F484185
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 383 | 1742 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300025904|Ga0207647_10055132|Ga0207647_100551322 |
| Length | 221 |
| Sequence | LTPEIAPETVVHFCQPPVTGTVTFPSRGPDGPSSRSLDWGVVTVQPIRLFGDPVLRTPAEPVIDFDKELRTLVADLAETMLEAPGQGLAAPQIGVGLRVFTYHVHDSMSGHLINPVLHFPDDEQQDGPEGCLSIPGMSFDCRRRANVVAHGQNMYGDPITVEGTAMLARCIQHETDHLDGVLFVDRLDAETRKAAMRAIRDAPWADRANPTIKVSPHGSAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 110 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 116 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 180 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 182 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 183 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 184 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 196 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 225 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 226 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 227 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 228 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 229 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 230 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 231 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 232 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 235 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 236 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 237 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 238 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 239 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 297 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 298 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 299 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 330 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 331 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 332 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 334 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 335 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 336 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 337 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 338 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 339 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 340 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 341 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 342 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 343 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 344 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 345 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 346 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 347 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 348 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 349 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 350 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 351 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 352 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 353 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 354 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 355 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 356 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 357 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 358 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 359 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 360 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 361 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 362 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 363 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 364 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 365 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 366 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 367 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 368 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 369 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 370 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 371 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 372 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 373 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 374 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 375 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 376 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 377 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 378 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 379 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 380 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 381 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 382 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 383 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.77 |
| Metatranscriptomes | 2.18 |
| Isolates | 5.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.49 |
| Nodule | 0.57 |
| Rhizoplane | 4.71 |
| Rhizosphere | 86.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207647_10055132 | 3300025904 | Bacteria | 2443 |
| 2 | JGI24752J21851_1007691 | 3300001976 | Bacteria | 1406 |
| 3 | JGI24737J22298_10140561 | 3300001990 | Bacteria | 713 |
| 4 | JGI24743J22301_10013365 | 3300001991 | Bacteria | 1503 |
| 5 | Ga0070658_10004108 | 3300005327 | Bacteria | 11931 |
| 6 | Ga0070658_10007218 | 3300005327 | Bacteria | 8968 |
| 7 | Ga0070658_10034494 | 3300005327 | Bacteria | 4071 |
| 8 | Ga0070658_10045665 | 3300005327 | Bacteria | 3542 |
| 9 | Ga0070658_10094025 | 3300005327 | Bacteria | 2473 |
| 10 | Ga0070676_10018940 | 3300005328 | Bacteria | 3823 |
| 11 | Ga0070676_10041823 | 3300005328 | Bacteria | 2659 |
| 12 | Ga0070676_10067118 | 3300005328 | Bacteria | 2144 |
| 13 | Ga0070683_100022848 | 3300005329 | Bacteria | 5594 |
| 14 | Ga0070683_100331578 | 3300005329 | Bacteria | 1448 |
| 15 | Ga0070683_100389617 | 3300005329 | Bacteria | 1328 |
| 16 | Ga0070683_100625139 | 3300005329 | Bacteria | 1031 |
| 17 | Ga0070683_101031459 | 3300005329 | Bacteria | 790 |
| 18 | Ga0070690_100142339 | 3300005330 | Bacteria | 1629 |
| 19 | Ga0070670_100001599 | 3300005331 | Bacteria | 18296 |
| 20 | Ga0070670_100030363 | 3300005331 | Bacteria | 4654 |
| 21 | Ga0068869_100002346 | 3300005334 | Bacteria | 11391 |
| 22 | Ga0068869_100009523 | 3300005334 | Bacteria | 6304 |
| 23 | Ga0068869_100020146 | 3300005334 | Bacteria | 4568 |
| 24 | Ga0068869_100107729 | 3300005334 | Bacteria | 2116 |
| 25 | Ga0068869_100706463 | 3300005334 | Bacteria | 860 |
| 26 | Ga0070666_10072372 | 3300005335 | Bacteria | 2347 |
| 27 | Ga0070680_100026701 | 3300005336 | Bacteria | 4618 |
| 28 | Ga0070680_100044687 | 3300005336 | Bacteria | 3600 |
| 29 | Ga0070680_100116716 | 3300005336 | Bacteria | 2225 |
| 30 | Ga0070680_100117095 | 3300005336 | Bacteria | 2221 |
| 31 | Ga0070680_100218692 | 3300005336 | Bacteria | 1607 |
| 32 | Ga0070680_100296846 | 3300005336 | Bacteria | 1370 |
| 33 | Ga0070682_100001498 | 3300005337 | Bacteria | 13088 |
| 34 | Ga0070682_100017404 | 3300005337 | Bacteria | 4190 |
| 35 | Ga0068868_100003533 | 3300005338 | Bacteria | 10891 |
| 36 | Ga0068868_100039320 | 3300005338 | Bacteria | 3676 |
| 37 | Ga0068868_100043967 | 3300005338 | Bacteria | 3490 |
| 38 | Ga0070660_100037288 | 3300005339 | Bacteria | 3685 |
| 39 | Ga0070660_100065551 | 3300005339 | Bacteria | 2827 |
| 40 | Ga0070660_100079237 | 3300005339 | Bacteria | 2577 |
| 41 | Ga0070660_100238247 | 3300005339 | Bacteria | 1481 |
| 42 | Ga0070660_100418678 | 3300005339 | Bacteria | 1109 |
| 43 | Ga0070689_100046920 | 3300005340 | Bacteria | 3330 |
| 44 | Ga0070689_100786756 | 3300005340 | Bacteria | 836 |
| 45 | Ga0070689_101083404 | 3300005340 | Bacteria | 716 |
| 46 | Ga0070691_10012601 | 3300005341 | Bacteria | 3872 |
| 47 | Ga0070691_10024547 | 3300005341 | Bacteria | 2802 |
| 48 | Ga0070691_10266132 | 3300005341 | Bacteria | 925 |
| 49 | Ga0070661_100006318 | 3300005344 | Bacteria | 8173 |
| 50 | Ga0070661_100014991 | 3300005344 | Bacteria | 5469 |
| 51 | Ga0070692_10017484 | 3300005345 | Bacteria | 3429 |
| 52 | Ga0070692_10054129 | 3300005345 | Bacteria | 2094 |
| 53 | Ga0070692_10229753 | 3300005345 | Bacteria | 1101 |
| 54 | Ga0070668_100003772 | 3300005347 | Bacteria | 11189 |
| 55 | Ga0070668_100819008 | 3300005347 | Bacteria | 828 |
| 56 | Ga0070668_101180683 | 3300005347 | Bacteria | 693 |
| 57 | Ga0070669_100338303 | 3300005353 | Bacteria | 1219 |
| 58 | Ga0070675_100009094 | 3300005354 | Bacteria | 7716 |
| 59 | Ga0070675_100010560 | 3300005354 | Bacteria | 7218 |
| 60 | Ga0070675_100011908 | 3300005354 | Bacteria | 6816 |
| 61 | Ga0070675_100852218 | 3300005354 | Bacteria | 834 |
| 62 | Ga0070671_100002713 | 3300005355 | Bacteria | 13735 |
| 63 | Ga0070671_100026821 | 3300005355 | Bacteria | 4738 |
| 64 | Ga0070671_100333584 | 3300005355 | Bacteria | 1293 |
| 65 | Ga0070673_100059250 | 3300005364 | Bacteria | 3030 |
| 66 | Ga0070673_100247476 | 3300005364 | Bacteria | 1552 |
| 67 | Ga0070659_100000619 | 3300005366 | Bacteria | 26037 |
| 68 | Ga0070659_100047992 | 3300005366 | Bacteria | 3352 |
| 69 | Ga0070659_100285251 | 3300005366 | Bacteria | 1374 |
| 70 | Ga0070659_100292158 | 3300005366 | Bacteria | 1357 |
| 71 | Ga0070659_100296848 | 3300005366 | Bacteria | 1346 |
| 72 | Ga0070709_10089432 | 3300005434 | Bacteria | 2027 |
| 73 | Ga0070709_10261928 | 3300005434 | Bacteria | 1249 |
| 74 | Ga0070714_100022172 | 3300005435 | Bacteria | 5205 |
| 75 | Ga0070714_100058439 | 3300005435 | Bacteria | 3304 |
| 76 | Ga0070714_100059168 | 3300005435 | Bacteria | 3284 |
| 77 | Ga0070714_100244639 | 3300005435 | Bacteria | 1657 |
| 78 | Ga0070713_100007535 | 3300005436 | Bacteria | 7648 |
| 79 | Ga0070713_100009883 | 3300005436 | Bacteria | 6864 |
| 80 | Ga0070713_100012018 | 3300005436 | Bacteria | 6337 |
| 81 | Ga0070713_100054431 | 3300005436 | Bacteria | 3320 |
| 82 | Ga0070713_100139405 | 3300005436 | Bacteria | 2147 |
| 83 | Ga0070713_100404284 | 3300005436 | Bacteria | 1276 |
| 84 | Ga0070713_100422604 | 3300005436 | Bacteria | 1248 |
| 85 | Ga0070713_100693965 | 3300005436 | Bacteria | 971 |
| 86 | Ga0070713_100737038 | 3300005436 | Bacteria | 942 |
| 87 | Ga0070710_10015850 | 3300005437 | Bacteria | 3822 |
| 88 | Ga0070711_100232973 | 3300005439 | Bacteria | 1436 |
| 89 | Ga0070708_100262332 | 3300005445 | Bacteria | 1624 |
| 90 | Ga0070663_100003535 | 3300005455 | Bacteria | 9023 |
| 91 | Ga0070663_100018807 | 3300005455 | Bacteria | 4539 |
| 92 | Ga0070663_100025083 | 3300005455 | Bacteria | 4022 |
| 93 | Ga0070663_100154621 | 3300005455 | Bacteria | 1761 |
| 94 | Ga0070678_100012017 | 3300005456 | Bacteria | 5364 |
| 95 | Ga0070678_100027089 | 3300005456 | Bacteria | 3886 |
| 96 | Ga0070662_100004777 | 3300005457 | Bacteria | 8586 |
| 97 | Ga0070681_10027526 | 3300005458 | Bacteria | 5715 |
| 98 | Ga0070681_10040253 | 3300005458 | Bacteria | 4684 |
| 99 | Ga0070681_10144931 | 3300005458 | Bacteria | 2304 |
| 100 | Ga0070681_10200375 | 3300005458 | Bacteria | 1914 |
| 101 | Ga0070685_10230521 | 3300005466 | Bacteria | 1218 |
| 102 | Ga0070698_100007787 | 3300005471 | Bacteria | 11594 |
| 103 | Ga0070679_100027848 | 3300005530 | Bacteria | 5567 |
| 104 | Ga0070679_100039513 | 3300005530 | Bacteria | 4689 |
| 105 | Ga0070679_100175965 | 3300005530 | Bacteria | 2112 |
| 106 | Ga0070679_100279840 | 3300005530 | Bacteria | 1621 |
| 107 | Ga0070679_100302185 | 3300005530 | Bacteria | 1551 |
| 108 | Ga0070684_100004536 | 3300005535 | Bacteria | 10582 |
| 109 | Ga0070684_100022936 | 3300005535 | Bacteria | 5213 |
| 110 | Ga0070684_100202129 | 3300005535 | Bacteria | 1810 |
| 111 | Ga0070684_100268632 | 3300005535 | Bacteria | 1561 |
| 112 | Ga0070684_100631548 | 3300005535 | Bacteria | 996 |
| 113 | Ga0068853_100093781 | 3300005539 | Bacteria | 2643 |
| 114 | Ga0070672_100319326 | 3300005543 | Bacteria | 1320 |
| 115 | Ga0070686_100097288 | 3300005544 | Bacteria | 1981 |
| 116 | Ga0070686_100168396 | 3300005544 | Bacteria | 1548 |
| 117 | Ga0070693_100046882 | 3300005547 | Bacteria | 2456 |
| 118 | Ga0070693_100067949 | 3300005547 | Bacteria | 2090 |
| 119 | Ga0070693_100175460 | 3300005547 | Bacteria | 1376 |
| 120 | Ga0070665_100040551 | 3300005548 | Bacteria | 4679 |
| 121 | Ga0070665_100111833 | 3300005548 | Bacteria | 2734 |
| 122 | Ga0070665_100488888 | 3300005548 | Bacteria | 1242 |
| 123 | Ga0070665_100584623 | 3300005548 | Bacteria | 1129 |
| 124 | Ga0068855_100035399 | 3300005563 | Bacteria | 5948 |
| 125 | Ga0068855_100063345 | 3300005563 | Bacteria | 4314 |
| 126 | Ga0068855_100274977 | 3300005563 | Bacteria | 1872 |
| 127 | Ga0068855_100388553 | 3300005563 | Bacteria | 1531 |
| 128 | Ga0068855_100389668 | 3300005563 | Bacteria | 1528 |
| 129 | Ga0068855_100446897 | 3300005563 | Bacteria | 1411 |
| 130 | Ga0070664_100010112 | 3300005564 | Bacteria | 7648 |
| 131 | Ga0070664_100286852 | 3300005564 | Bacteria | 1485 |
| 132 | Ga0070664_100630291 | 3300005564 | Bacteria | 996 |
| 133 | Ga0068857_100028443 | 3300005577 | Bacteria | 4933 |
| 134 | Ga0068857_100226797 | 3300005577 | Bacteria | 1707 |
| 135 | Ga0068857_100716398 | 3300005577 | Bacteria | 951 |
| 136 | Ga0068854_100028810 | 3300005578 | Bacteria | 3840 |
| 137 | Ga0068854_100033242 | 3300005578 | Bacteria | 3595 |
| 138 | Ga0068856_100021030 | 3300005614 | Bacteria | 6341 |
| 139 | Ga0068856_100120372 | 3300005614 | Bacteria | 2626 |
| 140 | Ga0068856_100218007 | 3300005614 | Bacteria | 1923 |
| 141 | Ga0068856_100428211 | 3300005614 | Bacteria | 1343 |
| 142 | Ga0068856_100579024 | 3300005614 | Bacteria | 1144 |
| 143 | Ga0068856_100796674 | 3300005614 | Bacteria | 965 |
| 144 | Ga0070702_100000171 | 3300005615 | Bacteria | 20677 |
| 145 | Ga0070702_100019326 | 3300005615 | Bacteria | 3551 |
| 146 | Ga0068852_100022896 | 3300005616 | Bacteria | 5019 |
| 147 | Ga0068852_100049930 | 3300005616 | Bacteria | 3581 |
| 148 | Ga0068859_100035566 | 3300005617 | Bacteria | 4997 |
| 149 | Ga0068859_100061735 | 3300005617 | Bacteria | 3777 |
| 150 | Ga0068859_101766751 | 3300005617 | Bacteria | 683 |
| 151 | Ga0068864_100017115 | 3300005618 | Bacteria | 6044 |
| 152 | Ga0068864_100057896 | 3300005618 | Bacteria | 3348 |
| 153 | Ga0068864_100126761 | 3300005618 | Bacteria | 2288 |
| 154 | Ga0068861_100514410 | 3300005719 | Bacteria | 1085 |
| 155 | Ga0068861_100630011 | 3300005719 | Bacteria | 988 |
| 156 | Ga0068851_10014261 | 3300005834 | Bacteria | 3772 |
| 157 | Ga0068870_10000071 | 3300005840 | Bacteria | 32257 |
| 158 | Ga0068870_10000371 | 3300005840 | Bacteria | 16836 |
| 159 | Ga0068863_100003726 | 3300005841 | Bacteria | 15076 |
| 160 | Ga0068863_100006202 | 3300005841 | Bacteria | 11728 |
| 161 | Ga0068863_100031033 | 3300005841 | Bacteria | 5103 |
| 162 | Ga0068863_100236320 | 3300005841 | Bacteria | 1764 |
| 163 | Ga0068858_100003961 | 3300005842 | Bacteria | 14613 |
| 164 | Ga0068858_100017430 | 3300005842 | Bacteria | 6736 |
| 165 | Ga0068858_100107503 | 3300005842 | Bacteria | 2604 |
| 166 | Ga0068858_100304478 | 3300005842 | Bacteria | 1521 |
| 167 | Ga0068860_100096313 | 3300005843 | Bacteria | 2821 |
| 168 | Ga0068862_100016202 | 3300005844 | Bacteria | 6201 |
| 169 | Ga0068862_100085630 | 3300005844 | Bacteria | 2739 |
| 170 | Ga0068862_100556443 | 3300005844 | Bacteria | 1096 |
| 171 | Ga0068862_101129028 | 3300005844 | Bacteria | 780 |
| 172 | Ga0081540_1002336 | 3300005983 | Bacteria | 15529 |
| 173 | Ga0081540_1163080 | 3300005983 | Bacteria | 861 |
| 174 | Ga0081540_1169948 | 3300005983 | Bacteria | 832 |
| 175 | Ga0081539_10004135 | 3300005985 | Bacteria | 16512 |
| 176 | Ga0081539_10008632 | 3300005985 | Bacteria | 8790 |
| 177 | Ga0081539_10010950 | 3300005985 | Bacteria | 7273 |
| 178 | Ga0081539_10016044 | 3300005985 | Bacteria | 5387 |
| 179 | Ga0081539_10098252 | 3300005985 | Bacteria | 1498 |
| 180 | Ga0070717_10144823 | 3300006028 | Bacteria | 2052 |
| 181 | Ga0070717_10606028 | 3300006028 | Bacteria | 993 |
| 182 | Ga0070716_100749409 | 3300006173 | Bacteria | 751 |
| 183 | Ga0070712_100028718 | 3300006175 | Bacteria | 3723 |
| 184 | Ga0070712_100147470 | 3300006175 | Bacteria | 1802 |
| 185 | Ga0070712_100291114 | 3300006175 | Bacteria | 1318 |
| 186 | Ga0097621_100063494 | 3300006237 | Bacteria | 3035 |
| 187 | Ga0097621_100644023 | 3300006237 | Bacteria | 972 |
| 188 | Ga0097621_100866122 | 3300006237 | Bacteria | 840 |
| 189 | Ga0068871_100100812 | 3300006358 | Bacteria | 2419 |
| 190 | Ga0075428_100004276 | 3300006844 | Bacteria | 15722 |
| 191 | Ga0075428_100060342 | 3300006844 | Bacteria | 4153 |
| 192 | Ga0075428_100135071 | 3300006844 | Bacteria | 2683 |
| 193 | Ga0075428_100151360 | 3300006844 | Bacteria | 2520 |
| 194 | Ga0075428_100232463 | 3300006844 | Bacteria | 1989 |
| 195 | Ga0075430_100035603 | 3300006846 | Bacteria | 4223 |
| 196 | Ga0075430_100195361 | 3300006846 | Bacteria | 1681 |
| 197 | Ga0075431_100003257 | 3300006847 | Bacteria | 15722 |
| 198 | Ga0075431_100396024 | 3300006847 | Bacteria | 1383 |
| 199 | Ga0075431_100402127 | 3300006847 | Bacteria | 1370 |
| 200 | Ga0075433_10004022 | 3300006852 | Bacteria | 11370 |
| 201 | Ga0075433_10097647 | 3300006852 | Bacteria | 2600 |
| 202 | Ga0075434_100001779 | 3300006871 | Bacteria | 18580 |
| 203 | Ga0075434_100010778 | 3300006871 | Bacteria | 8585 |
| 204 | Ga0075429_100000244 | 3300006880 | Bacteria | 37496 |
| 205 | Ga0075429_100036349 | 3300006880 | Bacteria | 4283 |
| 206 | Ga0075429_100037400 | 3300006880 | Bacteria | 4225 |
| 207 | Ga0075429_100314559 | 3300006880 | Bacteria | 1370 |
| 208 | Ga0068865_100190093 | 3300006881 | Bacteria | 1587 |
| 209 | Ga0075436_100009808 | 3300006914 | Bacteria | 6549 |
| 210 | Ga0075436_100017369 | 3300006914 | Bacteria | 4926 |
| 211 | Ga0097620_100035566 | 3300006931 | Bacteria | 4997 |
| 212 | Ga0097620_100061733 | 3300006931 | Bacteria | 3777 |
| 213 | Ga0097620_101766407 | 3300006931 | Bacteria | 683 |
| 214 | Ga0075435_100004529 | 3300007076 | Bacteria | 9555 |
| 215 | Ga0075435_100011752 | 3300007076 | Bacteria | 6460 |
| 216 | Ga0105251_10017112 | 3300009011 | Bacteria | 3894 |
| 217 | Ga0105244_10164505 | 3300009036 | Bacteria | 1058 |
| 218 | Ga0105240_10045960 | 3300009093 | Bacteria | 5536 |
| 219 | Ga0105240_10121183 | 3300009093 | Bacteria | 3149 |
| 220 | Ga0105240_10125769 | 3300009093 | Bacteria | 3081 |
| 221 | Ga0105240_11746079 | 3300009093 | Bacteria | 649 |
| 222 | Ga0111539_10025523 | 3300009094 | Bacteria | 7245 |
| 223 | Ga0111539_10308872 | 3300009094 | Bacteria | 1840 |
| 224 | Ga0111539_11980312 | 3300009094 | Bacteria | 676 |
| 225 | Ga0105245_10021743 | 3300009098 | Bacteria | 5632 |
| 226 | Ga0105245_10045369 | 3300009098 | Bacteria | 3926 |
| 227 | Ga0105245_10207857 | 3300009098 | Bacteria | 1883 |
| 228 | Ga0105245_10328942 | 3300009098 | Bacteria | 1508 |
| 229 | Ga0105245_11219362 | 3300009098 | Bacteria | 800 |
| 230 | Ga0105247_10000578 | 3300009101 | Bacteria | 29749 |
| 231 | Ga0105247_10009301 | 3300009101 | Bacteria | 5967 |
| 232 | Ga0105247_10015202 | 3300009101 | Bacteria | 4615 |
| 233 | Ga0105247_10439378 | 3300009101 | Bacteria | 938 |
| 234 | Ga0114129_10000723 | 3300009147 | Bacteria | 41902 |
| 235 | Ga0114129_10053320 | 3300009147 | Bacteria | 5672 |
| 236 | Ga0114129_10129285 | 3300009147 | Bacteria | 3471 |
| 237 | Ga0114129_10635809 | 3300009147 | Bacteria | 1379 |
| 238 | Ga0114129_11436832 | 3300009147 | Bacteria | 850 |
| 239 | Ga0105243_10208195 | 3300009148 | Bacteria | 1720 |
| 240 | Ga0105243_10332423 | 3300009148 | Bacteria | 1388 |
| 241 | Ga0105241_10004726 | 3300009174 | Bacteria | 10042 |
| 242 | Ga0105241_10087958 | 3300009174 | Bacteria | 2446 |
| 243 | Ga0105248_10045442 | 3300009177 | Bacteria | 4925 |
| 244 | Ga0105248_10244302 | 3300009177 | Bacteria | 2021 |
| 245 | Ga0105237_10048028 | 3300009545 | Bacteria | 4291 |
| 246 | Ga0105237_10160031 | 3300009545 | Bacteria | 2250 |
| 247 | Ga0105237_10450282 | 3300009545 | Bacteria | 1293 |
| 248 | Ga0105237_10451993 | 3300009545 | Bacteria | 1291 |
| 249 | Ga0105237_10532733 | 3300009545 | Bacteria | 1181 |
| 250 | Ga0105237_11142597 | 3300009545 | Bacteria | 785 |
| 251 | Ga0105238_10056000 | 3300009551 | Bacteria | 3956 |
| 252 | Ga0105238_10128092 | 3300009551 | Bacteria | 2517 |
| 253 | Ga0105238_10181055 | 3300009551 | Bacteria | 2084 |
| 254 | Ga0105238_10366559 | 3300009551 | Bacteria | 1430 |
| 255 | Ga0105249_10280513 | 3300009553 | Bacteria | 1664 |
| 256 | Ga0105239_10098213 | 3300010375 | Bacteria | 3237 |
| 257 | Ga0105239_10216350 | 3300010375 | Bacteria | 2148 |
| 258 | Ga0105239_10272814 | 3300010375 | Bacteria | 1903 |
| 259 | Ga0105239_10997353 | 3300010375 | Bacteria | 963 |
| 260 | Ga0105239_11052466 | 3300010375 | Bacteria | 936 |
| 261 | Ga0105239_12289298 | 3300010375 | Bacteria | 629 |
| 262 | Ga0105246_10000293 | 3300011119 | Bacteria | 26148 |
| 263 | Ga0105246_10000478 | 3300011119 | Bacteria | 21566 |
| 264 | Ga0105246_10649315 | 3300011119 | Bacteria | 918 |
| 265 | Ga0157373_10148071 | 3300013100 | Bacteria | 1651 |
| 266 | Ga0157373_10203843 | 3300013100 | Bacteria | 1394 |
| 267 | Ga0157371_10046257 | 3300013102 | Bacteria | 3095 |
| 268 | Ga0157371_10052250 | 3300013102 | Bacteria | 2902 |
| 269 | Ga0157371_10065918 | 3300013102 | Bacteria | 2565 |
| 270 | Ga0157371_10236099 | 3300013102 | Bacteria | 1315 |
| 271 | Ga0157370_10021623 | 3300013104 | Bacteria | 6409 |
| 272 | Ga0157370_10036347 | 3300013104 | Bacteria | 4780 |
| 273 | Ga0157370_10295791 | 3300013104 | Bacteria | 1495 |
| 274 | Ga0157370_10361586 | 3300013104 | Bacteria | 1337 |
| 275 | Ga0157370_10805028 | 3300013104 | Bacteria | 855 |
| 276 | Ga0157369_10004575 | 3300013105 | Bacteria | 16260 |
| 277 | Ga0157369_10004788 | 3300013105 | Bacteria | 15907 |
| 278 | Ga0157369_10024369 | 3300013105 | Bacteria | 6732 |
| 279 | Ga0157369_10071305 | 3300013105 | Bacteria | 3730 |
| 280 | Ga0157369_10071634 | 3300013105 | Bacteria | 3720 |
| 281 | Ga0157369_10135433 | 3300013105 | Bacteria | 2608 |
| 282 | Ga0157369_10147048 | 3300013105 | Bacteria | 2491 |
| 283 | Ga0157369_10247304 | 3300013105 | Bacteria | 1862 |
| 284 | Ga0157369_10608713 | 3300013105 | Bacteria | 1127 |
| 285 | Ga0157369_10713360 | 3300013105 | Bacteria | 1033 |
| 286 | Ga0157369_10768854 | 3300013105 | Bacteria | 990 |
| 287 | Ga0157374_10051088 | 3300013296 | Bacteria | 3846 |
| 288 | Ga0157374_10075075 | 3300013296 | Bacteria | 3194 |
| 289 | Ga0157374_10642813 | 3300013296 | Bacteria | 1072 |
| 290 | Ga0163162_10265665 | 3300013306 | Bacteria | 1847 |
| 291 | Ga0163162_10463406 | 3300013306 | Bacteria | 1399 |
| 292 | Ga0157375_10016266 | 3300013308 | Bacteria | 6674 |
| 293 | Ga0157375_10385333 | 3300013308 | Bacteria | 1568 |
| 294 | Ga0163163_10059376 | 3300014325 | Bacteria | 3783 |
| 295 | Ga0163163_10083601 | 3300014325 | Bacteria | 3197 |
| 296 | Ga0163163_10138016 | 3300014325 | Bacteria | 2480 |
| 297 | Ga0163163_10314691 | 3300014325 | Bacteria | 1619 |
| 298 | Ga0163163_10667284 | 3300014325 | Bacteria | 1103 |
| 299 | Ga0157380_10117386 | 3300014326 | Bacteria | 2247 |
| 300 | Ga0182008_10330389 | 3300014497 | Bacteria | 804 |
| 301 | Ga0182008_10362009 | 3300014497 | Bacteria | 772 |
| 302 | Ga0157377_10064788 | 3300014745 | Bacteria | 2097 |
| 303 | Ga0157377_10068681 | 3300014745 | Bacteria | 2043 |
| 304 | Ga0157377_10626577 | 3300014745 | Bacteria | 771 |
| 305 | Ga0157379_10000076 | 3300014968 | Bacteria | 63779 |
| 306 | Ga0157379_10088446 | 3300014968 | Bacteria | 2778 |
| 307 | Ga0157379_10092231 | 3300014968 | Bacteria | 2717 |
| 308 | Ga0157376_10249267 | 3300014969 | Bacteria | 1658 |
| 309 | Ga0157376_10263866 | 3300014969 | Bacteria | 1615 |
| 310 | Ga0157376_11064481 | 3300014969 | Bacteria | 833 |
| 311 | Ga0163161_10702572 | 3300017792 | Bacteria | 842 |
| 312 | Ga0197907_11071090 | 3300020069 | Bacteria | 1451 |
| 313 | Ga0206356_10034341 | 3300020070 | Bacteria | 1308 |
| 314 | Ga0206355_1226558 | 3300020076 | Bacteria | 877 |
| 315 | Ga0206351_10259414 | 3300020077 | Bacteria | 922 |
| 316 | Ga0206354_10516870 | 3300020081 | Bacteria | 2186 |
| 317 | Ga0206354_10545188 | 3300020081 | Bacteria | 1628 |
| 318 | Ga0206354_10624629 | 3300020081 | Bacteria | 792 |
| 319 | Ga0206353_10343003 | 3300020082 | Bacteria | 1108 |
| 320 | Ga0206353_10403903 | 3300020082 | Bacteria | 3320 |
| 321 | Ga0206353_10614142 | 3300020082 | Bacteria | 2076 |
| 322 | Ga0206353_10624157 | 3300020082 | Bacteria | 928 |
| 323 | Ga0206353_11253613 | 3300020082 | Bacteria | 2227 |
| 324 | Ga0213874_10037177 | 3300021377 | Bacteria | 1439 |
| 325 | Ga0213876_10001219 | 3300021384 | Bacteria | 16232 |
| 326 | Ga0213875_10096770 | 3300021388 | Bacteria | 1377 |
| 327 | Ga0224712_10081991 | 3300022467 | Bacteria | 1333 |
| 328 | Ga0224712_10088256 | 3300022467 | Bacteria | 1294 |
| 329 | Ga0224712_10104348 | 3300022467 | Bacteria | 1207 |
| 330 | Ga0224712_10135716 | 3300022467 | Bacteria | 1078 |
| 331 | Ga0224712_10318589 | 3300022467 | Bacteria | 730 |
| 332 | Ga0207656_10006329 | 3300025321 | Bacteria | 4245 |
| 333 | Ga0207656_10018219 | 3300025321 | Bacteria | 2761 |
| 334 | Ga0207713_1064019 | 3300025735 | Bacteria | 1386 |
| 335 | Ga0207692_10068602 | 3300025898 | Bacteria | 1860 |
| 336 | Ga0207642_10171968 | 3300025899 | Bacteria | 1173 |
| 337 | Ga0207710_10000023 | 3300025900 | Bacteria | 329909 |
| 338 | Ga0207710_10018127 | 3300025900 | Bacteria | 2992 |
| 339 | Ga0207710_10020248 | 3300025900 | Bacteria | 2843 |
| 340 | Ga0207688_10012543 | 3300025901 | Bacteria | 4612 |
| 341 | Ga0207688_10036476 | 3300025901 | Bacteria | 2724 |
| 342 | Ga0207688_10218527 | 3300025901 | Bacteria | 1147 |
| 343 | Ga0207680_10296976 | 3300025903 | Bacteria | 1125 |
| 344 | Ga0207647_10064296 | 3300025904 | Bacteria | 2230 |
| 345 | Ga0207647_10141142 | 3300025904 | Bacteria | 1412 |
| 346 | Ga0207647_10141341 | 3300025904 | Bacteria | 1411 |
| 347 | Ga0207685_10011482 | 3300025905 | Bacteria | 2664 |
| 348 | Ga0207699_10011845 | 3300025906 | Bacteria | 4419 |
| 349 | Ga0207699_10022015 | 3300025906 | Bacteria | 3447 |
| 350 | Ga0207699_10057501 | 3300025906 | Bacteria | 2322 |
| 351 | Ga0207699_10552288 | 3300025906 | Bacteria | 835 |
| 352 | Ga0207645_10047739 | 3300025907 | Bacteria | 2734 |
| 353 | Ga0207645_10101305 | 3300025907 | Bacteria | 1858 |
| 354 | Ga0207643_10000022 | 3300025908 | Bacteria | 105173 |
| 355 | Ga0207643_10000102 | 3300025908 | Bacteria | 57710 |
| 356 | Ga0207705_10000595 | 3300025909 | Bacteria | 30272 |
| 357 | Ga0207705_10011904 | 3300025909 | Bacteria | 6285 |
| 358 | Ga0207705_10037678 | 3300025909 | Bacteria | 3460 |
| 359 | Ga0207705_10050136 | 3300025909 | Bacteria | 3005 |
| 360 | Ga0207705_10412011 | 3300025909 | Bacteria | 1046 |
| 361 | Ga0207684_10445923 | 3300025910 | Bacteria | 1111 |
| 362 | Ga0207654_10294600 | 3300025911 | Bacteria | 1101 |
| 363 | Ga0207707_10015744 | 3300025912 | Bacteria | 6592 |
| 364 | Ga0207707_10058525 | 3300025912 | Bacteria | 3354 |
| 365 | Ga0207707_10070314 | 3300025912 | Bacteria | 3050 |
| 366 | Ga0207707_10229764 | 3300025912 | Bacteria | 1614 |
| 367 | Ga0207707_10448486 | 3300025912 | Bacteria | 1104 |
| 368 | Ga0207695_10513805 | 3300025913 | Bacteria | 1080 |
| 369 | Ga0207695_11230478 | 3300025913 | Bacteria | 629 |
| 370 | Ga0207671_10023017 | 3300025914 | Bacteria | 4702 |
| 371 | Ga0207693_10006163 | 3300025915 | Bacteria | 9948 |
| 372 | Ga0207693_10021091 | 3300025915 | Bacteria | 5179 |
| 373 | Ga0207693_10496861 | 3300025915 | Bacteria | 952 |
| 374 | Ga0207663_10866481 | 3300025916 | Bacteria | 721 |
| 375 | Ga0207660_10027222 | 3300025917 | Bacteria | 3898 |
| 376 | Ga0207660_10047641 | 3300025917 | Bacteria | 3032 |
| 377 | Ga0207660_10150580 | 3300025917 | Bacteria | 1787 |
| 378 | Ga0207657_10043599 | 3300025919 | Bacteria | 3950 |
| 379 | Ga0207657_10051901 | 3300025919 | Bacteria | 3562 |
| 380 | Ga0207657_10092164 | 3300025919 | Bacteria | 2526 |
| 381 | Ga0207657_10179941 | 3300025919 | Bacteria | 1709 |
| 382 | Ga0207657_10555313 | 3300025919 | Bacteria | 898 |
| 383 | Ga0207649_10015181 | 3300025920 | Bacteria | 4326 |
| 384 | Ga0207649_10039068 | 3300025920 | Bacteria | 2875 |
| 385 | Ga0207649_10258329 | 3300025920 | Bacteria | 1258 |
| 386 | Ga0207652_10032827 | 3300025921 | Bacteria | 4368 |
| 387 | Ga0207652_10218502 | 3300025921 | Bacteria | 1717 |
| 388 | Ga0207652_10240194 | 3300025921 | Bacteria | 1633 |
| 389 | Ga0207652_10306968 | 3300025921 | Bacteria | 1432 |
| 390 | Ga0207652_10342206 | 3300025921 | Bacteria | 1350 |
| 391 | Ga0207652_10454319 | 3300025921 | Bacteria | 1155 |
| 392 | Ga0207681_10912205 | 3300025923 | Bacteria | 736 |
| 393 | Ga0207694_10076256 | 3300025924 | Bacteria | 2626 |
| 394 | Ga0207694_10845073 | 3300025924 | Bacteria | 774 |
| 395 | Ga0207650_10017555 | 3300025925 | Bacteria | 5012 |
| 396 | Ga0207650_10019927 | 3300025925 | Bacteria | 4721 |
| 397 | Ga0207659_10005909 | 3300025926 | Bacteria | 7472 |
| 398 | Ga0207659_10033050 | 3300025926 | Bacteria | 3556 |
| 399 | Ga0207659_10162960 | 3300025926 | Bacteria | 1752 |
| 400 | Ga0207687_10003225 | 3300025927 | Bacteria | 11043 |
| 401 | Ga0207687_10010510 | 3300025927 | Bacteria | 6047 |
| 402 | Ga0207687_10128449 | 3300025927 | Bacteria | 1906 |
| 403 | Ga0207687_10229509 | 3300025927 | Bacteria | 1466 |
| 404 | Ga0207700_10009719 | 3300025928 | Bacteria | 6027 |
| 405 | Ga0207700_10035764 | 3300025928 | Bacteria | 3581 |
| 406 | Ga0207700_10046521 | 3300025928 | Bacteria | 3209 |
| 407 | Ga0207700_10095334 | 3300025928 | Bacteria | 2360 |
| 408 | Ga0207700_10098357 | 3300025928 | Bacteria | 2327 |
| 409 | Ga0207700_10118142 | 3300025928 | Bacteria | 2145 |
| 410 | Ga0207700_10385742 | 3300025928 | Bacteria | 1226 |
| 411 | Ga0207700_10783375 | 3300025928 | Bacteria | 853 |
| 412 | Ga0207664_10001757 | 3300025929 | Bacteria | 14282 |
| 413 | Ga0207664_10039091 | 3300025929 | Bacteria | 3682 |
| 414 | Ga0207664_10116066 | 3300025929 | Bacteria | 2233 |
| 415 | Ga0207664_10226503 | 3300025929 | Bacteria | 1623 |
| 416 | Ga0207664_10261864 | 3300025929 | Bacteria | 1512 |
| 417 | Ga0207664_10347810 | 3300025929 | Bacteria | 1312 |
| 418 | Ga0207664_10396591 | 3300025929 | Bacteria | 1227 |
| 419 | Ga0207644_10008498 | 3300025931 | Bacteria | 6718 |
| 420 | Ga0207644_10156128 | 3300025931 | Bacteria | 1769 |
| 421 | Ga0207690_10000575 | 3300025932 | Bacteria | 24004 |
| 422 | Ga0207690_10008450 | 3300025932 | Bacteria | 6112 |
| 423 | Ga0207690_10404635 | 3300025932 | Bacteria | 1089 |
| 424 | Ga0207690_10588759 | 3300025932 | Bacteria | 907 |
| 425 | Ga0207690_10712280 | 3300025932 | Bacteria | 826 |
| 426 | Ga0207706_10005138 | 3300025933 | Bacteria | 12214 |
| 427 | Ga0207709_10807725 | 3300025935 | Bacteria | 757 |
| 428 | Ga0207670_10012052 | 3300025936 | Bacteria | 5041 |
| 429 | Ga0207665_10094970 | 3300025939 | Bacteria | 2072 |
| 430 | Ga0207691_10015226 | 3300025940 | Bacteria | 7316 |
| 431 | Ga0207691_10111426 | 3300025940 | Bacteria | 2433 |
| 432 | Ga0207711_10384542 | 3300025941 | Bacteria | 1302 |
| 433 | Ga0207711_10477324 | 3300025941 | Bacteria | 1161 |
| 434 | Ga0207689_10001185 | 3300025942 | Bacteria | 25056 |
| 435 | Ga0207689_10003272 | 3300025942 | Bacteria | 14852 |
| 436 | Ga0207689_10005316 | 3300025942 | Bacteria | 11541 |
| 437 | Ga0207689_10133476 | 3300025942 | Bacteria | 2044 |
| 438 | Ga0207689_10499310 | 3300025942 | Bacteria | 1019 |
| 439 | Ga0207661_10002483 | 3300025944 | Bacteria | 12682 |
| 440 | Ga0207661_10010323 | 3300025944 | Bacteria | 6718 |
| 441 | Ga0207661_10244144 | 3300025944 | Bacteria | 1594 |
| 442 | Ga0207661_10253248 | 3300025944 | Bacteria | 1566 |
| 443 | Ga0207661_10287846 | 3300025944 | Bacteria | 1470 |
| 444 | Ga0207661_10742332 | 3300025944 | Bacteria | 903 |
| 445 | Ga0207679_10019242 | 3300025945 | Bacteria | 4585 |
| 446 | Ga0207679_10023587 | 3300025945 | Bacteria | 4209 |
| 447 | Ga0207679_10071691 | 3300025945 | Bacteria | 2614 |
| 448 | Ga0207679_10297411 | 3300025945 | Bacteria | 1390 |
| 449 | Ga0207667_10017863 | 3300025949 | Bacteria | 7972 |
| 450 | Ga0207667_10270394 | 3300025949 | Bacteria | 1737 |
| 451 | Ga0207651_10040032 | 3300025960 | Bacteria | 3097 |
| 452 | Ga0207651_10092859 | 3300025960 | Bacteria | 2214 |
| 453 | Ga0207668_10001583 | 3300025972 | Bacteria | 13306 |
| 454 | Ga0207668_10584755 | 3300025972 | Bacteria | 971 |
| 455 | Ga0207640_10011075 | 3300025981 | Bacteria | 5095 |
| 456 | Ga0207640_10070703 | 3300025981 | Bacteria | 2348 |
| 457 | Ga0207658_10061354 | 3300025986 | Bacteria | 2809 |
| 458 | Ga0207658_10075097 | 3300025986 | Bacteria | 2571 |
| 459 | Ga0207677_10029651 | 3300026023 | Bacteria | 3480 |
| 460 | Ga0207677_10038111 | 3300026023 | Bacteria | 3148 |
| 461 | Ga0207677_10175092 | 3300026023 | Bacteria | 1682 |
| 462 | Ga0207703_10000003 | 3300026035 | Bacteria | 532213 |
| 463 | Ga0207703_10087459 | 3300026035 | Bacteria | 2613 |
| 464 | Ga0207703_10320078 | 3300026035 | Bacteria | 1420 |
| 465 | Ga0207639_10163771 | 3300026041 | Bacteria | 1877 |
| 466 | Ga0207639_10629992 | 3300026041 | Bacteria | 991 |
| 467 | Ga0207678_10000141 | 3300026067 | Bacteria | 59147 |
| 468 | Ga0207678_10001333 | 3300026067 | Bacteria | 22773 |
| 469 | Ga0207678_10004168 | 3300026067 | Bacteria | 12977 |
| 470 | Ga0207678_10059214 | 3300026067 | Bacteria | 3295 |
| 471 | Ga0207678_10064609 | 3300026067 | Bacteria | 3144 |
| 472 | Ga0207678_10084789 | 3300026067 | Bacteria | 2709 |
| 473 | Ga0207678_10543241 | 3300026067 | Bacteria | 1016 |
| 474 | Ga0207708_10015814 | 3300026075 | Bacteria | 5663 |
| 475 | Ga0207708_10064175 | 3300026075 | Bacteria | 2805 |
| 476 | Ga0207702_10000567 | 3300026078 | Bacteria | 41121 |
| 477 | Ga0207702_10006389 | 3300026078 | Bacteria | 10171 |
| 478 | Ga0207702_10064519 | 3300026078 | Bacteria | 3134 |
| 479 | Ga0207702_10297173 | 3300026078 | Bacteria | 1531 |
| 480 | Ga0207702_10485094 | 3300026078 | Bacteria | 1203 |
| 481 | Ga0207641_10008900 | 3300026088 | Bacteria | 8292 |
| 482 | Ga0207641_10033796 | 3300026088 | Bacteria | 4249 |
| 483 | Ga0207676_10000814 | 3300026095 | Bacteria | 24327 |
| 484 | Ga0207676_10000974 | 3300026095 | Bacteria | 22077 |
| 485 | Ga0207676_10685772 | 3300026095 | Bacteria | 991 |
| 486 | Ga0207674_10013397 | 3300026116 | Bacteria | 9102 |
| 487 | Ga0207674_10032237 | 3300026116 | Bacteria | 5498 |
| 488 | Ga0207674_10784124 | 3300026116 | Bacteria | 920 |
| 489 | Ga0207675_100141707 | 3300026118 | Bacteria | 2284 |
| 490 | Ga0207675_100231589 | 3300026118 | Bacteria | 1783 |
| 491 | Ga0207675_100599876 | 3300026118 | Bacteria | 1104 |
| 492 | Ga0207683_10000171 | 3300026121 | Bacteria | 56009 |
| 493 | Ga0207683_10002042 | 3300026121 | Bacteria | 17869 |
| 494 | Ga0207683_10180428 | 3300026121 | Bacteria | 1914 |
| 495 | Ga0207683_10562757 | 3300026121 | Bacteria | 1054 |
| 496 | Ga0207698_10038926 | 3300026142 | Bacteria | 3518 |
| 497 | Ga0207698_10109663 | 3300026142 | Bacteria | 2310 |
| 498 | Ga0207698_10140302 | 3300026142 | Bacteria | 2081 |
| 499 | Ga0207698_10373447 | 3300026142 | Bacteria | 1354 |
| 500 | Ga0207698_10628340 | 3300026142 | Bacteria | 1061 |
| 501 | Ga0207428_10031502 | 3300027907 | Bacteria | 4372 |
| 502 | Ga0207428_10063708 | 3300027907 | Bacteria | 2912 |
| 503 | Ga0268266_10025102 | 3300028379 | Bacteria | 5073 |
| 504 | Ga0268266_10026732 | 3300028379 | Bacteria | 4911 |
| 505 | Ga0268266_10110251 | 3300028379 | Bacteria | 2438 |
| 506 | Ga0268266_10431383 | 3300028379 | Bacteria | 1250 |
| 507 | Ga0268265_10055749 | 3300028380 | Bacteria | 3004 |
| 508 | Ga0268265_10069153 | 3300028380 | Bacteria | 2741 |
| 509 | Ga0265338_10008011 | 3300028800 | Bacteria | 12932 |
| 510 | Ga0265338_10079175 | 3300028800 | Bacteria | 2766 |
| 511 | Ga0307512_10034068 | 3300030522 | Bacteria | 4364 |
| 512 | Ga0307512_10126895 | 3300030522 | Bacteria | 1616 |
| 513 | Ga0265773_1017838 | 3300031018 | Bacteria | 675 |
| 514 | Ga0307513_10005579 | 3300031456 | Bacteria | 16592 |
| 515 | Ga0307513_10030700 | 3300031456 | Bacteria | 6100 |
| 516 | Ga0307513_10086372 | 3300031456 | Bacteria | 3216 |
| 517 | Ga0307513_10481890 | 3300031456 | Bacteria | 960 |
| 518 | Ga0307509_10007679 | 3300031507 | Bacteria | 14014 |
| 519 | Ga0307509_10442742 | 3300031507 | Bacteria | 995 |
| 520 | Ga0307508_10005865 | 3300031616 | Bacteria | 11590 |
| 521 | Ga0307508_10037730 | 3300031616 | Bacteria | 4344 |
| 522 | Ga0307508_10237079 | 3300031616 | Bacteria | 1422 |
| 523 | Ga0307516_10000395 | 3300031730 | Bacteria | 56947 |
| 524 | Ga0307516_10080920 | 3300031730 | Bacteria | 3092 |
| 525 | Ga0307405_10043892 | 3300031731 | Bacteria | 2731 |
| 526 | Ga0307405_10093648 | 3300031731 | Bacteria | 1996 |
| 527 | Ga0307405_10488112 | 3300031731 | Bacteria | 985 |
| 528 | Ga0307413_10124339 | 3300031824 | Bacteria | 1753 |
| 529 | Ga0326468_10000491 | 3300031889 | Bacteria | 4156 |
| 530 | Ga0307406_10069281 | 3300031901 | Bacteria | 2306 |
| 531 | Ga0307406_10839138 | 3300031901 | Bacteria | 778 |
| 532 | Ga0307406_11014703 | 3300031901 | Bacteria | 712 |
| 533 | Ga0307407_10070006 | 3300031903 | Bacteria | 2084 |
| 534 | Ga0307407_10232393 | 3300031903 | Bacteria | 1253 |
| 535 | Ga0307412_10080851 | 3300031911 | Bacteria | 2246 |
| 536 | Ga0307409_100289009 | 3300031995 | Bacteria | 1519 |
| 537 | Ga0307409_100636361 | 3300031995 | Bacteria | 1059 |
| 538 | Ga0307409_101080364 | 3300031995 | Bacteria | 823 |
| 539 | Ga0307416_100035028 | 3300032002 | Bacteria | 3828 |
| 540 | Ga0307416_100735879 | 3300032002 | Bacteria | 1078 |
| 541 | Ga0307416_101718006 | 3300032002 | Bacteria | 732 |
| 542 | Ga0307411_10334682 | 3300032005 | Bacteria | 1228 |
| 543 | Ga0307415_100049996 | 3300032126 | Bacteria | 2830 |
| 544 | Ga0307415_100136742 | 3300032126 | Bacteria | 1865 |
| 545 | Ga0307415_100457012 | 3300032126 | Bacteria | 1105 |
| 546 | Ga0307415_100550923 | 3300032126 | Bacteria | 1018 |
| 547 | Ga0307415_100588348 | 3300032126 | Bacteria | 988 |
| 548 | Ga0307415_100663056 | 3300032126 | Bacteria | 937 |
| 549 | Ga0307507_10015989 | 3300033179 | Bacteria | 8774 |
| 550 | Ga0307510_10092101 | 3300033180 | Bacteria | 2870 |
| 551 | Ga0373923_0009629 | 3300035111 | Bacteria | 3493 |
| 552 | Ga0373932_0050899 | 3300035112 | Bacteria | 1229 |
| 553 | Ga0373953_0136844 | 3300035117 | Bacteria | 1046 |
| 554 | Ga0373956_0003862 | 3300035119 | Bacteria | 6025 |
| 555 | Ga0373957_0002593 | 3300035120 | Bacteria | 5186 |
| 556 | Ga0373946_0062274 | 3300035171 | Bacteria | 1591 |
| 557 | Ga0373955_0019462 | 3300035172 | Bacteria | 3393 |
| 558 | Ga0373942_0000028 | 3300035207 | Bacteria | 26905 |
| 559 | Ga0373924_0033184 | 3300035410 | Bacteria | 2082 |
| 560 | Ga0373931_0143873 | 3300035691 | Bacteria | 1384 |
| 561 | Ga0373931_0422240 | 3300035691 | Bacteria | 848 |
| 562 | Ga0373931_0551225 | 3300035691 | Bacteria | 749 |
| 563 | Ga0373935_0008810 | 3300035692 | Bacteria | 6042 |
| 564 | Ga0373935_0068108 | 3300035692 | Bacteria | 2290 |
| 565 | Ga0373933_0003332 | 3300035724 | Bacteria | 8957 |
| 566 | Ga0373947_0112790 | 3300035725 | Bacteria | 1720 |
| 567 | Ga0373947_0285097 | 3300035725 | Bacteria | 1099 |
| 568 | Ga0372808_016503 | 3300036459 | Bacteria | 1058 |
| 569 | Ga0373925_0000010 | 3300037068 | Bacteria | 229059 |
| 570 | Ga0373925_0398061 | 3300037068 | Bacteria | 1123 |
| 571 | Ga0395899_0072246 | 3300037312 | Bacteria | 2525 |
| 572 | Ga0395900_0003750 | 3300037418 | Bacteria | 16323 |
| 573 | Ga0395900_0791069 | 3300037418 | Bacteria | 877 |
| 574 | Ga0395898_0129786 | 3300037466 | Bacteria | 2414 |
| 575 | Ga0395898_0163422 | 3300037466 | Bacteria | 2130 |
| 576 | Ga0395898_0534207 | 3300037466 | Bacteria | 1114 |
| 577 | Ga0395905_0001026 | 3300037471 | Bacteria | 35609 |
| 578 | Ga0395905_0296375 | 3300037471 | Bacteria | 1504 |
| 579 | Ga0395905_0364611 | 3300037471 | Bacteria | 1338 |
| 580 | Ga0436364_1458938 | 3300037853 | Bacteria | 1235 |
| 581 | Ga0395901_0004693 | 3300038443 | Bacteria | 13783 |
| 582 | Ga0395901_0007057 | 3300038443 | Bacteria | 11354 |
| 583 | Ga0395901_0253127 | 3300038443 | Bacteria | 1835 |
| 584 | Ga0395901_0549152 | 3300038443 | Bacteria | 1171 |
| 585 | Ga0436365_0093685 | 3300039437 | Bacteria | 33238 |
| 586 | Ga0436365_0676582 | 3300039437 | Bacteria | 7068 |
| 587 | Ga0436363_1466024 | 3300039450 | Bacteria | 2356 |
| 588 | Ga0436362_0116484 | 3300039453 | Bacteria | 1013 |
| 589 | Ga0451791_1528709 | 3300041451 | Bacteria | 779 |
| 590 | Ga0451843_0032912 | 3300041509 | Bacteria | 1573 |
| 591 | Ga0451853_1832670 | 3300041512 | Bacteria | 850 |
| 592 | Ga0439448_0030051 | 3300042005 | Bacteria | 1722 |
| 593 | Ga0439448_0137468 | 3300042005 | Bacteria | 844 |
| 594 | Ga0439450_054604 | 3300042008 | Bacteria | 955 |
| 595 | Ga0439455_0027923 | 3300042012 | Bacteria | 1386 |
| 596 | Ga0439455_0040089 | 3300042012 | Bacteria | 1197 |
| 597 | Ga0450905_014361 | 3300042142 | Bacteria | 1129 |
| 598 | Ga0439459_0004962 | 3300042438 | Bacteria | 2165 |
| 599 | Ga0439464_0184085 | 3300042439 | Bacteria | 662 |
| 600 | Ga0439464_0196136 | 3300042439 | Bacteria | 643 |
| 601 | Ga0439460_0124636 | 3300042461 | Bacteria | 845 |
| 602 | Ga0466969_0014966 | 3300044656 | Bacteria | 4070 |
| 603 | Ga0466969_0162121 | 3300044656 | Bacteria | 1027 |
| 604 | Ga0466972_0430287 | 3300044658 | Bacteria | 619 |
| 605 | Ga0466965_0047569 | 3300044683 | Bacteria | 2124 |
| 606 | Ga0466965_0127189 | 3300044683 | Bacteria | 1319 |
| 607 | Ga0466965_0249524 | 3300044683 | Bacteria | 952 |
| 608 | Ga0466965_0425797 | 3300044683 | Bacteria | 736 |
| 609 | Ga0466966_0006104 | 3300044684 | Bacteria | 7959 |
| 610 | Ga0466966_0035166 | 3300044684 | Bacteria | 3239 |
| 611 | Ga0466966_0036693 | 3300044684 | Bacteria | 3164 |
| 612 | Ga0466966_0131742 | 3300044684 | Bacteria | 1531 |
| 613 | Ga0466966_0165110 | 3300044684 | Bacteria | 1347 |
| 614 | Ga0466966_0165275 | 3300044684 | Bacteria | 1346 |
| 615 | Ga0466961_0005917 | 3300044693 | Bacteria | 7752 |
| 616 | Ga0466961_0100722 | 3300044693 | Bacteria | 1820 |
| 617 | Ga0466961_0108554 | 3300044693 | Bacteria | 1747 |
| 618 | Ga0466961_0190930 | 3300044693 | Bacteria | 1269 |
| 619 | Ga0466961_0282980 | 3300044693 | Bacteria | 1014 |
| 620 | Ga0466961_0348220 | 3300044693 | Bacteria | 902 |
| 621 | Ga0466961_0392559 | 3300044693 | Bacteria | 842 |
| 622 | Ga0466963_0027413 | 3300044694 | Bacteria | 3647 |
| 623 | Ga0466963_0068417 | 3300044694 | Bacteria | 2385 |
| 624 | Ga0466963_0073346 | 3300044694 | Bacteria | 2307 |
| 625 | Ga0466963_0076717 | 3300044694 | Bacteria | 2257 |
| 626 | Ga0466963_0116103 | 3300044694 | Bacteria | 1840 |
| 627 | Ga0466963_0122969 | 3300044694 | Bacteria | 1787 |
| 628 | Ga0466963_0127240 | 3300044694 | Bacteria | 1757 |
| 629 | Ga0466963_0135895 | 3300044694 | Bacteria | 1701 |
| 630 | Ga0466963_0167966 | 3300044694 | Bacteria | 1528 |
| 631 | Ga0466963_0412957 | 3300044694 | Bacteria | 952 |
| 632 | Ga0466963_0537745 | 3300044694 | Bacteria | 825 |
| 633 | Ga0466963_0579013 | 3300044694 | Bacteria | 793 |
| 634 | Ga0466964_0008863 | 3300044706 | Bacteria | 3782 |
| 635 | Ga0466964_0150365 | 3300044706 | Bacteria | 1079 |
| 636 | Ga0466964_0275540 | 3300044706 | Bacteria | 839 |
| 637 | Ga0466971_0019249 | 3300044719 | Bacteria | 3030 |
| 638 | Ga0466971_0054142 | 3300044719 | Bacteria | 1808 |
| 639 | Ga0466971_0099279 | 3300044719 | Bacteria | 1337 |
| 640 | Ga0466970_0003376 | 3300044765 | Bacteria | 7769 |
| 641 | Ga0466970_0075910 | 3300044765 | Bacteria | 1810 |
| 642 | Ga0466970_0078835 | 3300044765 | Bacteria | 1778 |
| 643 | Ga0466970_0245314 | 3300044765 | Bacteria | 1003 |
| 644 | Ga0466970_0491867 | 3300044765 | Bacteria | 706 |
| 645 | Ga0466970_0709195 | 3300044765 | Bacteria | 587 |
| 646 | Ga0466957_0002757 | 3300044842 | Bacteria | 9511 |
| 647 | Ga0466957_0052638 | 3300044842 | Bacteria | 2479 |
| 648 | Ga0466957_0065992 | 3300044842 | Bacteria | 2230 |
| 649 | Ga0466957_0172904 | 3300044842 | Bacteria | 1408 |
| 650 | Ga0466957_0261510 | 3300044842 | Bacteria | 1153 |
| 651 | Ga0466957_0376739 | 3300044842 | Bacteria | 967 |
| 652 | Ga0466957_0888633 | 3300044842 | Bacteria | 636 |
| 653 | Ga0466960_0060434 | 3300044901 | Bacteria | 1857 |
| 654 | Ga0466960_0280592 | 3300044901 | Bacteria | 933 |
| 655 | Ga0466960_0659355 | 3300044901 | Bacteria | 625 |
| 656 | Ga0466959_0006200 | 3300045049 | Bacteria | 8262 |
| 657 | Ga0466959_0011536 | 3300045049 | Bacteria | 6352 |
| 658 | Ga0466959_0050084 | 3300045049 | Bacteria | 3068 |
| 659 | Ga0466959_0097800 | 3300045049 | Bacteria | 2103 |
| 660 | Ga0466959_0184811 | 3300045049 | Bacteria | 1457 |
| 661 | Ga0466959_0208389 | 3300045049 | Bacteria | 1359 |
| 662 | Ga0466959_0588687 | 3300045049 | Bacteria | 749 |
| 663 | Ga0466959_0626130 | 3300045049 | Bacteria | 723 |
| 664 | Ga0466958_0005392 | 3300045836 | Bacteria | 6875 |
| 665 | Ga0466958_0022838 | 3300045836 | Bacteria | 3667 |
| 666 | Ga0466958_0024961 | 3300045836 | Bacteria | 3520 |
| 667 | Ga0466958_0054647 | 3300045836 | Bacteria | 2421 |
| 668 | Ga0466958_0122227 | 3300045836 | Bacteria | 1630 |
| 669 | Ga0466958_0201199 | 3300045836 | Bacteria | 1267 |
| 670 | Ga0466967_0009511 | 3300045976 | Bacteria | 7217 |
| 671 | Ga0466967_0009954 | 3300045976 | Bacteria | 7099 |
| 672 | Ga0466967_0055695 | 3300045976 | Bacteria | 3484 |
| 673 | Ga0466967_0056816 | 3300045976 | Bacteria | 3452 |
| 674 | Ga0466967_0223613 | 3300045976 | Bacteria | 1790 |
| 675 | Ga0466967_0253267 | 3300045976 | Bacteria | 1682 |
| 676 | Ga0466967_0275470 | 3300045976 | Bacteria | 1613 |
| 677 | Ga0466967_0568258 | 3300045976 | Bacteria | 1117 |
| 678 | Ga0466967_0614735 | 3300045976 | Bacteria | 1073 |
| 679 | Ga0466967_0832340 | 3300045976 | Bacteria | 917 |
| 680 | Ga0495592_0048601 | 3300046454 | Bacteria | 3155 |
| 681 | Ga0495641_0049821 | 3300046461 | Bacteria | 1916 |
| 682 | Ga0495651_0026022 | 3300046462 | Bacteria | 4555 |
| 683 | Ga0495653_0051274 | 3300046463 | Bacteria | 3168 |
| 684 | Ga0495664_0050622 | 3300046477 | Bacteria | 2466 |
| 685 | Ga0495594_0021958 | 3300046499 | Bacteria | 3411 |
| 686 | Ga0495608_0044401 | 3300046511 | Bacteria | 2966 |
| 687 | Ga0495628_0066904 | 3300046516 | Bacteria | 2807 |
| 688 | Ga0495630_0086263 | 3300046517 | Bacteria | 2371 |
| 689 | Ga0495652_0011829 | 3300046529 | Bacteria | 7887 |
| 690 | Ga0495640_0015352 | 3300046533 | Bacteria | 5766 |
| 691 | Ga0495586_0104355 | 3300046535 | Bacteria | 1575 |
| 692 | Ga0495587_0012448 | 3300046536 | Bacteria | 5353 |
| 693 | Ga0495645_0030035 | 3300046543 | Bacteria | 3959 |
| 694 | Ga0495667_0009505 | 3300046559 | Bacteria | 6588 |
| 695 | Ga0495668_0000477 | 3300046616 | Bacteria | 50176 |
| 696 | Ga0495625_0000969 | 3300046660 | Bacteria | 38144 |
| 697 | Ga0495635_0203978 | 3300046663 | Bacteria | 1340 |
| 698 | Ga0495657_0049412 | 3300046675 | Bacteria | 2833 |
| 699 | Ga0495599_0009628 | 3300046678 | Bacteria | 5913 |
| 700 | Ga0495623_0093311 | 3300046679 | Bacteria | 1843 |
| 701 | Ga0495646_0279973 | 3300046680 | Bacteria | 886 |
| 702 | Ga0495658_0407263 | 3300046683 | Bacteria | 867 |
| 703 | Ga0495669_0031349 | 3300046684 | Bacteria | 2335 |
| 704 | Ga0495613_0215063 | 3300046689 | Bacteria | 1351 |
| 705 | Ga0495600_0059014 | 3300046809 | Bacteria | 2506 |
| 706 | Ga0495604_0043232 | 3300047317 | Bacteria | 3528 |
| 707 | Ga0495674_0070041 | 3300047319 | Bacteria | 3031 |
| 708 | Ga0495676_0066299 | 3300047321 | Bacteria | 2799 |
| 709 | Ga0495680_0028155 | 3300047322 | Bacteria | 4609 |
| 710 | Ga0495680_0473922 | 3300047322 | Bacteria | 853 |
| 711 | Ga0495683_0128282 | 3300047323 | Bacteria | 1198 |
| 712 | Ga0495675_0160813 | 3300047444 | Bacteria | 1383 |
| 713 | Ga0495684_0015890 | 3300047471 | Bacteria | 5796 |
| 714 | Ga0495602_0128972 | 3300048088 | Bacteria | 2020 |
| 715 | Ga0495626_0000234 | 3300048091 | Bacteria | 65050 |
| 716 | Ga0496100_0032464 | 3300048903 | Bacteria | 3257 |
| 717 | Ga0496100_0277587 | 3300048903 | Bacteria | 1248 |
| 718 | Ga0496101_0106525 | 3300048904 | Bacteria | 2105 |
| 719 | Ga0496101_0117961 | 3300048904 | Bacteria | 2004 |
| 720 | Ga0496102_0026483 | 3300048905 | Bacteria | 5173 |
| 721 | Ga0496102_0055310 | 3300048905 | Bacteria | 3619 |
| 722 | Ga0496103_0206255 | 3300048906 | Bacteria | 1264 |
| 723 | Ga0496104_0014353 | 3300048907 | Bacteria | 7155 |
| 724 | Ga0496104_0028303 | 3300048907 | Bacteria | 5194 |
| 725 | Ga0496105_0000419 | 3300048908 | Bacteria | 27857 |
| 726 | Ga0496105_0051856 | 3300048908 | Bacteria | 3388 |
| 727 | Ga0496105_0207087 | 3300048908 | Bacteria | 1600 |
| 728 | Ga0496105_0415302 | 3300048908 | Bacteria | 1066 |
| 729 | Ga0496106_0017256 | 3300048909 | Bacteria | 5342 |
| 730 | Ga0496106_0020477 | 3300048909 | Bacteria | 4909 |
| 731 | Ga0496107_0194279 | 3300048910 | Bacteria | 1508 |
| 732 | Ga0496108_0000149 | 3300048911 | Bacteria | 67412 |
| 733 | Ga0496108_0016367 | 3300048911 | Bacteria | 6047 |
| 734 | Ga0496108_0037214 | 3300048911 | Bacteria | 4052 |
| 735 | Ga0496109_0066011 | 3300048912 | Bacteria | 3312 |
| 736 | Ga0496109_0082676 | 3300048912 | Bacteria | 2960 |
| 737 | Ga0496109_0168439 | 3300048912 | Bacteria | 2054 |
| 738 | Ga0496109_0315005 | 3300048912 | Bacteria | 1476 |
| 739 | Ga0496110_0007084 | 3300048913 | Bacteria | 8926 |
| 740 | Ga0496110_0047056 | 3300048913 | Bacteria | 3775 |
| 741 | Ga0496110_0126346 | 3300048913 | Bacteria | 2307 |
| 742 | Ga0496110_0427477 | 3300048913 | Bacteria | 1207 |
| 743 | Ga0496110_1022382 | 3300048913 | Bacteria | 734 |
| 744 | Ga0496111_0008978 | 3300048914 | Bacteria | 6649 |
| 745 | Ga0496112_0016085 | 3300048915 | Bacteria | 6995 |
| 746 | Ga0496112_0066577 | 3300048915 | Bacteria | 3554 |
| 747 | Ga0496112_0515484 | 3300048915 | Bacteria | 1130 |
| 748 | Ga0496113_0007473 | 3300048916 | Bacteria | 7037 |
| 749 | Ga0496113_0261756 | 3300048916 | Bacteria | 1382 |
| 750 | Ga0496114_0040956 | 3300048917 | Bacteria | 3838 |
| 751 | Ga0496114_0093191 | 3300048917 | Bacteria | 2561 |
| 752 | Ga0496115_0069245 | 3300048918 | Bacteria | 2858 |
| 753 | Ga0496115_0074109 | 3300048918 | Bacteria | 2764 |
| 754 | Ga0496115_0236609 | 3300048918 | Bacteria | 1505 |
| 755 | Ga0496115_0510963 | 3300048918 | Bacteria | 964 |
| 756 | Ga0496119_0042137 | 3300048922 | Bacteria | 2898 |
| 757 | Ga0496119_0067600 | 3300048922 | Bacteria | 2107 |
| 758 | Ga0496121_0011363 | 3300048924 | Bacteria | 9897 |
| 759 | Ga0496126_0012001 | 3300048929 | Bacteria | 8904 |
| 760 | Ga0496126_0170916 | 3300048929 | Bacteria | 1852 |
| 761 | Ga0496126_0406155 | 3300048929 | Bacteria | 1104 |
| 762 | Ga0501031_0008755 | 3300049568 | Bacteria | 6583 |
| 763 | Ga0501032_0000515 | 3300049569 | Bacteria | 31388 |
| 764 | Ga0501033_0073236 | 3300049570 | Bacteria | 2515 |
| 765 | Ga0501033_0286546 | 3300049570 | Bacteria | 1162 |
| 766 | Ga0501034_0858214 | 3300049571 | Bacteria | 798 |
| 767 | Ga0501036_0670269 | 3300049572 | Bacteria | 858 |
| 768 | Ga0501038_0009857 | 3300049574 | Bacteria | 8742 |
| 769 | Ga0501039_0113632 | 3300049575 | Bacteria | 2118 |
| 770 | Ga0501043_0035771 | 3300049579 | Bacteria | 3907 |
| 771 | Ga0501047_0002063 | 3300049581 | Bacteria | 19207 |
| 772 | Ga0501047_0706726 | 3300049581 | Bacteria | 825 |
| 773 | Ga0501048_0000162 | 3300049582 | Bacteria | 41735 |
| 774 | Ga0501048_0640916 | 3300049582 | Bacteria | 763 |
| 775 | Ga0501070_0028074 | 3300049586 | Bacteria | 4719 |
| 776 | Ga0501071_0677535 | 3300049587 | Bacteria | 794 |
| 777 | Ga0501073_0126808 | 3300049589 | Bacteria | 1769 |
| 778 | Ga0501074_0611135 | 3300049590 | Bacteria | 771 |
| 779 | Ga0501081_0030387 | 3300049743 | Bacteria | 3657 |
| 780 | Ga0501035_0003639 | 3300049822 | Bacteria | 14701 |
| 781 | Ga0501044_0014311 | 3300049823 | Bacteria | 8564 |
| 782 | Ga0501044_0367579 | 3300049823 | Bacteria | 1355 |
| 783 | nmdc:mga05p37_114234_c1 | 3300050507 | Bacteria | 3319 |
| 784 | nmdc:mga05p37_23272_c1 | 3300050507 | Bacteria | 7515 |
| 785 | nmdc:mga05p37_3122_c1 | 3300050507 | Bacteria | 19253 |
| 786 | nmdc:mga05p37_403308_c1 | 3300050507 | Bacteria | 1596 |
| 787 | nmdc:mga09592_218816_c1 | 3300050508 | Bacteria | 1650 |
| 788 | nmdc:mga09592_310947_c1 | 3300050508 | Bacteria | 1365 |
| 789 | nmdc:mga09592_65809_c1 | 3300050508 | Bacteria | 3071 |
| 790 | nmdc:mga09592_686808_c1 | 3300050508 | Bacteria | 872 |
| 791 | nmdc:mga09592_794_c1 | 3300050508 | Bacteria | 24428 |
| 792 | nmdc:mga0qj67_184682_c1 | 3300050509 | Bacteria | 1694 |
| 793 | nmdc:mga0qj67_193_c1 | 3300050509 | Bacteria | 41569 |
| 794 | nmdc:mga06r32_275_c1 | 3300050510 | Bacteria | 42703 |
| 795 | nmdc:mga08y16_17213_c1 | 3300050511 | Bacteria | 7608 |
| 796 | nmdc:mga08y16_23121_c1 | 3300050511 | Bacteria | 6563 |
| 797 | nmdc:mga08y16_36108_c1 | 3300050511 | Bacteria | 5190 |
| 798 | nmdc:mga0n895_17176_c1 | 3300050512 | Bacteria | 6667 |
| 799 | nmdc:mga0n895_817_c1 | 3300050512 | Bacteria | 22316 |
| 800 | nmdc:mga0rr50_134000_c1 | 3300050513 | Bacteria | 1987 |
| 801 | nmdc:mga0rr50_18813_c1 | 3300050513 | Bacteria | 4649 |
| 802 | nmdc:mga08x19_43131_c1 | 3300050514 | Bacteria | 2878 |
| 803 | nmdc:mga08x19_7720_c1 | 3300050514 | Bacteria | 6389 |
| 804 | nmdc:mga0a205_115161_c1 | 3300050515 | Bacteria | 2587 |
| 805 | nmdc:mga0a205_2688_c1 | 3300050515 | Bacteria | 15721 |
| 806 | Ga0495601_0116582 | 3300053077 | Bacteria | 1732 |
| 807 | Ga0495612_0028133 | 3300053078 | Bacteria | 2263 |
| 808 | Ga0495595_0299010 | 3300053084 | Bacteria | 809 |
| 809 | Ga0500644_0094970 | 3300053088 | Bacteria | 1123 |
| 810 | Ga0500644_0181320 | 3300053088 | Bacteria | 862 |
| 811 | Ga0500646_0113347 | 3300053090 | Bacteria | 864 |
| 812 | Ga0500651_0075899 | 3300053093 | Bacteria | 2088 |
| 813 | Ga0500650_0046332 | 3300053098 | Bacteria | 2015 |
| 814 | Ga0500556_0149814 | 3300053104 | Bacteria | 919 |
| 815 | Ga0500569_013798 | 3300053109 | Bacteria | 1987 |
| 816 | Ga0500569_041536 | 3300053109 | Bacteria | 1350 |
| 817 | Ga0500594_0005937 | 3300053118 | Bacteria | 2723 |
| 818 | Ga0500652_047732 | 3300053131 | Bacteria | 1741 |
| 819 | Ga0500622_0343434 | 3300053156 | Bacteria | 622 |
| 820 | Ga0500630_041869 | 3300053159 | Bacteria | 2235 |
| 821 | Ga0500611_065971 | 3300053727 | Bacteria | 870 |
| 822 | Ga0466962_0004333 | 3300061719 | Bacteria | 6804 |
| 823 | Ga0466962_0024358 | 3300061719 | Bacteria | 2907 |
| 824 | Ga0466962_0027031 | 3300061719 | Bacteria | 2755 |
| 825 | Ga0466962_0037854 | 3300061719 | Bacteria | 2311 |
| 826 | Ga0466962_0110891 | 3300061719 | Bacteria | 1321 |
| 827 | Ga0466962_0277431 | 3300061719 | Bacteria | 827 |
| 828 | 2501942795 | 2501939600 | Bacteria | 6907073 |
| 829 | 2515494886 | 2515154088 | Bacteria | 5526283 |
| 830 | 2515718890 | 2515154129 | Bacteria | 5584369 |
| 831 | 2515755549 | 2515154137 | Bacteria | 5711575 |
| 832 | 2516083102 | 2515154202 | Bacteria | 5471270 |
| 833 | 2516090188 | 2515154203 | Bacteria | 5458536 |
| 834 | 2623587992 | 2622736626 | Bacteria | 7181580 |
| 835 | 2676487071 | 2675903059 | Bacteria | 8644972 |
| 836 | 2753268965 | 2751185782 | Bacteria | 11227053 |
| 837 | 2772643624 | 2772190715 | Bacteria | 6959372 |
| 838 | 2831936637 | 2831935698 | Bacteria | 5963223 |
| 839 | 2832008509 | 2832004796 | Bacteria | 6538017 |
| 840 | 2855675206 | 2855670206 | Bacteria | 7120389 |
| 841 | 2855681985 | 2855676851 | Bacteria | 7063653 |
| 842 | 2856862019 | 2856858025 | Bacteria | 7255264 |
| 843 | 2857289216 | 2857288857 | Bacteria | 7189066 |
| 844 | 2858850038 | 2858848962 | Bacteria | 6963058 |
| 845 | 2858873548 | 2858868258 | Bacteria | 7683772 |
| 846 | 2858883450 | 2858882152 | Bacteria | 7230291 |
| 847 | 2858891941 | 2858888857 | Bacteria | 7060307 |
| 848 | 2858899370 | 2858895516 | Bacteria | 7378898 |
| 849 | 2858907812 | 2858902515 | Bacteria | 7086037 |
| 850 | 2866065300 | 2866065130 | Bacteria | 6518152 |
| 851 | 2867307810 | 2867302475 | Bacteria | 7087181 |
| 852 | 2867319125 | 2867312974 | Bacteria | 7058875 |
| 853 | 2867320130 | 2867319477 | Bacteria | 7069771 |
| 854 | 2867508613 | 2867507094 | Bacteria | 6506033 |
| 855 | 2869049124 | 2869048445 | Bacteria | 6875584 |
| 856 | 2869067980 | 2869061728 | Bacteria | 7112407 |
| 857 | 2869073409 | 2869068681 | Bacteria | 7205615 |
| 858 | 2880492067 | 2880489317 | Bacteria | 7096270 |
| 859 | 2880500231 | 2880495981 | Bacteria | 7340502 |
| 860 | 2887486833 | 2887478801 | Bacteria | 8972725 |
| 861 | 2902586685 | 2902582711 | Bacteria | 6187705 |
| 862 | 2929228782 | 2929226422 | Bacteria | 7248583 |
| 863 | 2996227947 | 2996221748 | Bacteria | 6799777 |
| 864 | 649812619 | 649633069 | Bacteria | 6962533 |
| 865 | 8001786839 | 8001781756 | Bacteria | 9586736 |
| 866 | 8003833900 | 8003830390 | Bacteria | 6541657 |
| 867 | 8003877391 | 8003870546 | Bacteria | 7396674 |
| 868 | 8054707130 | 8054704163 | Bacteria | 7247792 |
| 869 | 8054731783 | 8054727385 | Bacteria | 7558670 |
| 870 | 8054738929 | 8054734606 | Bacteria | 6947278 |
| 871 | 8057568556 | 8057568493 | Bacteria | 7221719 |
| 872 | Ga0207647_10055132 | |||
| 873 | JGI24752J21851_1007691 | |||
| 874 | JGI24737J22298_10140561 | |||
| 875 | JGI24743J22301_10013365 | |||
| 876 | Ga0070658_10004108 | |||
| 877 | Ga0070658_10007218 | |||
| 878 | Ga0070658_10034494 | |||
| 879 | Ga0070658_10045665 | |||
| 880 | Ga0070658_10094025 | |||
| 881 | Ga0070676_10018940 | |||
| 882 | Ga0070676_10041823 | |||
| 883 | Ga0070676_10067118 | |||
| 884 | Ga0070683_100022848 | |||
| 885 | Ga0070683_100331578 | |||
| 886 | Ga0070683_100389617 | |||
| 887 | Ga0070683_100625139 | |||
| 888 | Ga0070683_101031459 | |||
| 889 | Ga0070690_100142339 | |||
| 890 | Ga0070670_100001599 | |||
| 891 | Ga0070670_100030363 | |||
| 892 | Ga0068869_100002346 | |||
| 893 | Ga0068869_100009523 | |||
| 894 | Ga0068869_100020146 | |||
| 895 | Ga0068869_100107729 | |||
| 896 | Ga0068869_100706463 | |||
| 897 | Ga0070666_10072372 | |||
| 898 | Ga0070680_100026701 | |||
| 899 | Ga0070680_100044687 | |||
| 900 | Ga0070680_100116716 | |||
| 901 | Ga0070680_100117095 | |||
| 902 | Ga0070680_100218692 | |||
| 903 | Ga0070680_100296846 | |||
| 904 | Ga0070682_100001498 | |||
| 905 | Ga0070682_100017404 | |||
| 906 | Ga0068868_100003533 | |||
| 907 | Ga0068868_100039320 | |||
| 908 | Ga0068868_100043967 | |||
| 909 | Ga0070660_100037288 | |||
| 910 | Ga0070660_100065551 | |||
| 911 | Ga0070660_100079237 | |||
| 912 | Ga0070660_100238247 | |||
| 913 | Ga0070660_100418678 | |||
| 914 | Ga0070689_100046920 | |||
| 915 | Ga0070689_100786756 | |||
| 916 | Ga0070689_101083404 | |||
| 917 | Ga0070691_10012601 | |||
| 918 | Ga0070691_10024547 | |||
| 919 | Ga0070691_10266132 | |||
| 920 | Ga0070661_100006318 | |||
| 921 | Ga0070661_100014991 | |||
| 922 | Ga0070692_10017484 | |||
| 923 | Ga0070692_10054129 | |||
| 924 | Ga0070692_10229753 | |||
| 925 | Ga0070668_100003772 | |||
| 926 | Ga0070668_100819008 | |||
| 927 | Ga0070668_101180683 | |||
| 928 | Ga0070669_100338303 | |||
| 929 | Ga0070675_100009094 | |||
| 930 | Ga0070675_100010560 | |||
| 931 | Ga0070675_100011908 | |||
| 932 | Ga0070675_100852218 | |||
| 933 | Ga0070671_100002713 | |||
| 934 | Ga0070671_100026821 | |||
| 935 | Ga0070671_100333584 | |||
| 936 | Ga0070673_100059250 | |||
| 937 | Ga0070673_100247476 | |||
| 938 | Ga0070659_100000619 | |||
| 939 | Ga0070659_100047992 | |||
| 940 | Ga0070659_100285251 | |||
| 941 | Ga0070659_100292158 | |||
| 942 | Ga0070659_100296848 | |||
| 943 | Ga0070709_10089432 | |||
| 944 | Ga0070709_10261928 | |||
| 945 | Ga0070714_100022172 | |||
| 946 | Ga0070714_100058439 | |||
| 947 | Ga0070714_100059168 | |||
| 948 | Ga0070714_100244639 | |||
| 949 | Ga0070713_100007535 | |||
| 950 | Ga0070713_100009883 | |||
| 951 | Ga0070713_100012018 | |||
| 952 | Ga0070713_100054431 | |||
| 953 | Ga0070713_100139405 | |||
| 954 | Ga0070713_100404284 | |||
| 955 | Ga0070713_100422604 | |||
| 956 | Ga0070713_100693965 | |||
| 957 | Ga0070713_100737038 | |||
| 958 | Ga0070710_10015850 | |||
| 959 | Ga0070711_100232973 | |||
| 960 | Ga0070708_100262332 | |||
| 961 | Ga0070663_100003535 | |||
| 962 | Ga0070663_100018807 | |||
| 963 | Ga0070663_100025083 | |||
| 964 | Ga0070663_100154621 | |||
| 965 | Ga0070678_100012017 | |||
| 966 | Ga0070678_100027089 | |||
| 967 | Ga0070662_100004777 | |||
| 968 | Ga0070681_10027526 | |||
| 969 | Ga0070681_10040253 | |||
| 970 | Ga0070681_10144931 | |||
| 971 | Ga0070681_10200375 | |||
| 972 | Ga0070685_10230521 | |||
| 973 | Ga0070698_100007787 | |||
| 974 | Ga0070679_100027848 | |||
| 975 | Ga0070679_100039513 | |||
| 976 | Ga0070679_100175965 | |||
| 977 | Ga0070679_100279840 | |||
| 978 | Ga0070679_100302185 | |||
| 979 | Ga0070684_100004536 | |||
| 980 | Ga0070684_100022936 | |||
| 981 | Ga0070684_100202129 | |||
| 982 | Ga0070684_100268632 | |||
| 983 | Ga0070684_100631548 | |||
| 984 | Ga0068853_100093781 | |||
| 985 | Ga0070672_100319326 | |||
| 986 | Ga0070686_100097288 | |||
| 987 | Ga0070686_100168396 | |||
| 988 | Ga0070693_100046882 | |||
| 989 | Ga0070693_100067949 | |||
| 990 | Ga0070693_100175460 | |||
| 991 | Ga0070665_100040551 | |||
| 992 | Ga0070665_100111833 | |||
| 993 | Ga0070665_100488888 | |||
| 994 | Ga0070665_100584623 | |||
| 995 | Ga0068855_100035399 | |||
| 996 | Ga0068855_100063345 | |||
| 997 | Ga0068855_100274977 | |||
| 998 | Ga0068855_100388553 | |||
| 999 | Ga0068855_100389668 | |||
| 1000 | Ga0068855_100446897 | |||
| 1001 | Ga0070664_100010112 | |||
| 1002 | Ga0070664_100286852 | |||
| 1003 | Ga0070664_100630291 | |||
| 1004 | Ga0068857_100028443 | |||
| 1005 | Ga0068857_100226797 | |||
| 1006 | Ga0068857_100716398 | |||
| 1007 | Ga0068854_100028810 | |||
| 1008 | Ga0068854_100033242 | |||
| 1009 | Ga0068856_100021030 | |||
| 1010 | Ga0068856_100120372 | |||
| 1011 | Ga0068856_100218007 | |||
| 1012 | Ga0068856_100428211 | |||
| 1013 | Ga0068856_100579024 | |||
| 1014 | Ga0068856_100796674 | |||
| 1015 | Ga0070702_100000171 | |||
| 1016 | Ga0070702_100019326 | |||
| 1017 | Ga0068852_100022896 | |||
| 1018 | Ga0068852_100049930 | |||
| 1019 | Ga0068859_100035566 | |||
| 1020 | Ga0068859_100061735 | |||
| 1021 | Ga0068859_101766751 | |||
| 1022 | Ga0068864_100017115 | |||
| 1023 | Ga0068864_100057896 | |||
| 1024 | Ga0068864_100126761 | |||
| 1025 | Ga0068861_100514410 | |||
| 1026 | Ga0068861_100630011 | |||
| 1027 | Ga0068851_10014261 | |||
| 1028 | Ga0068870_10000071 | |||
| 1029 | Ga0068870_10000371 | |||
| 1030 | Ga0068863_100003726 | |||
| 1031 | Ga0068863_100006202 | |||
| 1032 | Ga0068863_100031033 | |||
| 1033 | Ga0068863_100236320 | |||
| 1034 | Ga0068858_100003961 | |||
| 1035 | Ga0068858_100017430 | |||
| 1036 | Ga0068858_100107503 | |||
| 1037 | Ga0068858_100304478 | |||
| 1038 | Ga0068860_100096313 | |||
| 1039 | Ga0068862_100016202 | |||
| 1040 | Ga0068862_100085630 | |||
| 1041 | Ga0068862_100556443 | |||
| 1042 | Ga0068862_101129028 | |||
| 1043 | Ga0081540_1002336 | |||
| 1044 | Ga0081540_1163080 | |||
| 1045 | Ga0081540_1169948 | |||
| 1046 | Ga0081539_10004135 | |||
| 1047 | Ga0081539_10008632 | |||
| 1048 | Ga0081539_10010950 | |||
| 1049 | Ga0081539_10016044 | |||
| 1050 | Ga0081539_10098252 | |||
| 1051 | Ga0070717_10144823 | |||
| 1052 | Ga0070717_10606028 | |||
| 1053 | Ga0070716_100749409 | |||
| 1054 | Ga0070712_100028718 | |||
| 1055 | Ga0070712_100147470 | |||
| 1056 | Ga0070712_100291114 | |||
| 1057 | Ga0097621_100063494 | |||
| 1058 | Ga0097621_100644023 | |||
| 1059 | Ga0097621_100866122 | |||
| 1060 | Ga0068871_100100812 | |||
| 1061 | Ga0075428_100004276 | |||
| 1062 | Ga0075428_100060342 | |||
| 1063 | Ga0075428_100135071 | |||
| 1064 | Ga0075428_100151360 | |||
| 1065 | Ga0075428_100232463 | |||
| 1066 | Ga0075430_100035603 | |||
| 1067 | Ga0075430_100195361 | |||
| 1068 | Ga0075431_100003257 | |||
| 1069 | Ga0075431_100396024 | |||
| 1070 | Ga0075431_100402127 | |||
| 1071 | Ga0075433_10004022 | |||
| 1072 | Ga0075433_10097647 | |||
| 1073 | Ga0075434_100001779 | |||
| 1074 | Ga0075434_100010778 | |||
| 1075 | Ga0075429_100000244 | |||
| 1076 | Ga0075429_100036349 | |||
| 1077 | Ga0075429_100037400 | |||
| 1078 | Ga0075429_100314559 | |||
| 1079 | Ga0068865_100190093 | |||
| 1080 | Ga0075436_100009808 | |||
| 1081 | Ga0075436_100017369 | |||
| 1082 | Ga0097620_100035566 | |||
| 1083 | Ga0097620_100061733 | |||
| 1084 | Ga0097620_101766407 | |||
| 1085 | Ga0075435_100004529 | |||
| 1086 | Ga0075435_100011752 | |||
| 1087 | Ga0105251_10017112 | |||
| 1088 | Ga0105244_10164505 | |||
| 1089 | Ga0105240_10045960 | |||
| 1090 | Ga0105240_10121183 | |||
| 1091 | Ga0105240_10125769 | |||
| 1092 | Ga0105240_11746079 | |||
| 1093 | Ga0111539_10025523 | |||
| 1094 | Ga0111539_10308872 | |||
| 1095 | Ga0111539_11980312 | |||
| 1096 | Ga0105245_10021743 | |||
| 1097 | Ga0105245_10045369 | |||
| 1098 | Ga0105245_10207857 | |||
| 1099 | Ga0105245_10328942 | |||
| 1100 | Ga0105245_11219362 | |||
| 1101 | Ga0105247_10000578 | |||
| 1102 | Ga0105247_10009301 | |||
| 1103 | Ga0105247_10015202 | |||
| 1104 | Ga0105247_10439378 | |||
| 1105 | Ga0114129_10000723 | |||
| 1106 | Ga0114129_10053320 | |||
| 1107 | Ga0114129_10129285 | |||
| 1108 | Ga0114129_10635809 | |||
| 1109 | Ga0114129_11436832 | |||
| 1110 | Ga0105243_10208195 | |||
| 1111 | Ga0105243_10332423 | |||
| 1112 | Ga0105241_10004726 | |||
| 1113 | Ga0105241_10087958 | |||
| 1114 | Ga0105248_10045442 | |||
| 1115 | Ga0105248_10244302 | |||
| 1116 | Ga0105237_10048028 | |||
| 1117 | Ga0105237_10160031 | |||
| 1118 | Ga0105237_10450282 | |||
| 1119 | Ga0105237_10451993 | |||
| 1120 | Ga0105237_10532733 | |||
| 1121 | Ga0105237_11142597 | |||
| 1122 | Ga0105238_10056000 | |||
| 1123 | Ga0105238_10128092 | |||
| 1124 | Ga0105238_10181055 | |||
| 1125 | Ga0105238_10366559 | |||
| 1126 | Ga0105249_10280513 | |||
| 1127 | Ga0105239_10098213 | |||
| 1128 | Ga0105239_10216350 | |||
| 1129 | Ga0105239_10272814 | |||
| 1130 | Ga0105239_10997353 | |||
| 1131 | Ga0105239_11052466 | |||
| 1132 | Ga0105239_12289298 | |||
| 1133 | Ga0105246_10000293 | |||
| 1134 | Ga0105246_10000478 | |||
| 1135 | Ga0105246_10649315 | |||
| 1136 | Ga0157373_10148071 | |||
| 1137 | Ga0157373_10203843 | |||
| 1138 | Ga0157371_10046257 | |||
| 1139 | Ga0157371_10052250 | |||
| 1140 | Ga0157371_10065918 | |||
| 1141 | Ga0157371_10236099 | |||
| 1142 | Ga0157370_10021623 | |||
| 1143 | Ga0157370_10036347 | |||
| 1144 | Ga0157370_10295791 | |||
| 1145 | Ga0157370_10361586 | |||
| 1146 | Ga0157370_10805028 | |||
| 1147 | Ga0157369_10004575 | |||
| 1148 | Ga0157369_10004788 | |||
| 1149 | Ga0157369_10024369 | |||
| 1150 | Ga0157369_10071305 | |||
| 1151 | Ga0157369_10071634 | |||
| 1152 | Ga0157369_10135433 | |||
| 1153 | Ga0157369_10147048 | |||
| 1154 | Ga0157369_10247304 | |||
| 1155 | Ga0157369_10608713 | |||
| 1156 | Ga0157369_10713360 | |||
| 1157 | Ga0157369_10768854 | |||
| 1158 | Ga0157374_10051088 | |||
| 1159 | Ga0157374_10075075 | |||
| 1160 | Ga0157374_10642813 | |||
| 1161 | Ga0163162_10265665 | |||
| 1162 | Ga0163162_10463406 | |||
| 1163 | Ga0157375_10016266 | |||
| 1164 | Ga0157375_10385333 | |||
| 1165 | Ga0163163_10059376 | |||
| 1166 | Ga0163163_10083601 | |||
| 1167 | Ga0163163_10138016 | |||
| 1168 | Ga0163163_10314691 | |||
| 1169 | Ga0163163_10667284 | |||
| 1170 | Ga0157380_10117386 | |||
| 1171 | Ga0182008_10330389 | |||
| 1172 | Ga0182008_10362009 | |||
| 1173 | Ga0157377_10064788 | |||
| 1174 | Ga0157377_10068681 | |||
| 1175 | Ga0157377_10626577 | |||
| 1176 | Ga0157379_10000076 | |||
| 1177 | Ga0157379_10088446 | |||
| 1178 | Ga0157379_10092231 | |||
| 1179 | Ga0157376_10249267 | |||
| 1180 | Ga0157376_10263866 | |||
| 1181 | Ga0157376_11064481 | |||
| 1182 | Ga0163161_10702572 | |||
| 1183 | Ga0197907_11071090 | |||
| 1184 | Ga0206356_10034341 | |||
| 1185 | Ga0206355_1226558 | |||
| 1186 | Ga0206351_10259414 | |||
| 1187 | Ga0206354_10516870 | |||
| 1188 | Ga0206354_10545188 | |||
| 1189 | Ga0206354_10624629 | |||
| 1190 | Ga0206353_10343003 | |||
| 1191 | Ga0206353_10403903 | |||
| 1192 | Ga0206353_10614142 | |||
| 1193 | Ga0206353_10624157 | |||
| 1194 | Ga0206353_11253613 | |||
| 1195 | Ga0213874_10037177 | |||
| 1196 | Ga0213876_10001219 | |||
| 1197 | Ga0213875_10096770 | |||
| 1198 | Ga0224712_10081991 | |||
| 1199 | Ga0224712_10088256 | |||
| 1200 | Ga0224712_10104348 | |||
| 1201 | Ga0224712_10135716 | |||
| 1202 | Ga0224712_10318589 | |||
| 1203 | Ga0207656_10006329 | |||
| 1204 | Ga0207656_10018219 | |||
| 1205 | Ga0207713_1064019 | |||
| 1206 | Ga0207692_10068602 | |||
| 1207 | Ga0207642_10171968 | |||
| 1208 | Ga0207710_10000023 | |||
| 1209 | Ga0207710_10018127 | |||
| 1210 | Ga0207710_10020248 | |||
| 1211 | Ga0207688_10012543 | |||
| 1212 | Ga0207688_10036476 | |||
| 1213 | Ga0207688_10218527 | |||
| 1214 | Ga0207680_10296976 | |||
| 1215 | Ga0207647_10064296 | |||
| 1216 | Ga0207647_10141142 | |||
| 1217 | Ga0207647_10141341 | |||
| 1218 | Ga0207685_10011482 | |||
| 1219 | Ga0207699_10011845 | |||
| 1220 | Ga0207699_10022015 | |||
| 1221 | Ga0207699_10057501 | |||
| 1222 | Ga0207699_10552288 | |||
| 1223 | Ga0207645_10047739 | |||
| 1224 | Ga0207645_10101305 | |||
| 1225 | Ga0207643_10000022 | |||
| 1226 | Ga0207643_10000102 | |||
| 1227 | Ga0207705_10000595 | |||
| 1228 | Ga0207705_10011904 | |||
| 1229 | Ga0207705_10037678 | |||
| 1230 | Ga0207705_10050136 | |||
| 1231 | Ga0207705_10412011 | |||
| 1232 | Ga0207684_10445923 | |||
| 1233 | Ga0207654_10294600 | |||
| 1234 | Ga0207707_10015744 | |||
| 1235 | Ga0207707_10058525 | |||
| 1236 | Ga0207707_10070314 | |||
| 1237 | Ga0207707_10229764 | |||
| 1238 | Ga0207707_10448486 | |||
| 1239 | Ga0207695_10513805 | |||
| 1240 | Ga0207695_11230478 | |||
| 1241 | Ga0207671_10023017 | |||
| 1242 | Ga0207693_10006163 | |||
| 1243 | Ga0207693_10021091 | |||
| 1244 | Ga0207693_10496861 | |||
| 1245 | Ga0207663_10866481 | |||
| 1246 | Ga0207660_10027222 | |||
| 1247 | Ga0207660_10047641 | |||
| 1248 | Ga0207660_10150580 | |||
| 1249 | Ga0207657_10043599 | |||
| 1250 | Ga0207657_10051901 | |||
| 1251 | Ga0207657_10092164 | |||
| 1252 | Ga0207657_10179941 | |||
| 1253 | Ga0207657_10555313 | |||
| 1254 | Ga0207649_10015181 | |||
| 1255 | Ga0207649_10039068 | |||
| 1256 | Ga0207649_10258329 | |||
| 1257 | Ga0207652_10032827 | |||
| 1258 | Ga0207652_10218502 | |||
| 1259 | Ga0207652_10240194 | |||
| 1260 | Ga0207652_10306968 | |||
| 1261 | Ga0207652_10342206 | |||
| 1262 | Ga0207652_10454319 | |||
| 1263 | Ga0207681_10912205 | |||
| 1264 | Ga0207694_10076256 | |||
| 1265 | Ga0207694_10845073 | |||
| 1266 | Ga0207650_10017555 | |||
| 1267 | Ga0207650_10019927 | |||
| 1268 | Ga0207659_10005909 | |||
| 1269 | Ga0207659_10033050 | |||
| 1270 | Ga0207659_10162960 | |||
| 1271 | Ga0207687_10003225 | |||
| 1272 | Ga0207687_10010510 | |||
| 1273 | Ga0207687_10128449 | |||
| 1274 | Ga0207687_10229509 | |||
| 1275 | Ga0207700_10009719 | |||
| 1276 | Ga0207700_10035764 | |||
| 1277 | Ga0207700_10046521 | |||
| 1278 | Ga0207700_10095334 | |||
| 1279 | Ga0207700_10098357 | |||
| 1280 | Ga0207700_10118142 | |||
| 1281 | Ga0207700_10385742 | |||
| 1282 | Ga0207700_10783375 | |||
| 1283 | Ga0207664_10001757 | |||
| 1284 | Ga0207664_10039091 | |||
| 1285 | Ga0207664_10116066 | |||
| 1286 | Ga0207664_10226503 | |||
| 1287 | Ga0207664_10261864 | |||
| 1288 | Ga0207664_10347810 | |||
| 1289 | Ga0207664_10396591 | |||
| 1290 | Ga0207644_10008498 | |||
| 1291 | Ga0207644_10156128 | |||
| 1292 | Ga0207690_10000575 | |||
| 1293 | Ga0207690_10008450 | |||
| 1294 | Ga0207690_10404635 | |||
| 1295 | Ga0207690_10588759 | |||
| 1296 | Ga0207690_10712280 | |||
| 1297 | Ga0207706_10005138 | |||
| 1298 | Ga0207709_10807725 | |||
| 1299 | Ga0207670_10012052 | |||
| 1300 | Ga0207665_10094970 | |||
| 1301 | Ga0207691_10015226 | |||
| 1302 | Ga0207691_10111426 | |||
| 1303 | Ga0207711_10384542 | |||
| 1304 | Ga0207711_10477324 | |||
| 1305 | Ga0207689_10001185 | |||
| 1306 | Ga0207689_10003272 | |||
| 1307 | Ga0207689_10005316 | |||
| 1308 | Ga0207689_10133476 | |||
| 1309 | Ga0207689_10499310 | |||
| 1310 | Ga0207661_10002483 | |||
| 1311 | Ga0207661_10010323 | |||
| 1312 | Ga0207661_10244144 | |||
| 1313 | Ga0207661_10253248 | |||
| 1314 | Ga0207661_10287846 | |||
| 1315 | Ga0207661_10742332 | |||
| 1316 | Ga0207679_10019242 | |||
| 1317 | Ga0207679_10023587 | |||
| 1318 | Ga0207679_10071691 | |||
| 1319 | Ga0207679_10297411 | |||
| 1320 | Ga0207667_10017863 | |||
| 1321 | Ga0207667_10270394 | |||
| 1322 | Ga0207651_10040032 | |||
| 1323 | Ga0207651_10092859 | |||
| 1324 | Ga0207668_10001583 | |||
| 1325 | Ga0207668_10584755 | |||
| 1326 | Ga0207640_10011075 | |||
| 1327 | Ga0207640_10070703 | |||
| 1328 | Ga0207658_10061354 | |||
| 1329 | Ga0207658_10075097 | |||
| 1330 | Ga0207677_10029651 | |||
| 1331 | Ga0207677_10038111 | |||
| 1332 | Ga0207677_10175092 | |||
| 1333 | Ga0207703_10000003 | |||
| 1334 | Ga0207703_10087459 | |||
| 1335 | Ga0207703_10320078 | |||
| 1336 | Ga0207639_10163771 | |||
| 1337 | Ga0207639_10629992 | |||
| 1338 | Ga0207678_10000141 | |||
| 1339 | Ga0207678_10001333 | |||
| 1340 | Ga0207678_10004168 | |||
| 1341 | Ga0207678_10059214 | |||
| 1342 | Ga0207678_10064609 | |||
| 1343 | Ga0207678_10084789 | |||
| 1344 | Ga0207678_10543241 | |||
| 1345 | Ga0207708_10015814 | |||
| 1346 | Ga0207708_10064175 | |||
| 1347 | Ga0207702_10000567 | |||
| 1348 | Ga0207702_10006389 | |||
| 1349 | Ga0207702_10064519 | |||
| 1350 | Ga0207702_10297173 | |||
| 1351 | Ga0207702_10485094 | |||
| 1352 | Ga0207641_10008900 | |||
| 1353 | Ga0207641_10033796 | |||
| 1354 | Ga0207676_10000814 | |||
| 1355 | Ga0207676_10000974 | |||
| 1356 | Ga0207676_10685772 | |||
| 1357 | Ga0207674_10013397 | |||
| 1358 | Ga0207674_10032237 | |||
| 1359 | Ga0207674_10784124 | |||
| 1360 | Ga0207675_100141707 | |||
| 1361 | Ga0207675_100231589 | |||
| 1362 | Ga0207675_100599876 | |||
| 1363 | Ga0207683_10000171 | |||
| 1364 | Ga0207683_10002042 | |||
| 1365 | Ga0207683_10180428 | |||
| 1366 | Ga0207683_10562757 | |||
| 1367 | Ga0207698_10038926 | |||
| 1368 | Ga0207698_10109663 | |||
| 1369 | Ga0207698_10140302 | |||
| 1370 | Ga0207698_10373447 | |||
| 1371 | Ga0207698_10628340 | |||
| 1372 | Ga0207428_10031502 | |||
| 1373 | Ga0207428_10063708 | |||
| 1374 | Ga0268266_10025102 | |||
| 1375 | Ga0268266_10026732 | |||
| 1376 | Ga0268266_10110251 | |||
| 1377 | Ga0268266_10431383 | |||
| 1378 | Ga0268265_10055749 | |||
| 1379 | Ga0268265_10069153 | |||
| 1380 | Ga0265338_10008011 | |||
| 1381 | Ga0265338_10079175 | |||
| 1382 | Ga0307512_10034068 | |||
| 1383 | Ga0307512_10126895 | |||
| 1384 | Ga0265773_1017838 | |||
| 1385 | Ga0307513_10005579 | |||
| 1386 | Ga0307513_10030700 | |||
| 1387 | Ga0307513_10086372 | |||
| 1388 | Ga0307513_10481890 | |||
| 1389 | Ga0307509_10007679 | |||
| 1390 | Ga0307509_10442742 | |||
| 1391 | Ga0307508_10005865 | |||
| 1392 | Ga0307508_10037730 | |||
| 1393 | Ga0307508_10237079 | |||
| 1394 | Ga0307516_10000395 | |||
| 1395 | Ga0307516_10080920 | |||
| 1396 | Ga0307405_10043892 | |||
| 1397 | Ga0307405_10093648 | |||
| 1398 | Ga0307405_10488112 | |||
| 1399 | Ga0307413_10124339 | |||
| 1400 | Ga0326468_10000491 | |||
| 1401 | Ga0307406_10069281 | |||
| 1402 | Ga0307406_10839138 | |||
| 1403 | Ga0307406_11014703 | |||
| 1404 | Ga0307407_10070006 | |||
| 1405 | Ga0307407_10232393 | |||
| 1406 | Ga0307412_10080851 | |||
| 1407 | Ga0307409_100289009 | |||
| 1408 | Ga0307409_100636361 | |||
| 1409 | Ga0307409_101080364 | |||
| 1410 | Ga0307416_100035028 | |||
| 1411 | Ga0307416_100735879 | |||
| 1412 | Ga0307416_101718006 | |||
| 1413 | Ga0307411_10334682 | |||
| 1414 | Ga0307415_100049996 | |||
| 1415 | Ga0307415_100136742 | |||
| 1416 | Ga0307415_100457012 | |||
| 1417 | Ga0307415_100550923 | |||
| 1418 | Ga0307415_100588348 | |||
| 1419 | Ga0307415_100663056 | |||
| 1420 | Ga0307507_10015989 | |||
| 1421 | Ga0307510_10092101 | |||
| 1422 | Ga0373923_0009629 | |||
| 1423 | Ga0373932_0050899 | |||
| 1424 | Ga0373953_0136844 | |||
| 1425 | Ga0373956_0003862 | |||
| 1426 | Ga0373957_0002593 | |||
| 1427 | Ga0373946_0062274 | |||
| 1428 | Ga0373955_0019462 | |||
| 1429 | Ga0373942_0000028 | |||
| 1430 | Ga0373924_0033184 | |||
| 1431 | Ga0373931_0143873 | |||
| 1432 | Ga0373931_0422240 | |||
| 1433 | Ga0373931_0551225 | |||
| 1434 | Ga0373935_0008810 | |||
| 1435 | Ga0373935_0068108 | |||
| 1436 | Ga0373933_0003332 | |||
| 1437 | Ga0373947_0112790 | |||
| 1438 | Ga0373947_0285097 | |||
| 1439 | Ga0372808_016503 | |||
| 1440 | Ga0373925_0000010 | |||
| 1441 | Ga0373925_0398061 | |||
| 1442 | Ga0395899_0072246 | |||
| 1443 | Ga0395900_0003750 | |||
| 1444 | Ga0395900_0791069 | |||
| 1445 | Ga0395898_0129786 | |||
| 1446 | Ga0395898_0163422 | |||
| 1447 | Ga0395898_0534207 | |||
| 1448 | Ga0395905_0001026 | |||
| 1449 | Ga0395905_0296375 | |||
| 1450 | Ga0395905_0364611 | |||
| 1451 | Ga0436364_1458938 | |||
| 1452 | Ga0395901_0004693 | |||
| 1453 | Ga0395901_0007057 | |||
| 1454 | Ga0395901_0253127 | |||
| 1455 | Ga0395901_0549152 | |||
| 1456 | Ga0436365_0093685 | |||
| 1457 | Ga0436365_0676582 | |||
| 1458 | Ga0436363_1466024 | |||
| 1459 | Ga0436362_0116484 | |||
| 1460 | Ga0451791_1528709 | |||
| 1461 | Ga0451843_0032912 | |||
| 1462 | Ga0451853_1832670 | |||
| 1463 | Ga0439448_0030051 | |||
| 1464 | Ga0439448_0137468 | |||
| 1465 | Ga0439450_054604 | |||
| 1466 | Ga0439455_0027923 | |||
| 1467 | Ga0439455_0040089 | |||
| 1468 | Ga0450905_014361 | |||
| 1469 | Ga0439459_0004962 | |||
| 1470 | Ga0439464_0184085 | |||
| 1471 | Ga0439464_0196136 | |||
| 1472 | Ga0439460_0124636 | |||
| 1473 | Ga0466969_0014966 | |||
| 1474 | Ga0466969_0162121 | |||
| 1475 | Ga0466972_0430287 | |||
| 1476 | Ga0466965_0047569 | |||
| 1477 | Ga0466965_0127189 | |||
| 1478 | Ga0466965_0249524 | |||
| 1479 | Ga0466965_0425797 | |||
| 1480 | Ga0466966_0006104 | |||
| 1481 | Ga0466966_0035166 | |||
| 1482 | Ga0466966_0036693 | |||
| 1483 | Ga0466966_0131742 | |||
| 1484 | Ga0466966_0165110 | |||
| 1485 | Ga0466966_0165275 | |||
| 1486 | Ga0466961_0005917 | |||
| 1487 | Ga0466961_0100722 | |||
| 1488 | Ga0466961_0108554 | |||
| 1489 | Ga0466961_0190930 | |||
| 1490 | Ga0466961_0282980 | |||
| 1491 | Ga0466961_0348220 | |||
| 1492 | Ga0466961_0392559 | |||
| 1493 | Ga0466963_0027413 | |||
| 1494 | Ga0466963_0068417 | |||
| 1495 | Ga0466963_0073346 | |||
| 1496 | Ga0466963_0076717 | |||
| 1497 | Ga0466963_0116103 | |||
| 1498 | Ga0466963_0122969 | |||
| 1499 | Ga0466963_0127240 | |||
| 1500 | Ga0466963_0135895 | |||
| 1501 | Ga0466963_0167966 | |||
| 1502 | Ga0466963_0412957 | |||
| 1503 | Ga0466963_0537745 | |||
| 1504 | Ga0466963_0579013 | |||
| 1505 | Ga0466964_0008863 | |||
| 1506 | Ga0466964_0150365 | |||
| 1507 | Ga0466964_0275540 | |||
| 1508 | Ga0466971_0019249 | |||
| 1509 | Ga0466971_0054142 | |||
| 1510 | Ga0466971_0099279 | |||
| 1511 | Ga0466970_0003376 | |||
| 1512 | Ga0466970_0075910 | |||
| 1513 | Ga0466970_0078835 | |||
| 1514 | Ga0466970_0245314 | |||
| 1515 | Ga0466970_0491867 | |||
| 1516 | Ga0466970_0709195 | |||
| 1517 | Ga0466957_0002757 | |||
| 1518 | Ga0466957_0052638 | |||
| 1519 | Ga0466957_0065992 | |||
| 1520 | Ga0466957_0172904 | |||
| 1521 | Ga0466957_0261510 | |||
| 1522 | Ga0466957_0376739 | |||
| 1523 | Ga0466957_0888633 | |||
| 1524 | Ga0466960_0060434 | |||
| 1525 | Ga0466960_0280592 | |||
| 1526 | Ga0466960_0659355 | |||
| 1527 | Ga0466959_0006200 | |||
| 1528 | Ga0466959_0011536 | |||
| 1529 | Ga0466959_0050084 | |||
| 1530 | Ga0466959_0097800 | |||
| 1531 | Ga0466959_0184811 | |||
| 1532 | Ga0466959_0208389 | |||
| 1533 | Ga0466959_0588687 | |||
| 1534 | Ga0466959_0626130 | |||
| 1535 | Ga0466958_0005392 | |||
| 1536 | Ga0466958_0022838 | |||
| 1537 | Ga0466958_0024961 | |||
| 1538 | Ga0466958_0054647 | |||
| 1539 | Ga0466958_0122227 | |||
| 1540 | Ga0466958_0201199 | |||
| 1541 | Ga0466967_0009511 | |||
| 1542 | Ga0466967_0009954 | |||
| 1543 | Ga0466967_0055695 | |||
| 1544 | Ga0466967_0056816 | |||
| 1545 | Ga0466967_0223613 | |||
| 1546 | Ga0466967_0253267 | |||
| 1547 | Ga0466967_0275470 | |||
| 1548 | Ga0466967_0568258 | |||
| 1549 | Ga0466967_0614735 | |||
| 1550 | Ga0466967_0832340 | |||
| 1551 | Ga0495592_0048601 | |||
| 1552 | Ga0495641_0049821 | |||
| 1553 | Ga0495651_0026022 | |||
| 1554 | Ga0495653_0051274 | |||
| 1555 | Ga0495664_0050622 | |||
| 1556 | Ga0495594_0021958 | |||
| 1557 | Ga0495608_0044401 | |||
| 1558 | Ga0495628_0066904 | |||
| 1559 | Ga0495630_0086263 | |||
| 1560 | Ga0495652_0011829 | |||
| 1561 | Ga0495640_0015352 | |||
| 1562 | Ga0495586_0104355 | |||
| 1563 | Ga0495587_0012448 | |||
| 1564 | Ga0495645_0030035 | |||
| 1565 | Ga0495667_0009505 | |||
| 1566 | Ga0495668_0000477 | |||
| 1567 | Ga0495625_0000969 | |||
| 1568 | Ga0495635_0203978 | |||
| 1569 | Ga0495657_0049412 | |||
| 1570 | Ga0495599_0009628 | |||
| 1571 | Ga0495623_0093311 | |||
| 1572 | Ga0495646_0279973 | |||
| 1573 | Ga0495658_0407263 | |||
| 1574 | Ga0495669_0031349 | |||
| 1575 | Ga0495613_0215063 | |||
| 1576 | Ga0495600_0059014 | |||
| 1577 | Ga0495604_0043232 | |||
| 1578 | Ga0495674_0070041 | |||
| 1579 | Ga0495676_0066299 | |||
| 1580 | Ga0495680_0028155 | |||
| 1581 | Ga0495680_0473922 | |||
| 1582 | Ga0495683_0128282 | |||
| 1583 | Ga0495675_0160813 | |||
| 1584 | Ga0495684_0015890 | |||
| 1585 | Ga0495602_0128972 | |||
| 1586 | Ga0495626_0000234 | |||
| 1587 | Ga0496100_0032464 | |||
| 1588 | Ga0496100_0277587 | |||
| 1589 | Ga0496101_0106525 | |||
| 1590 | Ga0496101_0117961 | |||
| 1591 | Ga0496102_0026483 | |||
| 1592 | Ga0496102_0055310 | |||
| 1593 | Ga0496103_0206255 | |||
| 1594 | Ga0496104_0014353 | |||
| 1595 | Ga0496104_0028303 | |||
| 1596 | Ga0496105_0000419 | |||
| 1597 | Ga0496105_0051856 | |||
| 1598 | Ga0496105_0207087 | |||
| 1599 | Ga0496105_0415302 | |||
| 1600 | Ga0496106_0017256 | |||
| 1601 | Ga0496106_0020477 | |||
| 1602 | Ga0496107_0194279 | |||
| 1603 | Ga0496108_0000149 | |||
| 1604 | Ga0496108_0016367 | |||
| 1605 | Ga0496108_0037214 | |||
| 1606 | Ga0496109_0066011 | |||
| 1607 | Ga0496109_0082676 | |||
| 1608 | Ga0496109_0168439 | |||
| 1609 | Ga0496109_0315005 | |||
| 1610 | Ga0496110_0007084 | |||
| 1611 | Ga0496110_0047056 | |||
| 1612 | Ga0496110_0126346 | |||
| 1613 | Ga0496110_0427477 | |||
| 1614 | Ga0496110_1022382 | |||
| 1615 | Ga0496111_0008978 | |||
| 1616 | Ga0496112_0016085 | |||
| 1617 | Ga0496112_0066577 | |||
| 1618 | Ga0496112_0515484 | |||
| 1619 | Ga0496113_0007473 | |||
| 1620 | Ga0496113_0261756 | |||
| 1621 | Ga0496114_0040956 | |||
| 1622 | Ga0496114_0093191 | |||
| 1623 | Ga0496115_0069245 | |||
| 1624 | Ga0496115_0074109 | |||
| 1625 | Ga0496115_0236609 | |||
| 1626 | Ga0496115_0510963 | |||
| 1627 | Ga0496119_0042137 | |||
| 1628 | Ga0496119_0067600 | |||
| 1629 | Ga0496121_0011363 | |||
| 1630 | Ga0496126_0012001 | |||
| 1631 | Ga0496126_0170916 | |||
| 1632 | Ga0496126_0406155 | |||
| 1633 | Ga0501031_0008755 | |||
| 1634 | Ga0501032_0000515 | |||
| 1635 | Ga0501033_0073236 | |||
| 1636 | Ga0501033_0286546 | |||
| 1637 | Ga0501034_0858214 | |||
| 1638 | Ga0501036_0670269 | |||
| 1639 | Ga0501038_0009857 | |||
| 1640 | Ga0501039_0113632 | |||
| 1641 | Ga0501043_0035771 | |||
| 1642 | Ga0501047_0002063 | |||
| 1643 | Ga0501047_0706726 | |||
| 1644 | Ga0501048_0000162 | |||
| 1645 | Ga0501048_0640916 | |||
| 1646 | Ga0501070_0028074 | |||
| 1647 | Ga0501071_0677535 | |||
| 1648 | Ga0501073_0126808 | |||
| 1649 | Ga0501074_0611135 | |||
| 1650 | Ga0501081_0030387 | |||
| 1651 | Ga0501035_0003639 | |||
| 1652 | Ga0501044_0014311 | |||
| 1653 | Ga0501044_0367579 | |||
| 1654 | nmdc:mga05p37_114234_c1 | |||
| 1655 | nmdc:mga05p37_23272_c1 | |||
| 1656 | nmdc:mga05p37_3122_c1 | |||
| 1657 | nmdc:mga05p37_403308_c1 | |||
| 1658 | nmdc:mga09592_218816_c1 | |||
| 1659 | nmdc:mga09592_310947_c1 | |||
| 1660 | nmdc:mga09592_65809_c1 | |||
| 1661 | nmdc:mga09592_686808_c1 | |||
| 1662 | nmdc:mga09592_794_c1 | |||
| 1663 | nmdc:mga0qj67_184682_c1 | |||
| 1664 | nmdc:mga0qj67_193_c1 | |||
| 1665 | nmdc:mga06r32_275_c1 | |||
| 1666 | nmdc:mga08y16_17213_c1 | |||
| 1667 | nmdc:mga08y16_23121_c1 | |||
| 1668 | nmdc:mga08y16_36108_c1 | |||
| 1669 | nmdc:mga0n895_17176_c1 | |||
| 1670 | nmdc:mga0n895_817_c1 | |||
| 1671 | nmdc:mga0rr50_134000_c1 | |||
| 1672 | nmdc:mga0rr50_18813_c1 | |||
| 1673 | nmdc:mga08x19_43131_c1 | |||
| 1674 | nmdc:mga08x19_7720_c1 | |||
| 1675 | nmdc:mga0a205_115161_c1 | |||
| 1676 | nmdc:mga0a205_2688_c1 | |||
| 1677 | Ga0495601_0116582 | |||
| 1678 | Ga0495612_0028133 | |||
| 1679 | Ga0495595_0299010 | |||
| 1680 | Ga0500644_0094970 | |||
| 1681 | Ga0500644_0181320 | |||
| 1682 | Ga0500646_0113347 | |||
| 1683 | Ga0500651_0075899 | |||
| 1684 | Ga0500650_0046332 | |||
| 1685 | Ga0500556_0149814 | |||
| 1686 | Ga0500569_013798 | |||
| 1687 | Ga0500569_041536 | |||
| 1688 | Ga0500594_0005937 | |||
| 1689 | Ga0500652_047732 | |||
| 1690 | Ga0500622_0343434 | |||
| 1691 | Ga0500630_041869 | |||
| 1692 | Ga0500611_065971 | |||
| 1693 | Ga0466962_0004333 | |||
| 1694 | Ga0466962_0024358 | |||
| 1695 | Ga0466962_0027031 | |||
| 1696 | Ga0466962_0037854 | |||
| 1697 | Ga0466962_0110891 | |||
| 1698 | Ga0466962_0277431 | |||
| 1699 | 2501942795 | |||
| 1700 | 2515494886 | |||
| 1701 | 2515718890 | |||
| 1702 | 2515755549 | |||
| 1703 | 2516083102 | |||
| 1704 | 2516090188 | |||
| 1705 | 2623587992 | |||
| 1706 | 2676487071 | |||
| 1707 | 2753268965 | |||
| 1708 | 2772643624 | |||
| 1709 | 2831936637 | |||
| 1710 | 2832008509 | |||
| 1711 | 2855675206 | |||
| 1712 | 2855681985 | |||
| 1713 | 2856862019 | |||
| 1714 | 2857289216 | |||
| 1715 | 2858850038 | |||
| 1716 | 2858873548 | |||
| 1717 | 2858883450 | |||
| 1718 | 2858891941 | |||
| 1719 | 2858899370 | |||
| 1720 | 2858907812 | |||
| 1721 | 2866065300 | |||
| 1722 | 2867307810 | |||
| 1723 | 2867319125 | |||
| 1724 | 2867320130 | |||
| 1725 | 2867508613 | |||
| 1726 | 2869049124 | |||
| 1727 | 2869067980 | |||
| 1728 | 2869073409 | |||
| 1729 | 2880492067 | |||
| 1730 | 2880500231 | |||
| 1731 | 2887486833 | |||
| 1732 | 2902586685 | |||
| 1733 | 2929228782 | |||
| 1734 | 2996227947 | |||
| 1735 | 649812619 | |||
| 1736 | 8001786839 | |||
| 1737 | 8003833900 | |||
| 1738 | 8003877391 | |||
| 1739 | 8054707130 | |||
| 1740 | 8054731783 | |||
| 1741 | 8054738929 | |||
| 1742 | 8057568556 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vcp-assembly1.cif.gz_A | crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin | 0.9639 | 3 | 147 |
| 5vcp-assembly2.cif.gz_B | crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin | 0.9636 | 3 | 147 |
| 5vcp-assembly2.cif.gz_D | crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin | 0.9616 | 2 | 147 |
| 5vcp-assembly1.cif.gz_C | crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin | 0.961 | 3 | 147 |
| 1lme-assembly2.cif.gz_B | crystal structure of peptide deformylase from thermotoga maritima | 0.961 | 1 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5vcpA00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9639 | 3 | 147 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9606 | 1 | 147 | 3.90.45.10 |
| af_Q9VGY2_49_232_3.90.45.10 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9555 | 6 | 149 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9542 | 1 | 147 | 3.90.45.10 |
| af_Q2G265_1_160_3.90.45.10 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9539 | 1 | 147 | 3.90.45.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A199ASU5-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9878 | 1 | 163 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A370IB39-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9834 | 1 | 162 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A4Q3ABE0-F1-model_v4 | Peptide deformylase (EC 3.5.1.88) | 0.9819 | 6 | 131 |
GO:0042586
GO:0043686 |
| AF-A0A7T0KCZ2-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9816 | 1 | 163 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A4U3M4C0-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9783 | 2 | 155 |
GO:0006412
GO:0042586 GO:0046872 |