 | 259 |
| 753 | 3300038443 | Ga0395901_0394821 | Ga0395901_0394821_349_1131 | 259 |
| 754 | 3300038443 | Ga0395901_0585738 | Ga0395901_0585738_131_937 | 259 |
| 755 | 3300039437 | Ga0436365_1429874 | Ga0436365_1429874_2892_3677 | 259 |
| 756 | 3300039450 | Ga0436363_0375547 | Ga0436363_0375547_136_921 | 259 |
| 757 | 3300041413 | Ga0439465_0040698 | Ga0439465_0040698_309_1097 | 259 |
| 758 | 3300042005 | Ga0439448_0024486 | Ga0439448_0024486_502_1287 | 259 |
| 759 | 3300042006 | Ga0439432_002187 | Ga0439432_002187_3492_4277 | 259 |
| 760 | 3300042006 | Ga0439432_087363 | Ga0439432_087363_132_911 | 259 |
| 761 | 3300042007 | Ga0439449_0009979 | Ga0439449_0009979_408_1193 | 259 |
| 762 | 3300042012 | Ga0439455_0022907 | Ga0439455_0022907_418_1203 | 259 |
| 763 | 3300042157 | Ga0439458_0000485 | Ga0439458_0000485_5127_5912 | 259 |
| 764 | 3300042157 | Ga0439458_0000555 | Ga0439458_0000555_4842_5627 | 259 |
| 765 | 3300044656 | Ga0466969_0010344 | Ga0466969_0010344_3200_3985 | 259 |
| 766 | 3300044683 | Ga0466965_0219959 | Ga0466965_0219959_59_844 | 259 |
| 767 | 3300044684 | Ga0466966_0020358 | Ga0466966_0020358_2254_3039 | 259 |
| 768 | 3300044684 | Ga0466966_0041616 | Ga0466966_0041616_1538_2323 | 259 |
| 769 | 3300044684 | Ga0466966_0134013 | Ga0466966_0134013_338_1144 | 259 |
| 770 | 3300044693 | Ga0466961_0041219 | Ga0466961_0041219_1134_1919 | 259 |
| 771 | 3300044693 | Ga0466961_0157766 | Ga0466961_0157766_558_1343 | 259 |
| 772 | 3300044693 | Ga0466961_0212996 | Ga0466961_0212996_103_888 | 259 |
| 773 | 3300044706 | Ga0466964_0026443 | Ga0466964_0026443_108_893 | 259 |
| 774 | 3300044719 | Ga0466971_0021142 | Ga0466971_0021142_1275_2060 | 259 |
| 775 | 3300044765 | Ga0466970_0073946 | Ga0466970_0073946_905_1690 | 259 |
| 776 | 3300044842 | Ga0466957_0152655 | Ga0466957_0152655_384_1169 | 259 |
| 777 | 3300044842 | Ga0466957_0234604 | Ga0466957_0234604_244_1029 | 259 |
| 778 | 3300044901 | Ga0466960_0036388 | Ga0466960_0036388_1133_1918 | 259 |
| 779 | 3300044901 | Ga0466960_0115483 | Ga0466960_0115483_297_1079 | 259 |
| 780 | 3300045049 | Ga0466959_0033313 | Ga0466959_0033313_354_1139 | 259 |
| 781 | 3300045049 | Ga0466959_0052324 | Ga0466959_0052324_1280_2086 | 259 |
| 782 | 3300045049 | Ga0466959_0115492 | Ga0466959_0115492_543_1328 | 259 |
| 783 | 3300045049 | Ga0466959_0145087 | Ga0466959_0145087_635_1420 | 259 |
| 784 | 3300045049 | Ga0466959_0200741 | Ga0466959_0200741_444_1229 | 259 |
| 785 | 3300045049 | Ga0466959_0206900 | Ga0466959_0206900_184_966 | 259 |
| 786 | 3300045836 | Ga0466958_0108300 | Ga0466958_0108300_121_906 | 259 |
| 787 | 3300045836 | Ga0466958_0141047 | Ga0466958_0141047_654_1439 | 259 |
| 788 | 3300045836 | Ga0466958_0152369 | Ga0466958_0152369_567_1352 | 259 |
| 789 | 3300045836 | Ga0466958_0221850 | Ga0466958_0221850_241_1047 | 259 |
| 790 | 3300045836 | Ga0466958_0301766 | Ga0466958_0301766_109_894 | 259 |
| 791 | 3300045976 | Ga0466967_0132961 | Ga0466967_0132961_120_905 | 259 |
| 792 | 3300046453 | Ga0495627_000617 | Ga0495627_000617_6981_7760 | 259 |
| 793 | 3300046459 | Ga0495629_0131801 | Ga0495629_0131801_77_862 | 259 |
| 794 | 3300046524 | Ga0495648_0005005 | Ga0495648_0005005_9761_10540 | 259 |
| 795 | 3300046539 | Ga0495621_0007156 | Ga0495621_0007156_987_1772 | 259 |
| 796 | 3300046558 | Ga0495633_0099960 | Ga0495633_0099960_525_1310 | 259 |
| 797 | 3300046684 | Ga0495669_0006980 | Ga0495669_0006980_2257_3036 | 259 |
| 798 | 3300046684 | Ga0495669_0091413 | Ga0495669_0091413_37_822 | 259 |
| 799 | 3300046692 | Ga0495671_0043469 | Ga0495671_0043469_1352_2134 | 259 |
| 800 | 3300048903 | Ga0496100_0116257 | Ga0496100_0116257_842_1627 | 259 |
| 801 | 3300048903 | Ga0496100_0273315 | Ga0496100_0273315_173_958 | 259 |
| 802 | 3300048904 | Ga0496101_0001762 | Ga0496101_0001762_4513_5298 | 259 |
| 803 | 3300048905 | Ga0496102_0057117 | Ga0496102_0057117_2366_3151 | 259 |
| 804 | 3300048905 | Ga0496102_0310938 | Ga0496102_0310938_480_1262 | 259 |
| 805 | 3300048905 | Ga0496102_0457590 | Ga0496102_0457590_42_827 | 259 |
| 806 | 3300048906 | Ga0496103_0072289 | Ga0496103_0072289_254_1039 | 259 |
| 807 | 3300048906 | Ga0496103_0455452 | Ga0496103_0455452_17_802 | 259 |
| 808 | 3300048907 | Ga0496104_0603531 | Ga0496104_0603531_111_896 | 259 |
| 809 | 3300048908 | Ga0496105_0024862 | Ga0496105_0024862_123_908 | 259 |
| 810 | 3300048909 | Ga0496106_0019188 | Ga0496106_0019188_234_1019 | 259 |
| 811 | 3300048909 | Ga0496106_0087328 | Ga0496106_0087328_606_1391 | 259 |
| 812 | 3300048910 | Ga0496107_0014597 | Ga0496107_0014597_1405_2190 | 259 |
| 813 | 3300048910 | Ga0496107_0071018 | Ga0496107_0071018_942_1727 | 259 |
| 814 | 3300048910 | Ga0496107_0215234 | Ga0496107_0215234_492_1277 | 259 |
| 815 | 3300048910 | Ga0496107_0566249 | Ga0496107_0566249_39_824 | 259 |
| 816 | 3300048911 | Ga0496108_0003987 | Ga0496108_0003987_289_1074 | 259 |
| 817 | 3300048911 | Ga0496108_0007034 | Ga0496108_0007034_7655_8440 | 259 |
| 818 | 3300048911 | Ga0496108_0031482 | Ga0496108_0031482_3178_3960 | 259 |
| 819 | 3300048911 | Ga0496108_0067422 | Ga0496108_0067422_2080_2865 | 259 |
| 820 | 3300048911 | Ga0496108_0127890 | Ga0496108_0127890_758_1543 | 259 |
| 821 | 3300048912 | Ga0496109_0005615 | Ga0496109_0005615_1137_1922 | 259 |
| 822 | 3300048912 | Ga0496109_0007592 | Ga0496109_0007592_4654_5439 | 259 |
| 823 | 3300048912 | Ga0496109_0044858 | Ga0496109_0044858_1192_1977 | 259 |
| 824 | 3300048913 | Ga0496110_0016179 | Ga0496110_0016179_2188_2967 | 259 |
| 825 | 3300048913 | Ga0496110_0023577 | Ga0496110_0023577_3677_4462 | 259 |
| 826 | 3300048914 | Ga0496111_0027369 | Ga0496111_0027369_2674_3459 | 259 |
| 827 | 3300048914 | Ga0496111_0036464 | Ga0496111_0036464_370_1149 | 259 |
| 828 | 3300048914 | Ga0496111_0037180 | Ga0496111_0037180_2466_3251 | 259 |
| 829 | 3300048914 | Ga0496111_0052175 | Ga0496111_0052175_2046_2831 | 259 |
| 830 | 3300048915 | Ga0496112_0019765 | Ga0496112_0019765_5378_6163 | 259 |
| 831 | 3300048915 | Ga0496112_0020281 | Ga0496112_0020281_640_1425 | 259 |
| 832 | 3300048915 | Ga0496112_0040436 | Ga0496112_0040436_613_1398 | 259 |
| 833 | 3300048915 | Ga0496112_0074840 | Ga0496112_0074840_783_1568 | 259 |
| 834 | 3300048916 | Ga0496113_0006306 | Ga0496113_0006306_1515_2300 | 259 |
| 835 | 3300048916 | Ga0496113_0013166 | Ga0496113_0013166_2801_3586 | 259 |
| 836 | 3300048916 | Ga0496113_0177204 | Ga0496113_0177204_240_1025 | 259 |
| 837 | 3300048917 | Ga0496114_0000130 | Ga0496114_0000130_21246_22031 | 259 |
| 838 | 3300048917 | Ga0496114_0466878 | Ga0496114_0466878_309_1094 | 259 |
| 839 | 3300048919 | Ga0496116_0044039 | Ga0496116_0044039_1306_2088 | 259 |
| 840 | 3300048924 | Ga0496121_0006069 | Ga0496121_0006069_3092_3874 | 259 |
| 841 | 3300048925 | Ga0496122_0006730 | Ga0496122_0006730_10067_10846 | 259 |
| 842 | 3300048926 | Ga0496123_0005339 | Ga0496123_0005339_2606_3385 | 259 |
| 843 | 3300048927 | Ga0496124_0007058 | Ga0496124_0007058_9557_10336 | 259 |
| 844 | 3300048927 | Ga0496124_0042588 | Ga0496124_0042588_1204_1986 | 259 |
| 845 | 3300048928 | Ga0496125_0002768 | Ga0496125_0002768_11359_12138 | 259 |
| 846 | 3300048928 | Ga0496125_0010066 | Ga0496125_0010066_6067_6849 | 259 |
| 847 | 3300048929 | Ga0496126_0015740 | Ga0496126_0015740_1904_2686 | 259 |
| 848 | 3300049521 | Ga0501298_022284 | Ga0501298_022284_380_1165 | 259 |
| 849 | 3300049660 | Ga0501216_004767 | Ga0501216_004767_1131_1916 | 259 |
| 850 | 3300049663 | Ga0501223_000066 | Ga0501223_000066_27954_28733 | 259 |
| 851 | 3300049663 | Ga0501223_013803 | Ga0501223_013803_475_1260 | 259 |
| 852 | 3300049668 | Ga0501233_023952 | Ga0501233_023952_24_809 | 259 |
| 853 | 3300049669 | Ga0501235_007871 | Ga0501235_007871_449_1234 | 259 |
| 854 | 3300049669 | Ga0501235_023392 | Ga0501235_023392_244_1023 | 259 |
| 855 | 3300049686 | Ga0501257_054131 | Ga0501257_054131_192_977 | 259 |
| 856 | 3300049687 | Ga0501258_005296 | Ga0501258_005296_429_1214 | 259 |
| 857 | 3300049704 | Ga0501221_014696 | Ga0501221_014696_650_1435 | 259 |
| 858 | 3300049705 | Ga0501225_0000137 | Ga0501225_0000137_3940_4719 | 259 |
| 859 | 3300049705 | Ga0501225_0001770 | Ga0501225_0001770_3059_3838 | 259 |
| 860 | 3300049705 | Ga0501225_0030860 | Ga0501225_0030860_623_1402 | 259 |
| 861 | 3300049705 | Ga0501225_0044171 | Ga0501225_0044171_128_913 | 259 |
| 862 | 3300049706 | Ga0501229_003871 | Ga0501229_003871_701_1486 | 259 |
| 863 | 3300049759 | Ga0501262_005207 | Ga0501262_005207_34_819 | 259 |
| 864 | 3300049760 | Ga0501263_002869 | Ga0501263_002869_162_947 | 259 |
| 865 | 3300049765 | Ga0501268_001988 | Ga0501268_001988_1514_2299 | 259 |
| 866 | 3300049769 | Ga0501272_003433 | Ga0501272_003433_786_1571 | 259 |
| 867 | 3300049770 | Ga0501273_001227 | Ga0501273_001227_1005_1790 | 259 |
| 868 | 3300053083 | Ga0495655_0005326 | Ga0495655_0005326_433_1215 | 259 |
| 869 | 3300053118 | Ga0500594_0001515 | Ga0500594_0001515_1404_2186 | 259 |
| 870 | 3300053136 | Ga0500559_0013126 | Ga0500559_0013126_2084_2863 | 259 |
| 871 | 3300061719 | Ga0466962_0108377 | Ga0466962_0108377_297_1082 | 259 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xb3-assembly2.cif.gz_D | structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] | 0.9661 | 3 | 29 |
| 3djc-assembly1.cif.gz_L | crystal structure of pantothenate kinase from legionella pneumophila | 0.9329 | 1 | 259 |
| 2h3g-assembly1.cif.gz_X-2 | structure of the type iii pantothenate kinase (coax) from bacillus anthracis | 0.9327 | 1 | 255 |
| 7wn7-assembly1.cif.gz_A | crystal structure of hearnpv p26 | 0.932 | 3 | 29 |
| 3djc-assembly1.cif.gz_L | crystal structure of pantothenate kinase from legionella pneumophila | 0.9293 | 1 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2h3gX02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9472 | 90 | 255 | 3.30.420.40 |
| 2h3gX01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9454 | 1 | 88 | 3.30.420.40 |
| 2h3gX01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9353 | 1 | 88 | 3.30.420.40 |
| 3djcB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9303 | 2 | 88 | 3.30.420.40 |
| 2h3gX02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9301 | 90 | 255 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A846M789-F1-model_v4 | Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) | 0.9833 | 1 | 259 |
GO:0004594
GO:0005524 GO:0005737 GO:0015937 GO:0046872 |
| AF-A0A2E8LTB3-F1-model_v4 | deleted | 0.9812 | 1 | 256 |
|
| AF-A0A520I6S4-F1-model_v4 | Type III pantothenate kinase (EC 2.7.1.33) | 0.9778 | 146 | 256 |
GO:0004594
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A520I383-F1-model_v4 | Type III pantothenate kinase (EC 2.7.1.33) | 0.9771 | 60 | 259 |
GO:0004594
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A2E8LTB3-F1-model_v4 | deleted | 0.9737 | 1 | 256 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar