F484185

General Info

Members Datasets Scaffolds Average Seq Length
871 383 1742 182

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10055132|Ga0207647_100551322
Length 221
Sequence LTPEIAPETVVHFCQPPVTGTVTFPSRGPDGPSSRSLDWGVVTVQPIRLFGDPVLRTPAEPVIDFDKELRTLVADLAETMLEAPGQGLAAPQIGVGLRVFTYHVHDSMSGHLINPVLHFPDDEQQDGPEGCLSIPGMSFDCRRRANVVAHGQNMYGDPITVEGTAMLARCIQHETDHLDGVLFVDRLDAETRKAAMRAIRDAPWADRANPTIKVSPHGSAG

Samples

Sample ID Description Type Environment
1 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
110 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
180 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
222 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
226 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
227 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
228 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
229 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
329 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
330 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
331 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
332 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
333 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
334 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
335 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
336 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
337 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
338 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 2501939600 Micromonospora sp. L5 Isolate Unclassified
341 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
342 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
343 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
344 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
345 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
346 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
347 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
348 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
349 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
350 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
351 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
352 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
353 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
354 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
355 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
356 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
357 2858868258 Micromonospora sp. MH33 Isolate Unclassified
358 2858882152 Micromonospora noduli MED15 Isolate Nodule
359 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
360 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
361 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
362 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
363 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
364 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
365 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
366 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
367 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
368 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
369 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
370 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
371 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
372 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
373 2902582711 Micromonospora sp. AP08 Isolate Unclassified
374 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
375 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
376 649633069 Micromonospora sp. L5 Isolate Unclassified
377 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
378 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
379 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
380 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
381 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
382 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
383 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.77
Metatranscriptomes 2.18
Isolates 5.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0.57
Rhizoplane 4.71
Rhizosphere 86.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207647_10055132 3300025904 Bacteria 2443
2 JGI24752J21851_1007691 3300001976 Bacteria 1406
3 JGI24737J22298_10140561 3300001990 Bacteria 713
4 JGI24743J22301_10013365 3300001991 Bacteria 1503
5 Ga0070658_10004108 3300005327 Bacteria 11931
6 Ga0070658_10007218 3300005327 Bacteria 8968
7 Ga0070658_10034494 3300005327 Bacteria 4071
8 Ga0070658_10045665 3300005327 Bacteria 3542
9 Ga0070658_10094025 3300005327 Bacteria 2473
10 Ga0070676_10018940 3300005328 Bacteria 3823
11 Ga0070676_10041823 3300005328 Bacteria 2659
12 Ga0070676_10067118 3300005328 Bacteria 2144
13 Ga0070683_100022848 3300005329 Bacteria 5594
14 Ga0070683_100331578 3300005329 Bacteria 1448
15 Ga0070683_100389617 3300005329 Bacteria 1328
16 Ga0070683_100625139 3300005329 Bacteria 1031
17 Ga0070683_101031459 3300005329 Bacteria 790
18 Ga0070690_100142339 3300005330 Bacteria 1629
19 Ga0070670_100001599 3300005331 Bacteria 18296
20 Ga0070670_100030363 3300005331 Bacteria 4654
21 Ga0068869_100002346 3300005334 Bacteria 11391
22 Ga0068869_100009523 3300005334 Bacteria 6304
23 Ga0068869_100020146 3300005334 Bacteria 4568
24 Ga0068869_100107729 3300005334 Bacteria 2116
25 Ga0068869_100706463 3300005334 Bacteria 860
26 Ga0070666_10072372 3300005335 Bacteria 2347
27 Ga0070680_100026701 3300005336 Bacteria 4618
28 Ga0070680_100044687 3300005336 Bacteria 3600
29 Ga0070680_100116716 3300005336 Bacteria 2225
30 Ga0070680_100117095 3300005336 Bacteria 2221
31 Ga0070680_100218692 3300005336 Bacteria 1607
32 Ga0070680_100296846 3300005336 Bacteria 1370
33 Ga0070682_100001498 3300005337 Bacteria 13088
34 Ga0070682_100017404 3300005337 Bacteria 4190
35 Ga0068868_100003533 3300005338 Bacteria 10891
36 Ga0068868_100039320 3300005338 Bacteria 3676
37 Ga0068868_100043967 3300005338 Bacteria 3490
38 Ga0070660_100037288 3300005339 Bacteria 3685
39 Ga0070660_100065551 3300005339 Bacteria 2827
40 Ga0070660_100079237 3300005339 Bacteria 2577
41 Ga0070660_100238247 3300005339 Bacteria 1481
42 Ga0070660_100418678 3300005339 Bacteria 1109
43 Ga0070689_100046920 3300005340 Bacteria 3330
44 Ga0070689_100786756 3300005340 Bacteria 836
45 Ga0070689_101083404 3300005340 Bacteria 716
46 Ga0070691_10012601 3300005341 Bacteria 3872
47 Ga0070691_10024547 3300005341 Bacteria 2802
48 Ga0070691_10266132 3300005341 Bacteria 925
49 Ga0070661_100006318 3300005344 Bacteria 8173
50 Ga0070661_100014991 3300005344 Bacteria 5469
51 Ga0070692_10017484 3300005345 Bacteria 3429
52 Ga0070692_10054129 3300005345 Bacteria 2094
53 Ga0070692_10229753 3300005345 Bacteria 1101
54 Ga0070668_100003772 3300005347 Bacteria 11189
55 Ga0070668_100819008 3300005347 Bacteria 828
56 Ga0070668_101180683 3300005347 Bacteria 693
57 Ga0070669_100338303 3300005353 Bacteria 1219
58 Ga0070675_100009094 3300005354 Bacteria 7716
59 Ga0070675_100010560 3300005354 Bacteria 7218
60 Ga0070675_100011908 3300005354 Bacteria 6816
61 Ga0070675_100852218 3300005354 Bacteria 834
62 Ga0070671_100002713 3300005355 Bacteria 13735
63 Ga0070671_100026821 3300005355 Bacteria 4738
64 Ga0070671_100333584 3300005355 Bacteria 1293
65 Ga0070673_100059250 3300005364 Bacteria 3030
66 Ga0070673_100247476 3300005364 Bacteria 1552
67 Ga0070659_100000619 3300005366 Bacteria 26037
68 Ga0070659_100047992 3300005366 Bacteria 3352
69 Ga0070659_100285251 3300005366 Bacteria 1374
70 Ga0070659_100292158 3300005366 Bacteria 1357
71 Ga0070659_100296848 3300005366 Bacteria 1346
72 Ga0070709_10089432 3300005434 Bacteria 2027
73 Ga0070709_10261928 3300005434 Bacteria 1249
74 Ga0070714_100022172 3300005435 Bacteria 5205
75 Ga0070714_100058439 3300005435 Bacteria 3304
76 Ga0070714_100059168 3300005435 Bacteria 3284
77 Ga0070714_100244639 3300005435 Bacteria 1657
78 Ga0070713_100007535 3300005436 Bacteria 7648
79 Ga0070713_100009883 3300005436 Bacteria 6864
80 Ga0070713_100012018 3300005436 Bacteria 6337
81 Ga0070713_100054431 3300005436 Bacteria 3320
82 Ga0070713_100139405 3300005436 Bacteria 2147
83 Ga0070713_100404284 3300005436 Bacteria 1276
84 Ga0070713_100422604 3300005436 Bacteria 1248
85 Ga0070713_100693965 3300005436 Bacteria 971
86 Ga0070713_100737038 3300005436 Bacteria 942
87 Ga0070710_10015850 3300005437 Bacteria 3822
88 Ga0070711_100232973 3300005439 Bacteria 1436
89 Ga0070708_100262332 3300005445 Bacteria 1624
90 Ga0070663_100003535 3300005455 Bacteria 9023
91 Ga0070663_100018807 3300005455 Bacteria 4539
92 Ga0070663_100025083 3300005455 Bacteria 4022
93 Ga0070663_100154621 3300005455 Bacteria 1761
94 Ga0070678_100012017 3300005456 Bacteria 5364
95 Ga0070678_100027089 3300005456 Bacteria 3886
96 Ga0070662_100004777 3300005457 Bacteria 8586
97 Ga0070681_10027526 3300005458 Bacteria 5715
98 Ga0070681_10040253 3300005458 Bacteria 4684
99 Ga0070681_10144931 3300005458 Bacteria 2304
100 Ga0070681_10200375 3300005458 Bacteria 1914
101 Ga0070685_10230521 3300005466 Bacteria 1218
102 Ga0070698_100007787 3300005471 Bacteria 11594
103 Ga0070679_100027848 3300005530 Bacteria 5567
104 Ga0070679_100039513 3300005530 Bacteria 4689
105 Ga0070679_100175965 3300005530 Bacteria 2112
106 Ga0070679_100279840 3300005530 Bacteria 1621
107 Ga0070679_100302185 3300005530 Bacteria 1551
108 Ga0070684_100004536 3300005535 Bacteria 10582
109 Ga0070684_100022936 3300005535 Bacteria 5213
110 Ga0070684_100202129 3300005535 Bacteria 1810
111 Ga0070684_100268632 3300005535 Bacteria 1561
112 Ga0070684_100631548 3300005535 Bacteria 996
113 Ga0068853_100093781 3300005539 Bacteria 2643
114 Ga0070672_100319326 3300005543 Bacteria 1320
115 Ga0070686_100097288 3300005544 Bacteria 1981
116 Ga0070686_100168396 3300005544 Bacteria 1548
117 Ga0070693_100046882 3300005547 Bacteria 2456
118 Ga0070693_100067949 3300005547 Bacteria 2090
119 Ga0070693_100175460 3300005547 Bacteria 1376
120 Ga0070665_100040551 3300005548 Bacteria 4679
121 Ga0070665_100111833 3300005548 Bacteria 2734
122 Ga0070665_100488888 3300005548 Bacteria 1242
123 Ga0070665_100584623 3300005548 Bacteria 1129
124 Ga0068855_100035399 3300005563 Bacteria 5948
125 Ga0068855_100063345 3300005563 Bacteria 4314
126 Ga0068855_100274977 3300005563 Bacteria 1872
127 Ga0068855_100388553 3300005563 Bacteria 1531
128 Ga0068855_100389668 3300005563 Bacteria 1528
129 Ga0068855_100446897 3300005563 Bacteria 1411
130 Ga0070664_100010112 3300005564 Bacteria 7648
131 Ga0070664_100286852 3300005564 Bacteria 1485
132 Ga0070664_100630291 3300005564 Bacteria 996
133 Ga0068857_100028443 3300005577 Bacteria 4933
134 Ga0068857_100226797 3300005577 Bacteria 1707
135 Ga0068857_100716398 3300005577 Bacteria 951
136 Ga0068854_100028810 3300005578 Bacteria 3840
137 Ga0068854_100033242 3300005578 Bacteria 3595
138 Ga0068856_100021030 3300005614 Bacteria 6341
139 Ga0068856_100120372 3300005614 Bacteria 2626
140 Ga0068856_100218007 3300005614 Bacteria 1923
141 Ga0068856_100428211 3300005614 Bacteria 1343
142 Ga0068856_100579024 3300005614 Bacteria 1144
143 Ga0068856_100796674 3300005614 Bacteria 965
144 Ga0070702_100000171 3300005615 Bacteria 20677
145 Ga0070702_100019326 3300005615 Bacteria 3551
146 Ga0068852_100022896 3300005616 Bacteria 5019
147 Ga0068852_100049930 3300005616 Bacteria 3581
148 Ga0068859_100035566 3300005617 Bacteria 4997
149 Ga0068859_100061735 3300005617 Bacteria 3777
150 Ga0068859_101766751 3300005617 Bacteria 683
151 Ga0068864_100017115 3300005618 Bacteria 6044
152 Ga0068864_100057896 3300005618 Bacteria 3348
153 Ga0068864_100126761 3300005618 Bacteria 2288
154 Ga0068861_100514410 3300005719 Bacteria 1085
155 Ga0068861_100630011 3300005719 Bacteria 988
156 Ga0068851_10014261 3300005834 Bacteria 3772
157 Ga0068870_10000071 3300005840 Bacteria 32257
158 Ga0068870_10000371 3300005840 Bacteria 16836
159 Ga0068863_100003726 3300005841 Bacteria 15076
160 Ga0068863_100006202 3300005841 Bacteria 11728
161 Ga0068863_100031033 3300005841 Bacteria 5103
162 Ga0068863_100236320 3300005841 Bacteria 1764
163 Ga0068858_100003961 3300005842 Bacteria 14613
164 Ga0068858_100017430 3300005842 Bacteria 6736
165 Ga0068858_100107503 3300005842 Bacteria 2604
166 Ga0068858_100304478 3300005842 Bacteria 1521
167 Ga0068860_100096313 3300005843 Bacteria 2821
168 Ga0068862_100016202 3300005844 Bacteria 6201
169 Ga0068862_100085630 3300005844 Bacteria 2739
170 Ga0068862_100556443 3300005844 Bacteria 1096
171 Ga0068862_101129028 3300005844 Bacteria 780
172 Ga0081540_1002336 3300005983 Bacteria 15529
173 Ga0081540_1163080 3300005983 Bacteria 861
174 Ga0081540_1169948 3300005983 Bacteria 832
175 Ga0081539_10004135 3300005985 Bacteria 16512
176 Ga0081539_10008632 3300005985 Bacteria 8790
177 Ga0081539_10010950 3300005985 Bacteria 7273
178 Ga0081539_10016044 3300005985 Bacteria 5387
179 Ga0081539_10098252 3300005985 Bacteria 1498
180 Ga0070717_10144823 3300006028 Bacteria 2052
181 Ga0070717_10606028 3300006028 Bacteria 993
182 Ga0070716_100749409 3300006173 Bacteria 751
183 Ga0070712_100028718 3300006175 Bacteria 3723
184 Ga0070712_100147470 3300006175 Bacteria 1802
185 Ga0070712_100291114 3300006175 Bacteria 1318
186 Ga0097621_100063494 3300006237 Bacteria 3035
187 Ga0097621_100644023 3300006237 Bacteria 972
188 Ga0097621_100866122 3300006237 Bacteria 840
189 Ga0068871_100100812 3300006358 Bacteria 2419
190 Ga0075428_100004276 3300006844 Bacteria 15722
191 Ga0075428_100060342 3300006844 Bacteria 4153
192 Ga0075428_100135071 3300006844 Bacteria 2683
193 Ga0075428_100151360 3300006844 Bacteria 2520
194 Ga0075428_100232463 3300006844 Bacteria 1989
195 Ga0075430_100035603 3300006846 Bacteria 4223
196 Ga0075430_100195361 3300006846 Bacteria 1681
197 Ga0075431_100003257 3300006847 Bacteria 15722
198 Ga0075431_100396024 3300006847 Bacteria 1383
199 Ga0075431_100402127 3300006847 Bacteria 1370
200 Ga0075433_10004022 3300006852 Bacteria 11370
201 Ga0075433_10097647 3300006852 Bacteria 2600
202 Ga0075434_100001779 3300006871 Bacteria 18580
203 Ga0075434_100010778 3300006871 Bacteria 8585
204 Ga0075429_100000244 3300006880 Bacteria 37496
205 Ga0075429_100036349 3300006880 Bacteria 4283
206 Ga0075429_100037400 3300006880 Bacteria 4225
207 Ga0075429_100314559 3300006880 Bacteria 1370
208 Ga0068865_100190093 3300006881 Bacteria 1587
209 Ga0075436_100009808 3300006914 Bacteria 6549
210 Ga0075436_100017369 3300006914 Bacteria 4926
211 Ga0097620_100035566 3300006931 Bacteria 4997
212 Ga0097620_100061733 3300006931 Bacteria 3777
213 Ga0097620_101766407 3300006931 Bacteria 683
214 Ga0075435_100004529 3300007076 Bacteria 9555
215 Ga0075435_100011752 3300007076 Bacteria 6460
216 Ga0105251_10017112 3300009011 Bacteria 3894
217 Ga0105244_10164505 3300009036 Bacteria 1058
218 Ga0105240_10045960 3300009093 Bacteria 5536
219 Ga0105240_10121183 3300009093 Bacteria 3149
220 Ga0105240_10125769 3300009093 Bacteria 3081
221 Ga0105240_11746079 3300009093 Bacteria 649
222 Ga0111539_10025523 3300009094 Bacteria 7245
223 Ga0111539_10308872 3300009094 Bacteria 1840
224 Ga0111539_11980312 3300009094 Bacteria 676
225 Ga0105245_10021743 3300009098 Bacteria 5632
226 Ga0105245_10045369 3300009098 Bacteria 3926
227 Ga0105245_10207857 3300009098 Bacteria 1883
228 Ga0105245_10328942 3300009098 Bacteria 1508
229 Ga0105245_11219362 3300009098 Bacteria 800
230 Ga0105247_10000578 3300009101 Bacteria 29749
231 Ga0105247_10009301 3300009101 Bacteria 5967
232 Ga0105247_10015202 3300009101 Bacteria 4615
233 Ga0105247_10439378 3300009101 Bacteria 938
234 Ga0114129_10000723 3300009147 Bacteria 41902
235 Ga0114129_10053320 3300009147 Bacteria 5672
236 Ga0114129_10129285 3300009147 Bacteria 3471
237 Ga0114129_10635809 3300009147 Bacteria 1379
238 Ga0114129_11436832 3300009147 Bacteria 850
239 Ga0105243_10208195 3300009148 Bacteria 1720
240 Ga0105243_10332423 3300009148 Bacteria 1388
241 Ga0105241_10004726 3300009174 Bacteria 10042
242 Ga0105241_10087958 3300009174 Bacteria 2446
243 Ga0105248_10045442 3300009177 Bacteria 4925
244 Ga0105248_10244302 3300009177 Bacteria 2021
245 Ga0105237_10048028 3300009545 Bacteria 4291
246 Ga0105237_10160031 3300009545 Bacteria 2250
247 Ga0105237_10450282 3300009545 Bacteria 1293
248 Ga0105237_10451993 3300009545 Bacteria 1291
249 Ga0105237_10532733 3300009545 Bacteria 1181
250 Ga0105237_11142597 3300009545 Bacteria 785
251 Ga0105238_10056000 3300009551 Bacteria 3956
252 Ga0105238_10128092 3300009551 Bacteria 2517
253 Ga0105238_10181055 3300009551 Bacteria 2084
254 Ga0105238_10366559 3300009551 Bacteria 1430
255 Ga0105249_10280513 3300009553 Bacteria 1664
256 Ga0105239_10098213 3300010375 Bacteria 3237
257 Ga0105239_10216350 3300010375 Bacteria 2148
258 Ga0105239_10272814 3300010375 Bacteria 1903
259 Ga0105239_10997353 3300010375 Bacteria 963
260 Ga0105239_11052466 3300010375 Bacteria 936
261 Ga0105239_12289298 3300010375 Bacteria 629
262 Ga0105246_10000293 3300011119 Bacteria 26148
263 Ga0105246_10000478 3300011119 Bacteria 21566
264 Ga0105246_10649315 3300011119 Bacteria 918
265 Ga0157373_10148071 3300013100 Bacteria 1651
266 Ga0157373_10203843 3300013100 Bacteria 1394
267 Ga0157371_10046257 3300013102 Bacteria 3095
268 Ga0157371_10052250 3300013102 Bacteria 2902
269 Ga0157371_10065918 3300013102 Bacteria 2565
270 Ga0157371_10236099 3300013102 Bacteria 1315
271 Ga0157370_10021623 3300013104 Bacteria 6409
272 Ga0157370_10036347 3300013104 Bacteria 4780
273 Ga0157370_10295791 3300013104 Bacteria 1495
274 Ga0157370_10361586 3300013104 Bacteria 1337
275 Ga0157370_10805028 3300013104 Bacteria 855
276 Ga0157369_10004575 3300013105 Bacteria 16260
277 Ga0157369_10004788 3300013105 Bacteria 15907
278 Ga0157369_10024369 3300013105 Bacteria 6732
279 Ga0157369_10071305 3300013105 Bacteria 3730
280 Ga0157369_10071634 3300013105 Bacteria 3720
281 Ga0157369_10135433 3300013105 Bacteria 2608
282 Ga0157369_10147048 3300013105 Bacteria 2491
283 Ga0157369_10247304 3300013105 Bacteria 1862
284 Ga0157369_10608713 3300013105 Bacteria 1127
285 Ga0157369_10713360 3300013105 Bacteria 1033
286 Ga0157369_10768854 3300013105 Bacteria 990
287 Ga0157374_10051088 3300013296 Bacteria 3846
288 Ga0157374_10075075 3300013296 Bacteria 3194
289 Ga0157374_10642813 3300013296 Bacteria 1072
290 Ga0163162_10265665 3300013306 Bacteria 1847
291 Ga0163162_10463406 3300013306 Bacteria 1399
292 Ga0157375_10016266 3300013308 Bacteria 6674
293 Ga0157375_10385333 3300013308 Bacteria 1568
294 Ga0163163_10059376 3300014325 Bacteria 3783
295 Ga0163163_10083601 3300014325 Bacteria 3197
296 Ga0163163_10138016 3300014325 Bacteria 2480
297 Ga0163163_10314691 3300014325 Bacteria 1619
298 Ga0163163_10667284 3300014325 Bacteria 1103
299 Ga0157380_10117386 3300014326 Bacteria 2247
300 Ga0182008_10330389 3300014497 Bacteria 804
301 Ga0182008_10362009 3300014497 Bacteria 772
302 Ga0157377_10064788 3300014745 Bacteria 2097
303 Ga0157377_10068681 3300014745 Bacteria 2043
304 Ga0157377_10626577 3300014745 Bacteria 771
305 Ga0157379_10000076 3300014968 Bacteria 63779
306 Ga0157379_10088446 3300014968 Bacteria 2778
307 Ga0157379_10092231 3300014968 Bacteria 2717
308 Ga0157376_10249267 3300014969 Bacteria 1658
309 Ga0157376_10263866 3300014969 Bacteria 1615
310 Ga0157376_11064481 3300014969 Bacteria 833
311 Ga0163161_10702572 3300017792 Bacteria 842
312 Ga0197907_11071090 3300020069 Bacteria 1451
313 Ga0206356_10034341 3300020070 Bacteria 1308
314 Ga0206355_1226558 3300020076 Bacteria 877
315 Ga0206351_10259414 3300020077 Bacteria 922
316 Ga0206354_10516870 3300020081 Bacteria 2186
317 Ga0206354_10545188 3300020081 Bacteria 1628
318 Ga0206354_10624629 3300020081 Bacteria 792
319 Ga0206353_10343003 3300020082 Bacteria 1108
320 Ga0206353_10403903 3300020082 Bacteria 3320
321 Ga0206353_10614142 3300020082 Bacteria 2076
322 Ga0206353_10624157 3300020082 Bacteria 928
323 Ga0206353_11253613 3300020082 Bacteria 2227
324 Ga0213874_10037177 3300021377 Bacteria 1439
325 Ga0213876_10001219 3300021384 Bacteria 16232
326 Ga0213875_10096770 3300021388 Bacteria 1377
327 Ga0224712_10081991 3300022467 Bacteria 1333
328 Ga0224712_10088256 3300022467 Bacteria 1294
329 Ga0224712_10104348 3300022467 Bacteria 1207
330 Ga0224712_10135716 3300022467 Bacteria 1078
331 Ga0224712_10318589 3300022467 Bacteria 730
332 Ga0207656_10006329 3300025321 Bacteria 4245
333 Ga0207656_10018219 3300025321 Bacteria 2761
334 Ga0207713_1064019 3300025735 Bacteria 1386
335 Ga0207692_10068602 3300025898 Bacteria 1860
336 Ga0207642_10171968 3300025899 Bacteria 1173
337 Ga0207710_10000023 3300025900 Bacteria 329909
338 Ga0207710_10018127 3300025900 Bacteria 2992
339 Ga0207710_10020248 3300025900 Bacteria 2843
340 Ga0207688_10012543 3300025901 Bacteria 4612
341 Ga0207688_10036476 3300025901 Bacteria 2724
342 Ga0207688_10218527 3300025901 Bacteria 1147
343 Ga0207680_10296976 3300025903 Bacteria 1125
344 Ga0207647_10064296 3300025904 Bacteria 2230
345 Ga0207647_10141142 3300025904 Bacteria 1412
346 Ga0207647_10141341 3300025904 Bacteria 1411
347 Ga0207685_10011482 3300025905 Bacteria 2664
348 Ga0207699_10011845 3300025906 Bacteria 4419
349 Ga0207699_10022015 3300025906 Bacteria 3447
350 Ga0207699_10057501 3300025906 Bacteria 2322
351 Ga0207699_10552288 3300025906 Bacteria 835
352 Ga0207645_10047739 3300025907 Bacteria 2734
353 Ga0207645_10101305 3300025907 Bacteria 1858
354 Ga0207643_10000022 3300025908 Bacteria 105173
355 Ga0207643_10000102 3300025908 Bacteria 57710
356 Ga0207705_10000595 3300025909 Bacteria 30272
357 Ga0207705_10011904 3300025909 Bacteria 6285
358 Ga0207705_10037678 3300025909 Bacteria 3460
359 Ga0207705_10050136 3300025909 Bacteria 3005
360 Ga0207705_10412011 3300025909 Bacteria 1046
361 Ga0207684_10445923 3300025910 Bacteria 1111
362 Ga0207654_10294600 3300025911 Bacteria 1101
363 Ga0207707_10015744 3300025912 Bacteria 6592
364 Ga0207707_10058525 3300025912 Bacteria 3354
365 Ga0207707_10070314 3300025912 Bacteria 3050
366 Ga0207707_10229764 3300025912 Bacteria 1614
367 Ga0207707_10448486 3300025912 Bacteria 1104
368 Ga0207695_10513805 3300025913 Bacteria 1080
369 Ga0207695_11230478 3300025913 Bacteria 629
370 Ga0207671_10023017 3300025914 Bacteria 4702
371 Ga0207693_10006163 3300025915 Bacteria 9948
372 Ga0207693_10021091 3300025915 Bacteria 5179
373 Ga0207693_10496861 3300025915 Bacteria 952
374 Ga0207663_10866481 3300025916 Bacteria 721
375 Ga0207660_10027222 3300025917 Bacteria 3898
376 Ga0207660_10047641 3300025917 Bacteria 3032
377 Ga0207660_10150580 3300025917 Bacteria 1787
378 Ga0207657_10043599 3300025919 Bacteria 3950
379 Ga0207657_10051901 3300025919 Bacteria 3562
380 Ga0207657_10092164 3300025919 Bacteria 2526
381 Ga0207657_10179941 3300025919 Bacteria 1709
382 Ga0207657_10555313 3300025919 Bacteria 898
383 Ga0207649_10015181 3300025920 Bacteria 4326
384 Ga0207649_10039068 3300025920 Bacteria 2875
385 Ga0207649_10258329 3300025920 Bacteria 1258
386 Ga0207652_10032827 3300025921 Bacteria 4368
387 Ga0207652_10218502 3300025921 Bacteria 1717
388 Ga0207652_10240194 3300025921 Bacteria 1633
389 Ga0207652_10306968 3300025921 Bacteria 1432
390 Ga0207652_10342206 3300025921 Bacteria 1350
391 Ga0207652_10454319 3300025921 Bacteria 1155
392 Ga0207681_10912205 3300025923 Bacteria 736
393 Ga0207694_10076256 3300025924 Bacteria 2626
394 Ga0207694_10845073 3300025924 Bacteria 774
395 Ga0207650_10017555 3300025925 Bacteria 5012
396 Ga0207650_10019927 3300025925 Bacteria 4721
397 Ga0207659_10005909 3300025926 Bacteria 7472
398 Ga0207659_10033050 3300025926 Bacteria 3556
399 Ga0207659_10162960 3300025926 Bacteria 1752
400 Ga0207687_10003225 3300025927 Bacteria 11043
401 Ga0207687_10010510 3300025927 Bacteria 6047
402 Ga0207687_10128449 3300025927 Bacteria 1906
403 Ga0207687_10229509 3300025927 Bacteria 1466
404 Ga0207700_10009719 3300025928 Bacteria 6027
405 Ga0207700_10035764 3300025928 Bacteria 3581
406 Ga0207700_10046521 3300025928 Bacteria 3209
407 Ga0207700_10095334 3300025928 Bacteria 2360
408 Ga0207700_10098357 3300025928 Bacteria 2327
409 Ga0207700_10118142 3300025928 Bacteria 2145
410 Ga0207700_10385742 3300025928 Bacteria 1226
411 Ga0207700_10783375 3300025928 Bacteria 853
412 Ga0207664_10001757 3300025929 Bacteria 14282
413 Ga0207664_10039091 3300025929 Bacteria 3682
414 Ga0207664_10116066 3300025929 Bacteria 2233
415 Ga0207664_10226503 3300025929 Bacteria 1623
416 Ga0207664_10261864 3300025929 Bacteria 1512
417 Ga0207664_10347810 3300025929 Bacteria 1312
418 Ga0207664_10396591 3300025929 Bacteria 1227
419 Ga0207644_10008498 3300025931 Bacteria 6718
420 Ga0207644_10156128 3300025931 Bacteria 1769
421 Ga0207690_10000575 3300025932 Bacteria 24004
422 Ga0207690_10008450 3300025932 Bacteria 6112
423 Ga0207690_10404635 3300025932 Bacteria 1089
424 Ga0207690_10588759 3300025932 Bacteria 907
425 Ga0207690_10712280 3300025932 Bacteria 826
426 Ga0207706_10005138 3300025933 Bacteria 12214
427 Ga0207709_10807725 3300025935 Bacteria 757
428 Ga0207670_10012052 3300025936 Bacteria 5041
429 Ga0207665_10094970 3300025939 Bacteria 2072
430 Ga0207691_10015226 3300025940 Bacteria 7316
431 Ga0207691_10111426 3300025940 Bacteria 2433
432 Ga0207711_10384542 3300025941 Bacteria 1302
433 Ga0207711_10477324 3300025941 Bacteria 1161
434 Ga0207689_10001185 3300025942 Bacteria 25056
435 Ga0207689_10003272 3300025942 Bacteria 14852
436 Ga0207689_10005316 3300025942 Bacteria 11541
437 Ga0207689_10133476 3300025942 Bacteria 2044
438 Ga0207689_10499310 3300025942 Bacteria 1019
439 Ga0207661_10002483 3300025944 Bacteria 12682
440 Ga0207661_10010323 3300025944 Bacteria 6718
441 Ga0207661_10244144 3300025944 Bacteria 1594
442 Ga0207661_10253248 3300025944 Bacteria 1566
443 Ga0207661_10287846 3300025944 Bacteria 1470
444 Ga0207661_10742332 3300025944 Bacteria 903
445 Ga0207679_10019242 3300025945 Bacteria 4585
446 Ga0207679_10023587 3300025945 Bacteria 4209
447 Ga0207679_10071691 3300025945 Bacteria 2614
448 Ga0207679_10297411 3300025945 Bacteria 1390
449 Ga0207667_10017863 3300025949 Bacteria 7972
450 Ga0207667_10270394 3300025949 Bacteria 1737
451 Ga0207651_10040032 3300025960 Bacteria 3097
452 Ga0207651_10092859 3300025960 Bacteria 2214
453 Ga0207668_10001583 3300025972 Bacteria 13306
454 Ga0207668_10584755 3300025972 Bacteria 971
455 Ga0207640_10011075 3300025981 Bacteria 5095
456 Ga0207640_10070703 3300025981 Bacteria 2348
457 Ga0207658_10061354 3300025986 Bacteria 2809
458 Ga0207658_10075097 3300025986 Bacteria 2571
459 Ga0207677_10029651 3300026023 Bacteria 3480
460 Ga0207677_10038111 3300026023 Bacteria 3148
461 Ga0207677_10175092 3300026023 Bacteria 1682
462 Ga0207703_10000003 3300026035 Bacteria 532213
463 Ga0207703_10087459 3300026035 Bacteria 2613
464 Ga0207703_10320078 3300026035 Bacteria 1420
465 Ga0207639_10163771 3300026041 Bacteria 1877
466 Ga0207639_10629992 3300026041 Bacteria 991
467 Ga0207678_10000141 3300026067 Bacteria 59147
468 Ga0207678_10001333 3300026067 Bacteria 22773
469 Ga0207678_10004168 3300026067 Bacteria 12977
470 Ga0207678_10059214 3300026067 Bacteria 3295
471 Ga0207678_10064609 3300026067 Bacteria 3144
472 Ga0207678_10084789 3300026067 Bacteria 2709
473 Ga0207678_10543241 3300026067 Bacteria 1016
474 Ga0207708_10015814 3300026075 Bacteria 5663
475 Ga0207708_10064175 3300026075 Bacteria 2805
476 Ga0207702_10000567 3300026078 Bacteria 41121
477 Ga0207702_10006389 3300026078 Bacteria 10171
478 Ga0207702_10064519 3300026078 Bacteria 3134
479 Ga0207702_10297173 3300026078 Bacteria 1531
480 Ga0207702_10485094 3300026078 Bacteria 1203
481 Ga0207641_10008900 3300026088 Bacteria 8292
482 Ga0207641_10033796 3300026088 Bacteria 4249
483 Ga0207676_10000814 3300026095 Bacteria 24327
484 Ga0207676_10000974 3300026095 Bacteria 22077
485 Ga0207676_10685772 3300026095 Bacteria 991
486 Ga0207674_10013397 3300026116 Bacteria 9102
487 Ga0207674_10032237 3300026116 Bacteria 5498
488 Ga0207674_10784124 3300026116 Bacteria 920
489 Ga0207675_100141707 3300026118 Bacteria 2284
490 Ga0207675_100231589 3300026118 Bacteria 1783
491 Ga0207675_100599876 3300026118 Bacteria 1104
492 Ga0207683_10000171 3300026121 Bacteria 56009
493 Ga0207683_10002042 3300026121 Bacteria 17869
494 Ga0207683_10180428 3300026121 Bacteria 1914
495 Ga0207683_10562757 3300026121 Bacteria 1054
496 Ga0207698_10038926 3300026142 Bacteria 3518
497 Ga0207698_10109663 3300026142 Bacteria 2310
498 Ga0207698_10140302 3300026142 Bacteria 2081
499 Ga0207698_10373447 3300026142 Bacteria 1354
500 Ga0207698_10628340 3300026142 Bacteria 1061
501 Ga0207428_10031502 3300027907 Bacteria 4372
502 Ga0207428_10063708 3300027907 Bacteria 2912
503 Ga0268266_10025102 3300028379 Bacteria 5073
504 Ga0268266_10026732 3300028379 Bacteria 4911
505 Ga0268266_10110251 3300028379 Bacteria 2438
506 Ga0268266_10431383 3300028379 Bacteria 1250
507 Ga0268265_10055749 3300028380 Bacteria 3004
508 Ga0268265_10069153 3300028380 Bacteria 2741
509 Ga0265338_10008011 3300028800 Bacteria 12932
510 Ga0265338_10079175 3300028800 Bacteria 2766
511 Ga0307512_10034068 3300030522 Bacteria 4364
512 Ga0307512_10126895 3300030522 Bacteria 1616
513 Ga0265773_1017838 3300031018 Bacteria 675
514 Ga0307513_10005579 3300031456 Bacteria 16592
515 Ga0307513_10030700 3300031456 Bacteria 6100
516 Ga0307513_10086372 3300031456 Bacteria 3216
517 Ga0307513_10481890 3300031456 Bacteria 960
518 Ga0307509_10007679 3300031507 Bacteria 14014
519 Ga0307509_10442742 3300031507 Bacteria 995
520 Ga0307508_10005865 3300031616 Bacteria 11590
521 Ga0307508_10037730 3300031616 Bacteria 4344
522 Ga0307508_10237079 3300031616 Bacteria 1422
523 Ga0307516_10000395 3300031730 Bacteria 56947
524 Ga0307516_10080920 3300031730 Bacteria 3092
525 Ga0307405_10043892 3300031731 Bacteria 2731
526 Ga0307405_10093648 3300031731 Bacteria 1996
527 Ga0307405_10488112 3300031731 Bacteria 985
528 Ga0307413_10124339 3300031824 Bacteria 1753
529 Ga0326468_10000491 3300031889 Bacteria 4156
530 Ga0307406_10069281 3300031901 Bacteria 2306
531 Ga0307406_10839138 3300031901 Bacteria 778
532 Ga0307406_11014703 3300031901 Bacteria 712
533 Ga0307407_10070006 3300031903 Bacteria 2084
534 Ga0307407_10232393 3300031903 Bacteria 1253
535 Ga0307412_10080851 3300031911 Bacteria 2246
536 Ga0307409_100289009 3300031995 Bacteria 1519
537 Ga0307409_100636361 3300031995 Bacteria 1059
538 Ga0307409_101080364 3300031995 Bacteria 823
539 Ga0307416_100035028 3300032002 Bacteria 3828
540 Ga0307416_100735879 3300032002 Bacteria 1078
541 Ga0307416_101718006 3300032002 Bacteria 732
542 Ga0307411_10334682 3300032005 Bacteria 1228
543 Ga0307415_100049996 3300032126 Bacteria 2830
544 Ga0307415_100136742 3300032126 Bacteria 1865
545 Ga0307415_100457012 3300032126 Bacteria 1105
546 Ga0307415_100550923 3300032126 Bacteria 1018
547 Ga0307415_100588348 3300032126 Bacteria 988
548 Ga0307415_100663056 3300032126 Bacteria 937
549 Ga0307507_10015989 3300033179 Bacteria 8774
550 Ga0307510_10092101 3300033180 Bacteria 2870
551 Ga0373923_0009629 3300035111 Bacteria 3493
552 Ga0373932_0050899 3300035112 Bacteria 1229
553 Ga0373953_0136844 3300035117 Bacteria 1046
554 Ga0373956_0003862 3300035119 Bacteria 6025
555 Ga0373957_0002593 3300035120 Bacteria 5186
556 Ga0373946_0062274 3300035171 Bacteria 1591
557 Ga0373955_0019462 3300035172 Bacteria 3393
558 Ga0373942_0000028 3300035207 Bacteria 26905
559 Ga0373924_0033184 3300035410 Bacteria 2082
560 Ga0373931_0143873 3300035691 Bacteria 1384
561 Ga0373931_0422240 3300035691 Bacteria 848
562 Ga0373931_0551225 3300035691 Bacteria 749
563 Ga0373935_0008810 3300035692 Bacteria 6042
564 Ga0373935_0068108 3300035692 Bacteria 2290
565 Ga0373933_0003332 3300035724 Bacteria 8957
566 Ga0373947_0112790 3300035725 Bacteria 1720
567 Ga0373947_0285097 3300035725 Bacteria 1099
568 Ga0372808_016503 3300036459 Bacteria 1058
569 Ga0373925_0000010 3300037068 Bacteria 229059
570 Ga0373925_0398061 3300037068 Bacteria 1123
571 Ga0395899_0072246 3300037312 Bacteria 2525
572 Ga0395900_0003750 3300037418 Bacteria 16323
573 Ga0395900_0791069 3300037418 Bacteria 877
574 Ga0395898_0129786 3300037466 Bacteria 2414
575 Ga0395898_0163422 3300037466 Bacteria 2130
576 Ga0395898_0534207 3300037466 Bacteria 1114
577 Ga0395905_0001026 3300037471 Bacteria 35609
578 Ga0395905_0296375 3300037471 Bacteria 1504
579 Ga0395905_0364611 3300037471 Bacteria 1338
580 Ga0436364_1458938 3300037853 Bacteria 1235
581 Ga0395901_0004693 3300038443 Bacteria 13783
582 Ga0395901_0007057 3300038443 Bacteria 11354
583 Ga0395901_0253127 3300038443 Bacteria 1835
584 Ga0395901_0549152 3300038443 Bacteria 1171
585 Ga0436365_0093685 3300039437 Bacteria 33238
586 Ga0436365_0676582 3300039437 Bacteria 7068
587 Ga0436363_1466024 3300039450 Bacteria 2356
588 Ga0436362_0116484 3300039453 Bacteria 1013
589 Ga0451791_1528709 3300041451 Bacteria 779
590 Ga0451843_0032912 3300041509 Bacteria 1573
591 Ga0451853_1832670 3300041512 Bacteria 850
592 Ga0439448_0030051 3300042005 Bacteria 1722
593 Ga0439448_0137468 3300042005 Bacteria 844
594 Ga0439450_054604 3300042008 Bacteria 955
595 Ga0439455_0027923 3300042012 Bacteria 1386
596 Ga0439455_0040089 3300042012 Bacteria 1197
597 Ga0450905_014361 3300042142 Bacteria 1129
598 Ga0439459_0004962 3300042438 Bacteria 2165
599 Ga0439464_0184085 3300042439 Bacteria 662
600 Ga0439464_0196136 3300042439 Bacteria 643
601 Ga0439460_0124636 3300042461 Bacteria 845
602 Ga0466969_0014966 3300044656 Bacteria 4070
603 Ga0466969_0162121 3300044656 Bacteria 1027
604 Ga0466972_0430287 3300044658 Bacteria 619
605 Ga0466965_0047569 3300044683 Bacteria 2124
606 Ga0466965_0127189 3300044683 Bacteria 1319
607 Ga0466965_0249524 3300044683 Bacteria 952
608 Ga0466965_0425797 3300044683 Bacteria 736
609 Ga0466966_0006104 3300044684 Bacteria 7959
610 Ga0466966_0035166 3300044684 Bacteria 3239
611 Ga0466966_0036693 3300044684 Bacteria 3164
612 Ga0466966_0131742 3300044684 Bacteria 1531
613 Ga0466966_0165110 3300044684 Bacteria 1347
614 Ga0466966_0165275 3300044684 Bacteria 1346
615 Ga0466961_0005917 3300044693 Bacteria 7752
616 Ga0466961_0100722 3300044693 Bacteria 1820
617 Ga0466961_0108554 3300044693 Bacteria 1747
618 Ga0466961_0190930 3300044693 Bacteria 1269
619 Ga0466961_0282980 3300044693 Bacteria 1014
620 Ga0466961_0348220 3300044693 Bacteria 902
621 Ga0466961_0392559 3300044693 Bacteria 842
622 Ga0466963_0027413 3300044694 Bacteria 3647
623 Ga0466963_0068417 3300044694 Bacteria 2385
624 Ga0466963_0073346 3300044694 Bacteria 2307
625 Ga0466963_0076717 3300044694 Bacteria 2257
626 Ga0466963_0116103 3300044694 Bacteria 1840
627 Ga0466963_0122969 3300044694 Bacteria 1787
628 Ga0466963_0127240 3300044694 Bacteria 1757
629 Ga0466963_0135895 3300044694 Bacteria 1701
630 Ga0466963_0167966 3300044694 Bacteria 1528
631 Ga0466963_0412957 3300044694 Bacteria 952
632 Ga0466963_0537745 3300044694 Bacteria 825
633 Ga0466963_0579013 3300044694 Bacteria 793
634 Ga0466964_0008863 3300044706 Bacteria 3782
635 Ga0466964_0150365 3300044706 Bacteria 1079
636 Ga0466964_0275540 3300044706 Bacteria 839
637 Ga0466971_0019249 3300044719 Bacteria 3030
638 Ga0466971_0054142 3300044719 Bacteria 1808
639 Ga0466971_0099279 3300044719 Bacteria 1337
640 Ga0466970_0003376 3300044765 Bacteria 7769
641 Ga0466970_0075910 3300044765 Bacteria 1810
642 Ga0466970_0078835 3300044765 Bacteria 1778
643 Ga0466970_0245314 3300044765 Bacteria 1003
644 Ga0466970_0491867 3300044765 Bacteria 706
645 Ga0466970_0709195 3300044765 Bacteria 587
646 Ga0466957_0002757 3300044842 Bacteria 9511
647 Ga0466957_0052638 3300044842 Bacteria 2479
648 Ga0466957_0065992 3300044842 Bacteria 2230
649 Ga0466957_0172904 3300044842 Bacteria 1408
650 Ga0466957_0261510 3300044842 Bacteria 1153
651 Ga0466957_0376739 3300044842 Bacteria 967
652 Ga0466957_0888633 3300044842 Bacteria 636
653 Ga0466960_0060434 3300044901 Bacteria 1857
654 Ga0466960_0280592 3300044901 Bacteria 933
655 Ga0466960_0659355 3300044901 Bacteria 625
656 Ga0466959_0006200 3300045049 Bacteria 8262
657 Ga0466959_0011536 3300045049 Bacteria 6352
658 Ga0466959_0050084 3300045049 Bacteria 3068
659 Ga0466959_0097800 3300045049 Bacteria 2103
660 Ga0466959_0184811 3300045049 Bacteria 1457
661 Ga0466959_0208389 3300045049 Bacteria 1359
662 Ga0466959_0588687 3300045049 Bacteria 749
663 Ga0466959_0626130 3300045049 Bacteria 723
664 Ga0466958_0005392 3300045836 Bacteria 6875
665 Ga0466958_0022838 3300045836 Bacteria 3667
666 Ga0466958_0024961 3300045836 Bacteria 3520
667 Ga0466958_0054647 3300045836 Bacteria 2421
668 Ga0466958_0122227 3300045836 Bacteria 1630
669 Ga0466958_0201199 3300045836 Bacteria 1267
670 Ga0466967_0009511 3300045976 Bacteria 7217
671 Ga0466967_0009954 3300045976 Bacteria 7099
672 Ga0466967_0055695 3300045976 Bacteria 3484
673 Ga0466967_0056816 3300045976 Bacteria 3452
674 Ga0466967_0223613 3300045976 Bacteria 1790
675 Ga0466967_0253267 3300045976 Bacteria 1682
676 Ga0466967_0275470 3300045976 Bacteria 1613
677 Ga0466967_0568258 3300045976 Bacteria 1117
678 Ga0466967_0614735 3300045976 Bacteria 1073
679 Ga0466967_0832340 3300045976 Bacteria 917
680 Ga0495592_0048601 3300046454 Bacteria 3155
681 Ga0495641_0049821 3300046461 Bacteria 1916
682 Ga0495651_0026022 3300046462 Bacteria 4555
683 Ga0495653_0051274 3300046463 Bacteria 3168
684 Ga0495664_0050622 3300046477 Bacteria 2466
685 Ga0495594_0021958 3300046499 Bacteria 3411
686 Ga0495608_0044401 3300046511 Bacteria 2966
687 Ga0495628_0066904 3300046516 Bacteria 2807
688 Ga0495630_0086263 3300046517 Bacteria 2371
689 Ga0495652_0011829 3300046529 Bacteria 7887
690 Ga0495640_0015352 3300046533 Bacteria 5766
691 Ga0495586_0104355 3300046535 Bacteria 1575
692 Ga0495587_0012448 3300046536 Bacteria 5353
693 Ga0495645_0030035 3300046543 Bacteria 3959
694 Ga0495667_0009505 3300046559 Bacteria 6588
695 Ga0495668_0000477 3300046616 Bacteria 50176
696 Ga0495625_0000969 3300046660 Bacteria 38144
697 Ga0495635_0203978 3300046663 Bacteria 1340
698 Ga0495657_0049412 3300046675 Bacteria 2833
699 Ga0495599_0009628 3300046678 Bacteria 5913
700 Ga0495623_0093311 3300046679 Bacteria 1843
701 Ga0495646_0279973 3300046680 Bacteria 886
702 Ga0495658_0407263 3300046683 Bacteria 867
703 Ga0495669_0031349 3300046684 Bacteria 2335
704 Ga0495613_0215063 3300046689 Bacteria 1351
705 Ga0495600_0059014 3300046809 Bacteria 2506
706 Ga0495604_0043232 3300047317 Bacteria 3528
707 Ga0495674_0070041 3300047319 Bacteria 3031
708 Ga0495676_0066299 3300047321 Bacteria 2799
709 Ga0495680_0028155 3300047322 Bacteria 4609
710 Ga0495680_0473922 3300047322 Bacteria 853
711 Ga0495683_0128282 3300047323 Bacteria 1198
712 Ga0495675_0160813 3300047444 Bacteria 1383
713 Ga0495684_0015890 3300047471 Bacteria 5796
714 Ga0495602_0128972 3300048088 Bacteria 2020
715 Ga0495626_0000234 3300048091 Bacteria 65050
716 Ga0496100_0032464 3300048903 Bacteria 3257
717 Ga0496100_0277587 3300048903 Bacteria 1248
718 Ga0496101_0106525 3300048904 Bacteria 2105
719 Ga0496101_0117961 3300048904 Bacteria 2004
720 Ga0496102_0026483 3300048905 Bacteria 5173
721 Ga0496102_0055310 3300048905 Bacteria 3619
722 Ga0496103_0206255 3300048906 Bacteria 1264
723 Ga0496104_0014353 3300048907 Bacteria 7155
724 Ga0496104_0028303 3300048907 Bacteria 5194
725 Ga0496105_0000419 3300048908 Bacteria 27857
726 Ga0496105_0051856 3300048908 Bacteria 3388
727 Ga0496105_0207087 3300048908 Bacteria 1600
728 Ga0496105_0415302 3300048908 Bacteria 1066
729 Ga0496106_0017256 3300048909 Bacteria 5342
730 Ga0496106_0020477 3300048909 Bacteria 4909
731 Ga0496107_0194279 3300048910 Bacteria 1508
732 Ga0496108_0000149 3300048911 Bacteria 67412
733 Ga0496108_0016367 3300048911 Bacteria 6047
734 Ga0496108_0037214 3300048911 Bacteria 4052
735 Ga0496109_0066011 3300048912 Bacteria 3312
736 Ga0496109_0082676 3300048912 Bacteria 2960
737 Ga0496109_0168439 3300048912 Bacteria 2054
738 Ga0496109_0315005 3300048912 Bacteria 1476
739 Ga0496110_0007084 3300048913 Bacteria 8926
740 Ga0496110_0047056 3300048913 Bacteria 3775
741 Ga0496110_0126346 3300048913 Bacteria 2307
742 Ga0496110_0427477 3300048913 Bacteria 1207
743 Ga0496110_1022382 3300048913 Bacteria 734
744 Ga0496111_0008978 3300048914 Bacteria 6649
745 Ga0496112_0016085 3300048915 Bacteria 6995
746 Ga0496112_0066577 3300048915 Bacteria 3554
747 Ga0496112_0515484 3300048915 Bacteria 1130
748 Ga0496113_0007473 3300048916 Bacteria 7037
749 Ga0496113_0261756 3300048916 Bacteria 1382
750 Ga0496114_0040956 3300048917 Bacteria 3838
751 Ga0496114_0093191 3300048917 Bacteria 2561
752 Ga0496115_0069245 3300048918 Bacteria 2858
753 Ga0496115_0074109 3300048918 Bacteria 2764
754 Ga0496115_0236609 3300048918 Bacteria 1505
755 Ga0496115_0510963 3300048918 Bacteria 964
756 Ga0496119_0042137 3300048922 Bacteria 2898
757 Ga0496119_0067600 3300048922 Bacteria 2107
758 Ga0496121_0011363 3300048924 Bacteria 9897
759 Ga0496126_0012001 3300048929 Bacteria 8904
760 Ga0496126_0170916 3300048929 Bacteria 1852
761 Ga0496126_0406155 3300048929 Bacteria 1104
762 Ga0501031_0008755 3300049568 Bacteria 6583
763 Ga0501032_0000515 3300049569 Bacteria 31388
764 Ga0501033_0073236 3300049570 Bacteria 2515
765 Ga0501033_0286546 3300049570 Bacteria 1162
766 Ga0501034_0858214 3300049571 Bacteria 798
767 Ga0501036_0670269 3300049572 Bacteria 858
768 Ga0501038_0009857 3300049574 Bacteria 8742
769 Ga0501039_0113632 3300049575 Bacteria 2118
770 Ga0501043_0035771 3300049579 Bacteria 3907
771 Ga0501047_0002063 3300049581 Bacteria 19207
772 Ga0501047_0706726 3300049581 Bacteria 825
773 Ga0501048_0000162 3300049582 Bacteria 41735
774 Ga0501048_0640916 3300049582 Bacteria 763
775 Ga0501070_0028074 3300049586 Bacteria 4719
776 Ga0501071_0677535 3300049587 Bacteria 794
777 Ga0501073_0126808 3300049589 Bacteria 1769
778 Ga0501074_0611135 3300049590 Bacteria 771
779 Ga0501081_0030387 3300049743 Bacteria 3657
780 Ga0501035_0003639 3300049822 Bacteria 14701
781 Ga0501044_0014311 3300049823 Bacteria 8564
782 Ga0501044_0367579 3300049823 Bacteria 1355
783 nmdc:mga05p37_114234_c1 3300050507 Bacteria 3319
784 nmdc:mga05p37_23272_c1 3300050507 Bacteria 7515
785 nmdc:mga05p37_3122_c1 3300050507 Bacteria 19253
786 nmdc:mga05p37_403308_c1 3300050507 Bacteria 1596
787 nmdc:mga09592_218816_c1 3300050508 Bacteria 1650
788 nmdc:mga09592_310947_c1 3300050508 Bacteria 1365
789 nmdc:mga09592_65809_c1 3300050508 Bacteria 3071
790 nmdc:mga09592_686808_c1 3300050508 Bacteria 872
791 nmdc:mga09592_794_c1 3300050508 Bacteria 24428
792 nmdc:mga0qj67_184682_c1 3300050509 Bacteria 1694
793 nmdc:mga0qj67_193_c1 3300050509 Bacteria 41569
794 nmdc:mga06r32_275_c1 3300050510 Bacteria 42703
795 nmdc:mga08y16_17213_c1 3300050511 Bacteria 7608
796 nmdc:mga08y16_23121_c1 3300050511 Bacteria 6563
797 nmdc:mga08y16_36108_c1 3300050511 Bacteria 5190
798 nmdc:mga0n895_17176_c1 3300050512 Bacteria 6667
799 nmdc:mga0n895_817_c1 3300050512 Bacteria 22316
800 nmdc:mga0rr50_134000_c1 3300050513 Bacteria 1987
801 nmdc:mga0rr50_18813_c1 3300050513 Bacteria 4649
802 nmdc:mga08x19_43131_c1 3300050514 Bacteria 2878
803 nmdc:mga08x19_7720_c1 3300050514 Bacteria 6389
804 nmdc:mga0a205_115161_c1 3300050515 Bacteria 2587
805 nmdc:mga0a205_2688_c1 3300050515 Bacteria 15721
806 Ga0495601_0116582 3300053077 Bacteria 1732
807 Ga0495612_0028133 3300053078 Bacteria 2263
808 Ga0495595_0299010 3300053084 Bacteria 809
809 Ga0500644_0094970 3300053088 Bacteria 1123
810 Ga0500644_0181320 3300053088 Bacteria 862
811 Ga0500646_0113347 3300053090 Bacteria 864
812 Ga0500651_0075899 3300053093 Bacteria 2088
813 Ga0500650_0046332 3300053098 Bacteria 2015
814 Ga0500556_0149814 3300053104 Bacteria 919
815 Ga0500569_013798 3300053109 Bacteria 1987
816 Ga0500569_041536 3300053109 Bacteria 1350
817 Ga0500594_0005937 3300053118 Bacteria 2723
818 Ga0500652_047732 3300053131 Bacteria 1741
819 Ga0500622_0343434 3300053156 Bacteria 622
820 Ga0500630_041869 3300053159 Bacteria 2235
821 Ga0500611_065971 3300053727 Bacteria 870
822 Ga0466962_0004333 3300061719 Bacteria 6804
823 Ga0466962_0024358 3300061719 Bacteria 2907
824 Ga0466962_0027031 3300061719 Bacteria 2755
825 Ga0466962_0037854 3300061719 Bacteria 2311
826 Ga0466962_0110891 3300061719 Bacteria 1321
827 Ga0466962_0277431 3300061719 Bacteria 827
828 2501942795 2501939600 Bacteria 6907073
829 2515494886 2515154088 Bacteria 5526283
830 2515718890 2515154129 Bacteria 5584369
831 2515755549 2515154137 Bacteria 5711575
832 2516083102 2515154202 Bacteria 5471270
833 2516090188 2515154203 Bacteria 5458536
834 2623587992 2622736626 Bacteria 7181580
835 2676487071 2675903059 Bacteria 8644972
836 2753268965 2751185782 Bacteria 11227053
837 2772643624 2772190715 Bacteria 6959372
838 2831936637 2831935698 Bacteria 5963223
839 2832008509 2832004796 Bacteria 6538017
840 2855675206 2855670206 Bacteria 7120389
841 2855681985 2855676851 Bacteria 7063653
842 2856862019 2856858025 Bacteria 7255264
843 2857289216 2857288857 Bacteria 7189066
844 2858850038 2858848962 Bacteria 6963058
845 2858873548 2858868258 Bacteria 7683772
846 2858883450 2858882152 Bacteria 7230291
847 2858891941 2858888857 Bacteria 7060307
848 2858899370 2858895516 Bacteria 7378898
849 2858907812 2858902515 Bacteria 7086037
850 2866065300 2866065130 Bacteria 6518152
851 2867307810 2867302475 Bacteria 7087181
852 2867319125 2867312974 Bacteria 7058875
853 2867320130 2867319477 Bacteria 7069771
854 2867508613 2867507094 Bacteria 6506033
855 2869049124 2869048445 Bacteria 6875584
856 2869067980 2869061728 Bacteria 7112407
857 2869073409 2869068681 Bacteria 7205615
858 2880492067 2880489317 Bacteria 7096270
859 2880500231 2880495981 Bacteria 7340502
860 2887486833 2887478801 Bacteria 8972725
861 2902586685 2902582711 Bacteria 6187705
862 2929228782 2929226422 Bacteria 7248583
863 2996227947 2996221748 Bacteria 6799777
864 649812619 649633069 Bacteria 6962533
865 8001786839 8001781756 Bacteria 9586736
866 8003833900 8003830390 Bacteria 6541657
867 8003877391 8003870546 Bacteria 7396674
868 8054707130 8054704163 Bacteria 7247792
869 8054731783 8054727385 Bacteria 7558670
870 8054738929 8054734606 Bacteria 6947278
871 8057568556 8057568493 Bacteria 7221719
872 Ga0207647_10055132
873 JGI24752J21851_1007691
874 JGI24737J22298_10140561
875 JGI24743J22301_10013365
876 Ga0070658_10004108
877 Ga0070658_10007218
878 Ga0070658_10034494
879 Ga0070658_10045665
880 Ga0070658_10094025
881 Ga0070676_10018940
882 Ga0070676_10041823
883 Ga0070676_10067118
884 Ga0070683_100022848
885 Ga0070683_100331578
886 Ga0070683_100389617
887 Ga0070683_100625139
888 Ga0070683_101031459
889 Ga0070690_100142339
890 Ga0070670_100001599
891 Ga0070670_100030363
892 Ga0068869_100002346
893 Ga0068869_100009523
894 Ga0068869_100020146
895 Ga0068869_100107729
896 Ga0068869_100706463
897 Ga0070666_10072372
898 Ga0070680_100026701
899 Ga0070680_100044687
900 Ga0070680_100116716
901 Ga0070680_100117095
902 Ga0070680_100218692
903 Ga0070680_100296846
904 Ga0070682_100001498
905 Ga0070682_100017404
906 Ga0068868_100003533
907 Ga0068868_100039320
908 Ga0068868_100043967
909 Ga0070660_100037288
910 Ga0070660_100065551
911 Ga0070660_100079237
912 Ga0070660_100238247
913 Ga0070660_100418678
914 Ga0070689_100046920
915 Ga0070689_100786756
916 Ga0070689_101083404
917 Ga0070691_10012601
918 Ga0070691_10024547
919 Ga0070691_10266132
920 Ga0070661_100006318
921 Ga0070661_100014991
922 Ga0070692_10017484
923 Ga0070692_10054129
924 Ga0070692_10229753
925 Ga0070668_100003772
926 Ga0070668_100819008
927 Ga0070668_101180683
928 Ga0070669_100338303
929 Ga0070675_100009094
930 Ga0070675_100010560
931 Ga0070675_100011908
932 Ga0070675_100852218
933 Ga0070671_100002713
934 Ga0070671_100026821
935 Ga0070671_100333584
936 Ga0070673_100059250
937 Ga0070673_100247476
938 Ga0070659_100000619
939 Ga0070659_100047992
940 Ga0070659_100285251
941 Ga0070659_100292158
942 Ga0070659_100296848
943 Ga0070709_10089432
944 Ga0070709_10261928
945 Ga0070714_100022172
946 Ga0070714_100058439
947 Ga0070714_100059168
948 Ga0070714_100244639
949 Ga0070713_100007535
950 Ga0070713_100009883
951 Ga0070713_100012018
952 Ga0070713_100054431
953 Ga0070713_100139405
954 Ga0070713_100404284
955 Ga0070713_100422604
956 Ga0070713_100693965
957 Ga0070713_100737038
958 Ga0070710_10015850
959 Ga0070711_100232973
960 Ga0070708_100262332
961 Ga0070663_100003535
962 Ga0070663_100018807
963 Ga0070663_100025083
964 Ga0070663_100154621
965 Ga0070678_100012017
966 Ga0070678_100027089
967 Ga0070662_100004777
968 Ga0070681_10027526
969 Ga0070681_10040253
970 Ga0070681_10144931
971 Ga0070681_10200375
972 Ga0070685_10230521
973 Ga0070698_100007787
974 Ga0070679_100027848
975 Ga0070679_100039513
976 Ga0070679_100175965
977 Ga0070679_100279840
978 Ga0070679_100302185
979 Ga0070684_100004536
980 Ga0070684_100022936
981 Ga0070684_100202129
982 Ga0070684_100268632
983 Ga0070684_100631548
984 Ga0068853_100093781
985 Ga0070672_100319326
986 Ga0070686_100097288
987 Ga0070686_100168396
988 Ga0070693_100046882
989 Ga0070693_100067949
990 Ga0070693_100175460
991 Ga0070665_100040551
992 Ga0070665_100111833
993 Ga0070665_100488888
994 Ga0070665_100584623
995 Ga0068855_100035399
996 Ga0068855_100063345
997 Ga0068855_100274977
998 Ga0068855_100388553
999 Ga0068855_100389668
1000 Ga0068855_100446897
1001 Ga0070664_100010112
1002 Ga0070664_100286852
1003 Ga0070664_100630291
1004 Ga0068857_100028443
1005 Ga0068857_100226797
1006 Ga0068857_100716398
1007 Ga0068854_100028810
1008 Ga0068854_100033242
1009 Ga0068856_100021030
1010 Ga0068856_100120372
1011 Ga0068856_100218007
1012 Ga0068856_100428211
1013 Ga0068856_100579024
1014 Ga0068856_100796674
1015 Ga0070702_100000171
1016 Ga0070702_100019326
1017 Ga0068852_100022896
1018 Ga0068852_100049930
1019 Ga0068859_100035566
1020 Ga0068859_100061735
1021 Ga0068859_101766751
1022 Ga0068864_100017115
1023 Ga0068864_100057896
1024 Ga0068864_100126761
1025 Ga0068861_100514410
1026 Ga0068861_100630011
1027 Ga0068851_10014261
1028 Ga0068870_10000071
1029 Ga0068870_10000371
1030 Ga0068863_100003726
1031 Ga0068863_100006202
1032 Ga0068863_100031033
1033 Ga0068863_100236320
1034 Ga0068858_100003961
1035 Ga0068858_100017430
1036 Ga0068858_100107503
1037 Ga0068858_100304478
1038 Ga0068860_100096313
1039 Ga0068862_100016202
1040 Ga0068862_100085630
1041 Ga0068862_100556443
1042 Ga0068862_101129028
1043 Ga0081540_1002336
1044 Ga0081540_1163080
1045 Ga0081540_1169948
1046 Ga0081539_10004135
1047 Ga0081539_10008632
1048 Ga0081539_10010950
1049 Ga0081539_10016044
1050 Ga0081539_10098252
1051 Ga0070717_10144823
1052 Ga0070717_10606028
1053 Ga0070716_100749409
1054 Ga0070712_100028718
1055 Ga0070712_100147470
1056 Ga0070712_100291114
1057 Ga0097621_100063494
1058 Ga0097621_100644023
1059 Ga0097621_100866122
1060 Ga0068871_100100812
1061 Ga0075428_100004276
1062 Ga0075428_100060342
1063 Ga0075428_100135071
1064 Ga0075428_100151360
1065 Ga0075428_100232463
1066 Ga0075430_100035603
1067 Ga0075430_100195361
1068 Ga0075431_100003257
1069 Ga0075431_100396024
1070 Ga0075431_100402127
1071 Ga0075433_10004022
1072 Ga0075433_10097647
1073 Ga0075434_100001779
1074 Ga0075434_100010778
1075 Ga0075429_100000244
1076 Ga0075429_100036349
1077 Ga0075429_100037400
1078 Ga0075429_100314559
1079 Ga0068865_100190093
1080 Ga0075436_100009808
1081 Ga0075436_100017369
1082 Ga0097620_100035566
1083 Ga0097620_100061733
1084 Ga0097620_101766407
1085 Ga0075435_100004529
1086 Ga0075435_100011752
1087 Ga0105251_10017112
1088 Ga0105244_10164505
1089 Ga0105240_10045960
1090 Ga0105240_10121183
1091 Ga0105240_10125769
1092 Ga0105240_11746079
1093 Ga0111539_10025523
1094 Ga0111539_10308872
1095 Ga0111539_11980312
1096 Ga0105245_10021743
1097 Ga0105245_10045369
1098 Ga0105245_10207857
1099 Ga0105245_10328942
1100 Ga0105245_11219362
1101 Ga0105247_10000578
1102 Ga0105247_10009301
1103 Ga0105247_10015202
1104 Ga0105247_10439378
1105 Ga0114129_10000723
1106 Ga0114129_10053320
1107 Ga0114129_10129285
1108 Ga0114129_10635809
1109 Ga0114129_11436832
1110 Ga0105243_10208195
1111 Ga0105243_10332423
1112 Ga0105241_10004726
1113 Ga0105241_10087958
1114 Ga0105248_10045442
1115 Ga0105248_10244302
1116 Ga0105237_10048028
1117 Ga0105237_10160031
1118 Ga0105237_10450282
1119 Ga0105237_10451993
1120 Ga0105237_10532733
1121 Ga0105237_11142597
1122 Ga0105238_10056000
1123 Ga0105238_10128092
1124 Ga0105238_10181055
1125 Ga0105238_10366559
1126 Ga0105249_10280513
1127 Ga0105239_10098213
1128 Ga0105239_10216350
1129 Ga0105239_10272814
1130 Ga0105239_10997353
1131 Ga0105239_11052466
1132 Ga0105239_12289298
1133 Ga0105246_10000293
1134 Ga0105246_10000478
1135 Ga0105246_10649315
1136 Ga0157373_10148071
1137 Ga0157373_10203843
1138 Ga0157371_10046257
1139 Ga0157371_10052250
1140 Ga0157371_10065918
1141 Ga0157371_10236099
1142 Ga0157370_10021623
1143 Ga0157370_10036347
1144 Ga0157370_10295791
1145 Ga0157370_10361586
1146 Ga0157370_10805028
1147 Ga0157369_10004575
1148 Ga0157369_10004788
1149 Ga0157369_10024369
1150 Ga0157369_10071305
1151 Ga0157369_10071634
1152 Ga0157369_10135433
1153 Ga0157369_10147048
1154 Ga0157369_10247304
1155 Ga0157369_10608713
1156 Ga0157369_10713360
1157 Ga0157369_10768854
1158 Ga0157374_10051088
1159 Ga0157374_10075075
1160 Ga0157374_10642813
1161 Ga0163162_10265665
1162 Ga0163162_10463406
1163 Ga0157375_10016266
1164 Ga0157375_10385333
1165 Ga0163163_10059376
1166 Ga0163163_10083601
1167 Ga0163163_10138016
1168 Ga0163163_10314691
1169 Ga0163163_10667284
1170 Ga0157380_10117386
1171 Ga0182008_10330389
1172 Ga0182008_10362009
1173 Ga0157377_10064788
1174 Ga0157377_10068681
1175 Ga0157377_10626577
1176 Ga0157379_10000076
1177 Ga0157379_10088446
1178 Ga0157379_10092231
1179 Ga0157376_10249267
1180 Ga0157376_10263866
1181 Ga0157376_11064481
1182 Ga0163161_10702572
1183 Ga0197907_11071090
1184 Ga0206356_10034341
1185 Ga0206355_1226558
1186 Ga0206351_10259414
1187 Ga0206354_10516870
1188 Ga0206354_10545188
1189 Ga0206354_10624629
1190 Ga0206353_10343003
1191 Ga0206353_10403903
1192 Ga0206353_10614142
1193 Ga0206353_10624157
1194 Ga0206353_11253613
1195 Ga0213874_10037177
1196 Ga0213876_10001219
1197 Ga0213875_10096770
1198 Ga0224712_10081991
1199 Ga0224712_10088256
1200 Ga0224712_10104348
1201 Ga0224712_10135716
1202 Ga0224712_10318589
1203 Ga0207656_10006329
1204 Ga0207656_10018219
1205 Ga0207713_1064019
1206 Ga0207692_10068602
1207 Ga0207642_10171968
1208 Ga0207710_10000023
1209 Ga0207710_10018127
1210 Ga0207710_10020248
1211 Ga0207688_10012543
1212 Ga0207688_10036476
1213 Ga0207688_10218527
1214 Ga0207680_10296976
1215 Ga0207647_10064296
1216 Ga0207647_10141142
1217 Ga0207647_10141341
1218 Ga0207685_10011482
1219 Ga0207699_10011845
1220 Ga0207699_10022015
1221 Ga0207699_10057501
1222 Ga0207699_10552288
1223 Ga0207645_10047739
1224 Ga0207645_10101305
1225 Ga0207643_10000022
1226 Ga0207643_10000102
1227 Ga0207705_10000595
1228 Ga0207705_10011904
1229 Ga0207705_10037678
1230 Ga0207705_10050136
1231 Ga0207705_10412011
1232 Ga0207684_10445923
1233 Ga0207654_10294600
1234 Ga0207707_10015744
1235 Ga0207707_10058525
1236 Ga0207707_10070314
1237 Ga0207707_10229764
1238 Ga0207707_10448486
1239 Ga0207695_10513805
1240 Ga0207695_11230478
1241 Ga0207671_10023017
1242 Ga0207693_10006163
1243 Ga0207693_10021091
1244 Ga0207693_10496861
1245 Ga0207663_10866481
1246 Ga0207660_10027222
1247 Ga0207660_10047641
1248 Ga0207660_10150580
1249 Ga0207657_10043599
1250 Ga0207657_10051901
1251 Ga0207657_10092164
1252 Ga0207657_10179941
1253 Ga0207657_10555313
1254 Ga0207649_10015181
1255 Ga0207649_10039068
1256 Ga0207649_10258329
1257 Ga0207652_10032827
1258 Ga0207652_10218502
1259 Ga0207652_10240194
1260 Ga0207652_10306968
1261 Ga0207652_10342206
1262 Ga0207652_10454319
1263 Ga0207681_10912205
1264 Ga0207694_10076256
1265 Ga0207694_10845073
1266 Ga0207650_10017555
1267 Ga0207650_10019927
1268 Ga0207659_10005909
1269 Ga0207659_10033050
1270 Ga0207659_10162960
1271 Ga0207687_10003225
1272 Ga0207687_10010510
1273 Ga0207687_10128449
1274 Ga0207687_10229509
1275 Ga0207700_10009719
1276 Ga0207700_10035764
1277 Ga0207700_10046521
1278 Ga0207700_10095334
1279 Ga0207700_10098357
1280 Ga0207700_10118142
1281 Ga0207700_10385742
1282 Ga0207700_10783375
1283 Ga0207664_10001757
1284 Ga0207664_10039091
1285 Ga0207664_10116066
1286 Ga0207664_10226503
1287 Ga0207664_10261864
1288 Ga0207664_10347810
1289 Ga0207664_10396591
1290 Ga0207644_10008498
1291 Ga0207644_10156128
1292 Ga0207690_10000575
1293 Ga0207690_10008450
1294 Ga0207690_10404635
1295 Ga0207690_10588759
1296 Ga0207690_10712280
1297 Ga0207706_10005138
1298 Ga0207709_10807725
1299 Ga0207670_10012052
1300 Ga0207665_10094970
1301 Ga0207691_10015226
1302 Ga0207691_10111426
1303 Ga0207711_10384542
1304 Ga0207711_10477324
1305 Ga0207689_10001185
1306 Ga0207689_10003272
1307 Ga0207689_10005316
1308 Ga0207689_10133476
1309 Ga0207689_10499310
1310 Ga0207661_10002483
1311 Ga0207661_10010323
1312 Ga0207661_10244144
1313 Ga0207661_10253248
1314 Ga0207661_10287846
1315 Ga0207661_10742332
1316 Ga0207679_10019242
1317 Ga0207679_10023587
1318 Ga0207679_10071691
1319 Ga0207679_10297411
1320 Ga0207667_10017863
1321 Ga0207667_10270394
1322 Ga0207651_10040032
1323 Ga0207651_10092859
1324 Ga0207668_10001583
1325 Ga0207668_10584755
1326 Ga0207640_10011075
1327 Ga0207640_10070703
1328 Ga0207658_10061354
1329 Ga0207658_10075097
1330 Ga0207677_10029651
1331 Ga0207677_10038111
1332 Ga0207677_10175092
1333 Ga0207703_10000003
1334 Ga0207703_10087459
1335 Ga0207703_10320078
1336 Ga0207639_10163771
1337 Ga0207639_10629992
1338 Ga0207678_10000141
1339 Ga0207678_10001333
1340 Ga0207678_10004168
1341 Ga0207678_10059214
1342 Ga0207678_10064609
1343 Ga0207678_10084789
1344 Ga0207678_10543241
1345 Ga0207708_10015814
1346 Ga0207708_10064175
1347 Ga0207702_10000567
1348 Ga0207702_10006389
1349 Ga0207702_10064519
1350 Ga0207702_10297173
1351 Ga0207702_10485094
1352 Ga0207641_10008900
1353 Ga0207641_10033796
1354 Ga0207676_10000814
1355 Ga0207676_10000974
1356 Ga0207676_10685772
1357 Ga0207674_10013397
1358 Ga0207674_10032237
1359 Ga0207674_10784124
1360 Ga0207675_100141707
1361 Ga0207675_100231589
1362 Ga0207675_100599876
1363 Ga0207683_10000171
1364 Ga0207683_10002042
1365 Ga0207683_10180428
1366 Ga0207683_10562757
1367 Ga0207698_10038926
1368 Ga0207698_10109663
1369 Ga0207698_10140302
1370 Ga0207698_10373447
1371 Ga0207698_10628340
1372 Ga0207428_10031502
1373 Ga0207428_10063708
1374 Ga0268266_10025102
1375 Ga0268266_10026732
1376 Ga0268266_10110251
1377 Ga0268266_10431383
1378 Ga0268265_10055749
1379 Ga0268265_10069153
1380 Ga0265338_10008011
1381 Ga0265338_10079175
1382 Ga0307512_10034068
1383 Ga0307512_10126895
1384 Ga0265773_1017838
1385 Ga0307513_10005579
1386 Ga0307513_10030700
1387 Ga0307513_10086372
1388 Ga0307513_10481890
1389 Ga0307509_10007679
1390 Ga0307509_10442742
1391 Ga0307508_10005865
1392 Ga0307508_10037730
1393 Ga0307508_10237079
1394 Ga0307516_10000395
1395 Ga0307516_10080920
1396 Ga0307405_10043892
1397 Ga0307405_10093648
1398 Ga0307405_10488112
1399 Ga0307413_10124339
1400 Ga0326468_10000491
1401 Ga0307406_10069281
1402 Ga0307406_10839138
1403 Ga0307406_11014703
1404 Ga0307407_10070006
1405 Ga0307407_10232393
1406 Ga0307412_10080851
1407 Ga0307409_100289009
1408 Ga0307409_100636361
1409 Ga0307409_101080364
1410 Ga0307416_100035028
1411 Ga0307416_100735879
1412 Ga0307416_101718006
1413 Ga0307411_10334682
1414 Ga0307415_100049996
1415 Ga0307415_100136742
1416 Ga0307415_100457012
1417 Ga0307415_100550923
1418 Ga0307415_100588348
1419 Ga0307415_100663056
1420 Ga0307507_10015989
1421 Ga0307510_10092101
1422 Ga0373923_0009629
1423 Ga0373932_0050899
1424 Ga0373953_0136844
1425 Ga0373956_0003862
1426 Ga0373957_0002593
1427 Ga0373946_0062274
1428 Ga0373955_0019462
1429 Ga0373942_0000028
1430 Ga0373924_0033184
1431 Ga0373931_0143873
1432 Ga0373931_0422240
1433 Ga0373931_0551225
1434 Ga0373935_0008810
1435 Ga0373935_0068108
1436 Ga0373933_0003332
1437 Ga0373947_0112790
1438 Ga0373947_0285097
1439 Ga0372808_016503
1440 Ga0373925_0000010
1441 Ga0373925_0398061
1442 Ga0395899_0072246
1443 Ga0395900_0003750
1444 Ga0395900_0791069
1445 Ga0395898_0129786
1446 Ga0395898_0163422
1447 Ga0395898_0534207
1448 Ga0395905_0001026
1449 Ga0395905_0296375
1450 Ga0395905_0364611
1451 Ga0436364_1458938
1452 Ga0395901_0004693
1453 Ga0395901_0007057
1454 Ga0395901_0253127
1455 Ga0395901_0549152
1456 Ga0436365_0093685
1457 Ga0436365_0676582
1458 Ga0436363_1466024
1459 Ga0436362_0116484
1460 Ga0451791_1528709
1461 Ga0451843_0032912
1462 Ga0451853_1832670
1463 Ga0439448_0030051
1464 Ga0439448_0137468
1465 Ga0439450_054604
1466 Ga0439455_0027923
1467 Ga0439455_0040089
1468 Ga0450905_014361
1469 Ga0439459_0004962
1470 Ga0439464_0184085
1471 Ga0439464_0196136
1472 Ga0439460_0124636
1473 Ga0466969_0014966
1474 Ga0466969_0162121
1475 Ga0466972_0430287
1476 Ga0466965_0047569
1477 Ga0466965_0127189
1478 Ga0466965_0249524
1479 Ga0466965_0425797
1480 Ga0466966_0006104
1481 Ga0466966_0035166
1482 Ga0466966_0036693
1483 Ga0466966_0131742
1484 Ga0466966_0165110
1485 Ga0466966_0165275
1486 Ga0466961_0005917
1487 Ga0466961_0100722
1488 Ga0466961_0108554
1489 Ga0466961_0190930
1490 Ga0466961_0282980
1491 Ga0466961_0348220
1492 Ga0466961_0392559
1493 Ga0466963_0027413
1494 Ga0466963_0068417
1495 Ga0466963_0073346
1496 Ga0466963_0076717
1497 Ga0466963_0116103
1498 Ga0466963_0122969
1499 Ga0466963_0127240
1500 Ga0466963_0135895
1501 Ga0466963_0167966
1502 Ga0466963_0412957
1503 Ga0466963_0537745
1504 Ga0466963_0579013
1505 Ga0466964_0008863
1506 Ga0466964_0150365
1507 Ga0466964_0275540
1508 Ga0466971_0019249
1509 Ga0466971_0054142
1510 Ga0466971_0099279
1511 Ga0466970_0003376
1512 Ga0466970_0075910
1513 Ga0466970_0078835
1514 Ga0466970_0245314
1515 Ga0466970_0491867
1516 Ga0466970_0709195
1517 Ga0466957_0002757
1518 Ga0466957_0052638
1519 Ga0466957_0065992
1520 Ga0466957_0172904
1521 Ga0466957_0261510
1522 Ga0466957_0376739
1523 Ga0466957_0888633
1524 Ga0466960_0060434
1525 Ga0466960_0280592
1526 Ga0466960_0659355
1527 Ga0466959_0006200
1528 Ga0466959_0011536
1529 Ga0466959_0050084
1530 Ga0466959_0097800
1531 Ga0466959_0184811
1532 Ga0466959_0208389
1533 Ga0466959_0588687
1534 Ga0466959_0626130
1535 Ga0466958_0005392
1536 Ga0466958_0022838
1537 Ga0466958_0024961
1538 Ga0466958_0054647
1539 Ga0466958_0122227
1540 Ga0466958_0201199
1541 Ga0466967_0009511
1542 Ga0466967_0009954
1543 Ga0466967_0055695
1544 Ga0466967_0056816
1545 Ga0466967_0223613
1546 Ga0466967_0253267
1547 Ga0466967_0275470
1548 Ga0466967_0568258
1549 Ga0466967_0614735
1550 Ga0466967_0832340
1551 Ga0495592_0048601
1552 Ga0495641_0049821
1553 Ga0495651_0026022
1554 Ga0495653_0051274
1555 Ga0495664_0050622
1556 Ga0495594_0021958
1557 Ga0495608_0044401
1558 Ga0495628_0066904
1559 Ga0495630_0086263
1560 Ga0495652_0011829
1561 Ga0495640_0015352
1562 Ga0495586_0104355
1563 Ga0495587_0012448
1564 Ga0495645_0030035
1565 Ga0495667_0009505
1566 Ga0495668_0000477
1567 Ga0495625_0000969
1568 Ga0495635_0203978
1569 Ga0495657_0049412
1570 Ga0495599_0009628
1571 Ga0495623_0093311
1572 Ga0495646_0279973
1573 Ga0495658_0407263
1574 Ga0495669_0031349
1575 Ga0495613_0215063
1576 Ga0495600_0059014
1577 Ga0495604_0043232
1578 Ga0495674_0070041
1579 Ga0495676_0066299
1580 Ga0495680_0028155
1581 Ga0495680_0473922
1582 Ga0495683_0128282
1583 Ga0495675_0160813
1584 Ga0495684_0015890
1585 Ga0495602_0128972
1586 Ga0495626_0000234
1587 Ga0496100_0032464
1588 Ga0496100_0277587
1589 Ga0496101_0106525
1590 Ga0496101_0117961
1591 Ga0496102_0026483
1592 Ga0496102_0055310
1593 Ga0496103_0206255
1594 Ga0496104_0014353
1595 Ga0496104_0028303
1596 Ga0496105_0000419
1597 Ga0496105_0051856
1598 Ga0496105_0207087
1599 Ga0496105_0415302
1600 Ga0496106_0017256
1601 Ga0496106_0020477
1602 Ga0496107_0194279
1603 Ga0496108_0000149
1604 Ga0496108_0016367
1605 Ga0496108_0037214
1606 Ga0496109_0066011
1607 Ga0496109_0082676
1608 Ga0496109_0168439
1609 Ga0496109_0315005
1610 Ga0496110_0007084
1611 Ga0496110_0047056
1612 Ga0496110_0126346
1613 Ga0496110_0427477
1614 Ga0496110_1022382
1615 Ga0496111_0008978
1616 Ga0496112_0016085
1617 Ga0496112_0066577
1618 Ga0496112_0515484
1619 Ga0496113_0007473
1620 Ga0496113_0261756
1621 Ga0496114_0040956
1622 Ga0496114_0093191
1623 Ga0496115_0069245
1624 Ga0496115_0074109
1625 Ga0496115_0236609
1626 Ga0496115_0510963
1627 Ga0496119_0042137
1628 Ga0496119_0067600
1629 Ga0496121_0011363
1630 Ga0496126_0012001
1631 Ga0496126_0170916
1632 Ga0496126_0406155
1633 Ga0501031_0008755
1634 Ga0501032_0000515
1635 Ga0501033_0073236
1636 Ga0501033_0286546
1637 Ga0501034_0858214
1638 Ga0501036_0670269
1639 Ga0501038_0009857
1640 Ga0501039_0113632
1641 Ga0501043_0035771
1642 Ga0501047_0002063
1643 Ga0501047_0706726
1644 Ga0501048_0000162
1645 Ga0501048_0640916
1646 Ga0501070_0028074
1647 Ga0501071_0677535
1648 Ga0501073_0126808
1649 Ga0501074_0611135
1650 Ga0501081_0030387
1651 Ga0501035_0003639
1652 Ga0501044_0014311
1653 Ga0501044_0367579
1654 nmdc:mga05p37_114234_c1
1655 nmdc:mga05p37_23272_c1
1656 nmdc:mga05p37_3122_c1
1657 nmdc:mga05p37_403308_c1
1658 nmdc:mga09592_218816_c1
1659 nmdc:mga09592_310947_c1
1660 nmdc:mga09592_65809_c1
1661 nmdc:mga09592_686808_c1
1662 nmdc:mga09592_794_c1
1663 nmdc:mga0qj67_184682_c1
1664 nmdc:mga0qj67_193_c1
1665 nmdc:mga06r32_275_c1
1666 nmdc:mga08y16_17213_c1
1667 nmdc:mga08y16_23121_c1
1668 nmdc:mga08y16_36108_c1
1669 nmdc:mga0n895_17176_c1
1670 nmdc:mga0n895_817_c1
1671 nmdc:mga0rr50_134000_c1
1672 nmdc:mga0rr50_18813_c1
1673 nmdc:mga08x19_43131_c1
1674 nmdc:mga08x19_7720_c1
1675 nmdc:mga0a205_115161_c1
1676 nmdc:mga0a205_2688_c1
1677 Ga0495601_0116582
1678 Ga0495612_0028133
1679 Ga0495595_0299010
1680 Ga0500644_0094970
1681 Ga0500644_0181320
1682 Ga0500646_0113347
1683 Ga0500651_0075899
1684 Ga0500650_0046332
1685 Ga0500556_0149814
1686 Ga0500569_013798
1687 Ga0500569_041536
1688 Ga0500594_0005937
1689 Ga0500652_047732
1690 Ga0500622_0343434
1691 Ga0500630_041869
1692 Ga0500611_065971
1693 Ga0466962_0004333
1694 Ga0466962_0024358
1695 Ga0466962_0027031
1696 Ga0466962_0037854
1697 Ga0466962_0110891
1698 Ga0466962_0277431
1699 2501942795
1700 2515494886
1701 2515718890
1702 2515755549
1703 2516083102
1704 2516090188
1705 2623587992
1706 2676487071
1707 2753268965
1708 2772643624
1709 2831936637
1710 2832008509
1711 2855675206
1712 2855681985
1713 2856862019
1714 2857289216
1715 2858850038
1716 2858873548
1717 2858883450
1718 2858891941
1719 2858899370
1720 2858907812
1721 2866065300
1722 2867307810
1723 2867319125
1724 2867320130
1725 2867508613
1726 2869049124
1727 2869067980
1728 2869073409
1729 2880492067
1730 2880500231
1731 2887486833
1732 2902586685
1733 2929228782
1734 2996227947
1735 649812619
1736 8001786839
1737 8003833900
1738 8003877391
1739 8054707130
1740 8054731783
1741 8054738929
1742 8057568556

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

44

193

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vcp-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9639 3 147
5vcp-assembly2.cif.gz_B crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9636 3 147
5vcp-assembly2.cif.gz_D crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9616 2 147
5vcp-assembly1.cif.gz_C crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.961 3 147
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.961 1 147
ID Description Score Start End Superfamily
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9639 3 147 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9606 1 147 3.90.45.10
af_Q9VGY2_49_232_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9555 6 149 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9542 1 147 3.90.45.10
af_Q2G265_1_160_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9539 1 147 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A199ASU5-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9878 1 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A370IB39-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9834 1 162 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A4Q3ABE0-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9819 6 131 GO:0042586
GO:0043686
AF-A0A7T0KCZ2-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9816 1 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A4U3M4C0-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9783 2 155 GO:0006412
GO:0042586
GO:0046872

Map