F484187

General Info

Members Datasets Scaffolds Average Seq Length
871 244 871 261

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10107453|Ga0207706_101074531
Length 274
Sequence MILAIDAGNTNLVFALVDKGEIKARWRIATDPRRTADQYSVWLHQLLELEGFSRDQIDGVIIGTVVPRALHNLEVLSEKYFRKTPVIAGQGAAEWPLQLDVDEPHNVGADRALNAIAAHAKYPGDLLIIDFGTATTFDVVSASGAYTGGIIAPGINLSLDALVNAAAKLPRIAIETPATNSVIGRTTASQMIIGIYWGYVAMLEGLTERIKSEVGRPVTVVATGLGHGDDVTRICVEHTDPAKHESSVIDCKTARVVKKLLRSPDAHDSGVNTT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
81 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
228 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
229 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
230 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
231 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
232 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
233 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
234 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
235 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
236 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
237 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
238 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
239 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
240 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
241 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
242 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
243 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 4.59
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3748052 2162886007 Bacteria 1346
2 JGI24741J21665_1000692 3300001915 Bacteria 10187
3 JGI24740J21852_10002149 3300001979 Bacteria 9011
4 JGI24740J21852_10003759 3300001979 Bacteria 6608
5 JGI24740J21852_10021057 3300001979 Bacteria 2265
6 JGI24739J22299_10000252 3300001989 Bacteria 18058
7 JGI24739J22299_10001180 3300001989 Bacteria 9776
8 JGI24737J22298_10002295 3300001990 Bacteria 6798
9 JGI24737J22298_10005205 3300001990 Bacteria 4500
10 JGI24737J22298_10006259 3300001990 Bacteria 4074
11 JGI24737J22298_10022606 3300001990 Bacteria 1999
12 JGI24735J21928_10001159 3300002067 Bacteria 9419
13 JGI24735J21928_10012860 3300002067 Bacteria 2642
14 JGI24738J21930_10000674 3300002075 Bacteria 9899
15 JGI24738J21930_10001019 3300002075 Bacteria 8002
16 JGI24744J21845_10001866 3300002077 Bacteria 4234
17 Ga0065704_10073918 3300005289 Bacteria 6672
18 Ga0065707_10010189 3300005295 Bacteria 2281
19 Ga0070658_10069755 3300005327 Bacteria 2876
20 Ga0070658_10079929 3300005327 Bacteria 2685
21 Ga0070658_10133947 3300005327 Bacteria 2066
22 Ga0070658_10146879 3300005327 Bacteria 1972
23 Ga0070658_10159219 3300005327 Bacteria 1894
24 Ga0070658_10206277 3300005327 Bacteria 1660
25 Ga0070658_10240928 3300005327 Bacteria 1533
26 Ga0070658_10344516 3300005327 Bacteria 1275
27 Ga0070658_10377692 3300005327 Bacteria 1215
28 Ga0070676_10003269 3300005328 Bacteria 8417
29 Ga0070676_10196259 3300005328 Bacteria 1321
30 Ga0070676_10240914 3300005328 Bacteria 1203
31 Ga0070676_10245316 3300005328 Bacteria 1193
32 Ga0070676_10405803 3300005328 Bacteria 949
33 Ga0070676_10442032 3300005328 Bacteria 913
34 Ga0070683_100019454 3300005329 Bacteria 6031
35 Ga0070683_100024802 3300005329 Bacteria 5377
36 Ga0070683_100141403 3300005329 Bacteria 2280
37 Ga0070683_100255802 3300005329 Bacteria 1666
38 Ga0070690_100015646 3300005330 Bacteria 4531
39 Ga0070690_100025806 3300005330 Bacteria 3620
40 Ga0070690_100096383 3300005330 Bacteria 1955
41 Ga0070670_100000807 3300005331 Bacteria 24382
42 Ga0070670_100008121 3300005331 Bacteria 8932
43 Ga0070670_100014557 3300005331 Bacteria 6754
44 Ga0070670_100031408 3300005331 Bacteria 4573
45 Ga0070670_100031539 3300005331 Bacteria 4565
46 Ga0070677_10023752 3300005333 Bacteria 2273
47 Ga0070677_10088434 3300005333 Bacteria 1342
48 Ga0068869_100024538 3300005334 Bacteria 4176
49 Ga0070666_10002658 3300005335 Bacteria 10780
50 Ga0070666_10003092 3300005335 Bacteria 10102
51 Ga0070666_10013352 3300005335 Bacteria 5208
52 Ga0070666_10032530 3300005335 Bacteria 3445
53 Ga0070666_10246778 3300005335 Bacteria 1263
54 Ga0070680_100003695 3300005336 Bacteria 11429
55 Ga0070680_100012588 3300005336 Bacteria 6577
56 Ga0070682_100013647 3300005337 Bacteria 4680
57 Ga0070682_100145211 3300005337 Bacteria 1622
58 Ga0068868_100001893 3300005338 Bacteria 14366
59 Ga0068868_100009974 3300005338 Bacteria 6861
60 Ga0068868_100013938 3300005338 Bacteria 5913
61 Ga0068868_100169491 3300005338 Bacteria 1807
62 Ga0068868_100560811 3300005338 Bacteria 1008
63 Ga0070660_100006064 3300005339 Bacteria 8358
64 Ga0070660_100014880 3300005339 Bacteria 5615
65 Ga0070660_100021606 3300005339 Bacteria 4749
66 Ga0070660_100029285 3300005339 Bacteria 4125
67 Ga0070660_100035865 3300005339 Bacteria 3754
68 Ga0070660_100038635 3300005339 Bacteria 3624
69 Ga0070660_100042108 3300005339 Bacteria 3484
70 Ga0070660_100093260 3300005339 Bacteria 2377
71 Ga0070660_100134033 3300005339 Bacteria 1984
72 Ga0070660_100393123 3300005339 Bacteria 1146
73 Ga0070689_100006805 3300005340 Bacteria 7951
74 Ga0070689_100247015 3300005340 Bacteria 1471
75 Ga0070691_10098103 3300005341 Bacteria 1452
76 Ga0070661_100009704 3300005344 Bacteria 6676
77 Ga0070661_100014744 3300005344 Bacteria 5512
78 Ga0070661_100037391 3300005344 Bacteria 3531
79 Ga0070661_100094213 3300005344 Bacteria 2219
80 Ga0070661_100105175 3300005344 Bacteria 2103
81 Ga0070661_100120518 3300005344 Bacteria 1964
82 Ga0070661_100122744 3300005344 Bacteria 1946
83 Ga0070661_100182420 3300005344 Bacteria 1597
84 Ga0070661_100361200 3300005344 Bacteria 1141
85 Ga0070668_100124876 3300005347 Bacteria 2061
86 Ga0070668_100148459 3300005347 Bacteria 1894
87 Ga0070669_100001260 3300005353 Bacteria 18380
88 Ga0070675_100104855 3300005354 Bacteria 2385
89 Ga0070675_100163269 3300005354 Bacteria 1917
90 Ga0070671_100000927 3300005355 Bacteria 21442
91 Ga0070671_100002825 3300005355 Bacteria 13490
92 Ga0070671_100011596 3300005355 Bacteria 7092
93 Ga0070671_100012260 3300005355 Bacteria 6897
94 Ga0070671_100028280 3300005355 Bacteria 4616
95 Ga0070671_100089917 3300005355 Bacteria 2570
96 Ga0070671_100273666 3300005355 Bacteria 1435
97 Ga0070671_100328366 3300005355 Bacteria 1304
98 Ga0070674_100023242 3300005356 Bacteria 4010
99 Ga0070674_100041914 3300005356 Bacteria 3106
100 Ga0070674_100179089 3300005356 Bacteria 1622
101 Ga0070673_100001674 3300005364 Bacteria 13140
102 Ga0070673_100002345 3300005364 Bacteria 11503
103 Ga0070673_100020014 3300005364 Bacteria 4819
104 Ga0070673_100049184 3300005364 Bacteria 3291
105 Ga0070673_100054226 3300005364 Bacteria 3153
106 Ga0070673_100076667 3300005364 Bacteria 2700
107 Ga0070673_100455939 3300005364 Bacteria 1151
108 Ga0070659_100001267 3300005366 Bacteria 18320
109 Ga0070659_100018346 3300005366 Bacteria 5281
110 Ga0070659_100039254 3300005366 Bacteria 3695
111 Ga0070659_100044004 3300005366 Bacteria 3494
112 Ga0070659_100045903 3300005366 Bacteria 3424
113 Ga0070659_100250544 3300005366 Bacteria 1468
114 Ga0070659_100268103 3300005366 Bacteria 1418
115 Ga0070667_100004545 3300005367 Bacteria 11676
116 Ga0070667_100005246 3300005367 Bacteria 10834
117 Ga0070667_100021218 3300005367 Bacteria 5397
118 Ga0070667_100192796 3300005367 Bacteria 1806
119 Ga0070667_100233717 3300005367 Bacteria 1640
120 Ga0070667_100401331 3300005367 Bacteria 1248
121 Ga0070667_100411854 3300005367 Bacteria 1231
122 Ga0070714_100020265 3300005435 Bacteria 5428
123 Ga0070714_100098350 3300005435 Bacteria 2574
124 Ga0070714_100374956 3300005435 Bacteria 1340
125 Ga0070714_100401194 3300005435 Bacteria 1296
126 Ga0070714_100857313 3300005435 Bacteria 881
127 Ga0070663_100014152 3300005455 Bacteria 5113
128 Ga0070663_100029638 3300005455 Bacteria 3742
129 Ga0070663_100089109 3300005455 Bacteria 2282
130 Ga0070663_100153030 3300005455 Bacteria 1770
131 Ga0070678_100009697 3300005456 Bacteria 5851
132 Ga0070678_100053016 3300005456 Bacteria 2948
133 Ga0070678_100098312 3300005456 Bacteria 2263
134 Ga0070678_100202114 3300005456 Bacteria 1641
135 Ga0070678_100554340 3300005456 Bacteria 1021
136 Ga0070662_100001203 3300005457 Bacteria 15912
137 Ga0070662_100034885 3300005457 Bacteria 3549
138 Ga0070662_100078224 3300005457 Bacteria 2456
139 Ga0070662_100135123 3300005457 Bacteria 1906
140 Ga0070662_100140977 3300005457 Bacteria 1868
141 Ga0070662_100165462 3300005457 Bacteria 1733
142 Ga0070662_100336784 3300005457 Bacteria 1233
143 Ga0070681_10044346 3300005458 Bacteria 4451
144 Ga0070681_10303661 3300005458 Bacteria 1505
145 Ga0068867_100005599 3300005459 Bacteria 8900
146 Ga0068867_100018721 3300005459 Bacteria 4924
147 Ga0068867_100052268 3300005459 Bacteria 3015
148 Ga0070685_10461159 3300005466 Bacteria 892
149 Ga0070679_100022016 3300005530 Bacteria 6226
150 Ga0070679_100071652 3300005530 Bacteria 3456
151 Ga0070684_100002726 3300005535 Bacteria 13054
152 Ga0070684_100011882 3300005535 Bacteria 6952
153 Ga0070684_100225611 3300005535 Bacteria 1710
154 Ga0068853_100002144 3300005539 Bacteria 14696
155 Ga0068853_100119051 3300005539 Bacteria 2353
156 Ga0068853_100137438 3300005539 Bacteria 2191
157 Ga0068853_100217507 3300005539 Bacteria 1743
158 Ga0068853_100251837 3300005539 Bacteria 1621
159 Ga0070672_100015078 3300005543 Bacteria 5493
160 Ga0070672_100015719 3300005543 Bacteria 5404
161 Ga0070672_100096027 3300005543 Bacteria 2397
162 Ga0070672_100350488 3300005543 Bacteria 1258
163 Ga0070696_100007378 3300005546 Bacteria 7345
164 Ga0070665_100001208 3300005548 Bacteria 31486
165 Ga0070665_100004742 3300005548 Bacteria 14155
166 Ga0070665_100012842 3300005548 Bacteria 8431
167 Ga0070665_100034005 3300005548 Bacteria 5126
168 Ga0068855_100002638 3300005563 Bacteria 22114
169 Ga0068855_100113573 3300005563 Bacteria 3107
170 Ga0068855_100193123 3300005563 Bacteria 2295
171 Ga0068855_100199919 3300005563 Bacteria 2250
172 Ga0068855_100353041 3300005563 Bacteria 1619
173 Ga0070664_100000446 3300005564 Bacteria 31189
174 Ga0070664_100003398 3300005564 Bacteria 12850
175 Ga0070664_100012233 3300005564 Bacteria 6974
176 Ga0070664_100048375 3300005564 Bacteria 3594
177 Ga0070664_100074362 3300005564 Bacteria 2916
178 Ga0070664_100076084 3300005564 Bacteria 2883
179 Ga0070664_100097431 3300005564 Bacteria 2553
180 Ga0070664_100146716 3300005564 Bacteria 2081
181 Ga0070664_100573006 3300005564 Bacteria 1045
182 Ga0068857_100001517 3300005577 Bacteria 18537
183 Ga0068857_100003065 3300005577 Bacteria 13816
184 Ga0068857_100004069 3300005577 Bacteria 12310
185 Ga0068857_100304739 3300005577 Bacteria 1469
186 Ga0068854_100003147 3300005578 Bacteria 10280
187 Ga0068854_100008221 3300005578 Bacteria 6697
188 Ga0068854_100023884 3300005578 Bacteria 4179
189 Ga0068854_100080461 3300005578 Bacteria 2404
190 Ga0068854_100106470 3300005578 Bacteria 2110
191 Ga0068854_100144622 3300005578 Bacteria 1828
192 Ga0068854_100343546 3300005578 Bacteria 1219
193 Ga0068854_100520284 3300005578 Bacteria 1005
194 Ga0068854_100674101 3300005578 Bacteria 890
195 Ga0068856_100015113 3300005614 Bacteria 7458
196 Ga0068856_100040080 3300005614 Bacteria 4599
197 Ga0068856_100050336 3300005614 Bacteria 4107
198 Ga0068856_100078153 3300005614 Bacteria 3280
199 Ga0070702_100269258 3300005615 Bacteria 1164
200 Ga0068852_100000461 3300005616 Bacteria 26890
201 Ga0068852_100019867 3300005616 Bacteria 5329
202 Ga0068852_100029627 3300005616 Bacteria 4499
203 Ga0068852_100116814 3300005616 Bacteria 2435
204 Ga0068852_100126481 3300005616 Bacteria 2348
205 Ga0068852_100494035 3300005616 Bacteria 1218
206 Ga0068852_101081768 3300005616 Bacteria 822
207 Ga0068859_100008534 3300005617 Bacteria 10365
208 Ga0068859_100009839 3300005617 Bacteria 9652
209 Ga0068859_100050360 3300005617 Bacteria 4184
210 Ga0068859_100243805 3300005617 Bacteria 1887
211 Ga0068864_100003315 3300005618 Bacteria 13307
212 Ga0068864_100020883 3300005618 Bacteria 5481
213 Ga0068864_100064482 3300005618 Bacteria 3177
214 Ga0068864_100118776 3300005618 Bacteria 2361
215 Ga0068864_100254766 3300005618 Bacteria 1631
216 Ga0068866_10056715 3300005718 Bacteria 2015
217 Ga0068861_100000052 3300005719 Bacteria 54577
218 Ga0068861_100216662 3300005719 Bacteria 1616
219 Ga0068851_10006913 3300005834 Bacteria 5202
220 Ga0068851_10018291 3300005834 Bacteria 3375
221 Ga0068851_10215039 3300005834 Bacteria 1078
222 Ga0068851_10230068 3300005834 Bacteria 1045
223 Ga0068870_10136484 3300005840 Bacteria 1431
224 Ga0068863_100003487 3300005841 Bacteria 15520
225 Ga0068863_100008185 3300005841 Bacteria 10213
226 Ga0068863_100009190 3300005841 Bacteria 9642
227 Ga0068863_100012720 3300005841 Bacteria 8116
228 Ga0068863_100036906 3300005841 Bacteria 4653
229 Ga0068863_100057339 3300005841 Bacteria 3686
230 Ga0068858_100008071 3300005842 Bacteria 10138
231 Ga0068858_100017583 3300005842 Bacteria 6704
232 Ga0068858_100136500 3300005842 Bacteria 2301
233 Ga0068858_100157035 3300005842 Bacteria 2140
234 Ga0068860_100003073 3300005843 Bacteria 17251
235 Ga0068860_100036352 3300005843 Bacteria 4720
236 Ga0068860_100064032 3300005843 Bacteria 3492
237 Ga0068862_100018707 3300005844 Bacteria 5770
238 Ga0068862_100492483 3300005844 Bacteria 1162
239 Ga0081539_10188094 3300005985 Bacteria 963
240 Ga0070716_100084000 3300006173 Bacteria 1908
241 Ga0097621_100003754 3300006237 Bacteria 10526
242 Ga0097621_100080112 3300006237 Bacteria 2716
243 Ga0097621_100558030 3300006237 Bacteria 1043
244 Ga0068871_100019567 3300006358 Bacteria 5171
245 Ga0068871_100373963 3300006358 Bacteria 1264
246 Ga0068865_100005997 3300006881 Bacteria 7401
247 Ga0068865_100025297 3300006881 Bacteria 3903
248 Ga0068865_100078208 3300006881 Bacteria 2366
249 Ga0097620_100008534 3300006931 Bacteria 10365
250 Ga0097620_100009839 3300006931 Bacteria 9652
251 Ga0097620_100050361 3300006931 Bacteria 4184
252 Ga0097620_100243789 3300006931 Bacteria 1887
253 Ga0105251_10026917 3300009011 Bacteria 2922
254 Ga0105251_10104757 3300009011 Bacteria 1291
255 Ga0105240_10044466 3300009093 Bacteria 5643
256 Ga0105240_10460880 3300009093 Bacteria 1420
257 Ga0105240_10584971 3300009093 Bacteria 1231
258 Ga0105240_10867517 3300009093 Bacteria 973
259 Ga0105245_10001667 3300009098 Bacteria 20219
260 Ga0105247_10450826 3300009101 Bacteria 927
261 Ga0105241_10007878 3300009174 Bacteria 7831
262 Ga0105241_10041880 3300009174 Bacteria 3462
263 Ga0105242_10012800 3300009176 Bacteria 6463
264 Ga0105248_10000096 3300009177 Bacteria 97519
265 Ga0105248_10001577 3300009177 Bacteria 25361
266 Ga0105248_10006141 3300009177 Bacteria 13173
267 Ga0105248_10006863 3300009177 Bacteria 12484
268 Ga0105248_10006890 3300009177 Bacteria 12456
269 Ga0105248_10332047 3300009177 Bacteria 1712
270 Ga0105248_10681055 3300009177 Bacteria 1160
271 Ga0105237_10015281 3300009545 Bacteria 7996
272 Ga0105237_10079942 3300009545 Bacteria 3259
273 Ga0105237_10149808 3300009545 Bacteria 2329
274 Ga0105237_10151641 3300009545 Bacteria 2314
275 Ga0105238_10039716 3300009551 Bacteria 4772
276 Ga0105238_10191208 3300009551 Bacteria 2023
277 Ga0105238_10226369 3300009551 Bacteria 1847
278 Ga0105249_10198579 3300009553 Bacteria 1962
279 Ga0105148_100202 3300009978 Bacteria 8692
280 Ga0105147_105299 3300009982 Bacteria 1083
281 Ga0105239_10117373 3300010375 Bacteria 2953
282 Ga0105246_10022077 3300011119 Bacteria 4104
283 Ga0105246_10040645 3300011119 Bacteria 3140
284 Ga0105246_10275590 3300011119 Bacteria 1347
285 Ga0157373_10007215 3300013100 Bacteria 8288
286 Ga0157373_10017921 3300013100 Bacteria 5156
287 Ga0157373_10039257 3300013100 Bacteria 3390
288 Ga0157373_10081485 3300013100 Bacteria 2281
289 Ga0157373_10122166 3300013100 Bacteria 1830
290 Ga0157373_10129123 3300013100 Bacteria 1777
291 Ga0157373_10155107 3300013100 Bacteria 1611
292 Ga0157371_10003770 3300013102 Bacteria 13565
293 Ga0157371_10022992 3300013102 Bacteria 4558
294 Ga0157371_10040657 3300013102 Bacteria 3320
295 Ga0157371_10076634 3300013102 Bacteria 2368
296 Ga0157371_10114766 3300013102 Bacteria 1913
297 Ga0157371_10132648 3300013102 Bacteria 1773
298 Ga0157371_10135588 3300013102 Bacteria 1753
299 Ga0157371_10197728 3300013102 Bacteria 1441
300 Ga0157370_10102505 3300013104 Bacteria 2680
301 Ga0157370_10382552 3300013104 Bacteria 1296
302 Ga0157370_10532422 3300013104 Bacteria 1078
303 Ga0157369_10122804 3300013105 Bacteria 2755
304 Ga0157369_10139262 3300013105 Bacteria 2568
305 Ga0157369_10193603 3300013105 Bacteria 2136
306 Ga0157369_10214579 3300013105 Bacteria 2016
307 Ga0157369_10980573 3300013105 Bacteria 865
308 Ga0157374_10009229 3300013296 Bacteria 8456
309 Ga0157374_10117607 3300013296 Bacteria 2562
310 Ga0157378_10001776 3300013297 Bacteria 19365
311 Ga0157378_10142034 3300013297 Bacteria 2230
312 Ga0163162_10048501 3300013306 Bacteria 4255
313 Ga0163162_10158044 3300013306 Bacteria 2388
314 Ga0157372_10068574 3300013307 Bacteria 3988
315 Ga0157372_10103884 3300013307 Bacteria 3247
316 Ga0157372_10230095 3300013307 Bacteria 2149
317 Ga0157372_10269475 3300013307 Bacteria 1978
318 Ga0157372_10302866 3300013307 Bacteria 1859
319 Ga0157372_10795999 3300013307 Bacteria 1098
320 Ga0157372_10853167 3300013307 Bacteria 1057
321 Ga0157375_10003831 3300013308 Bacteria 13044
322 Ga0157375_10026239 3300013308 Bacteria 5426
323 Ga0163163_10019009 3300014325 Bacteria 6446
324 Ga0163163_10034122 3300014325 Bacteria 4926
325 Ga0163163_10120482 3300014325 Bacteria 2658
326 Ga0163163_10721089 3300014325 Bacteria 1061
327 Ga0157379_10006317 3300014968 Bacteria 10205
328 Ga0157379_10368662 3300014968 Bacteria 1317
329 Ga0163161_10013697 3300017792 Bacteria 5647
330 Ga0207673_1019010 3300025290 Bacteria 922
331 Ga0207697_10001060 3300025315 Bacteria 15193
332 Ga0207697_10003608 3300025315 Bacteria 7588
333 Ga0207697_10013963 3300025315 Bacteria 3343
334 Ga0207697_10015837 3300025315 Bacteria 3110
335 Ga0207656_10011903 3300025321 Bacteria 3296
336 Ga0207656_10028906 3300025321 Bacteria 2279
337 Ga0207656_10086913 3300025321 Bacteria 1414
338 Ga0207656_10151540 3300025321 Bacteria 1098
339 Ga0207682_10028455 3300025893 Bacteria 2230
340 Ga0207642_10253517 3300025899 Bacteria 1000
341 Ga0207688_10002178 3300025901 Bacteria 10550
342 Ga0207688_10005414 3300025901 Bacteria 6938
343 Ga0207680_10007785 3300025903 Bacteria 5236
344 Ga0207680_10008339 3300025903 Bacteria 5080
345 Ga0207680_10028080 3300025903 Bacteria 3143
346 Ga0207680_10101677 3300025903 Bacteria 1848
347 Ga0207680_10165735 3300025903 Bacteria 1485
348 Ga0207647_10000153 3300025904 Bacteria 54496
349 Ga0207647_10001078 3300025904 Bacteria 21029
350 Ga0207647_10005438 3300025904 Bacteria 9335
351 Ga0207647_10007591 3300025904 Bacteria 7815
352 Ga0207647_10009600 3300025904 Bacteria 6869
353 Ga0207647_10020279 3300025904 Bacteria 4459
354 Ga0207647_10237091 3300025904 Bacteria 1048
355 Ga0207645_10003786 3300025907 Bacteria 11356
356 Ga0207645_10019133 3300025907 Bacteria 4496
357 Ga0207645_10066206 3300025907 Bacteria 2309
358 Ga0207645_10192331 3300025907 Bacteria 1341
359 Ga0207645_10252235 3300025907 Bacteria 1167
360 Ga0207645_10395103 3300025907 Bacteria 929
361 Ga0207643_10016175 3300025908 Bacteria 4067
362 Ga0207705_10007304 3300025909 Bacteria 8125
363 Ga0207705_10009311 3300025909 Bacteria 7143
364 Ga0207705_10041020 3300025909 Bacteria 3320
365 Ga0207705_10071335 3300025909 Bacteria 2518
366 Ga0207705_10073108 3300025909 Bacteria 2487
367 Ga0207705_10105175 3300025909 Bacteria 2080
368 Ga0207705_10299638 3300025909 Bacteria 1233
369 Ga0207705_10382995 3300025909 Bacteria 1086
370 Ga0207654_10021779 3300025911 Bacteria 3412
371 Ga0207654_10084466 3300025911 Bacteria 1919
372 Ga0207654_10132718 3300025911 Bacteria 1578
373 Ga0207654_10147794 3300025911 Bacteria 1505
374 Ga0207707_10130129 3300025912 Bacteria 2201
375 Ga0207707_10413934 3300025912 Bacteria 1156
376 Ga0207695_10014240 3300025913 Bacteria 9433
377 Ga0207695_10089367 3300025913 Bacteria 3098
378 Ga0207695_10489827 3300025913 Bacteria 1112
379 Ga0207695_10581297 3300025913 Bacteria 1001
380 Ga0207695_10604420 3300025913 Bacteria 978
381 Ga0207671_10016290 3300025914 Bacteria 5782
382 Ga0207671_10430501 3300025914 Bacteria 1050
383 Ga0207693_10043480 3300025915 Bacteria 3534
384 Ga0207660_10040596 3300025917 Bacteria 3258
385 Ga0207660_10153568 3300025917 Bacteria 1771
386 Ga0207660_10164361 3300025917 Bacteria 1715
387 Ga0207657_10000924 3300025919 Bacteria 31097
388 Ga0207657_10002827 3300025919 Bacteria 18655
389 Ga0207657_10005125 3300025919 Bacteria 13731
390 Ga0207657_10005183 3300025919 Bacteria 13672
391 Ga0207657_10008828 3300025919 Bacteria 10195
392 Ga0207657_10010444 3300025919 Bacteria 9266
393 Ga0207657_10025691 3300025919 Bacteria 5425
394 Ga0207657_10027595 3300025919 Bacteria 5198
395 Ga0207657_10042191 3300025919 Bacteria 4027
396 Ga0207657_10047659 3300025919 Bacteria 3745
397 Ga0207657_10048576 3300025919 Bacteria 3704
398 Ga0207657_10064335 3300025919 Bacteria 3131
399 Ga0207657_10082175 3300025919 Bacteria 2705
400 Ga0207657_10157225 3300025919 Bacteria 1848
401 Ga0207657_10190417 3300025919 Bacteria 1655
402 Ga0207657_10377541 3300025919 Bacteria 1116
403 Ga0207649_10008713 3300025920 Bacteria 5538
404 Ga0207649_10032395 3300025920 Bacteria 3116
405 Ga0207649_10068043 3300025920 Bacteria 2263
406 Ga0207649_10077508 3300025920 Bacteria 2142
407 Ga0207649_10107548 3300025920 Bacteria 1857
408 Ga0207649_10249720 3300025920 Bacteria 1277
409 Ga0207649_10398560 3300025920 Bacteria 1029
410 Ga0207652_10028892 3300025921 Bacteria 4629
411 Ga0207681_10009549 3300025923 Bacteria 5927
412 Ga0207681_10030101 3300025923 Bacteria 3536
413 Ga0207681_10538046 3300025923 Bacteria 960
414 Ga0207694_10063156 3300025924 Bacteria 2885
415 Ga0207694_10146573 3300025924 Bacteria 1900
416 Ga0207694_10170950 3300025924 Bacteria 1759
417 Ga0207650_10017927 3300025925 Bacteria 4961
418 Ga0207650_10020206 3300025925 Bacteria 4694
419 Ga0207659_10014238 3300025926 Bacteria 5120
420 Ga0207659_10016588 3300025926 Bacteria 4796
421 Ga0207659_10115517 3300025926 Bacteria 2047
422 Ga0207659_10243662 3300025926 Bacteria 1456
423 Ga0207687_10009029 3300025927 Bacteria 6515
424 Ga0207700_10033241 3300025928 Bacteria 3689
425 Ga0207664_10082708 3300025929 Bacteria 2616
426 Ga0207664_10109568 3300025929 Bacteria 2294
427 Ga0207644_10000235 3300025931 Bacteria 38139
428 Ga0207644_10002554 3300025931 Bacteria 11714
429 Ga0207644_10002568 3300025931 Bacteria 11682
430 Ga0207644_10005217 3300025931 Bacteria 8482
431 Ga0207644_10005419 3300025931 Bacteria 8320
432 Ga0207644_10005961 3300025931 Bacteria 7946
433 Ga0207644_10283154 3300025931 Bacteria 1331
434 Ga0207644_10485879 3300025931 Bacteria 1017
435 Ga0207690_10003079 3300025932 Bacteria 10047
436 Ga0207690_10008443 3300025932 Bacteria 6115
437 Ga0207690_10084295 3300025932 Bacteria 2227
438 Ga0207690_10087872 3300025932 Bacteria 2188
439 Ga0207690_10145420 3300025932 Bacteria 1752
440 Ga0207690_10349098 3300025932 Bacteria 1169
441 Ga0207706_10000194 3300025933 Bacteria 67452
442 Ga0207706_10001656 3300025933 Bacteria 22037
443 Ga0207706_10002630 3300025933 Bacteria 17485
444 Ga0207706_10004866 3300025933 Bacteria 12574
445 Ga0207706_10039419 3300025933 Bacteria 4188
446 Ga0207706_10040372 3300025933 Bacteria 4136
447 Ga0207706_10073264 3300025933 Bacteria 3012
448 Ga0207706_10107453 3300025933 Bacteria 2456
449 Ga0207706_10109764 3300025933 Bacteria 2428
450 Ga0207706_10166146 3300025933 Bacteria 1939
451 Ga0207706_10178117 3300025933 Bacteria 1867
452 Ga0207706_10191207 3300025933 Bacteria 1797
453 Ga0207706_10440076 3300025933 Bacteria 1128
454 Ga0207686_10094562 3300025934 Bacteria 1981
455 Ga0207709_10040229 3300025935 Bacteria 2798
456 Ga0207670_10025140 3300025936 Bacteria 3734
457 Ga0207669_10018762 3300025937 Bacteria 3585
458 Ga0207669_10063789 3300025937 Bacteria 2276
459 Ga0207669_10161006 3300025937 Bacteria 1585
460 Ga0207669_10241389 3300025937 Bacteria 1339
461 Ga0207704_10007493 3300025938 Bacteria 5160
462 Ga0207704_10039589 3300025938 Bacteria 2747
463 Ga0207704_10052721 3300025938 Bacteria 2467
464 Ga0207665_10007628 3300025939 Bacteria 7145
465 Ga0207665_10082057 3300025939 Bacteria 2221
466 Ga0207691_10002330 3300025940 Bacteria 18590
467 Ga0207691_10003389 3300025940 Bacteria 15500
468 Ga0207691_10003584 3300025940 Bacteria 15103
469 Ga0207691_10009649 3300025940 Bacteria 9260
470 Ga0207691_10015795 3300025940 Bacteria 7175
471 Ga0207691_10114565 3300025940 Bacteria 2395
472 Ga0207711_10001137 3300025941 Bacteria 25387
473 Ga0207711_10002848 3300025941 Bacteria 15174
474 Ga0207711_10006288 3300025941 Bacteria 10020
475 Ga0207711_10038127 3300025941 Bacteria 4086
476 Ga0207711_10052245 3300025941 Bacteria 3502
477 Ga0207711_10054929 3300025941 Bacteria 3418
478 Ga0207711_10069349 3300025941 Bacteria 3056
479 Ga0207711_10333410 3300025941 Bacteria 1403
480 Ga0207689_10000094 3300025942 Bacteria 71733
481 Ga0207689_10033567 3300025942 Bacteria 4264
482 Ga0207689_10046212 3300025942 Bacteria 3599
483 Ga0207661_10009081 3300025944 Bacteria 7123
484 Ga0207661_10043473 3300025944 Bacteria 3545
485 Ga0207661_10296046 3300025944 Bacteria 1449
486 Ga0207679_10003846 3300025945 Bacteria 9310
487 Ga0207679_10021663 3300025945 Bacteria 4362
488 Ga0207679_10021775 3300025945 Bacteria 4353
489 Ga0207679_10030202 3300025945 Bacteria 3782
490 Ga0207679_10042727 3300025945 Bacteria 3259
491 Ga0207679_10043122 3300025945 Bacteria 3246
492 Ga0207679_10092676 3300025945 Bacteria 2341
493 Ga0207679_10100608 3300025945 Bacteria 2259
494 Ga0207679_10375934 3300025945 Bacteria 1244
495 Ga0207679_10410373 3300025945 Bacteria 1193
496 Ga0207667_10008988 3300025949 Bacteria 11821
497 Ga0207667_10077422 3300025949 Bacteria 3449
498 Ga0207667_10089753 3300025949 Bacteria 3176
499 Ga0207667_10092395 3300025949 Bacteria 3125
500 Ga0207667_10111308 3300025949 Bacteria 2824
501 Ga0207667_10128792 3300025949 Bacteria 2607
502 Ga0207667_10361204 3300025949 Bacteria 1481
503 Ga0207651_10002269 3300025960 Bacteria 9129
504 Ga0207651_10003286 3300025960 Bacteria 7914
505 Ga0207651_10008767 3300025960 Bacteria 5487
506 Ga0207651_10304423 3300025960 Bacteria 1327
507 Ga0207668_10134838 3300025972 Bacteria 1890
508 Ga0207668_10544855 3300025972 Bacteria 1004
509 Ga0207640_10095937 3300025981 Bacteria 2066
510 Ga0207640_10128274 3300025981 Bacteria 1829
511 Ga0207640_10237090 3300025981 Bacteria 1407
512 Ga0207640_10443266 3300025981 Bacteria 1068
513 Ga0207640_10468516 3300025981 Bacteria 1042
514 Ga0207640_10595373 3300025981 Bacteria 935
515 Ga0207658_10006765 3300025986 Bacteria 7807
516 Ga0207658_10020303 3300025986 Bacteria 4600
517 Ga0207658_10257990 3300025986 Bacteria 1484
518 Ga0207658_10353296 3300025986 Bacteria 1280
519 Ga0207658_10384618 3300025986 Bacteria 1230
520 Ga0207658_10548157 3300025986 Bacteria 1034
521 Ga0207677_10004013 3300026023 Bacteria 7853
522 Ga0207677_10004145 3300026023 Bacteria 7757
523 Ga0207677_10006879 3300026023 Bacteria 6251
524 Ga0207677_10036404 3300026023 Bacteria 3207
525 Ga0207677_10119855 3300026023 Bacteria 1977
526 Ga0207677_10141931 3300026023 Bacteria 1840
527 Ga0207677_10431258 3300026023 Bacteria 1125
528 Ga0207703_10003160 3300026035 Bacteria 13896
529 Ga0207703_10023759 3300026035 Bacteria 4821
530 Ga0207703_10032326 3300026035 Bacteria 4141
531 Ga0207703_10101622 3300026035 Bacteria 2438
532 Ga0207703_10356362 3300026035 Bacteria 1348
533 Ga0207639_10001213 3300026041 Bacteria 17498
534 Ga0207639_10007329 3300026041 Bacteria 7515
535 Ga0207639_10097249 3300026041 Bacteria 2370
536 Ga0207639_10227943 3300026041 Bacteria 1613
537 Ga0207639_10254757 3300026041 Bacteria 1532
538 Ga0207639_10278082 3300026041 Bacteria 1471
539 Ga0207639_10483742 3300026041 Bacteria 1129
540 Ga0207678_10000716 3300026067 Bacteria 30304
541 Ga0207678_10007209 3300026067 Bacteria 9857
542 Ga0207678_10019180 3300026067 Bacteria 6004
543 Ga0207678_10020789 3300026067 Bacteria 5753
544 Ga0207678_10034705 3300026067 Bacteria 4393
545 Ga0207678_10051209 3300026067 Bacteria 3565
546 Ga0207678_10177581 3300026067 Bacteria 1818
547 Ga0207678_10338726 3300026067 Bacteria 1296
548 Ga0207678_10382268 3300026067 Bacteria 1217
549 Ga0207678_10395635 3300026067 Bacteria 1196
550 Ga0207678_10579443 3300026067 Bacteria 983
551 Ga0207702_10015322 3300026078 Bacteria 6355
552 Ga0207702_10016918 3300026078 Bacteria 6035
553 Ga0207702_10130877 3300026078 Bacteria 2258
554 Ga0207702_10819984 3300026078 Bacteria 920
555 Ga0207641_10012223 3300026088 Bacteria 7045
556 Ga0207641_10042134 3300026088 Bacteria 3828
557 Ga0207641_10043133 3300026088 Bacteria 3786
558 Ga0207641_10165150 3300026088 Bacteria 2015
559 Ga0207641_10279949 3300026088 Bacteria 1568
560 Ga0207648_10000104 3300026089 Bacteria 81717
561 Ga0207648_10003117 3300026089 Bacteria 17506
562 Ga0207648_10013745 3300026089 Bacteria 7514
563 Ga0207648_10058958 3300026089 Bacteria 3348
564 Ga0207648_10264045 3300026089 Bacteria 1537
565 Ga0207676_10004148 3300026095 Bacteria 10231
566 Ga0207676_10010419 3300026095 Bacteria 6617
567 Ga0207676_10026266 3300026095 Bacteria 4330
568 Ga0207676_10033212 3300026095 Bacteria 3897
569 Ga0207676_10035753 3300026095 Bacteria 3773
570 Ga0207676_10319868 3300026095 Bacteria 1424
571 Ga0207674_10000345 3300026116 Bacteria 59803
572 Ga0207674_10001057 3300026116 Bacteria 35856
573 Ga0207674_10001571 3300026116 Bacteria 29407
574 Ga0207674_10003098 3300026116 Bacteria 20546
575 Ga0207674_10003125 3300026116 Bacteria 20421
576 Ga0207674_10016803 3300026116 Bacteria 7998
577 Ga0207674_10049649 3300026116 Bacteria 4290
578 Ga0207675_100000035 3300026118 Bacteria 95190
579 Ga0207675_100346828 3300026118 Bacteria 1454
580 Ga0207683_10001980 3300026121 Bacteria 18118
581 Ga0207683_10004221 3300026121 Bacteria 12412
582 Ga0207683_10011385 3300026121 Bacteria 7591
583 Ga0207683_10086278 3300026121 Bacteria 2790
584 Ga0207698_10003964 3300026142 Bacteria 8973
585 Ga0207698_10005650 3300026142 Bacteria 7743
586 Ga0207698_10010338 3300026142 Bacteria 5987
587 Ga0207698_10014787 3300026142 Bacteria 5201
588 Ga0207698_10035580 3300026142 Bacteria 3645
589 Ga0207698_10066036 3300026142 Bacteria 2846
590 Ga0207698_10073695 3300026142 Bacteria 2720
591 Ga0207698_10086869 3300026142 Bacteria 2545
592 Ga0207698_10184453 3300026142 Bacteria 1852
593 Ga0207698_10615438 3300026142 Bacteria 1072
594 Ga0209970_1013361 3300027614 Bacteria 1361
595 Ga0209974_10000337 3300027876 Bacteria 15344
596 Ga0268266_10000133 3300028379 Bacteria 143210
597 Ga0268266_10004030 3300028379 Bacteria 14202
598 Ga0268266_10162059 3300028379 Bacteria 2024
599 Ga0268266_10805455 3300028379 Bacteria 907
600 Ga0268265_10107245 3300028380 Bacteria 2271
601 Ga0268265_10179747 3300028380 Bacteria 1816
602 Ga0268264_10072608 3300028381 Bacteria 2918
603 Ga0268264_10224758 3300028381 Bacteria 1730
604 Ga0268264_10353904 3300028381 Bacteria 1399
605 Ga0307408_100090974 3300031548 Bacteria 2303
606 Ga0307408_100265206 3300031548 Bacteria 1423
607 Ga0307408_100360594 3300031548 Bacteria 1236
608 Ga0307408_100620507 3300031548 Bacteria 963
609 Ga0307405_10044659 3300031731 Bacteria 2711
610 Ga0307405_10160507 3300031731 Bacteria 1591
611 Ga0307405_10183488 3300031731 Bacteria 1504
612 Ga0307405_10189402 3300031731 Bacteria 1484
613 Ga0307405_10405255 3300031731 Bacteria 1069
614 Ga0307413_10077439 3300031824 Bacteria 2117
615 Ga0307413_10102054 3300031824 Bacteria 1898
616 Ga0307413_10296963 3300031824 Bacteria 1223
617 Ga0307410_10004817 3300031852 Bacteria 7047
618 Ga0307410_10012174 3300031852 Bacteria 4959
619 Ga0307410_10012813 3300031852 Bacteria 4866
620 Ga0307410_10048944 3300031852 Bacteria 2835
621 Ga0307410_10057491 3300031852 Bacteria 2649
622 Ga0307410_10255265 3300031852 Bacteria 1365
623 Ga0307410_10359737 3300031852 Bacteria 1165
624 Ga0307406_10012522 3300031901 Bacteria 4835
625 Ga0307406_10151833 3300031901 Bacteria 1653
626 Ga0307406_10180289 3300031901 Bacteria 1537
627 Ga0307406_10246744 3300031901 Bacteria 1342
628 Ga0307407_10008669 3300031903 Bacteria 4682
629 Ga0307407_10037907 3300031903 Bacteria 2667
630 Ga0307407_10052099 3300031903 Bacteria 2349
631 Ga0307407_10140408 3300031903 Bacteria 1558
632 Ga0307407_10151008 3300031903 Bacteria 1509
633 Ga0307412_10001044 3300031911 Bacteria 15823
634 Ga0307412_10043424 3300031911 Bacteria 2927
635 Ga0307412_10245438 3300031911 Bacteria 1387
636 Ga0307412_10265673 3300031911 Bacteria 1340
637 Ga0307409_100016559 3300031995 Bacteria 4881
638 Ga0307409_100102146 3300031995 Bacteria 2381
639 Ga0307409_100133004 3300031995 Bacteria 2129
640 Ga0307409_100162156 3300031995 Bacteria 1957
641 Ga0307409_100196810 3300031995 Bacteria 1799
642 Ga0307409_100275523 3300031995 Bacteria 1552
643 Ga0307416_100001404 3300032002 Bacteria 13051
644 Ga0307416_100047175 3300032002 Bacteria 3407
645 Ga0307416_100108083 3300032002 Bacteria 2443
646 Ga0307416_100113208 3300032002 Bacteria 2397
647 Ga0307416_100121541 3300032002 Bacteria 2329
648 Ga0307414_10000144 3300032004 Bacteria 48442
649 Ga0307414_10045909 3300032004 Bacteria 2994
650 Ga0307414_10046156 3300032004 Bacteria 2988
651 Ga0307414_10050673 3300032004 Bacteria 2877
652 Ga0307414_10061562 3300032004 Bacteria 2659
653 Ga0307411_10013445 3300032005 Bacteria 4517
654 Ga0307411_10031954 3300032005 Bacteria 3246
655 Ga0307411_10077934 3300032005 Bacteria 2270
656 Ga0307411_10399639 3300032005 Bacteria 1135
657 Ga0307411_10558978 3300032005 Bacteria 977
658 Ga0307415_100008803 3300032126 Bacteria 5618
659 Ga0307415_100207401 3300032126 Bacteria 1560
660 Ga0307415_100402528 3300032126 Bacteria 1169
661 Ga0373943_0029968 3300035170 Bacteria 2573
662 Ga0395899_0000225 3300037312 Bacteria 76673
663 Ga0395899_0000804 3300037312 Bacteria 30745
664 Ga0395899_0000911 3300037312 Bacteria 27806
665 Ga0395899_0001269 3300037312 Bacteria 21956
666 Ga0395899_0002669 3300037312 Bacteria 14380
667 Ga0395899_0012431 3300037312 Bacteria 6522
668 Ga0395899_0029775 3300037312 Bacteria 4106
669 Ga0395899_0059726 3300037312 Bacteria 2811
670 Ga0395899_0064303 3300037312 Bacteria 2697
671 Ga0395899_0109598 3300037312 Bacteria 1986
672 Ga0395899_0189680 3300037312 Bacteria 1439
673 Ga0395899_0204422 3300037312 Bacteria 1375
674 Ga0395899_0223569 3300037312 Bacteria 1303
675 Ga0395899_0233151 3300037312 Bacteria 1270
676 Ga0395899_0245653 3300037312 Bacteria 1230
677 Ga0395899_0308089 3300037312 Bacteria 1070
678 Ga0395900_0000911 3300037418 Bacteria 38912
679 Ga0395900_0001255 3300037418 Bacteria 31098
680 Ga0395900_0002300 3300037418 Bacteria 21222
681 Ga0395900_0002356 3300037418 Bacteria 20915
682 Ga0395900_0009730 3300037418 Bacteria 9846
683 Ga0395900_0012076 3300037418 Bacteria 8825
684 Ga0395900_0013567 3300037418 Bacteria 8324
685 Ga0395900_0048295 3300037418 Bacteria 4384
686 Ga0395900_0056921 3300037418 Bacteria 4025
687 Ga0395900_0066499 3300037418 Bacteria 3703
688 Ga0395900_0098392 3300037418 Bacteria 3006
689 Ga0395900_0118616 3300037418 Bacteria 2715
690 Ga0395900_0147207 3300037418 Bacteria 2408
691 Ga0395900_0150794 3300037418 Bacteria 2375
692 Ga0395900_0165283 3300037418 Bacteria 2255
693 Ga0395900_0424005 3300037418 Bacteria 1291
694 Ga0395900_0489819 3300037418 Bacteria 1181
695 Ga0395900_0544508 3300037418 Bacteria 1106
696 Ga0395898_0000021 3300037466 Bacteria 393971
697 Ga0395898_0001464 3300037466 Bacteria 33283
698 Ga0395898_0001496 3300037466 Bacteria 32433
699 Ga0395898_0007069 3300037466 Bacteria 11922
700 Ga0395898_0027288 3300037466 Bacteria 5734
701 Ga0395898_0036361 3300037466 Bacteria 4889
702 Ga0395898_0111649 3300037466 Bacteria 2620
703 Ga0395898_0342748 3300037466 Bacteria 1425
704 Ga0395898_0782832 3300037466 Bacteria 894
705 Ga0395905_0000006 3300037471 Bacteria 549428
706 Ga0395905_0000193 3300037471 Bacteria 96667
707 Ga0395905_0000546 3300037471 Bacteria 51378
708 Ga0395905_0001063 3300037471 Bacteria 34650
709 Ga0395905_0001765 3300037471 Bacteria 25140
710 Ga0395905_0003104 3300037471 Bacteria 17940
711 Ga0395905_0005749 3300037471 Bacteria 12610
712 Ga0395905_0005835 3300037471 Bacteria 12513
713 Ga0395905_0008283 3300037471 Bacteria 10263
714 Ga0395905_0013279 3300037471 Bacteria 7901
715 Ga0395905_0015356 3300037471 Bacteria 7278
716 Ga0395905_0021076 3300037471 Bacteria 6171
717 Ga0395905_0046031 3300037471 Bacteria 4091
718 Ga0395905_0048606 3300037471 Bacteria 3975
719 Ga0395905_0048956 3300037471 Bacteria 3960
720 Ga0395905_0050664 3300037471 Bacteria 3889
721 Ga0395905_0053660 3300037471 Bacteria 3772
722 Ga0395905_0055189 3300037471 Bacteria 3718
723 Ga0395905_0055532 3300037471 Bacteria 3706
724 Ga0395905_0078477 3300037471 Bacteria 3094
725 Ga0395905_0093819 3300037471 Bacteria 2815
726 Ga0395905_0188729 3300037471 Bacteria 1934
727 Ga0395905_0200783 3300037471 Bacteria 1869
728 Ga0395905_0201534 3300037471 Bacteria 1866
729 Ga0395905_0203973 3300037471 Bacteria 1853
730 Ga0395905_0219816 3300037471 Bacteria 1778
731 Ga0395905_0223035 3300037471 Bacteria 1764
732 Ga0395905_0231094 3300037471 Bacteria 1729
733 Ga0395905_0271373 3300037471 Bacteria 1582
734 Ga0395905_0337631 3300037471 Bacteria 1397
735 Ga0395905_0386152 3300037471 Bacteria 1294
736 Ga0395905_0492578 3300037471 Bacteria 1125
737 Ga0395905_0512240 3300037471 Bacteria 1100
738 Ga0395901_0000681 3300038443 Bacteria 39074
739 Ga0395901_0005736 3300038443 Bacteria 12573
740 Ga0395901_0008542 3300038443 Bacteria 10349
741 Ga0395901_0015982 3300038443 Bacteria 7647
742 Ga0395901_0028300 3300038443 Bacteria 5764
743 Ga0395901_0033758 3300038443 Bacteria 5283
744 Ga0395901_0042606 3300038443 Bacteria 4707
745 Ga0395901_0074461 3300038443 Bacteria 3542
746 Ga0395901_0080587 3300038443 Bacteria 3399
747 Ga0395901_0130958 3300038443 Bacteria 2636
748 Ga0395901_0137581 3300038443 Bacteria 2567
749 Ga0395901_0154848 3300038443 Bacteria 2407
750 Ga0395901_0174454 3300038443 Bacteria 2255
751 Ga0395901_0353907 3300038443 Bacteria 1515
752 Ga0395901_0394821 3300038443 Bacteria 1422
753 Ga0395901_0585738 3300038443 Bacteria 1126
754 Ga0436365_1429874 3300039437 Bacteria 7327
755 Ga0436363_0375547 3300039450 Bacteria 1144
756 Ga0439465_0040698 3300041413 Bacteria 1503
757 Ga0439448_0024486 3300042005 Bacteria 1888
758 Ga0439432_002187 3300042006 Bacteria 7386
759 Ga0439432_087363 3300042006 Bacteria 940
760 Ga0439449_0009979 3300042007 Bacteria 3593
761 Ga0439455_0022907 3300042012 Bacteria 1501
762 Ga0439458_0000485 3300042157 Bacteria 10187
763 Ga0439458_0000555 3300042157 Bacteria 9619
764 Ga0466969_0010344 3300044656 Bacteria 4947
765 Ga0466965_0219959 3300044683 Bacteria 1012
766 Ga0466966_0020358 3300044684 Bacteria 4364
767 Ga0466966_0041616 3300044684 Bacteria 2952
768 Ga0466966_0134013 3300044684 Bacteria 1515
769 Ga0466961_0041219 3300044693 Bacteria 2960
770 Ga0466961_0157766 3300044693 Bacteria 1415
771 Ga0466961_0212996 3300044693 Bacteria 1192
772 Ga0466964_0026443 3300044706 Bacteria 2271
773 Ga0466971_0021142 3300044719 Bacteria 2895
774 Ga0466970_0073946 3300044765 Bacteria 1834
775 Ga0466957_0152655 3300044842 Bacteria 1495
776 Ga0466957_0234604 3300044842 Bacteria 1216
777 Ga0466960_0036388 3300044901 Bacteria 2305
778 Ga0466960_0115483 3300044901 Bacteria 1400
779 Ga0466959_0033313 3300045049 Bacteria 3810
780 Ga0466959_0052324 3300045049 Bacteria 2991
781 Ga0466959_0115492 3300045049 Bacteria 1912
782 Ga0466959_0145087 3300045049 Bacteria 1675
783 Ga0466959_0200741 3300045049 Bacteria 1388
784 Ga0466959_0206900 3300045049 Bacteria 1365
785 Ga0466958_0108300 3300045836 Bacteria 1733
786 Ga0466958_0141047 3300045836 Bacteria 1517
787 Ga0466958_0152369 3300045836 Bacteria 1458
788 Ga0466958_0221850 3300045836 Bacteria 1206
789 Ga0466958_0301766 3300045836 Bacteria 1028
790 Ga0466967_0132961 3300045976 Bacteria 2311
791 Ga0495627_000617 3300046453 Bacteria 28261
792 Ga0495629_0131801 3300046459 Bacteria 1741
793 Ga0495648_0005005 3300046524 Bacteria 11134
794 Ga0495621_0007156 3300046539 Bacteria 3292
795 Ga0495633_0099960 3300046558 Bacteria 1346
796 Ga0495669_0006980 3300046684 Bacteria 4730
797 Ga0495669_0091413 3300046684 Bacteria 1405
798 Ga0495671_0043469 3300046692 Bacteria 2255
799 Ga0496100_0116257 3300048903 Bacteria 1866
800 Ga0496100_0273315 3300048903 Bacteria 1257
801 Ga0496101_0001762 3300048904 Bacteria 12986
802 Ga0496102_0057117 3300048905 Bacteria 3562
803 Ga0496102_0310938 3300048905 Bacteria 1485
804 Ga0496102_0457590 3300048905 Bacteria 1197
805 Ga0496103_0072289 3300048906 Bacteria 2160
806 Ga0496103_0455452 3300048906 Unclassified 820
807 Ga0496104_0603531 3300048907 Bacteria 1008
808 Ga0496105_0024862 3300048908 Bacteria 4868
809 Ga0496106_0019188 3300048909 Bacteria 5070
810 Ga0496106_0087328 3300048909 Bacteria 2403
811 Ga0496107_0014597 3300048910 Bacteria 5498
812 Ga0496107_0071018 3300048910 Bacteria 2529
813 Ga0496107_0215234 3300048910 Bacteria 1429
814 Ga0496107_0566249 3300048910 Bacteria 841
815 Ga0496108_0003987 3300048911 Bacteria 11847
816 Ga0496108_0007034 3300048911 Bacteria 9111
817 Ga0496108_0031482 3300048911 Bacteria 4402
818 Ga0496108_0067422 3300048911 Bacteria 3018
819 Ga0496108_0127890 3300048911 Bacteria 2182
820 Ga0496109_0005615 3300048912 Bacteria 10497
821 Ga0496109_0007592 3300048912 Bacteria 9193
822 Ga0496109_0044858 3300048912 Bacteria 4011
823 Ga0496109_0117395 3300048912 Bacteria 2477
824 Ga0496110_0016179 3300048913 Bacteria 6221
825 Ga0496110_0023577 3300048913 Bacteria 5236
826 Ga0496111_0027369 3300048914 Bacteria 4033
827 Ga0496111_0036464 3300048914 Bacteria 3516
828 Ga0496111_0037180 3300048914 Bacteria 3484
829 Ga0496111_0052175 3300048914 Bacteria 2952
830 Ga0496112_0019765 3300048915 Bacteria 6367
831 Ga0496112_0020281 3300048915 Bacteria 6297
832 Ga0496112_0040436 3300048915 Bacteria 4558
833 Ga0496112_0074840 3300048915 Bacteria 3349
834 Ga0496113_0006306 3300048916 Bacteria 7502
835 Ga0496113_0013166 3300048916 Bacteria 5590
836 Ga0496113_0177204 3300048916 Bacteria 1689
837 Ga0496114_0000130 3300048917 Bacteria 54437
838 Ga0496114_0466878 3300048917 Bacteria 1117
839 Ga0496116_0044039 3300048919 Bacteria 3035
840 Ga0496121_0006069 3300048924 Bacteria 15210
841 Ga0496122_0006730 3300048925 Bacteria 13083
842 Ga0496123_0005339 3300048926 Bacteria 12988
843 Ga0496124_0007058 3300048927 Bacteria 12033
844 Ga0496124_0042588 3300048927 Bacteria 3908
845 Ga0496125_0002768 3300048928 Bacteria 22192
846 Ga0496125_0010066 3300048928 Bacteria 9595
847 Ga0496126_0015740 3300048929 Bacteria 7600
848 Ga0501298_022284 3300049521 Bacteria 1193
849 Ga0501216_004767 3300049660 Bacteria 2023
850 Ga0501223_000066 3300049663 Bacteria 33567
851 Ga0501223_013803 3300049663 Bacteria 1606
852 Ga0501233_023952 3300049668 Bacteria 1331
853 Ga0501235_007871 3300049669 Bacteria 2323
854 Ga0501235_023392 3300049669 Bacteria 1377
855 Ga0501257_054131 3300049686 Bacteria 1005
856 Ga0501258_005296 3300049687 Bacteria 1247
857 Ga0501221_014696 3300049704 Bacteria 1459
858 Ga0501225_0000137 3300049705 Bacteria 22173
859 Ga0501225_0001770 3300049705 Bacteria 6756
860 Ga0501225_0030860 3300049705 Bacteria 1475
861 Ga0501225_0044171 3300049705 Bacteria 1232
862 Ga0501229_003871 3300049706 Bacteria 1809
863 Ga0501262_005207 3300049759 Bacteria 1531
864 Ga0501263_002869 3300049760 Bacteria 1799
865 Ga0501268_001988 3300049765 Bacteria 2629
866 Ga0501272_003433 3300049769 Bacteria 1611
867 Ga0501273_001227 3300049770 Bacteria 2386
868 Ga0495655_0005326 3300053083 Bacteria 2267
869 Ga0500594_0001515 3300053118 Bacteria 5051
870 Ga0500559_0013126 3300053136 Bacteria 3512
871 Ga0466962_0108377 3300061719 Bacteria 1336

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10019180 Ga0207678_100191806 211
2 3300005339 Ga0070660_100021606 Ga0070660_1000216064 239
3 3300025919 Ga0207657_10027595 Ga0207657_100275953 239
4 3300025933 Ga0207706_10107453 Ga0207706_101074531 251
5 3300025909 Ga0207705_10299638 Ga0207705_102996382 256
6 3300005340 Ga0070689_100247015 Ga0070689_1002470151 258
7 3300025911 Ga0207654_10132718 Ga0207654_101327183 258
8 3300031548 Ga0307408_100620507 Ga0307408_1006205071 258
9 3300031824 Ga0307413_10296963 Ga0307413_102969632 258
10 3300032002 Ga0307416_100108083 Ga0307416_1001080831 258
11 3300032002 Ga0307416_100121541 Ga0307416_1001215413 258
12 3300032126 Ga0307415_100402528 Ga0307415_1004025281 258
13 3300048912 Ga0496109_0117395 Ga0496109_0117395_131_907 258
14 2162886007 SwRhRL2b_contig_3748052 SwRhRL2b_0784.00004870 259
15 3300001915 JGI24741J21665_1000692 JGI24741J21665_10006924 259
16 3300001979 JGI24740J21852_10002149 JGI24740J21852_100021495 259
17 3300001979 JGI24740J21852_10003759 JGI24740J21852_100037593 259
18 3300001979 JGI24740J21852_10021057 JGI24740J21852_100210572 259
19 3300001989 JGI24739J22299_10000252 JGI24739J22299_100002527 259
20 3300001989 JGI24739J22299_10001180 JGI24739J22299_100011805 259
21 3300001990 JGI24737J22298_10002295 JGI24737J22298_100022955 259
22 3300001990 JGI24737J22298_10005205 JGI24737J22298_100052054 259
23 3300001990 JGI24737J22298_10006259 JGI24737J22298_100062591 259
24 3300001990 JGI24737J22298_10022606 JGI24737J22298_100226063 259
25 3300002067 JGI24735J21928_10001159 JGI24735J21928_100011595 259
26 3300002067 JGI24735J21928_10012860 JGI24735J21928_100128602 259
27 3300002075 JGI24738J21930_10000674 JGI24738J21930_100006749 259
28 3300002075 JGI24738J21930_10001019 JGI24738J21930_100010194 259
29 3300002077 JGI24744J21845_10001866 JGI24744J21845_100018662 259
30 3300005289 Ga0065704_10073918 Ga0065704_100739184 259
31 3300005295 Ga0065707_10010189 Ga0065707_100101892 259
32 3300005327 Ga0070658_10069755 Ga0070658_100697554 259
33 3300005327 Ga0070658_10079929 Ga0070658_100799292 259
34 3300005327 Ga0070658_10133947 Ga0070658_101339472 259
35 3300005327 Ga0070658_10146879 Ga0070658_101468792 259
36 3300005327 Ga0070658_10159219 Ga0070658_101592192 259
37 3300005327 Ga0070658_10206277 Ga0070658_102062772 259
38 3300005327 Ga0070658_10240928 Ga0070658_102409282 259
39 3300005327 Ga0070658_10344516 Ga0070658_103445161 259
40 3300005327 Ga0070658_10377692 Ga0070658_103776922 259
41 3300005328 Ga0070676_10003269 Ga0070676_100032693 259
42 3300005328 Ga0070676_10196259 Ga0070676_101962591 259
43 3300005328 Ga0070676_10240914 Ga0070676_102409142 259
44 3300005328 Ga0070676_10245316 Ga0070676_102453162 259
45 3300005328 Ga0070676_10405803 Ga0070676_104058031 259
46 3300005328 Ga0070676_10442032 Ga0070676_104420321 259
47 3300005329 Ga0070683_100019454 Ga0070683_1000194542 259
48 3300005329 Ga0070683_100024802 Ga0070683_1000248022 259
49 3300005329 Ga0070683_100141403 Ga0070683_1001414032 259
50 3300005329 Ga0070683_100255802 Ga0070683_1002558022 259
51 3300005330 Ga0070690_100015646 Ga0070690_1000156464 259
52 3300005330 Ga0070690_100025806 Ga0070690_1000258063 259
53 3300005330 Ga0070690_100096383 Ga0070690_1000963832 259
54 3300005331 Ga0070670_100000807 Ga0070670_10000080713 259
55 3300005331 Ga0070670_100008121 Ga0070670_1000081212 259
56 3300005331 Ga0070670_100014557 Ga0070670_1000145575 259
57 3300005331 Ga0070670_100031408 Ga0070670_1000314082 259
58 3300005331 Ga0070670_100031539 Ga0070670_1000315394 259
59 3300005333 Ga0070677_10023752 Ga0070677_100237522 259
60 3300005333 Ga0070677_10088434 Ga0070677_100884342 259
61 3300005334 Ga0068869_100024538 Ga0068869_1000245382 259
62 3300005335 Ga0070666_10002658 Ga0070666_100026585 259
63 3300005335 Ga0070666_10003092 Ga0070666_100030923 259
64 3300005335 Ga0070666_10013352 Ga0070666_100133521 259
65 3300005335 Ga0070666_10032530 Ga0070666_100325304 259
66 3300005335 Ga0070666_10246778 Ga0070666_102467782 259
67 3300005336 Ga0070680_100003695 Ga0070680_1000036958 259
68 3300005336 Ga0070680_100012588 Ga0070680_1000125885 259
69 3300005337 Ga0070682_100013647 Ga0070682_1000136472 259
70 3300005337 Ga0070682_100145211 Ga0070682_1001452112 259
71 3300005338 Ga0068868_100001893 Ga0068868_1000018937 259
72 3300005338 Ga0068868_100009974 Ga0068868_1000099744 259
73 3300005338 Ga0068868_100013938 Ga0068868_1000139385 259
74 3300005338 Ga0068868_100169491 Ga0068868_1001694912 259
75 3300005338 Ga0068868_100560811 Ga0068868_1005608111 259
76 3300005339 Ga0070660_100006064 Ga0070660_1000060644 259
77 3300005339 Ga0070660_100014880 Ga0070660_1000148806 259
78 3300005339 Ga0070660_100029285 Ga0070660_1000292854 259
79 3300005339 Ga0070660_100035865 Ga0070660_1000358654 259
80 3300005339 Ga0070660_100038635 Ga0070660_1000386353 259
81 3300005339 Ga0070660_100042108 Ga0070660_1000421084 259
82 3300005339 Ga0070660_100093260 Ga0070660_1000932602 259
83 3300005339 Ga0070660_100134033 Ga0070660_1001340332 259
84 3300005339 Ga0070660_100393123 Ga0070660_1003931232 259
85 3300005340 Ga0070689_100006805 Ga0070689_1000068052 259
86 3300005341 Ga0070691_10098103 Ga0070691_100981031 259
87 3300005344 Ga0070661_100009704 Ga0070661_1000097044 259
88 3300005344 Ga0070661_100014744 Ga0070661_1000147442 259
89 3300005344 Ga0070661_100037391 Ga0070661_1000373912 259
90 3300005344 Ga0070661_100094213 Ga0070661_1000942132 259
91 3300005344 Ga0070661_100105175 Ga0070661_1001051752 259
92 3300005344 Ga0070661_100120518 Ga0070661_1001205181 259
93 3300005344 Ga0070661_100122744 Ga0070661_1001227443 259
94 3300005344 Ga0070661_100182420 Ga0070661_1001824201 259
95 3300005344 Ga0070661_100361200 Ga0070661_1003612002 259
96 3300005347 Ga0070668_100124876 Ga0070668_1001248761 259
97 3300005347 Ga0070668_100148459 Ga0070668_1001484592 259
98 3300005353 Ga0070669_100001260 Ga0070669_10000126013 259
99 3300005354 Ga0070675_100104855 Ga0070675_1001048552 259
100 3300005354 Ga0070675_100163269 Ga0070675_1001632691 259
101 3300005355 Ga0070671_100000927 Ga0070671_10000092711 259
102 3300005355 Ga0070671_100002825 Ga0070671_10000282511 259
103 3300005355 Ga0070671_100011596 Ga0070671_1000115964 259
104 3300005355 Ga0070671_100012260 Ga0070671_1000122601 259
105 3300005355 Ga0070671_100028280 Ga0070671_1000282802 259
106 3300005355 Ga0070671_100089917 Ga0070671_1000899173 259
107 3300005355 Ga0070671_100273666 Ga0070671_1002736662 259
108 3300005355 Ga0070671_100328366 Ga0070671_1003283662 259
109 3300005356 Ga0070674_100023242 Ga0070674_1000232424 259
110 3300005356 Ga0070674_100041914 Ga0070674_1000419142 259
111 3300005356 Ga0070674_100179089 Ga0070674_1001790891 259
112 3300005364 Ga0070673_100001674 Ga0070673_1000016742 259
113 3300005364 Ga0070673_100002345 Ga0070673_1000023458 259
114 3300005364 Ga0070673_100020014 Ga0070673_1000200143 259
115 3300005364 Ga0070673_100049184 Ga0070673_1000491844 259
116 3300005364 Ga0070673_100054226 Ga0070673_1000542263 259
117 3300005364 Ga0070673_100076667 Ga0070673_1000766671 259
118 3300005364 Ga0070673_100455939 Ga0070673_1004559392 259
119 3300005366 Ga0070659_100001267 Ga0070659_10000126716 259
120 3300005366 Ga0070659_100018346 Ga0070659_1000183462 259
121 3300005366 Ga0070659_100039254 Ga0070659_1000392544 259
122 3300005366 Ga0070659_100044004 Ga0070659_1000440042 259
123 3300005366 Ga0070659_100045903 Ga0070659_1000459032 259
124 3300005366 Ga0070659_100250544 Ga0070659_1002505441 259
125 3300005366 Ga0070659_100268103 Ga0070659_1002681032 259
126 3300005367 Ga0070667_100004545 Ga0070667_1000045452 259
127 3300005367 Ga0070667_100005246 Ga0070667_1000052464 259
128 3300005367 Ga0070667_100021218 Ga0070667_1000212182 259
129 3300005367 Ga0070667_100192796 Ga0070667_1001927962 259
130 3300005367 Ga0070667_100233717 Ga0070667_1002337171 259
131 3300005367 Ga0070667_100401331 Ga0070667_1004013311 259
132 3300005367 Ga0070667_100411854 Ga0070667_1004118542 259
133 3300005435 Ga0070714_100020265 Ga0070714_1000202652 259
134 3300005435 Ga0070714_100098350 Ga0070714_1000983502 259
135 3300005435 Ga0070714_100374956 Ga0070714_1003749562 259
136 3300005435 Ga0070714_100401194 Ga0070714_1004011942 259
137 3300005435 Ga0070714_100857313 Ga0070714_1008573131 259
138 3300005455 Ga0070663_100014152 Ga0070663_1000141523 259
139 3300005455 Ga0070663_100029638 Ga0070663_1000296382 259
140 3300005455 Ga0070663_100089109 Ga0070663_1000891091 259
141 3300005455 Ga0070663_100153030 Ga0070663_1001530302 259
142 3300005456 Ga0070678_100009697 Ga0070678_1000096974 259
143 3300005456 Ga0070678_100053016 Ga0070678_1000530162 259
144 3300005456 Ga0070678_100098312 Ga0070678_1000983122 259
145 3300005456 Ga0070678_100202114 Ga0070678_1002021142 259
146 3300005456 Ga0070678_100554340 Ga0070678_1005543401 259
147 3300005457 Ga0070662_100001203 Ga0070662_10000120313 259
148 3300005457 Ga0070662_100034885 Ga0070662_1000348853 259
149 3300005457 Ga0070662_100078224 Ga0070662_1000782242 259
150 3300005457 Ga0070662_100135123 Ga0070662_1001351231 259
151 3300005457 Ga0070662_100140977 Ga0070662_1001409771 259
152 3300005457 Ga0070662_100165462 Ga0070662_1001654622 259
153 3300005457 Ga0070662_100336784 Ga0070662_1003367842 259
154 3300005458 Ga0070681_10044346 Ga0070681_100443464 259
155 3300005458 Ga0070681_10303661 Ga0070681_103036611 259
156 3300005459 Ga0068867_100005599 Ga0068867_1000055995 259
157 3300005459 Ga0068867_100018721 Ga0068867_1000187213 259
158 3300005459 Ga0068867_100052268 Ga0068867_1000522682 259
159 3300005466 Ga0070685_10461159 Ga0070685_104611591 259
160 3300005530 Ga0070679_100022016 Ga0070679_1000220162 259
161 3300005530 Ga0070679_100071652 Ga0070679_1000716523 259
162 3300005535 Ga0070684_100002726 Ga0070684_1000027265 259
163 3300005535 Ga0070684_100011882 Ga0070684_1000118823 259
164 3300005535 Ga0070684_100225611 Ga0070684_1002256112 259
165 3300005539 Ga0068853_100002144 Ga0068853_10000214411 259
166 3300005539 Ga0068853_100119051 Ga0068853_1001190512 259
167 3300005539 Ga0068853_100137438 Ga0068853_1001374382 259
168 3300005539 Ga0068853_100217507 Ga0068853_1002175072 259
169 3300005539 Ga0068853_100251837 Ga0068853_1002518372 259
170 3300005543 Ga0070672_100015078 Ga0070672_1000150785 259
171 3300005543 Ga0070672_100015719 Ga0070672_1000157195 259
172 3300005543 Ga0070672_100096027 Ga0070672_1000960272 259
173 3300005543 Ga0070672_100350488 Ga0070672_1003504882 259
174 3300005546 Ga0070696_100007378 Ga0070696_1000073786 259
175 3300005548 Ga0070665_100001208 Ga0070665_10000120820 259
176 3300005548 Ga0070665_100004742 Ga0070665_1000047425 259
177 3300005548 Ga0070665_100012842 Ga0070665_1000128423 259
178 3300005548 Ga0070665_100034005 Ga0070665_1000340055 259
179 3300005563 Ga0068855_100002638 Ga0068855_10000263811 259
180 3300005563 Ga0068855_100113573 Ga0068855_1001135732 259
181 3300005563 Ga0068855_100193123 Ga0068855_1001931232 259
182 3300005563 Ga0068855_100199919 Ga0068855_1001999193 259
183 3300005563 Ga0068855_100353041 Ga0068855_1003530412 259
184 3300005564 Ga0070664_100000446 Ga0070664_10000044620 259
185 3300005564 Ga0070664_100003398 Ga0070664_10000339811 259
186 3300005564 Ga0070664_100012233 Ga0070664_1000122332 259
187 3300005564 Ga0070664_100048375 Ga0070664_1000483753 259
188 3300005564 Ga0070664_100074362 Ga0070664_1000743622 259
189 3300005564 Ga0070664_100076084 Ga0070664_1000760843 259
190 3300005564 Ga0070664_100097431 Ga0070664_1000974311 259
191 3300005564 Ga0070664_100146716 Ga0070664_1001467162 259
192 3300005564 Ga0070664_100573006 Ga0070664_1005730062 259
193 3300005577 Ga0068857_100001517 Ga0068857_1000015178 259
194 3300005577 Ga0068857_100003065 Ga0068857_1000030657 259
195 3300005577 Ga0068857_100004069 Ga0068857_1000040696 259
196 3300005577 Ga0068857_100304739 Ga0068857_1003047392 259
197 3300005578 Ga0068854_100003147 Ga0068854_1000031476 259
198 3300005578 Ga0068854_100008221 Ga0068854_1000082212 259
199 3300005578 Ga0068854_100023884 Ga0068854_1000238843 259
200 3300005578 Ga0068854_100080461 Ga0068854_1000804613 259
201 3300005578 Ga0068854_100106470 Ga0068854_1001064702 259
202 3300005578 Ga0068854_100144622 Ga0068854_1001446222 259
203 3300005578 Ga0068854_100343546 Ga0068854_1003435462 259
204 3300005578 Ga0068854_100520284 Ga0068854_1005202842 259
205 3300005578 Ga0068854_100674101 Ga0068854_1006741011 259
206 3300005614 Ga0068856_100015113 Ga0068856_1000151131 259
207 3300005614 Ga0068856_100040080 Ga0068856_1000400802 259
208 3300005614 Ga0068856_100050336 Ga0068856_1000503361 259
209 3300005614 Ga0068856_100078153 Ga0068856_1000781532 259
210 3300005615 Ga0070702_100269258 Ga0070702_1002692581 259
211 3300005616 Ga0068852_100000461 Ga0068852_10000046112 259
212 3300005616 Ga0068852_100019867 Ga0068852_1000198674 259
213 3300005616 Ga0068852_100029627 Ga0068852_1000296272 259
214 3300005616 Ga0068852_100116814 Ga0068852_1001168143 259
215 3300005616 Ga0068852_100126481 Ga0068852_1001264812 259
216 3300005616 Ga0068852_100494035 Ga0068852_1004940351 259
217 3300005616 Ga0068852_101081768 Ga0068852_1010817681 259
218 3300005617 Ga0068859_100008534 Ga0068859_1000085345 259
219 3300005617 Ga0068859_100009839 Ga0068859_1000098392 259
220 3300005617 Ga0068859_100050360 Ga0068859_1000503604 259
221 3300005617 Ga0068859_100243805 Ga0068859_1002438052 259
222 3300005618 Ga0068864_100003315 Ga0068864_1000033154 259
223 3300005618 Ga0068864_100020883 Ga0068864_1000208835 259
224 3300005618 Ga0068864_100064482 Ga0068864_1000644824 259
225 3300005618 Ga0068864_100118776 Ga0068864_1001187762 259
226 3300005618 Ga0068864_100254766 Ga0068864_1002547662 259
227 3300005718 Ga0068866_10056715 Ga0068866_100567152 259
228 3300005719 Ga0068861_100000052 Ga0068861_10000005241 259
229 3300005719 Ga0068861_100216662 Ga0068861_1002166622 259
230 3300005834 Ga0068851_10006913 Ga0068851_100069132 259
231 3300005834 Ga0068851_10018291 Ga0068851_100182912 259
232 3300005834 Ga0068851_10215039 Ga0068851_102150392 259
233 3300005834 Ga0068851_10230068 Ga0068851_102300682 259
234 3300005840 Ga0068870_10136484 Ga0068870_101364842 259
235 3300005841 Ga0068863_100003487 Ga0068863_10000348710 259
236 3300005841 Ga0068863_100008185 Ga0068863_1000081852 259
237 3300005841 Ga0068863_100009190 Ga0068863_1000091906 259
238 3300005841 Ga0068863_100012720 Ga0068863_1000127204 259
239 3300005841 Ga0068863_100036906 Ga0068863_1000369064 259
240 3300005841 Ga0068863_100057339 Ga0068863_1000573392 259
241 3300005842 Ga0068858_100008071 Ga0068858_1000080717 259
242 3300005842 Ga0068858_100017583 Ga0068858_1000175834 259
243 3300005842 Ga0068858_100136500 Ga0068858_1001365002 259
244 3300005842 Ga0068858_100157035 Ga0068858_1001570352 259
245 3300005843 Ga0068860_100003073 Ga0068860_1000030736 259
246 3300005843 Ga0068860_100036352 Ga0068860_1000363522 259
247 3300005843 Ga0068860_100064032 Ga0068860_1000640324 259
248 3300005844 Ga0068862_100018707 Ga0068862_1000187073 259
249 3300005844 Ga0068862_100492483 Ga0068862_1004924832 259
250 3300005985 Ga0081539_10188094 Ga0081539_101880941 259
251 3300006173 Ga0070716_100084000 Ga0070716_1000840001 259
252 3300006237 Ga0097621_100003754 Ga0097621_1000037547 259
253 3300006237 Ga0097621_100080112 Ga0097621_1000801122 259
254 3300006237 Ga0097621_100558030 Ga0097621_1005580302 259
255 3300006358 Ga0068871_100019567 Ga0068871_1000195675 259
256 3300006358 Ga0068871_100373963 Ga0068871_1003739632 259
257 3300006881 Ga0068865_100005997 Ga0068865_1000059974 259
258 3300006881 Ga0068865_100025297 Ga0068865_1000252972 259
259 3300006881 Ga0068865_100078208 Ga0068865_1000782082 259
260 3300006931 Ga0097620_100008534 Ga0097620_1000085345 259
261 3300006931 Ga0097620_100009839 Ga0097620_1000098398 259
262 3300006931 Ga0097620_100050361 Ga0097620_1000503614 259
263 3300006931 Ga0097620_100243789 Ga0097620_1002437892 259
264 3300009011 Ga0105251_10026917 Ga0105251_100269172 259
265 3300009011 Ga0105251_10104757 Ga0105251_101047572 259
266 3300009093 Ga0105240_10044466 Ga0105240_100444664 259
267 3300009093 Ga0105240_10460880 Ga0105240_104608802 259
268 3300009093 Ga0105240_10584971 Ga0105240_105849712 259
269 3300009093 Ga0105240_10867517 Ga0105240_108675171 259
270 3300009098 Ga0105245_10001667 Ga0105245_100016678 259
271 3300009101 Ga0105247_10450826 Ga0105247_104508262 259
272 3300009174 Ga0105241_10007878 Ga0105241_100078785 259
273 3300009174 Ga0105241_10041880 Ga0105241_100418802 259
274 3300009176 Ga0105242_10012800 Ga0105242_100128004 259
275 3300009177 Ga0105248_10000096 Ga0105248_1000009619 259
276 3300009177 Ga0105248_10001577 Ga0105248_1000157710 259
277 3300009177 Ga0105248_10006141 Ga0105248_100061419 259
278 3300009177 Ga0105248_10006863 Ga0105248_100068633 259
279 3300009177 Ga0105248_10006890 Ga0105248_100068907 259
280 3300009177 Ga0105248_10332047 Ga0105248_103320472 259
281 3300009177 Ga0105248_10681055 Ga0105248_106810552 259
282 3300009545 Ga0105237_10015281 Ga0105237_100152814 259
283 3300009545 Ga0105237_10079942 Ga0105237_100799422 259
284 3300009545 Ga0105237_10149808 Ga0105237_101498083 259
285 3300009545 Ga0105237_10151641 Ga0105237_101516412 259
286 3300009551 Ga0105238_10039716 Ga0105238_100397164 259
287 3300009551 Ga0105238_10191208 Ga0105238_101912082 259
288 3300009551 Ga0105238_10226369 Ga0105238_102263692 259
289 3300009553 Ga0105249_10198579 Ga0105249_101985791 259
290 3300009978 Ga0105148_100202 Ga0105148_1002023 259
291 3300009982 Ga0105147_105299 Ga0105147_1052991 259
292 3300010375 Ga0105239_10117373 Ga0105239_101173732 259
293 3300011119 Ga0105246_10022077 Ga0105246_100220773 259
294 3300011119 Ga0105246_10040645 Ga0105246_100406454 259
295 3300011119 Ga0105246_10275590 Ga0105246_102755902 259
296 3300013100 Ga0157373_10007215 Ga0157373_100072151 259
297 3300013100 Ga0157373_10017921 Ga0157373_100179215 259
298 3300013100 Ga0157373_10039257 Ga0157373_100392573 259
299 3300013100 Ga0157373_10081485 Ga0157373_100814853 259
300 3300013100 Ga0157373_10122166 Ga0157373_101221662 259
301 3300013100 Ga0157373_10129123 Ga0157373_101291232 259
302 3300013100 Ga0157373_10155107 Ga0157373_101551072 259
303 3300013102 Ga0157371_10003770 Ga0157371_100037708 259
304 3300013102 Ga0157371_10022992 Ga0157371_100229924 259
305 3300013102 Ga0157371_10040657 Ga0157371_100406572 259
306 3300013102 Ga0157371_10076634 Ga0157371_100766342 259
307 3300013102 Ga0157371_10114766 Ga0157371_101147662 259
308 3300013102 Ga0157371_10132648 Ga0157371_101326483 259
309 3300013102 Ga0157371_10135588 Ga0157371_101355883 259
310 3300013102 Ga0157371_10197728 Ga0157371_101977281 259
311 3300013104 Ga0157370_10102505 Ga0157370_101025053 259
312 3300013104 Ga0157370_10382552 Ga0157370_103825522 259
313 3300013104 Ga0157370_10532422 Ga0157370_105324222 259
314 3300013105 Ga0157369_10122804 Ga0157369_101228043 259
315 3300013105 Ga0157369_10139262 Ga0157369_101392622 259
316 3300013105 Ga0157369_10193603 Ga0157369_101936032 259
317 3300013105 Ga0157369_10214579 Ga0157369_102145792 259
318 3300013105 Ga0157369_10980573 Ga0157369_109805731 259
319 3300013296 Ga0157374_10009229 Ga0157374_100092292 259
320 3300013296 Ga0157374_10117607 Ga0157374_101176072 259
321 3300013297 Ga0157378_10001776 Ga0157378_100017767 259
322 3300013297 Ga0157378_10142034 Ga0157378_101420342 259
323 3300013306 Ga0163162_10048501 Ga0163162_100485012 259
324 3300013306 Ga0163162_10158044 Ga0163162_101580442 259
325 3300013307 Ga0157372_10068574 Ga0157372_100685742 259
326 3300013307 Ga0157372_10103884 Ga0157372_101038843 259
327 3300013307 Ga0157372_10230095 Ga0157372_102300951 259
328 3300013307 Ga0157372_10269475 Ga0157372_102694752 259
329 3300013307 Ga0157372_10302866 Ga0157372_103028662 259
330 3300013307 Ga0157372_10795999 Ga0157372_107959991 259
331 3300013307 Ga0157372_10853167 Ga0157372_108531672 259
332 3300013308 Ga0157375_10003831 Ga0157375_100038314 259
333 3300013308 Ga0157375_10026239 Ga0157375_100262395 259
334 3300014325 Ga0163163_10019009 Ga0163163_100190095 259
335 3300014325 Ga0163163_10034122 Ga0163163_100341224 259
336 3300014325 Ga0163163_10120482 Ga0163163_101204822 259
337 3300014325 Ga0163163_10721089 Ga0163163_107210892 259
338 3300014968 Ga0157379_10006317 Ga0157379_100063172 259
339 3300014968 Ga0157379_10368662 Ga0157379_103686622 259
340 3300017792 Ga0163161_10013697 Ga0163161_100136975 259
341 3300025290 Ga0207673_1019010 Ga0207673_10190102 259
342 3300025315 Ga0207697_10001060 Ga0207697_1000106011 259
343 3300025315 Ga0207697_10003608 Ga0207697_100036084 259
344 3300025315 Ga0207697_10013963 Ga0207697_100139634 259
345 3300025315 Ga0207697_10015837 Ga0207697_100158372 259
346 3300025321 Ga0207656_10011903 Ga0207656_100119032 259
347 3300025321 Ga0207656_10028906 Ga0207656_100289063 259
348 3300025321 Ga0207656_10086913 Ga0207656_100869132 259
349 3300025321 Ga0207656_10151540 Ga0207656_101515402 259
350 3300025893 Ga0207682_10028455 Ga0207682_100284553 259
351 3300025899 Ga0207642_10253517 Ga0207642_102535172 259
352 3300025901 Ga0207688_10002178 Ga0207688_100021787 259
353 3300025901 Ga0207688_10005414 Ga0207688_100054145 259
354 3300025903 Ga0207680_10007785 Ga0207680_100077854 259
355 3300025903 Ga0207680_10008339 Ga0207680_100083391 259
356 3300025903 Ga0207680_10028080 Ga0207680_100280802 259
357 3300025903 Ga0207680_10101677 Ga0207680_101016771 259
358 3300025903 Ga0207680_10165735 Ga0207680_101657352 259
359 3300025904 Ga0207647_10000153 Ga0207647_100001535 259
360 3300025904 Ga0207647_10001078 Ga0207647_100010787 259
361 3300025904 Ga0207647_10005438 Ga0207647_100054385 259
362 3300025904 Ga0207647_10007591 Ga0207647_100075914 259
363 3300025904 Ga0207647_10009600 Ga0207647_100096005 259
364 3300025904 Ga0207647_10020279 Ga0207647_100202792 259
365 3300025904 Ga0207647_10237091 Ga0207647_102370912 259
366 3300025907 Ga0207645_10003786 Ga0207645_100037865 259
367 3300025907 Ga0207645_10019133 Ga0207645_100191334 259
368 3300025907 Ga0207645_10066206 Ga0207645_100662062 259
369 3300025907 Ga0207645_10192331 Ga0207645_101923312 259
370 3300025907 Ga0207645_10252235 Ga0207645_102522352 259
371 3300025907 Ga0207645_10395103 Ga0207645_103951031 259
372 3300025908 Ga0207643_10016175 Ga0207643_100161754 259
373 3300025909 Ga0207705_10007304 Ga0207705_100073048 259
374 3300025909 Ga0207705_10009311 Ga0207705_100093114 259
375 3300025909 Ga0207705_10041020 Ga0207705_100410203 259
376 3300025909 Ga0207705_10071335 Ga0207705_100713352 259
377 3300025909 Ga0207705_10073108 Ga0207705_100731082 259
378 3300025909 Ga0207705_10105175 Ga0207705_101051752 259
379 3300025909 Ga0207705_10382995 Ga0207705_103829951 259
380 3300025911 Ga0207654_10021779 Ga0207654_100217792 259
381 3300025911 Ga0207654_10084466 Ga0207654_100844662 259
382 3300025911 Ga0207654_10147794 Ga0207654_101477942 259
383 3300025912 Ga0207707_10130129 Ga0207707_101301292 259
384 3300025912 Ga0207707_10413934 Ga0207707_104139342 259
385 3300025913 Ga0207695_10014240 Ga0207695_100142408 259
386 3300025913 Ga0207695_10089367 Ga0207695_100893673 259
387 3300025913 Ga0207695_10489827 Ga0207695_104898272 259
388 3300025913 Ga0207695_10581297 Ga0207695_105812972 259
389 3300025913 Ga0207695_10604420 Ga0207695_106044201 259
390 3300025914 Ga0207671_10016290 Ga0207671_100162902 259
391 3300025914 Ga0207671_10430501 Ga0207671_104305012 259
392 3300025915 Ga0207693_10043480 Ga0207693_100434802 259
393 3300025917 Ga0207660_10040596 Ga0207660_100405962 259
394 3300025917 Ga0207660_10153568 Ga0207660_101535682 259
395 3300025917 Ga0207660_10164361 Ga0207660_101643612 259
396 3300025919 Ga0207657_10000924 Ga0207657_100009244 259
397 3300025919 Ga0207657_10002827 Ga0207657_100028278 259
398 3300025919 Ga0207657_10005125 Ga0207657_100051259 259
399 3300025919 Ga0207657_10005183 Ga0207657_1000518312 259
400 3300025919 Ga0207657_10008828 Ga0207657_100088289 259
401 3300025919 Ga0207657_10010444 Ga0207657_100104446 259
402 3300025919 Ga0207657_10025691 Ga0207657_100256915 259
403 3300025919 Ga0207657_10042191 Ga0207657_100421913 259
404 3300025919 Ga0207657_10047659 Ga0207657_100476592 259
405 3300025919 Ga0207657_10048576 Ga0207657_100485764 259
406 3300025919 Ga0207657_10064335 Ga0207657_100643351 259
407 3300025919 Ga0207657_10082175 Ga0207657_100821753 259
408 3300025919 Ga0207657_10157225 Ga0207657_101572252 259
409 3300025919 Ga0207657_10190417 Ga0207657_101904172 259
410 3300025919 Ga0207657_10377541 Ga0207657_103775411 259
411 3300025920 Ga0207649_10008713 Ga0207649_100087135 259
412 3300025920 Ga0207649_10032395 Ga0207649_100323952 259
413 3300025920 Ga0207649_10068043 Ga0207649_100680432 259
414 3300025920 Ga0207649_10077508 Ga0207649_100775082 259
415 3300025920 Ga0207649_10107548 Ga0207649_101075482 259
416 3300025920 Ga0207649_10249720 Ga0207649_102497202 259
417 3300025920 Ga0207649_10398560 Ga0207649_103985602 259
418 3300025921 Ga0207652_10028892 Ga0207652_100288924 259
419 3300025923 Ga0207681_10009549 Ga0207681_100095492 259
420 3300025923 Ga0207681_10030101 Ga0207681_100301013 259
421 3300025923 Ga0207681_10538046 Ga0207681_105380461 259
422 3300025924 Ga0207694_10063156 Ga0207694_100631562 259
423 3300025924 Ga0207694_10146573 Ga0207694_101465732 259
424 3300025924 Ga0207694_10170950 Ga0207694_101709502 259
425 3300025925 Ga0207650_10017927 Ga0207650_100179275 259
426 3300025925 Ga0207650_10020206 Ga0207650_100202064 259
427 3300025926 Ga0207659_10014238 Ga0207659_100142384 259
428 3300025926 Ga0207659_10016588 Ga0207659_100165883 259
429 3300025926 Ga0207659_10115517 Ga0207659_101155171 259
430 3300025926 Ga0207659_10243662 Ga0207659_102436621 259
431 3300025927 Ga0207687_10009029 Ga0207687_100090296 259
432 3300025928 Ga0207700_10033241 Ga0207700_100332412 259
433 3300025929 Ga0207664_10082708 Ga0207664_100827083 259
434 3300025929 Ga0207664_10109568 Ga0207664_101095682 259
435 3300025931 Ga0207644_10000235 Ga0207644_100002356 259
436 3300025931 Ga0207644_10002554 Ga0207644_100025544 259
437 3300025931 Ga0207644_10002568 Ga0207644_100025689 259
438 3300025931 Ga0207644_10005217 Ga0207644_100052175 259
439 3300025931 Ga0207644_10005419 Ga0207644_100054196 259
440 3300025931 Ga0207644_10005961 Ga0207644_100059616 259
441 3300025931 Ga0207644_10283154 Ga0207644_102831542 259
442 3300025931 Ga0207644_10485879 Ga0207644_104858792 259
443 3300025932 Ga0207690_10003079 Ga0207690_100030795 259
444 3300025932 Ga0207690_10008443 Ga0207690_100084432 259
445 3300025932 Ga0207690_10084295 Ga0207690_100842952 259
446 3300025932 Ga0207690_10087872 Ga0207690_100878722 259
447 3300025932 Ga0207690_10145420 Ga0207690_101454202 259
448 3300025932 Ga0207690_10349098 Ga0207690_103490982 259
449 3300025933 Ga0207706_10000194 Ga0207706_1000019456 259
450 3300025933 Ga0207706_10001656 Ga0207706_100016562 259
451 3300025933 Ga0207706_10002630 Ga0207706_100026308 259
452 3300025933 Ga0207706_10004866 Ga0207706_100048663 259
453 3300025933 Ga0207706_10039419 Ga0207706_100394194 259
454 3300025933 Ga0207706_10040372 Ga0207706_100403724 259
455 3300025933 Ga0207706_10073264 Ga0207706_100732642 259
456 3300025933 Ga0207706_10109764 Ga0207706_101097642 259
457 3300025933 Ga0207706_10166146 Ga0207706_101661463 259
458 3300025933 Ga0207706_10178117 Ga0207706_101781172 259
459 3300025933 Ga0207706_10191207 Ga0207706_101912073 259
460 3300025933 Ga0207706_10440076 Ga0207706_104400762 259
461 3300025934 Ga0207686_10094562 Ga0207686_100945622 259
462 3300025935 Ga0207709_10040229 Ga0207709_100402292 259
463 3300025936 Ga0207670_10025140 Ga0207670_100251403 259
464 3300025937 Ga0207669_10018762 Ga0207669_100187621 259
465 3300025937 Ga0207669_10063789 Ga0207669_100637893 259
466 3300025937 Ga0207669_10161006 Ga0207669_101610062 259
467 3300025937 Ga0207669_10241389 Ga0207669_102413892 259
468 3300025938 Ga0207704_10007493 Ga0207704_100074934 259
469 3300025938 Ga0207704_10039589 Ga0207704_100395892 259
470 3300025938 Ga0207704_10052721 Ga0207704_100527212 259
471 3300025939 Ga0207665_10007628 Ga0207665_100076284 259
472 3300025939 Ga0207665_10082057 Ga0207665_100820572 259
473 3300025940 Ga0207691_10002330 Ga0207691_100023309 259
474 3300025940 Ga0207691_10003389 Ga0207691_100033892 259
475 3300025940 Ga0207691_10003584 Ga0207691_100035844 259
476 3300025940 Ga0207691_10009649 Ga0207691_100096493 259
477 3300025940 Ga0207691_10015795 Ga0207691_100157952 259
478 3300025940 Ga0207691_10114565 Ga0207691_101145653 259
479 3300025941 Ga0207711_10001137 Ga0207711_1000113722 259
480 3300025941 Ga0207711_10002848 Ga0207711_1000284812 259
481 3300025941 Ga0207711_10006288 Ga0207711_100062885 259
482 3300025941 Ga0207711_10038127 Ga0207711_100381272 259
483 3300025941 Ga0207711_10052245 Ga0207711_100522452 259
484 3300025941 Ga0207711_10054929 Ga0207711_100549294 259
485 3300025941 Ga0207711_10069349 Ga0207711_100693492 259
486 3300025941 Ga0207711_10333410 Ga0207711_103334103 259
487 3300025942 Ga0207689_10000094 Ga0207689_1000009424 259
488 3300025942 Ga0207689_10033567 Ga0207689_100335673 259
489 3300025942 Ga0207689_10046212 Ga0207689_100462122 259
490 3300025944 Ga0207661_10009081 Ga0207661_100090814 259
491 3300025944 Ga0207661_10043473 Ga0207661_100434732 259
492 3300025944 Ga0207661_10296046 Ga0207661_102960462 259
493 3300025945 Ga0207679_10003846 Ga0207679_100038465 259
494 3300025945 Ga0207679_10021663 Ga0207679_100216632 259
495 3300025945 Ga0207679_10021775 Ga0207679_100217752 259
496 3300025945 Ga0207679_10030202 Ga0207679_100302024 259
497 3300025945 Ga0207679_10042727 Ga0207679_100427272 259
498 3300025945 Ga0207679_10043122 Ga0207679_100431223 259
499 3300025945 Ga0207679_10092676 Ga0207679_100926763 259
500 3300025945 Ga0207679_10100608 Ga0207679_101006082 259
501 3300025945 Ga0207679_10375934 Ga0207679_103759342 259
502 3300025945 Ga0207679_10410373 Ga0207679_104103732 259
503 3300025949 Ga0207667_10008988 Ga0207667_1000898811 259
504 3300025949 Ga0207667_10077422 Ga0207667_100774222 259
505 3300025949 Ga0207667_10089753 Ga0207667_100897534 259
506 3300025949 Ga0207667_10092395 Ga0207667_100923953 259
507 3300025949 Ga0207667_10111308 Ga0207667_101113083 259
508 3300025949 Ga0207667_10128792 Ga0207667_101287922 259
509 3300025949 Ga0207667_10361204 Ga0207667_103612042 259
510 3300025960 Ga0207651_10002269 Ga0207651_100022696 259
511 3300025960 Ga0207651_10003286 Ga0207651_100032863 259
512 3300025960 Ga0207651_10008767 Ga0207651_100087675 259
513 3300025960 Ga0207651_10304423 Ga0207651_103044232 259
514 3300025972 Ga0207668_10134838 Ga0207668_101348382 259
515 3300025972 Ga0207668_10544855 Ga0207668_105448551 259
516 3300025981 Ga0207640_10095937 Ga0207640_100959372 259
517 3300025981 Ga0207640_10128274 Ga0207640_101282743 259
518 3300025981 Ga0207640_10237090 Ga0207640_102370901 259
519 3300025981 Ga0207640_10443266 Ga0207640_104432662 259
520 3300025981 Ga0207640_10468516 Ga0207640_104685161 259
521 3300025981 Ga0207640_10595373 Ga0207640_105953731 259
522 3300025986 Ga0207658_10006765 Ga0207658_100067652 259
523 3300025986 Ga0207658_10020303 Ga0207658_100203032 259
524 3300025986 Ga0207658_10257990 Ga0207658_102579903 259
525 3300025986 Ga0207658_10353296 Ga0207658_103532962 259
526 3300025986 Ga0207658_10384618 Ga0207658_103846182 259
527 3300025986 Ga0207658_10548157 Ga0207658_105481571 259
528 3300026023 Ga0207677_10004013 Ga0207677_100040136 259
529 3300026023 Ga0207677_10004145 Ga0207677_100041456 259
530 3300026023 Ga0207677_10006879 Ga0207677_100068795 259
531 3300026023 Ga0207677_10036404 Ga0207677_100364044 259
532 3300026023 Ga0207677_10119855 Ga0207677_101198552 259
533 3300026023 Ga0207677_10141931 Ga0207677_101419312 259
534 3300026023 Ga0207677_10431258 Ga0207677_104312582 259
535 3300026035 Ga0207703_10003160 Ga0207703_100031609 259
536 3300026035 Ga0207703_10023759 Ga0207703_100237592 259
537 3300026035 Ga0207703_10032326 Ga0207703_100323262 259
538 3300026035 Ga0207703_10101622 Ga0207703_101016222 259
539 3300026035 Ga0207703_10356362 Ga0207703_103563622 259
540 3300026041 Ga0207639_10001213 Ga0207639_100012135 259
541 3300026041 Ga0207639_10007329 Ga0207639_100073293 259
542 3300026041 Ga0207639_10097249 Ga0207639_100972493 259
543 3300026041 Ga0207639_10227943 Ga0207639_102279432 259
544 3300026041 Ga0207639_10254757 Ga0207639_102547572 259
545 3300026041 Ga0207639_10278082 Ga0207639_102780822 259
546 3300026041 Ga0207639_10483742 Ga0207639_104837421 259
547 3300026067 Ga0207678_10000716 Ga0207678_1000071621 259
548 3300026067 Ga0207678_10007209 Ga0207678_100072095 259
549 3300026067 Ga0207678_10020789 Ga0207678_100207892 259
550 3300026067 Ga0207678_10034705 Ga0207678_100347053 259
551 3300026067 Ga0207678_10051209 Ga0207678_100512094 259
552 3300026067 Ga0207678_10177581 Ga0207678_101775812 259
553 3300026067 Ga0207678_10338726 Ga0207678_103387262 259
554 3300026067 Ga0207678_10382268 Ga0207678_103822681 259
555 3300026067 Ga0207678_10395635 Ga0207678_103956352 259
556 3300026067 Ga0207678_10579443 Ga0207678_105794431 259
557 3300026078 Ga0207702_10015322 Ga0207702_100153225 259
558 3300026078 Ga0207702_10016918 Ga0207702_100169182 259
559 3300026078 Ga0207702_10130877 Ga0207702_101308772 259
560 3300026078 Ga0207702_10819984 Ga0207702_108199841 259
561 3300026088 Ga0207641_10012223 Ga0207641_100122232 259
562 3300026088 Ga0207641_10042134 Ga0207641_100421343 259
563 3300026088 Ga0207641_10043133 Ga0207641_100431333 259
564 3300026088 Ga0207641_10165150 Ga0207641_101651502 259
565 3300026088 Ga0207641_10279949 Ga0207641_102799492 259
566 3300026089 Ga0207648_10000104 Ga0207648_1000010414 259
567 3300026089 Ga0207648_10003117 Ga0207648_100031174 259
568 3300026089 Ga0207648_10013745 Ga0207648_100137453 259
569 3300026089 Ga0207648_10058958 Ga0207648_100589582 259
570 3300026089 Ga0207648_10264045 Ga0207648_102640452 259
571 3300026095 Ga0207676_10004148 Ga0207676_100041483 259
572 3300026095 Ga0207676_10010419 Ga0207676_100104196 259
573 3300026095 Ga0207676_10026266 Ga0207676_100262662 259
574 3300026095 Ga0207676_10033212 Ga0207676_100332124 259
575 3300026095 Ga0207676_10035753 Ga0207676_100357534 259
576 3300026095 Ga0207676_10319868 Ga0207676_103198682 259
577 3300026116 Ga0207674_10000345 Ga0207674_100003458 259
578 3300026116 Ga0207674_10001057 Ga0207674_1000105737 259
579 3300026116 Ga0207674_10001571 Ga0207674_100015715 259
580 3300026116 Ga0207674_10003098 Ga0207674_1000309811 259
581 3300026116 Ga0207674_10003125 Ga0207674_1000312510 259
582 3300026116 Ga0207674_10016803 Ga0207674_100168034 259
583 3300026116 Ga0207674_10049649 Ga0207674_100496494 259
584 3300026118 Ga0207675_100000035 Ga0207675_10000003558 259
585 3300026118 Ga0207675_100346828 Ga0207675_1003468282 259
586 3300026121 Ga0207683_10001980 Ga0207683_1000198014 259
587 3300026121 Ga0207683_10004221 Ga0207683_100042217 259
588 3300026121 Ga0207683_10011385 Ga0207683_100113856 259
589 3300026121 Ga0207683_10086278 Ga0207683_100862782 259
590 3300026142 Ga0207698_10003964 Ga0207698_100039643 259
591 3300026142 Ga0207698_10005650 Ga0207698_100056502 259
592 3300026142 Ga0207698_10010338 Ga0207698_100103385 259
593 3300026142 Ga0207698_10014787 Ga0207698_100147875 259
594 3300026142 Ga0207698_10035580 Ga0207698_100355803 259
595 3300026142 Ga0207698_10066036 Ga0207698_100660363 259
596 3300026142 Ga0207698_10073695 Ga0207698_100736952 259
597 3300026142 Ga0207698_10086869 Ga0207698_100868692 259
598 3300026142 Ga0207698_10184453 Ga0207698_101844532 259
599 3300026142 Ga0207698_10615438 Ga0207698_106154381 259
600 3300027614 Ga0209970_1013361 Ga0209970_10133612 259
601 3300027876 Ga0209974_10000337 Ga0209974_1000033711 259
602 3300028379 Ga0268266_10000133 Ga0268266_10000133124 259
603 3300028379 Ga0268266_10004030 Ga0268266_100040308 259
604 3300028379 Ga0268266_10162059 Ga0268266_101620592 259
605 3300028379 Ga0268266_10805455 Ga0268266_108054551 259
606 3300028380 Ga0268265_10107245 Ga0268265_101072452 259
607 3300028380 Ga0268265_10179747 Ga0268265_101797471 259
608 3300028381 Ga0268264_10072608 Ga0268264_100726082 259
609 3300028381 Ga0268264_10224758 Ga0268264_102247582 259
610 3300028381 Ga0268264_10353904 Ga0268264_103539041 259
611 3300031548 Ga0307408_100090974 Ga0307408_1000909742 259
612 3300031548 Ga0307408_100265206 Ga0307408_1002652062 259
613 3300031548 Ga0307408_100360594 Ga0307408_1003605942 259
614 3300031731 Ga0307405_10044659 Ga0307405_100446592 259
615 3300031731 Ga0307405_10160507 Ga0307405_101605072 259
616 3300031731 Ga0307405_10183488 Ga0307405_101834882 259
617 3300031731 Ga0307405_10189402 Ga0307405_101894022 259
618 3300031731 Ga0307405_10405255 Ga0307405_104052552 259
619 3300031824 Ga0307413_10077439 Ga0307413_100774392 259
620 3300031824 Ga0307413_10102054 Ga0307413_101020542 259
621 3300031852 Ga0307410_10004817 Ga0307410_100048176 259
622 3300031852 Ga0307410_10012174 Ga0307410_100121742 259
623 3300031852 Ga0307410_10012813 Ga0307410_100128134 259
624 3300031852 Ga0307410_10048944 Ga0307410_100489442 259
625 3300031852 Ga0307410_10057491 Ga0307410_100574912 259
626 3300031852 Ga0307410_10255265 Ga0307410_102552652 259
627 3300031852 Ga0307410_10359737 Ga0307410_103597372 259
628 3300031901 Ga0307406_10012522 Ga0307406_100125222 259
629 3300031901 Ga0307406_10151833 Ga0307406_101518332 259
630 3300031901 Ga0307406_10180289 Ga0307406_101802892 259
631 3300031901 Ga0307406_10246744 Ga0307406_102467442 259
632 3300031903 Ga0307407_10008669 Ga0307407_100086695 259
633 3300031903 Ga0307407_10037907 Ga0307407_100379073 259
634 3300031903 Ga0307407_10052099 Ga0307407_100520992 259
635 3300031903 Ga0307407_10140408 Ga0307407_101404082 259
636 3300031903 Ga0307407_10151008 Ga0307407_101510082 259
637 3300031911 Ga0307412_10001044 Ga0307412_100010442 259
638 3300031911 Ga0307412_10043424 Ga0307412_100434243 259
639 3300031911 Ga0307412_10245438 Ga0307412_102454382 259
640 3300031911 Ga0307412_10265673 Ga0307412_102656732 259
641 3300031995 Ga0307409_100016559 Ga0307409_1000165594 259
642 3300031995 Ga0307409_100102146 Ga0307409_1001021461 259
643 3300031995 Ga0307409_100133004 Ga0307409_1001330042 259
644 3300031995 Ga0307409_100162156 Ga0307409_1001621562 259
645 3300031995 Ga0307409_100196810 Ga0307409_1001968103 259
646 3300031995 Ga0307409_100275523 Ga0307409_1002755232 259
647 3300032002 Ga0307416_100001404 Ga0307416_1000014042 259
648 3300032002 Ga0307416_100047175 Ga0307416_1000471753 259
649 3300032002 Ga0307416_100113208 Ga0307416_1001132082 259
650 3300032004 Ga0307414_10000144 Ga0307414_1000014444 259
651 3300032004 Ga0307414_10045909 Ga0307414_100459092 259
652 3300032004 Ga0307414_10046156 Ga0307414_100461561 259
653 3300032004 Ga0307414_10050673 Ga0307414_100506732 259
654 3300032004 Ga0307414_10061562 Ga0307414_100615622 259
655 3300032005 Ga0307411_10013445 Ga0307411_100134455 259
656 3300032005 Ga0307411_10031954 Ga0307411_100319542 259
657 3300032005 Ga0307411_10077934 Ga0307411_100779342 259
658 3300032005 Ga0307411_10399639 Ga0307411_103996392 259
659 3300032005 Ga0307411_10558978 Ga0307411_105589782 259
660 3300032126 Ga0307415_100008803 Ga0307415_1000088032 259
661 3300032126 Ga0307415_100207401 Ga0307415_1002074012 259
662 3300035170 Ga0373943_0029968 Ga0373943_0029968_1421_2206 259
663 3300037312 Ga0395899_0000225 Ga0395899_0000225_63123_63908 259
664 3300037312 Ga0395899_0000804 Ga0395899_0000804_7049_7834 259
665 3300037312 Ga0395899_0000911 Ga0395899_0000911_14854_15639 259
666 3300037312 Ga0395899_0001269 Ga0395899_0001269_12178_12963 259
667 3300037312 Ga0395899_0002669 Ga0395899_0002669_6777_7562 259
668 3300037312 Ga0395899_0012431 Ga0395899_0012431_5252_6058 259
669 3300037312 Ga0395899_0029775 Ga0395899_0029775_2006_2791 259
670 3300037312 Ga0395899_0059726 Ga0395899_0059726_90_875 259
671 3300037312 Ga0395899_0064303 Ga0395899_0064303_71_856 259
672 3300037312 Ga0395899_0109598 Ga0395899_0109598_1007_1792 259
673 3300037312 Ga0395899_0189680 Ga0395899_0189680_599_1381 259
674 3300037312 Ga0395899_0204422 Ga0395899_0204422_197_976 259
675 3300037312 Ga0395899_0223569 Ga0395899_0223569_398_1183 259
676 3300037312 Ga0395899_0233151 Ga0395899_0233151_372_1157 259
677 3300037312 Ga0395899_0245653 Ga0395899_0245653_141_926 259
678 3300037312 Ga0395899_0308089 Ga0395899_0308089_112_897 259
679 3300037418 Ga0395900_0000911 Ga0395900_0000911_23897_24682 259
680 3300037418 Ga0395900_0001255 Ga0395900_0001255_23891_24676 259
681 3300037418 Ga0395900_0002300 Ga0395900_0002300_16376_17161 259
682 3300037418 Ga0395900_0002356 Ga0395900_0002356_6972_7757 259
683 3300037418 Ga0395900_0009730 Ga0395900_0009730_6496_7281 259
684 3300037418 Ga0395900_0012076 Ga0395900_0012076_4511_5296 259
685 3300037418 Ga0395900_0013567 Ga0395900_0013567_376_1161 259
686 3300037418 Ga0395900_0048295 Ga0395900_0048295_1276_2058 259
687 3300037418 Ga0395900_0056921 Ga0395900_0056921_2498_3283 259
688 3300037418 Ga0395900_0066499 Ga0395900_0066499_490_1275 259
689 3300037418 Ga0395900_0098392 Ga0395900_0098392_38_823 259
690 3300037418 Ga0395900_0118616 Ga0395900_0118616_1276_2058 259
691 3300037418 Ga0395900_0147207 Ga0395900_0147207_1165_1947 259
692 3300037418 Ga0395900_0150794 Ga0395900_0150794_1110_1895 259
693 3300037418 Ga0395900_0165283 Ga0395900_0165283_675_1460 259
694 3300037418 Ga0395900_0424005 Ga0395900_0424005_58_840 259
695 3300037418 Ga0395900_0489819 Ga0395900_0489819_73_858 259
696 3300037418 Ga0395900_0544508 Ga0395900_0544508_202_987 259
697 3300037466 Ga0395898_0000021 Ga0395898_0000021_115218_116003 259
698 3300037466 Ga0395898_0001464 Ga0395898_0001464_8667_9452 259
699 3300037466 Ga0395898_0001496 Ga0395898_0001496_25816_26601 259
700 3300037466 Ga0395898_0007069 Ga0395898_0007069_632_1417 259
701 3300037466 Ga0395898_0027288 Ga0395898_0027288_2730_3515 259
702 3300037466 Ga0395898_0036361 Ga0395898_0036361_2885_3670 259
703 3300037466 Ga0395898_0111649 Ga0395898_0111649_656_1441 259
704 3300037466 Ga0395898_0342748 Ga0395898_0342748_351_1133 259
705 3300037466 Ga0395898_0782832 Ga0395898_0782832_71_856 259
706 3300037471 Ga0395905_0000006 Ga0395905_0000006_331470_332255 259
707 3300037471 Ga0395905_0000193 Ga0395905_0000193_30750_31535 259
708 3300037471 Ga0395905_0000546 Ga0395905_0000546_29546_30331 259
709 3300037471 Ga0395905_0001063 Ga0395905_0001063_32433_33218 259
710 3300037471 Ga0395905_0001765 Ga0395905_0001765_18644_19429 259
711 3300037471 Ga0395905_0003104 Ga0395905_0003104_13750_14535 259
712 3300037471 Ga0395905_0005749 Ga0395905_0005749_1665_2450 259
713 3300037471 Ga0395905_0005835 Ga0395905_0005835_4126_4911 259
714 3300037471 Ga0395905_0008283 Ga0395905_0008283_9059_9844 259
715 3300037471 Ga0395905_0013279 Ga0395905_0013279_4483_5268 259
716 3300037471 Ga0395905_0015356 Ga0395905_0015356_5334_6119 259
717 3300037471 Ga0395905_0021076 Ga0395905_0021076_3627_4412 259
718 3300037471 Ga0395905_0046031 Ga0395905_0046031_1212_1991 259
719 3300037471 Ga0395905_0048606 Ga0395905_0048606_2150_2935 259
720 3300037471 Ga0395905_0048956 Ga0395905_0048956_2679_3464 259
721 3300037471 Ga0395905_0050664 Ga0395905_0050664_1016_1801 259
722 3300037471 Ga0395905_0053660 Ga0395905_0053660_2801_3586 259
723 3300037471 Ga0395905_0055189 Ga0395905_0055189_1955_2740 259
724 3300037471 Ga0395905_0055532 Ga0395905_0055532_1112_1897 259
725 3300037471 Ga0395905_0078477 Ga0395905_0078477_63_845 259
726 3300037471 Ga0395905_0093819 Ga0395905_0093819_427_1212 259
727 3300037471 Ga0395905_0188729 Ga0395905_0188729_567_1349 259
728 3300037471 Ga0395905_0200783 Ga0395905_0200783_488_1294 259
729 3300037471 Ga0395905_0201534 Ga0395905_0201534_248_1033 259
730 3300037471 Ga0395905_0203973 Ga0395905_0203973_21_800 259
731 3300037471 Ga0395905_0219816 Ga0395905_0219816_587_1372 259
732 3300037471 Ga0395905_0223035 Ga0395905_0223035_145_930 259
733 3300037471 Ga0395905_0231094 Ga0395905_0231094_510_1289 259
734 3300037471 Ga0395905_0271373 Ga0395905_0271373_534_1316 259
735 3300037471 Ga0395905_0337631 Ga0395905_0337631_542_1327 259
736 3300037471 Ga0395905_0386152 Ga0395905_0386152_104_889 259
737 3300037471 Ga0395905_0492578 Ga0395905_0492578_297_1076 259
738 3300037471 Ga0395905_0512240 Ga0395905_0512240_173_958 259
739 3300038443 Ga0395901_0000681 Ga0395901_0000681_12755_13540 259
740 3300038443 Ga0395901_0005736 Ga0395901_0005736_3566_4351 259
741 3300038443 Ga0395901_0008542 Ga0395901_0008542_6280_7065 259
742 3300038443 Ga0395901_0015982 Ga0395901_0015982_4437_5222 259
743 3300038443 Ga0395901_0028300 Ga0395901_0028300_3970_4755 259
744 3300038443 Ga0395901_0033758 Ga0395901_0033758_197_982 259
745 3300038443 Ga0395901_0042606 Ga0395901_0042606_1859_2644 259
746 3300038443 Ga0395901_0074461 Ga0395901_0074461_1272_2057 259
747 3300038443 Ga0395901_0080587 Ga0395901_0080587_2145_2930 259
748 3300038443 Ga0395901_0130958 Ga0395901_0130958_1093_1878 259
749 3300038443 Ga0395901_0137581 Ga0395901_0137581_1672_2457 259
750 3300038443 Ga0395901_0154848 Ga0395901_0154848_1316_2101 259
751 3300038443 Ga0395901_0174454 Ga0395901_0174454_1203_1988 259
752 3300038443 Ga0395901_0353907 Ga0395901_0353907_357_1142 259
753 3300038443 Ga0395901_0394821 Ga0395901_0394821_349_1131 259
754 3300038443 Ga0395901_0585738 Ga0395901_0585738_131_937 259
755 3300039437 Ga0436365_1429874 Ga0436365_1429874_2892_3677 259
756 3300039450 Ga0436363_0375547 Ga0436363_0375547_136_921 259
757 3300041413 Ga0439465_0040698 Ga0439465_0040698_309_1097 259
758 3300042005 Ga0439448_0024486 Ga0439448_0024486_502_1287 259
759 3300042006 Ga0439432_002187 Ga0439432_002187_3492_4277 259
760 3300042006 Ga0439432_087363 Ga0439432_087363_132_911 259
761 3300042007 Ga0439449_0009979 Ga0439449_0009979_408_1193 259
762 3300042012 Ga0439455_0022907 Ga0439455_0022907_418_1203 259
763 3300042157 Ga0439458_0000485 Ga0439458_0000485_5127_5912 259
764 3300042157 Ga0439458_0000555 Ga0439458_0000555_4842_5627 259
765 3300044656 Ga0466969_0010344 Ga0466969_0010344_3200_3985 259
766 3300044683 Ga0466965_0219959 Ga0466965_0219959_59_844 259
767 3300044684 Ga0466966_0020358 Ga0466966_0020358_2254_3039 259
768 3300044684 Ga0466966_0041616 Ga0466966_0041616_1538_2323 259
769 3300044684 Ga0466966_0134013 Ga0466966_0134013_338_1144 259
770 3300044693 Ga0466961_0041219 Ga0466961_0041219_1134_1919 259
771 3300044693 Ga0466961_0157766 Ga0466961_0157766_558_1343 259
772 3300044693 Ga0466961_0212996 Ga0466961_0212996_103_888 259
773 3300044706 Ga0466964_0026443 Ga0466964_0026443_108_893 259
774 3300044719 Ga0466971_0021142 Ga0466971_0021142_1275_2060 259
775 3300044765 Ga0466970_0073946 Ga0466970_0073946_905_1690 259
776 3300044842 Ga0466957_0152655 Ga0466957_0152655_384_1169 259
777 3300044842 Ga0466957_0234604 Ga0466957_0234604_244_1029 259
778 3300044901 Ga0466960_0036388 Ga0466960_0036388_1133_1918 259
779 3300044901 Ga0466960_0115483 Ga0466960_0115483_297_1079 259
780 3300045049 Ga0466959_0033313 Ga0466959_0033313_354_1139 259
781 3300045049 Ga0466959_0052324 Ga0466959_0052324_1280_2086 259
782 3300045049 Ga0466959_0115492 Ga0466959_0115492_543_1328 259
783 3300045049 Ga0466959_0145087 Ga0466959_0145087_635_1420 259
784 3300045049 Ga0466959_0200741 Ga0466959_0200741_444_1229 259
785 3300045049 Ga0466959_0206900 Ga0466959_0206900_184_966 259
786 3300045836 Ga0466958_0108300 Ga0466958_0108300_121_906 259
787 3300045836 Ga0466958_0141047 Ga0466958_0141047_654_1439 259
788 3300045836 Ga0466958_0152369 Ga0466958_0152369_567_1352 259
789 3300045836 Ga0466958_0221850 Ga0466958_0221850_241_1047 259
790 3300045836 Ga0466958_0301766 Ga0466958_0301766_109_894 259
791 3300045976 Ga0466967_0132961 Ga0466967_0132961_120_905 259
792 3300046453 Ga0495627_000617 Ga0495627_000617_6981_7760 259
793 3300046459 Ga0495629_0131801 Ga0495629_0131801_77_862 259
794 3300046524 Ga0495648_0005005 Ga0495648_0005005_9761_10540 259
795 3300046539 Ga0495621_0007156 Ga0495621_0007156_987_1772 259
796 3300046558 Ga0495633_0099960 Ga0495633_0099960_525_1310 259
797 3300046684 Ga0495669_0006980 Ga0495669_0006980_2257_3036 259
798 3300046684 Ga0495669_0091413 Ga0495669_0091413_37_822 259
799 3300046692 Ga0495671_0043469 Ga0495671_0043469_1352_2134 259
800 3300048903 Ga0496100_0116257 Ga0496100_0116257_842_1627 259
801 3300048903 Ga0496100_0273315 Ga0496100_0273315_173_958 259
802 3300048904 Ga0496101_0001762 Ga0496101_0001762_4513_5298 259
803 3300048905 Ga0496102_0057117 Ga0496102_0057117_2366_3151 259
804 3300048905 Ga0496102_0310938 Ga0496102_0310938_480_1262 259
805 3300048905 Ga0496102_0457590 Ga0496102_0457590_42_827 259
806 3300048906 Ga0496103_0072289 Ga0496103_0072289_254_1039 259
807 3300048906 Ga0496103_0455452 Ga0496103_0455452_17_802 259
808 3300048907 Ga0496104_0603531 Ga0496104_0603531_111_896 259
809 3300048908 Ga0496105_0024862 Ga0496105_0024862_123_908 259
810 3300048909 Ga0496106_0019188 Ga0496106_0019188_234_1019 259
811 3300048909 Ga0496106_0087328 Ga0496106_0087328_606_1391 259
812 3300048910 Ga0496107_0014597 Ga0496107_0014597_1405_2190 259
813 3300048910 Ga0496107_0071018 Ga0496107_0071018_942_1727 259
814 3300048910 Ga0496107_0215234 Ga0496107_0215234_492_1277 259
815 3300048910 Ga0496107_0566249 Ga0496107_0566249_39_824 259
816 3300048911 Ga0496108_0003987 Ga0496108_0003987_289_1074 259
817 3300048911 Ga0496108_0007034 Ga0496108_0007034_7655_8440 259
818 3300048911 Ga0496108_0031482 Ga0496108_0031482_3178_3960 259
819 3300048911 Ga0496108_0067422 Ga0496108_0067422_2080_2865 259
820 3300048911 Ga0496108_0127890 Ga0496108_0127890_758_1543 259
821 3300048912 Ga0496109_0005615 Ga0496109_0005615_1137_1922 259
822 3300048912 Ga0496109_0007592 Ga0496109_0007592_4654_5439 259
823 3300048912 Ga0496109_0044858 Ga0496109_0044858_1192_1977 259
824 3300048913 Ga0496110_0016179 Ga0496110_0016179_2188_2967 259
825 3300048913 Ga0496110_0023577 Ga0496110_0023577_3677_4462 259
826 3300048914 Ga0496111_0027369 Ga0496111_0027369_2674_3459 259
827 3300048914 Ga0496111_0036464 Ga0496111_0036464_370_1149 259
828 3300048914 Ga0496111_0037180 Ga0496111_0037180_2466_3251 259
829 3300048914 Ga0496111_0052175 Ga0496111_0052175_2046_2831 259
830 3300048915 Ga0496112_0019765 Ga0496112_0019765_5378_6163 259
831 3300048915 Ga0496112_0020281 Ga0496112_0020281_640_1425 259
832 3300048915 Ga0496112_0040436 Ga0496112_0040436_613_1398 259
833 3300048915 Ga0496112_0074840 Ga0496112_0074840_783_1568 259
834 3300048916 Ga0496113_0006306 Ga0496113_0006306_1515_2300 259
835 3300048916 Ga0496113_0013166 Ga0496113_0013166_2801_3586 259
836 3300048916 Ga0496113_0177204 Ga0496113_0177204_240_1025 259
837 3300048917 Ga0496114_0000130 Ga0496114_0000130_21246_22031 259
838 3300048917 Ga0496114_0466878 Ga0496114_0466878_309_1094 259
839 3300048919 Ga0496116_0044039 Ga0496116_0044039_1306_2088 259
840 3300048924 Ga0496121_0006069 Ga0496121_0006069_3092_3874 259
841 3300048925 Ga0496122_0006730 Ga0496122_0006730_10067_10846 259
842 3300048926 Ga0496123_0005339 Ga0496123_0005339_2606_3385 259
843 3300048927 Ga0496124_0007058 Ga0496124_0007058_9557_10336 259
844 3300048927 Ga0496124_0042588 Ga0496124_0042588_1204_1986 259
845 3300048928 Ga0496125_0002768 Ga0496125_0002768_11359_12138 259
846 3300048928 Ga0496125_0010066 Ga0496125_0010066_6067_6849 259
847 3300048929 Ga0496126_0015740 Ga0496126_0015740_1904_2686 259
848 3300049521 Ga0501298_022284 Ga0501298_022284_380_1165 259
849 3300049660 Ga0501216_004767 Ga0501216_004767_1131_1916 259
850 3300049663 Ga0501223_000066 Ga0501223_000066_27954_28733 259
851 3300049663 Ga0501223_013803 Ga0501223_013803_475_1260 259
852 3300049668 Ga0501233_023952 Ga0501233_023952_24_809 259
853 3300049669 Ga0501235_007871 Ga0501235_007871_449_1234 259
854 3300049669 Ga0501235_023392 Ga0501235_023392_244_1023 259
855 3300049686 Ga0501257_054131 Ga0501257_054131_192_977 259
856 3300049687 Ga0501258_005296 Ga0501258_005296_429_1214 259
857 3300049704 Ga0501221_014696 Ga0501221_014696_650_1435 259
858 3300049705 Ga0501225_0000137 Ga0501225_0000137_3940_4719 259
859 3300049705 Ga0501225_0001770 Ga0501225_0001770_3059_3838 259
860 3300049705 Ga0501225_0030860 Ga0501225_0030860_623_1402 259
861 3300049705 Ga0501225_0044171 Ga0501225_0044171_128_913 259
862 3300049706 Ga0501229_003871 Ga0501229_003871_701_1486 259
863 3300049759 Ga0501262_005207 Ga0501262_005207_34_819 259
864 3300049760 Ga0501263_002869 Ga0501263_002869_162_947 259
865 3300049765 Ga0501268_001988 Ga0501268_001988_1514_2299 259
866 3300049769 Ga0501272_003433 Ga0501272_003433_786_1571 259
867 3300049770 Ga0501273_001227 Ga0501273_001227_1005_1790 259
868 3300053083 Ga0495655_0005326 Ga0495655_0005326_433_1215 259
869 3300053118 Ga0500594_0001515 Ga0500594_0001515_1404_2186 259
870 3300053136 Ga0500559_0013126 Ga0500559_0013126_2084_2863 259
871 3300061719 Ga0466962_0108377 Ga0466962_0108377_297_1082 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03309

Pan_kinase

Type III pantothenate kinase

2

209

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xb3-assembly2.cif.gz_D structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.9661 3 29
3djc-assembly1.cif.gz_L crystal structure of pantothenate kinase from legionella pneumophila 0.9329 1 259
2h3g-assembly1.cif.gz_X-2 structure of the type iii pantothenate kinase (coax) from bacillus anthracis 0.9327 1 255
7wn7-assembly1.cif.gz_A crystal structure of hearnpv p26 0.932 3 29
3djc-assembly1.cif.gz_L crystal structure of pantothenate kinase from legionella pneumophila 0.9293 1 259
ID Description Score Start End Superfamily
2h3gX02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9472 90 255 3.30.420.40
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9454 1 88 3.30.420.40
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9353 1 88 3.30.420.40
3djcB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9303 2 88 3.30.420.40
2h3gX02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9301 90 255 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A846M789-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9833 1 259 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872
AF-A0A2E8LTB3-F1-model_v4 deleted 0.9812 1 256
AF-A0A520I6S4-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) 0.9778 146 256 GO:0004594
GO:0005524
GO:0005737
GO:0015937
AF-A0A520I383-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) 0.9771 60 259 GO:0004594
GO:0005524
GO:0005737
GO:0015937
AF-A0A2E8LTB3-F1-model_v4 deleted 0.9737 1 256

Feature Viewer

pLDDT pTM Quality
90.49 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map