F484166

General Info

Members Datasets Scaffolds Average Seq Length
870 389 823 172

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_001616|Ga0500618_001616_7842_8438
Length 198
Sequence MKAQMMVRTTLEKTMIAGAVAAIALASSAAFAAPLKVDAAKSTVGATFKQLNVPVDAKLKKFSAVIDFDAAKPESSKASVDIDVASFDLGDAEYNKEVQKKEWFNAAQFPKATFVTSSIKPSAGAAAGTKYDVAGKLTIKGKSTDVSFPLTVKKEGATQVFDGTLPIKRLTYNIGEGEWKDTSMVADEVSIKFHFVAQ

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
7 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
8 2643221645 Massilia sp. Root351 Isolate Unclassified
9 2738541280 Massilia sp. GV090 Isolate Unclassified
10 2738541297 Duganella sp. GV083 Isolate Unclassified
11 2738541300 Massilia sp. GV016 Isolate Unclassified
12 2738541357 Duganella sp. GV053 Isolate Unclassified
13 2738543003 Duganella sp. GV066 Isolate Unclassified
14 2738543018 Massilia sp. GV045 Isolate Unclassified
15 2738543026 Duganella sp. GV089 Isolate Unclassified
16 2738543029 Duganella sp. GV039 Isolate Unclassified
17 2738543030 Massilia sp. GV097 Isolate Unclassified
18 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
19 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
20 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
21 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
22 2818991436 Collimonas arenae 515 Isolate Unclassified
23 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
24 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
25 2821131069 Duganella sp. 1224 Isolate Unclassified
26 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
27 2842711865 Duganella sp. R-73148 Isolate Unclassified
28 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
29 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
30 2857558681 Duganella sp. R-74565 Isolate Unclassified
31 2857564685 Duganella sp. R-74599 Isolate Unclassified
32 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
33 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
34 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
35 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
36 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
37 2904424332 Duganella sp. 1411 Isolate Rhizosphere
38 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
39 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
40 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
41 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
42 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
43 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
44 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
45 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
46 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
47 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
48 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
49 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
50 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
51 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
52 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
53 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
54 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
55 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
56 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
57 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
58 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
59 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
60 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
61 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
62 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
63 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
64 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
65 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
66 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
67 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
68 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
69 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
70 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
71 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
74 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
75 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
76 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
77 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
78 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
79 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
80 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
81 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
82 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
83 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
84 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
87 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
88 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
89 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
90 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
91 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
92 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
93 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
94 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
95 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
98 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
144 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
145 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
156 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
223 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
224 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
225 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
226 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
227 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
230 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
276 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
277 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
278 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
279 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
299 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
300 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
301 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
302 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
309 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
322 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
325 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
326 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
327 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
328 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
333 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
347 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
357 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
358 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
361 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
362 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
366 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
367 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
368 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
369 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
370 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
371 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.8
Metatranscriptomes 3.68
Isolates 5.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.95
Nodule 0.57
Rhizoplane 2.76
Rhizosphere 75.17
Stem 0
Stem Tuber 0
Unclassified 9.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000142 3300002704 Bacteria 33693
2 JGI25155J39150_1000219 3300002704 Bacteria 22984
3 JGI25156J39149_1000497 3300002705 Bacteria 23452
4 JGI25156J39149_1003054 3300002705 Bacteria 5671
5 JGI25162J39368_1000025 3300002737 Bacteria 228879
6 JGI25162J39368_1005347 3300002737 Bacteria 2559
7 JGI25154J39366_1000423 3300002738 Bacteria 22650
8 JGI25154J39366_1000432 3300002738 Bacteria 22245
9 JGI25157J39369_1000158 3300002741 Bacteria 56328
10 JGI25157J39369_1000203 3300002741 Bacteria 49480
11 JGI25150J39212_1001267 3300002774 Bacteria 7274
12 JGI25150J39212_1035054 3300002774 Bacteria 672
13 JGI25159J45721_1011470 3300002987 Bacteria 2169
14 JGI25159J45721_1035208 3300002987 Bacteria 768
15 JGI25165J46597_1000054 3300003214 Bacteria 228891
16 JGI25153J46596_10021808 3300003215 Bacteria 2379
17 rootH1_10018115 3300003316 Bacteria 3845
18 rootH2_10293157 3300003320 Bacteria 1472
19 rootL2_10003812 3300003322 Bacteria 12708
20 rootL2_10025871 3300003322 Bacteria 5171
21 rootH1_10041734 3300003316 Bacteria 4023
22 rootH1_10041734 3300003323 Bacteria 3489
23 JGI25161J50226_1010203 3300003374 Bacteria 1272
24 JGI25161J50226_1017073 3300003374 Bacteria 768
25 Ga0007417J51691_1016591 3300003544 Bacteria 1408
26 Ga0007410J51695_1021115 3300003574 Bacteria 1068
27 Ga0007410J51695_1024144 3300003574 Bacteria 1299
28 Ga0007409J51694_1006046 3300003575 Bacteria 1202
29 Ga0007416J51690_1029903 3300003577 Bacteria 1827
30 Ga0055538_1000002 3300003751 Bacteria 999437
31 Ga0055538_1000026 3300003751 Bacteria 228891
32 Ga0055538_1000117 3300003751 Bacteria 60939
33 Ga0055539_1000002 3300003752 Bacteria 999437
34 Ga0055539_1000033 3300003752 Bacteria 228891
35 Ga0055539_1000163 3300003752 Bacteria 60939
36 Ga0055533_1000004 3300003756 Bacteria 999437
37 Ga0055533_1000044 3300003756 Bacteria 228891
38 Ga0055533_1000166 3300003756 Bacteria 60939
39 Ga0055532_1000005 3300003758 Bacteria 458107
40 Ga0055525_1000002 3300003759 Bacteria 999437
41 Ga0055525_1000052 3300003759 Bacteria 228891
42 Ga0055525_1000081 3300003759 Bacteria 161329
43 Ga0055525_1000227 3300003759 Bacteria 60939
44 Ga0055535_1024759 3300003761 Bacteria 685
45 Ga0055529_1000565 3300003763 Bacteria 30558
46 Ga0055526_1004232 3300003771 Bacteria 8712
47 Ga0055526_1005886 3300003771 Bacteria 6868
48 Ga0055526_1015143 3300003771 Bacteria 3113
49 Ga0055526_1064010 3300003771 Bacteria 771
50 Ga0055537_1003974 3300003773 Bacteria 4369
51 Ga0055524_1000026 3300003775 Bacteria 214653
52 Ga0055524_1010165 3300003775 Bacteria 3766
53 Ga0055534_1002884 3300003784 Bacteria 5709
54 Ga0055534_1003282 3300003784 Bacteria 5146
55 Ga0055528_1010434 3300003790 Bacteria 3777
56 Ga0055530_10010428 3300003791 Bacteria 3435
57 Ga0055530_10037080 3300003791 Bacteria 1222
58 Ga0055541_1000002 3300003841 Bacteria 896405
59 Ga0055541_1000069 3300003841 Bacteria 94648
60 Ga0055541_1000109 3300003841 Bacteria 60939
61 Ga0055543_1004724 3300004625 Bacteria 3637
62 Ga0065165_1000557 3300005262 Bacteria 55476
63 Ga0065165_1011662 3300005262 Bacteria 3637
64 Ga0065704_10286848 3300005289 Bacteria 911
65 Ga0065707_10223324 3300005295 Bacteria 1216
66 Ga0070658_10310880 3300005327 Bacteria 1344
67 Ga0070658_11126602 3300005327 Bacteria 682
68 Ga0070658_11289576 3300005327 Bacteria 634
69 Ga0070676_10074194 3300005328 Bacteria 2048
70 Ga0070670_100000002 3300005331 Bacteria 568775
71 Ga0070680_100399210 3300005336 Bacteria 1172
72 Ga0070682_100209046 3300005337 Bacteria 1382
73 Ga0070660_100019039 3300005339 Bacteria 5025
74 Ga0070660_100019636 3300005339 Bacteria 4955
75 Ga0070660_100878083 3300005339 Bacteria 756
76 Ga0070661_100016272 3300005344 Bacteria 5256
77 Ga0070661_100471047 3300005344 Bacteria 1002
78 Ga0070669_100005576 3300005353 Bacteria 9091
79 Ga0070671_100000025 3300005355 Bacteria 121912
80 Ga0070688_100004285 3300005365 Bacteria 7416
81 Ga0070659_100027283 3300005366 Bacteria 4399
82 Ga0070659_100248247 3300005366 Bacteria 1474
83 Ga0070667_100000394 3300005367 Bacteria 47270
84 Ga0068867_100808148 3300005459 Bacteria 837
85 Ga0070685_10000005 3300005466 Bacteria 190119
86 Ga0068853_101402260 3300005539 Bacteria 676
87 Ga0070665_100150604 3300005548 Bacteria 2329
88 Ga0068855_100002941 3300005563 Bacteria 20811
89 Ga0068855_100023836 3300005563 Bacteria 7331
90 Ga0068855_100113778 3300005563 Bacteria 3103
91 Ga0068855_100654854 3300005563 Bacteria 1127
92 Ga0070664_100107270 3300005564 Bacteria 2435
93 Ga0068854_100007911 3300005578 Bacteria 6804
94 Ga0068854_100351826 3300005578 Bacteria 1206
95 Ga0068856_100196880 3300005614 Bacteria 2029
96 Ga0068856_100577120 3300005614 Bacteria 1146
97 Ga0068852_100105451 3300005616 Bacteria 2554
98 Ga0068852_100470435 3300005616 Bacteria 1247
99 Ga0068859_100041050 3300005617 Bacteria 4648
100 Ga0068864_100000003 3300005618 Bacteria 568775
101 Ga0068851_10118595 3300005834 Bacteria 1420
102 Ga0068860_100000326 3300005843 Bacteria 64692
103 Ga0068862_100068501 3300005844 Bacteria 3061
104 Ga0070717_10329720 3300006028 Bacteria 1361
105 Ga0070712_100003941 3300006175 Bacteria 9138
106 Ga0075362_10006912 3300006177 Bacteria 4254
107 Ga0097621_100672441 3300006237 Bacteria 951
108 Ga0068871_100961585 3300006358 Bacteria 794
109 Ga0097620_100041051 3300006931 Bacteria 4648
110 Ga0079104_1003938 3300006946 Bacteria 6622
111 Ga0105244_10002846 3300009036 Bacteria 12839
112 Ga0105244_10004702 3300009036 Bacteria 9297
113 Ga0105244_10017619 3300009036 Bacteria 4031
114 Ga0105244_10082230 3300009036 Bacteria 1593
115 Ga0105240_10003355 3300009093 Bacteria 24916
116 Ga0105240_10007797 3300009093 Bacteria 15467
117 Ga0105240_10076139 3300009093 Bacteria 4137
118 Ga0105240_10255882 3300009093 Bacteria 2022
119 Ga0105245_10095866 3300009098 Bacteria 2737
120 Ga0105243_10069287 3300009148 Bacteria 2845
121 Ga0105241_10134982 3300009174 Bacteria 2002
122 Ga0105242_10002231 3300009176 Bacteria 15286
123 Ga0105248_10148536 3300009177 Unclassified 2644
124 Ga0105237_10006971 3300009545 Bacteria 12457
125 Ga0105238_10000505 3300009551 Bacteria 41099
126 Ga0105238_10028613 3300009551 Bacteria 5677
127 Ga0105249_10146050 3300009553 Unclassified 2273
128 Ga0105239_10003532 3300010375 Bacteria 19140
129 Ga0105239_10093891 3300010375 Bacteria 3313
130 Ga0105239_10566910 3300010375 Bacteria 1294
131 Ga0105246_10495530 3300011119 Bacteria 1036
132 Ga0157373_10065917 3300013100 Bacteria 2562
133 Ga0157371_10000064 3300013102 Bacteria 169056
134 Ga0157371_10376395 3300013102 Bacteria 1036
135 Ga0157378_11587540 3300013297 Bacteria 700
136 Ga0163162_10090756 3300013306 Bacteria 3137
137 Ga0157372_10418475 3300013307 Bacteria 1562
138 Ga0157372_11872767 3300013307 Bacteria 690
139 Ga0163163_10000136 3300014325 Bacteria 75532
140 Ga0182008_10012348 3300014497 Bacteria 4509
141 Ga0182008_10022337 3300014497 Bacteria 3241
142 Ga0182008_10290110 3300014497 Bacteria 853
143 Ga0157379_10845278 3300014968 Unclassified 866
144 Ga0157376_11137173 3300014969 Bacteria 807
145 Ga0182006_1000010 3300015261 Bacteria 413414
146 Ga0182006_1000070 3300015261 Bacteria 137793
147 Ga0182006_1003847 3300015261 Bacteria 7537
148 Ga0182006_1011302 3300015261 Bacteria 3933
149 Ga0182006_1019017 3300015261 Bacteria 2897
150 Ga0182006_1137093 3300015261 Bacteria 838
151 Ga0182007_10000021 3300015262 Bacteria 193408
152 Ga0182007_10005022 3300015262 Bacteria 5877
153 Ga0182007_10028545 3300015262 Bacteria 1916
154 Ga0182007_10039625 3300015262 Bacteria 1576
155 Ga0182007_10047837 3300015262 Bacteria 1414
156 Ga0182005_1000003 3300015265 Bacteria 683269
157 Ga0182005_1000009 3300015265 Bacteria 455334
158 Ga0182005_1000140 3300015265 Bacteria 51063
159 Ga0163161_10013082 3300017792 Bacteria 5767
160 Ga0163161_10127977 3300017792 Bacteria 1914
161 Ga0213872_10001180 3300021361 Bacteria 17725
162 Ga0213872_10039352 3300021361 Bacteria 2157
163 Ga0213872_10142017 3300021361 Bacteria 1053
164 Ga0209435_100004 3300025206 Bacteria 633417
165 Ga0209435_100214 3300025206 Bacteria 16487
166 Ga0209436_104714 3300025208 Bacteria 3303
167 Ga0209784_100002 3300025224 Bacteria 1753105
168 Ga0209784_100020 3300025224 Bacteria 412353
169 Ga0209784_100153 3300025224 Bacteria 62664
170 Ga0209566_100003 3300025225 Bacteria 1753105
171 Ga0209566_100020 3300025225 Bacteria 412353
172 Ga0209566_100195 3300025225 Bacteria 62664
173 Ga0209674_100004 3300025226 Bacteria 1753105
174 Ga0209674_100035 3300025226 Bacteria 412353
175 Ga0209674_100198 3300025226 Bacteria 62664
176 Ga0209672_110782 3300025228 Bacteria 1217
177 Ga0209147_100011 3300025229 Bacteria 702140
178 Ga0209563_100006 3300025230 Bacteria 1753105
179 Ga0209563_100015 3300025230 Bacteria 879901
180 Ga0209563_100038 3300025230 Bacteria 412353
181 Ga0209563_100157 3300025230 Bacteria 62664
182 Ga0207427_100803 3300025231 Bacteria 14223
183 Ga0209437_100066 3300025233 Bacteria 327883
184 Ga0209437_100084 3300025233 Bacteria 255423
185 Ga0209258_100560 3300025242 Bacteria 32331
186 Ga0207425_1000205 3300025245 Bacteria 47028
187 Ga0207425_1001881 3300025245 Bacteria 8024
188 Ga0209646_1000032 3300025246 Bacteria 375315
189 Ga0209646_1000283 3300025246 Bacteria 44163
190 Ga0209026_1000062 3300025250 Bacteria 213298
191 Ga0209026_1001071 3300025250 Bacteria 13234
192 Ga0209677_100003 3300025253 Bacteria 1753105
193 Ga0209677_100031 3300025253 Bacteria 329719
194 Ga0209677_100156 3300025253 Bacteria 62664
195 Ga0209677_109110 3300025253 Bacteria 1824
196 Ga0209759_1000054 3300025256 Bacteria 211422
197 Ga0209759_1000548 3300025256 Bacteria 38674
198 Ga0209233_1000060 3300025261 Bacteria 412379
199 Ga0209565_1000163 3300025263 Bacteria 87185
200 Ga0209565_1002537 3300025263 Bacteria 6491
201 Ga0209565_1003524 3300025263 Bacteria 5022
202 Ga0209565_1019823 3300025263 Bacteria 1429
203 Ga0209455_1000063 3300025272 Bacteria 333019
204 Ga0209673_1013569 3300025273 Bacteria 3207
205 Ga0209130_1001475 3300025284 Bacteria 15380
206 Ga0209675_1000635 3300025291 Bacteria 24937
207 Ga0209675_1004769 3300025291 Bacteria 5897
208 Ga0209675_1035477 3300025291 Bacteria 1137
209 Ga0209025_1007316 3300025294 Bacteria 8276
210 Ga0209564_1000026 3300025295 Bacteria 519154
211 Ga0209564_1000098 3300025295 Bacteria 228906
212 Ga0209564_1010469 3300025295 Bacteria 4266
213 Ga0209758_1000270 3300025297 Bacteria 102973
214 Ga0209050_1000183 3300025298 Bacteria 142357
215 Ga0209050_1000753 3300025298 Bacteria 46582
216 Ga0209256_1000013 3300025299 Bacteria 689442
217 Ga0209256_1001083 3300025299 Bacteria 31411
218 Ga0209256_1003724 3300025299 Bacteria 10323
219 Ga0207426_1008085 3300025302 Bacteria 4309
220 Ga0209051_1033169 3300025303 Bacteria 1956
221 Ga0209257_1000010 3300025304 Bacteria 1158682
222 Ga0207655_1006312 3300025728 Bacteria 7876
223 Ga0207655_1007374 3300025728 Bacteria 7136
224 Ga0207655_1072617 3300025728 Bacteria 1272
225 Ga0207655_1102042 3300025728 Bacteria 985
226 Ga0207680_10007523 3300025903 Bacteria 5318
227 Ga0207705_10015832 3300025909 Bacteria 5416
228 Ga0207705_10573990 3300025909 Bacteria 877
229 Ga0207654_10003120 3300025911 Bacteria 8391
230 Ga0207695_10001902 3300025913 Bacteria 32583
231 Ga0207695_10006732 3300025913 Bacteria 14831
232 Ga0207695_10032133 3300025913 Bacteria 5747
233 Ga0207695_10694482 3300025913 Bacteria 898
234 Ga0207671_10007433 3300025914 Bacteria 9507
235 Ga0207671_10084328 3300025914 Bacteria 2386
236 Ga0207660_10242713 3300025917 Bacteria 1420
237 Ga0207657_10004403 3300025919 Bacteria 14895
238 Ga0207681_10000156 3300025923 Bacteria 56382
239 Ga0207694_10000392 3300025924 Bacteria 40819
240 Ga0207650_10000003 3300025925 Bacteria 1123235
241 Ga0207650_10071357 3300025925 Bacteria 2612
242 Ga0207644_10000312 3300025931 Bacteria 31641
243 Ga0207690_10017481 3300025932 Bacteria 4379
244 Ga0207690_10315843 3300025932 Bacteria 1227
245 Ga0207706_10096998 3300025933 Bacteria 2592
246 Ga0207686_10004796 3300025934 Bacteria 7259
247 Ga0207711_10002080 3300025941 Bacteria 18084
248 Ga0207711_10008967 3300025941 Bacteria 8363
249 Ga0207661_10315241 3300025944 Bacteria 1405
250 Ga0207679_10087306 3300025945 Bacteria 2401
251 Ga0207667_10000019 3300025949 Bacteria 386233
252 Ga0207667_10015769 3300025949 Bacteria 8568
253 Ga0207667_10287065 3300025949 Bacteria 1681
254 Ga0207712_10142307 3300025961 Unclassified 1842
255 Ga0207640_10002070 3300025981 Bacteria 10810
256 Ga0207640_10205995 3300025981 Bacteria 1494
257 Ga0207658_10000004 3300025986 Bacteria 569357
258 Ga0207703_10607025 3300026035 Unclassified 1035
259 Ga0207639_10224640 3300026041 Bacteria 1624
260 Ga0207702_10314059 3300026078 Bacteria 1491
261 Ga0207641_10190748 3300026088 Bacteria 1883
262 Ga0207641_10661571 3300026088 Unclassified 1026
263 Ga0207648_10224184 3300026089 Bacteria 1671
264 Ga0207676_10000003 3300026095 Bacteria 1123235
265 Ga0207674_10193579 3300026116 Bacteria 1983
266 Ga0207674_10502681 3300026116 Bacteria 1171
267 Ga0207698_10002422 3300026142 Bacteria 11040
268 Ga0207698_10826271 3300026142 Bacteria 930
269 Ga0207698_11889844 3300026142 Bacteria 612
270 Ga0209281_1027586 3300027111 Bacteria 1039
271 Ga0268266_10060143 3300028379 Bacteria 3274
272 Ga0268265_10001641 3300028380 Bacteria 18332
273 Ga0268264_10000123 3300028381 Bacteria 189361
274 Ga0265338_10000251 3300028800 Bacteria 98343
275 Ga0265332_10140284 3300031238 Bacteria 1013
276 Ga0307408_100030099 3300031548 Bacteria 3767
277 Ga0307408_100039064 3300031548 Bacteria 3352
278 Ga0307408_100120973 3300031548 Bacteria 2028
279 Ga0307518_10093594 3300031838 Bacteria 2159
280 Ga0307412_10912337 3300031911 Bacteria 771
281 Ga0307416_100654254 3300032002 Bacteria 1136
282 Ga0307414_10045777 3300032004 Bacteria 2998
283 Ga0307414_10817207 3300032004 Bacteria 851
284 Ga0395899_0006725 3300037312 Bacteria 8904
285 Ga0395899_0023733 3300037312 Bacteria 4641
286 Ga0395899_0573065 3300037312 Bacteria 723
287 Ga0395900_0000532 3300037418 Bacteria 53751
288 Ga0395900_0004176 3300037418 Bacteria 15339
289 Ga0395900_0011395 3300037418 Bacteria 9100
290 Ga0395900_0044333 3300037418 Bacteria 4583
291 Ga0395900_0372424 3300037418 Bacteria 1397
292 Ga0395900_0860748 3300037418 Bacteria 831
293 Ga0395898_0017582 3300037466 Bacteria 7296
294 Ga0395905_0000589 3300037471 Bacteria 48792
295 Ga0395905_0010271 3300037471 Bacteria 9115
296 Ga0395905_0072918 3300037471 Bacteria 3218
297 Ga0395905_0131813 3300037471 Bacteria 2350
298 Ga0395905_0290802 3300037471 Bacteria 1521
299 Ga0395905_0916846 3300037471 Bacteria 779
300 Ga0395901_0000765 3300038443 Bacteria 36025
301 Ga0395901_0002028 3300038443 Bacteria 20821
302 Ga0395901_0009241 3300038443 Bacteria 9990
303 Ga0395901_0319235 3300038443 Bacteria 1607
304 Ga0436361_0065289 3300039447 Bacteria 15724
305 Ga0436361_0179116 3300039447 Bacteria 893
306 Ga0436361_0239425 3300039447 Bacteria 40455
307 Ga0436361_0370552 3300039447 Bacteria 1375
308 Ga0436361_0480035 3300039447 Bacteria 16007
309 Ga0436361_1087377 3300039447 Bacteria 2723
310 Ga0439465_0139031 3300041413 Bacteria 862
311 Ga0439448_0024773 3300042005 Bacteria 1878
312 Ga0439448_0034436 3300042005 Bacteria 1618
313 Ga0439450_003658 3300042008 Bacteria 2563
314 Ga0439455_0002204 3300042012 Bacteria 3488
315 Ga0439455_0070868 3300042012 Bacteria 936
316 Ga0450904_000854 3300042139 Bacteria 5015
317 Ga0450906_092126 3300042145 Bacteria 550
318 Ga0439464_0093207 3300042439 Bacteria 910
319 Ga0466969_0024922 3300044656 Bacteria 3076
320 Ga0466969_0401196 3300044656 Bacteria 622
321 Ga0466972_0000283 3300044658 Bacteria 31634
322 Ga0466972_0031399 3300044658 Bacteria 2612
323 Ga0466981_0558362 3300044669 Bacteria 627
324 Ga0466965_0001710 3300044683 Bacteria 9017
325 Ga0466965_0006716 3300044683 Bacteria 5248
326 Ga0466965_0047069 3300044683 Bacteria 2135
327 Ga0466966_0010145 3300044684 Bacteria 6247
328 Ga0466961_0286026 3300044693 Bacteria 1008
329 Ga0466961_0485655 3300044693 Bacteria 746
330 Ga0466963_0077203 3300044694 Bacteria 2250
331 Ga0466964_0005209 3300044706 Bacteria 4821
332 Ga0466964_0012691 3300044706 Bacteria 3189
333 Ga0466964_0023327 3300044706 Bacteria 2406
334 Ga0466964_0213964 3300044706 Bacteria 932
335 Ga0466971_0182658 3300044719 Bacteria 986
336 Ga0466971_0224141 3300044719 Bacteria 891
337 Ga0466968_0005176 3300044735 Bacteria 4879
338 Ga0466968_0168236 3300044735 Bacteria 1015
339 Ga0466970_0033906 3300044765 Bacteria 2700
340 Ga0466970_0077320 3300044765 Bacteria 1794
341 Ga0466957_0003305 3300044842 Bacteria 8825
342 Ga0466959_0057388 3300045049 Bacteria 2838
343 Ga0466959_0082530 3300045049 Bacteria 2315
344 Ga0466959_0147587 3300045049 Bacteria 1659
345 Ga0466959_0235373 3300045049 Bacteria 1266
346 Ga0466958_0044719 3300045836 Bacteria 2669
347 Ga0466967_0027416 3300045976 Bacteria 4738
348 Ga0495617_075766 3300046452 Bacteria 1104
349 Ga0495627_004698 3300046453 Bacteria 5650
350 Ga0495627_005183 3300046453 Bacteria 5303
351 Ga0495592_0086444 3300046454 Bacteria 2258
352 Ga0495603_0127264 3300046455 Bacteria 1484
353 Ga0495590_0093492 3300046457 Bacteria 1065
354 Ga0495629_0008589 3300046459 Bacteria 7521
355 Ga0495629_0056479 3300046459 Bacteria 2744
356 Ga0495638_0036578 3300046460 Bacteria 3127
357 Ga0495638_0083406 3300046460 Bacteria 1936
358 Ga0495638_0117589 3300046460 Bacteria 1573
359 Ga0495651_0154334 3300046462 Bacteria 1651
360 Ga0495653_0036769 3300046463 Bacteria 3853
361 Ga0495653_0041862 3300046463 Bacteria 3572
362 Ga0495653_0135297 3300046463 Bacteria 1739
363 Ga0495650_0000051 3300046471 Bacteria 318297
364 Ga0495650_0000212 3300046471 Bacteria 124622
365 Ga0495650_0000712 3300046471 Bacteria 42514
366 Ga0495650_0033656 3300046471 Bacteria 2278
367 Ga0495580_0024981 3300046472 Bacteria 4368
368 Ga0495582_0005030 3300046473 Bacteria 7408
369 Ga0495582_0214083 3300046473 Bacteria 1102
370 Ga0495605_0000005 3300046474 Bacteria 376973
371 Ga0495605_0026659 3300046474 Bacteria 3002
372 Ga0495605_0027564 3300046474 Bacteria 2942
373 Ga0495605_0047131 3300046474 Bacteria 2114
374 Ga0495639_0228194 3300046475 Bacteria 917
375 Ga0495584_0000381 3300046491 Bacteria 30594
376 Ga0495584_0000755 3300046491 Bacteria 21387
377 Ga0495584_0001114 3300046491 Bacteria 16663
378 Ga0495584_0007663 3300046491 Bacteria 5625
379 Ga0495584_0018616 3300046491 Bacteria 3530
380 Ga0495584_0019150 3300046491 Bacteria 3476
381 Ga0495584_0021044 3300046491 Bacteria 3312
382 Ga0495584_0070048 3300046491 Bacteria 1762
383 Ga0495584_0094776 3300046491 Bacteria 1507
384 Ga0495584_0099702 3300046491 Bacteria 1468
385 Ga0495584_0224600 3300046491 Bacteria 954
386 Ga0495585_0000889 3300046492 Bacteria 25313
387 Ga0495585_0007941 3300046492 Bacteria 6449
388 Ga0495585_0008221 3300046492 Bacteria 6333
389 Ga0495585_0011129 3300046492 Bacteria 5335
390 Ga0495585_0017446 3300046492 Bacteria 4147
391 Ga0495585_0092311 3300046492 Bacteria 1629
392 Ga0495585_0097505 3300046492 Bacteria 1576
393 Ga0495585_0135032 3300046492 Bacteria 1295
394 Ga0495585_0235050 3300046492 Bacteria 919
395 Ga0495594_0016435 3300046499 Bacteria 3898
396 Ga0495594_0293937 3300046499 Bacteria 925
397 Ga0495594_0365398 3300046499 Bacteria 821
398 Ga0495596_0004154 3300046500 Bacteria 7112
399 Ga0495596_0005456 3300046500 Bacteria 6007
400 Ga0495596_0017944 3300046500 Bacteria 2922
401 Ga0495596_0036442 3300046500 Bacteria 1948
402 Ga0495596_0044212 3300046500 Bacteria 1753
403 Ga0495596_0175637 3300046500 Bacteria 833
404 Ga0495607_0011208 3300046501 Bacteria 5980
405 Ga0495607_0034188 3300046501 Bacteria 3086
406 Ga0495607_0039793 3300046501 Bacteria 2805
407 Ga0495607_0052064 3300046501 Bacteria 2373
408 Ga0495607_0063189 3300046501 Bacteria 2095
409 Ga0495607_0090256 3300046501 Bacteria 1662
410 Ga0495583_0000983 3300046506 Bacteria 32667
411 Ga0495583_0018489 3300046506 Bacteria 3667
412 Ga0495583_0019099 3300046506 Bacteria 3587
413 Ga0495583_0038221 3300046506 Bacteria 2269
414 Ga0495583_0044743 3300046506 Bacteria 2051
415 Ga0495583_0052003 3300046506 Bacteria 1865
416 Ga0495583_0108125 3300046506 Bacteria 1180
417 Ga0495583_0170507 3300046506 Bacteria 894
418 Ga0495606_0000547 3300046507 Bacteria 60321
419 Ga0495606_0002788 3300046507 Bacteria 19515
420 Ga0495606_0003771 3300046507 Bacteria 15756
421 Ga0495606_0036377 3300046507 Bacteria 3353
422 Ga0495606_0050389 3300046507 Bacteria 2724
423 Ga0495606_0072842 3300046507 Bacteria 2157
424 Ga0495606_0115547 3300046507 Bacteria 1613
425 Ga0495606_0119684 3300046507 Bacteria 1577
426 Ga0495606_0259831 3300046507 Bacteria 959
427 Ga0495606_0346055 3300046507 Bacteria 790
428 Ga0495608_0011730 3300046511 Bacteria 6093
429 Ga0495610_0000021 3300046512 Bacteria 336300
430 Ga0495610_0006777 3300046512 Bacteria 7771
431 Ga0495616_0000093 3300046513 Bacteria 75781
432 Ga0495616_0024971 3300046513 Bacteria 3197
433 Ga0495616_0026678 3300046513 Bacteria 3071
434 Ga0495616_0040738 3300046513 Bacteria 2371
435 Ga0495616_0084167 3300046513 Bacteria 1516
436 Ga0495616_0105541 3300046513 Bacteria 1315
437 Ga0495616_0106310 3300046513 Bacteria 1309
438 Ga0495618_0043922 3300046514 Bacteria 2819
439 Ga0495620_0020297 3300046515 Bacteria 3247
440 Ga0495628_0006086 3300046516 Bacteria 10550
441 Ga0495628_0013454 3300046516 Bacteria 6883
442 Ga0495630_0005271 3300046517 Bacteria 9123
443 Ga0495630_0021183 3300046517 Bacteria 4800
444 Ga0495631_0014034 3300046518 Bacteria 3872
445 Ga0495631_0019628 3300046518 Bacteria 3168
446 Ga0495631_0020566 3300046518 Bacteria 3082
447 Ga0495631_0022012 3300046518 Bacteria 2965
448 Ga0495631_0182652 3300046518 Bacteria 898
449 Ga0495631_0187925 3300046518 Bacteria 884
450 Ga0495631_0221516 3300046518 Bacteria 807
451 Ga0495632_0001724 3300046519 Bacteria 17773
452 Ga0495632_0008471 3300046519 Bacteria 6306
453 Ga0495632_0059363 3300046519 Bacteria 1861
454 Ga0495637_0000305 3300046520 Bacteria 38029
455 Ga0495637_0051276 3300046520 Bacteria 1728
456 Ga0495643_0000096 3300046522 Bacteria 146041
457 Ga0495643_0000181 3300046522 Bacteria 100368
458 Ga0495643_0000983 3300046522 Bacteria 29263
459 Ga0495643_0001269 3300046522 Bacteria 24190
460 Ga0495643_0036792 3300046522 Bacteria 2687
461 Ga0495643_0077756 3300046522 Bacteria 1733
462 Ga0495643_0106851 3300046522 Bacteria 1427
463 Ga0495643_0230749 3300046522 Bacteria 873
464 Ga0495643_0253848 3300046522 Bacteria 819
465 Ga0495644_0014817 3300046523 Bacteria 2985
466 Ga0495644_0029509 3300046523 Bacteria 2072
467 Ga0495644_0030512 3300046523 Bacteria 2035
468 Ga0495648_0019268 3300046524 Bacteria 4804
469 Ga0495648_0037553 3300046524 Bacteria 3110
470 Ga0495648_0071327 3300046524 Bacteria 2014
471 Ga0495648_0090475 3300046524 Bacteria 1715
472 Ga0495648_0301215 3300046524 Bacteria 751
473 Ga0495663_0104318 3300046525 Bacteria 936
474 Ga0495666_0000293 3300046526 Bacteria 21877
475 Ga0495666_0007083 3300046526 Bacteria 5634
476 Ga0495642_0022230 3300046528 Bacteria 2498
477 Ga0495642_0036277 3300046528 Bacteria 1992
478 Ga0495642_0052284 3300046528 Bacteria 1682
479 Ga0495642_0088467 3300046528 Bacteria 1309
480 Ga0495642_0097643 3300046528 Bacteria 1248
481 Ga0495642_0206597 3300046528 Bacteria 856
482 Ga0495652_0014252 3300046529 Bacteria 7138
483 Ga0495652_0032215 3300046529 Bacteria 4585
484 Ga0495652_0041820 3300046529 Bacteria 3954
485 Ga0495652_0060251 3300046529 Bacteria 3208
486 Ga0495652_0089342 3300046529 Bacteria 2522
487 Ga0495652_0127906 3300046529 Bacteria 2015
488 Ga0495654_0000005 3300046530 Bacteria 491381
489 Ga0495654_0011080 3300046530 Bacteria 4895
490 Ga0495654_0021618 3300046530 Bacteria 3346
491 Ga0495654_0028810 3300046530 Bacteria 2836
492 Ga0495654_0142868 3300046530 Bacteria 1065
493 Ga0495654_0166524 3300046530 Bacteria 964
494 Ga0495665_0020394 3300046531 Bacteria 3560
495 Ga0495665_0027126 3300046531 Bacteria 3075
496 Ga0495665_0137168 3300046531 Bacteria 1279
497 Ga0495665_0272221 3300046531 Bacteria 869
498 Ga0495665_0381375 3300046531 Bacteria 716
499 Ga0495640_0004944 3300046533 Bacteria 10598
500 Ga0495586_0016302 3300046535 Bacteria 3951
501 Ga0495586_0021007 3300046535 Bacteria 3479
502 Ga0495586_0022390 3300046535 Bacteria 3372
503 Ga0495586_0042318 3300046535 Bacteria 2453
504 Ga0495586_0127766 3300046535 Bacteria 1422
505 Ga0495586_0172270 3300046535 Bacteria 1223
506 Ga0495586_0318063 3300046535 Bacteria 892
507 Ga0495587_0015121 3300046536 Bacteria 4823
508 Ga0495587_0033763 3300046536 Bacteria 3086
509 Ga0495587_0174471 3300046536 Bacteria 1220
510 Ga0495609_0008303 3300046538 Bacteria 5092
511 Ga0495609_0017904 3300046538 Bacteria 3287
512 Ga0495609_0044718 3300046538 Bacteria 1985
513 Ga0495609_0048276 3300046538 Bacteria 1903
514 Ga0495609_0051016 3300046538 Bacteria 1843
515 Ga0495609_0058074 3300046538 Bacteria 1711
516 Ga0495609_0129126 3300046538 Bacteria 1083
517 Ga0495609_0146116 3300046538 Bacteria 1007
518 Ga0495597_0000310 3300046542 Bacteria 43852
519 Ga0495597_0002547 3300046542 Bacteria 11430
520 Ga0495597_0003418 3300046542 Bacteria 9274
521 Ga0495597_0004282 3300046542 Bacteria 7887
522 Ga0495597_0012024 3300046542 Bacteria 4183
523 Ga0495597_0050362 3300046542 Bacteria 1839
524 Ga0495597_0148467 3300046542 Bacteria 963
525 Ga0495645_0026559 3300046543 Bacteria 4204
526 Ga0495645_0231595 3300046543 Bacteria 1237
527 Ga0495622_0053142 3300046557 Bacteria 1879
528 Ga0495622_0054503 3300046557 Bacteria 1855
529 Ga0495622_0067145 3300046557 Bacteria 1657
530 Ga0495622_0187524 3300046557 Bacteria 925
531 Ga0495633_0000357 3300046558 Bacteria 49514
532 Ga0495633_0002184 3300046558 Bacteria 14032
533 Ga0495633_0009027 3300046558 Bacteria 5546
534 Ga0495633_0022770 3300046558 Bacteria 3111
535 Ga0495633_0034395 3300046558 Bacteria 2437
536 Ga0495633_0040898 3300046558 Bacteria 2206
537 Ga0495633_0071185 3300046558 Bacteria 1622
538 Ga0495633_0123596 3300046558 Bacteria 1198
539 Ga0495633_0215978 3300046558 Bacteria 878
540 Ga0495667_0108419 3300046559 Bacteria 1794
541 Ga0495656_0001209 3300046615 Bacteria 8415
542 Ga0495656_0069076 3300046615 Bacteria 1564
543 Ga0495656_0075758 3300046615 Bacteria 1506
544 Ga0495656_0216050 3300046615 Bacteria 957
545 Ga0495656_0497204 3300046615 Bacteria 646
546 Ga0495668_0000008 3300046616 Bacteria 498364
547 Ga0495668_0001106 3300046616 Bacteria 27873
548 Ga0495668_0021698 3300046616 Bacteria 3678
549 Ga0495668_0034818 3300046616 Bacteria 2823
550 Ga0495668_0047044 3300046616 Bacteria 2395
551 Ga0495668_0048141 3300046616 Bacteria 2365
552 Ga0495668_0145246 3300046616 Bacteria 1298
553 Ga0495668_0344287 3300046616 Bacteria 818
554 Ga0495668_0397196 3300046616 Bacteria 757
555 Ga0495634_0000991 3300046642 Bacteria 26768
556 Ga0495634_0117670 3300046642 Bacteria 1704
557 Ga0495634_0337122 3300046642 Bacteria 905
558 Ga0495611_0093809 3300046648 Bacteria 1388
559 Ga0495611_0093887 3300046648 Bacteria 1388
560 Ga0495611_0096401 3300046648 Bacteria 1369
561 Ga0495611_0165269 3300046648 Bacteria 1034
562 Ga0495625_0001934 3300046660 Bacteria 23417
563 Ga0495625_0002185 3300046660 Bacteria 21708
564 Ga0495625_0004513 3300046660 Bacteria 13131
565 Ga0495625_0022179 3300046660 Bacteria 4872
566 Ga0495625_0065254 3300046660 Bacteria 2567
567 Ga0495625_0087883 3300046660 Bacteria 2154
568 Ga0495625_0149084 3300046660 Bacteria 1573
569 Ga0495625_0186517 3300046660 Bacteria 1376
570 Ga0495625_0353390 3300046660 Bacteria 928
571 Ga0495625_0403729 3300046660 Bacteria 853
572 Ga0495625_0463312 3300046660 Bacteria 781
573 Ga0495635_0001964 3300046663 Bacteria 13979
574 Ga0495659_0002967 3300046664 Bacteria 5444
575 Ga0495659_0037958 3300046664 Bacteria 1709
576 Ga0495661_0012263 3300046665 Bacteria 5789
577 Ga0495661_0012374 3300046665 Bacteria 5759
578 Ga0495661_0032622 3300046665 Bacteria 3291
579 Ga0495661_0037214 3300046665 Bacteria 3040
580 Ga0495661_0044067 3300046665 Bacteria 2737
581 Ga0495661_0071706 3300046665 Bacteria 2023
582 Ga0495661_0096991 3300046665 Bacteria 1666
583 Ga0495661_0120669 3300046665 Bacteria 1448
584 Ga0495661_0194571 3300046665 Bacteria 1065
585 Ga0495661_0210518 3300046665 Bacteria 1012
586 Ga0495661_0273676 3300046665 Bacteria 853
587 Ga0495588_0000113 3300046674 Bacteria 137279
588 Ga0495588_0010764 3300046674 Bacteria 4269
589 Ga0495588_0297746 3300046674 Bacteria 849
590 Ga0495588_0323176 3300046674 Bacteria 811
591 Ga0495588_0471139 3300046674 Bacteria 658
592 Ga0495657_0064926 3300046675 Bacteria 2402
593 Ga0495599_0027691 3300046678 Bacteria 3551
594 Ga0495623_0016264 3300046679 Bacteria 4805
595 Ga0495623_0170724 3300046679 Bacteria 1270
596 Ga0495623_0233308 3300046679 Bacteria 1042
597 Ga0495623_0273114 3300046679 Bacteria 943
598 Ga0495646_0020393 3300046680 Bacteria 4194
599 Ga0495646_0041520 3300046680 Bacteria 2826
600 Ga0495646_0175128 3300046680 Bacteria 1180
601 Ga0495669_0000075 3300046684 Bacteria 65812
602 Ga0495669_0006448 3300046684 Bacteria 4899
603 Ga0495669_0258688 3300046684 Bacteria 836
604 Ga0495613_0021937 3300046689 Bacteria 4760
605 Ga0495613_0147015 3300046689 Bacteria 1682
606 Ga0495613_0167143 3300046689 Bacteria 1562
607 Ga0495624_0177809 3300046690 Bacteria 1297
608 Ga0495670_0003298 3300046691 Bacteria 7954
609 Ga0495670_0022250 3300046691 Bacteria 3130
610 Ga0495670_0053351 3300046691 Bacteria 2025
611 Ga0495670_0056475 3300046691 Bacteria 1969
612 Ga0495670_0065209 3300046691 Bacteria 1835
613 Ga0495670_0087202 3300046691 Bacteria 1594
614 Ga0495670_0160614 3300046691 Bacteria 1180
615 Ga0495671_0007599 3300046692 Bacteria 6162
616 Ga0495671_0014178 3300046692 Bacteria 4295
617 Ga0495671_0048958 3300046692 Bacteria 2107
618 Ga0495671_0077195 3300046692 Bacteria 1633
619 Ga0495649_0007384 3300046694 Bacteria 6710
620 Ga0495649_0059791 3300046694 Bacteria 2051
621 Ga0495649_0073599 3300046694 Bacteria 1830
622 Ga0495649_0078012 3300046694 Bacteria 1773
623 Ga0495649_0090343 3300046694 Bacteria 1633
624 Ga0495649_0113557 3300046694 Bacteria 1435
625 Ga0495649_0378468 3300046694 Bacteria 712
626 Ga0495589_0001253 3300046794 Bacteria 15034
627 Ga0495589_0027732 3300046794 Bacteria 2862
628 Ga0495589_0072985 3300046794 Bacteria 1675
629 Ga0495589_0080904 3300046794 Bacteria 1580
630 Ga0495600_0011825 3300046809 Bacteria 5450
631 Ga0495600_0070875 3300046809 Bacteria 2278
632 Ga0495600_0194477 3300046809 Bacteria 1303
633 Ga0495600_0199116 3300046809 Bacteria 1287
634 Ga0495600_0524328 3300046809 Bacteria 726
635 Ga0495660_0003778 3300046810 Bacteria 9283
636 Ga0495660_0053711 3300046810 Bacteria 2186
637 Ga0495660_0065622 3300046810 Bacteria 1937
638 Ga0495660_0184307 3300046810 Bacteria 1007
639 Ga0495581_0007750 3300047315 Bacteria 6214
640 Ga0495581_0040566 3300047315 Bacteria 2693
641 Ga0495581_0065186 3300047315 Bacteria 2105
642 Ga0495581_0099725 3300047315 Bacteria 1687
643 Ga0495604_0008392 3300047317 Bacteria 8170
644 Ga0495604_0009665 3300047317 Bacteria 7624
645 Ga0495604_0025743 3300047317 Bacteria 4686
646 Ga0495604_0169591 3300047317 Bacteria 1536
647 Ga0495636_0004688 3300047318 Bacteria 5362
648 Ga0495636_0207537 3300047318 Bacteria 896
649 Ga0495636_0295009 3300047318 Bacteria 757
650 Ga0495674_0001330 3300047319 Bacteria 24082
651 Ga0495672_0000014 3300047320 Bacteria 505636
652 Ga0495672_0000285 3300047320 Bacteria 70145
653 Ga0495672_0025841 3300047320 Bacteria 3754
654 Ga0495672_0102790 3300047320 Bacteria 1547
655 Ga0495672_0131295 3300047320 Bacteria 1317
656 Ga0495676_0032442 3300047321 Bacteria 4408
657 Ga0495676_0433009 3300047321 Bacteria 869
658 Ga0495680_0005963 3300047322 Bacteria 11395
659 Ga0495680_0090337 3300047322 Bacteria 2298
660 Ga0495683_0000112 3300047323 Bacteria 82903
661 Ga0495683_0038289 3300047323 Bacteria 2428
662 Ga0495683_0055612 3300047323 Bacteria 1969
663 Ga0495683_0182017 3300047323 Bacteria 959
664 Ga0495683_0214538 3300047323 Bacteria 861
665 Ga0495687_000060 3300047443 Bacteria 179124
666 Ga0495687_010203 3300047443 Bacteria 5167
667 Ga0495675_0000641 3300047444 Bacteria 22216
668 Ga0495675_0102882 3300047444 Bacteria 1786
669 Ga0495675_0114778 3300047444 Bacteria 1679
670 Ga0495677_0003569 3300047445 Bacteria 6034
671 Ga0495677_0004197 3300047445 Bacteria 5558
672 Ga0495677_0008437 3300047445 Bacteria 3825
673 Ga0495677_0013167 3300047445 Bacteria 3009
674 Ga0495677_0033535 3300047445 Bacteria 1871
675 Ga0495677_0036290 3300047445 Bacteria 1800
676 Ga0495677_0091042 3300047445 Bacteria 1149
677 Ga0495679_017776 3300047446 Bacteria 2539
678 Ga0495685_009277 3300047447 Bacteria 3281
679 Ga0495685_016278 3300047447 Bacteria 2539
680 Ga0495685_105721 3300047447 Bacteria 928
681 Ga0495673_0000033 3300047469 Bacteria 354152
682 Ga0495673_0000034 3300047469 Bacteria 326920
683 Ga0495681_0005423 3300047470 Bacteria 8541
684 Ga0495681_0014139 3300047470 Bacteria 4593
685 Ga0495681_0016409 3300047470 Bacteria 4153
686 Ga0495681_0023598 3300047470 Bacteria 3264
687 Ga0495681_0030386 3300047470 Bacteria 2751
688 Ga0495681_0035504 3300047470 Bacteria 2474
689 Ga0495681_0037873 3300047470 Bacteria 2370
690 Ga0495681_0039116 3300047470 Bacteria 2318
691 Ga0495681_0093372 3300047470 Bacteria 1325
692 Ga0495681_0127366 3300047470 Bacteria 1087
693 Ga0495681_0302280 3300047470 Bacteria 619
694 Ga0495686_0001306 3300047472 Bacteria 28040
695 Ga0495686_0001600 3300047472 Bacteria 23919
696 Ga0495686_0034550 3300047472 Bacteria 3255
697 Ga0495686_0040470 3300047472 Bacteria 2971
698 Ga0495686_0041735 3300047472 Bacteria 2920
699 Ga0495593_0007821 3300047673 Bacteria 6230
700 Ga0495593_0021382 3300047673 Bacteria 3615
701 Ga0495593_0060082 3300047673 Bacteria 1990
702 Ga0495593_0071856 3300047673 Bacteria 1797
703 Ga0495602_0002022 3300048088 Bacteria 20408
704 Ga0495602_0151365 3300048088 Bacteria 1823
705 Ga0495602_0166569 3300048088 Bacteria 1714
706 Ga0495602_0345020 3300048088 Bacteria 1076
707 Ga0495614_0006176 3300048089 Bacteria 5382
708 Ga0495614_0024164 3300048089 Bacteria 2624
709 Ga0495614_0099458 3300048089 Bacteria 1270
710 Ga0495614_0186182 3300048089 Bacteria 935
711 Ga0495626_0000044 3300048091 Bacteria 165533
712 Ga0495626_0000974 3300048091 Bacteria 24662
713 Ga0495626_0001091 3300048091 Bacteria 22989
714 Ga0495626_0007753 3300048091 Bacteria 5948
715 Ga0495626_0010381 3300048091 Bacteria 4971
716 Ga0495626_0023256 3300048091 Bacteria 3054
717 Ga0495626_0028057 3300048091 Bacteria 2732
718 Ga0495626_0058687 3300048091 Bacteria 1757
719 Ga0495626_0090112 3300048091 Bacteria 1349
720 Ga0495626_0092477 3300048091 Bacteria 1328
721 Ga0496100_0014602 3300048903 Bacteria 4564
722 Ga0496100_0773637 3300048903 Bacteria 751
723 Ga0496101_0133907 3300048904 Bacteria 1884
724 Ga0496102_0000279 3300048905 Bacteria 65185
725 Ga0496102_0000977 3300048905 Bacteria 26896
726 Ga0496102_0065912 3300048905 Bacteria 3319
727 Ga0496102_0599882 3300048905 Bacteria 1024
728 Ga0496102_0778555 3300048905 Bacteria 879
729 Ga0496103_0001678 3300048906 Bacteria 14484
730 Ga0496103_0007002 3300048906 Bacteria 6727
731 Ga0496103_0174887 3300048906 Bacteria 1379
732 Ga0496107_0110383 3300048910 Bacteria 2021
733 Ga0496107_0163164 3300048910 Bacteria 1652
734 Ga0496107_0341651 3300048910 Bacteria 1114
735 Ga0496109_0136903 3300048912 Bacteria 2289
736 Ga0496110_0007252 3300048913 Bacteria 8836
737 Ga0496111_0249845 3300048914 Bacteria 1317
738 Ga0496111_0264928 3300048914 Bacteria 1275
739 Ga0496112_0625724 3300048915 Bacteria 1007
740 Ga0496113_0026839 3300048916 Bacteria 4122
741 Ga0496114_0137840 3300048917 Bacteria 2110
742 Ga0496114_0427586 3300048917 Bacteria 1173
743 Ga0496115_0268235 3300048918 Bacteria 1403
744 Ga0496116_0010763 3300048919 Bacteria 7634
745 Ga0496116_0016976 3300048919 Bacteria 5674
746 Ga0496116_0071545 3300048919 Bacteria 2195
747 Ga0496117_0000010 3300048920 Bacteria 611954
748 Ga0496118_0000009 3300048921 Bacteria 611954
749 Ga0496118_0089671 3300048921 Bacteria 2122
750 Ga0496121_0016466 3300048924 Bacteria 7632
751 Ga0496121_0018662 3300048924 Bacteria 6981
752 Ga0496121_0022185 3300048924 Bacteria 6176
753 Ga0496121_0118573 3300048924 Bacteria 2003
754 Ga0496121_0544422 3300048924 Bacteria 727
755 Ga0496122_0000513 3300048925 Bacteria 80013
756 Ga0496122_0018308 3300048925 Bacteria 6482
757 Ga0496122_0025832 3300048925 Bacteria 5085
758 Ga0496123_0000145 3300048926 Bacteria 144475
759 Ga0496123_0004642 3300048926 Bacteria 14267
760 Ga0496123_0052096 3300048926 Bacteria 2719
761 Ga0496124_0118031 3300048927 Bacteria 2124
762 Ga0496124_0133675 3300048927 Bacteria 1967
763 Ga0496124_0148865 3300048927 Bacteria 1839
764 Ga0496124_0190102 3300048927 Bacteria 1572
765 Ga0496124_0261593 3300048927 Unclassified 1273
766 Ga0496125_0001481 3300048928 Bacteria 33868
767 Ga0496125_0032436 3300048928 Bacteria 4640
768 Ga0496125_0035873 3300048928 Bacteria 4340
769 Ga0496125_0167339 3300048928 Unclassified 1483
770 Ga0496125_0172039 3300048928 Bacteria 1454
771 Ga0496125_0274243 3300048928 Bacteria 1049
772 Ga0496126_0086756 3300048929 Bacteria 2758
773 Ga0496126_0277185 3300048929 Bacteria 1390
774 Ga0501309_002863 3300049129 Bacteria 1909
775 Ga0495678_000076 3300049459 Bacteria 125077
776 Ga0495678_000175 3300049459 Bacteria 73523
777 Ga0495678_000780 3300049459 Bacteria 28573
778 Ga0495682_0001244 3300049460 Bacteria 14408
779 Ga0495682_0011867 3300049460 Bacteria 3349
780 Ga0495682_0063027 3300049460 Bacteria 1337
781 Ga0501292_027335 3300049515 Bacteria 945
782 Ga0501034_0144066 3300049571 Bacteria 2361
783 Ga0501210_017290 3300049657 Bacteria 650
784 Ga0501229_048866 3300049706 Bacteria 620
785 Ga0501269_000437 3300049766 Bacteria 9300
786 Ga0501035_0000816 3300049822 Bacteria 33256
787 Ga0495601_0006228 3300053077 Bacteria 6965
788 Ga0495601_0316794 3300053077 Bacteria 1016
789 Ga0500650_0000107 3300053098 Bacteria 22912
790 Ga0500594_0011747 3300053118 Bacteria 2049
791 Ga0500594_0048637 3300053118 Bacteria 1186
792 Ga0500595_001191 3300053119 Bacteria 14359
793 Ga0500618_000954 3300053125 Bacteria 14768
794 Ga0500618_001000 3300053125 Bacteria 14271
795 Ga0500618_001616 3300053125 Bacteria 9759
796 Ga0500574_001023 3300053141 Bacteria 3935
797 Ga0500634_0164240 3300053161 Bacteria 1021
798 Ga0587084_004887 3300059477 Bacteria 1559
799 Ga0587084_010006 3300059477 Bacteria 1236
800 Ga0587093_004214 3300059478 Bacteria 1454
801 Ga0587070_004835 3300059491 Bacteria 1730
802 Ga0587080_003903 3300059503 Bacteria 1895
803 Ga0587083_0001972 3300059505 Bacteria 2453
804 Ga0587088_001642 3300059508 Bacteria 2372
805 Ga0587089_007506 3300059509 Bacteria 1295
806 Ga0587090_031712 3300059510 Bacteria 887
807 Ga0587094_004612 3300059513 Bacteria 1574
808 Ga0587106_007225 3300059605 Bacteria 1342
809 Ga0587106_009761 3300059605 Bacteria 1228
810 Ga0587062_031699 3300059639 Bacteria 813
811 Ga0587069_003497 3300059642 Bacteria 1700
812 Ga0587069_007957 3300059642 Bacteria 1326
813 Ga0587069_014580 3300059642 Bacteria 1098
814 Ga0587075_002311 3300059644 Bacteria 2000
815 Ga0587075_042694 3300059644 Bacteria 766
816 Ga0587076_007597 3300059645 Bacteria 1486
817 Ga0587078_008471 3300059646 Bacteria 1153
818 Ga0587079_015290 3300059647 Bacteria 1301
819 Ga0587079_016520 3300059647 Bacteria 1268
820 Ga0587079_023657 3300059647 Bacteria 1126
821 Ga0587102_001965 3300059649 Bacteria 1531
822 Ga0587096_00172 3300060247 Bacteria 1445
823 Ga0587071_009863 3300060344 Bacteria 1582

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015262 Ga0182007_10028545 Ga0182007_100285452 142
2 3300042145 Ga0450906_092126 Ga0450906_092126_19_456 145
3 3300009036 Ga0105244_10082230 Ga0105244_100822302 147
4 3300025728 Ga0207655_1102042 Ga0207655_11020422 147
5 3300013307 Ga0157372_10418475 Ga0157372_104184752 150
6 3300025909 Ga0207705_10573990 Ga0207705_105739902 150
7 3300046491 Ga0495584_0000755 Ga0495584_0000755_3702_4256 150
8 3300046507 Ga0495606_0346055 Ga0495606_0346055_133_687 150
9 3300046513 Ga0495616_0026678 Ga0495616_0026678_2504_3058 150
10 3300048905 Ga0496102_0778555 Ga0496102_0778555_66_620 150
11 3300005578 Ga0068854_100007911 Ga0068854_1000079112 151
12 3300005614 Ga0068856_100577120 Ga0068856_1005771202 151
13 3300009093 Ga0105240_10076139 Ga0105240_100761394 151
14 3300009545 Ga0105237_10006971 Ga0105237_100069715 151
15 3300009551 Ga0105238_10000505 Ga0105238_1000050544 151
16 3300010375 Ga0105239_10003532 Ga0105239_1000353215 151
17 3300015261 Ga0182006_1011302 Ga0182006_10113024 151
18 3300025913 Ga0207695_10006732 Ga0207695_100067328 151
19 3300025914 Ga0207671_10007433 Ga0207671_100074334 151
20 3300025924 Ga0207694_10000392 Ga0207694_1000039244 151
21 3300025981 Ga0207640_10002070 Ga0207640_100020705 151
22 3300026116 Ga0207674_10502681 Ga0207674_105026812 151
23 3300047318 Ga0495636_0295009 Ga0495636_0295009_186_737 151
24 3300005339 Ga0070660_100878083 Ga0070660_1008780831 154
25 3300005344 Ga0070661_100471047 Ga0070661_1004710472 154
26 3300005564 Ga0070664_100107270 Ga0070664_1001072702 154
27 3300013102 Ga0157371_10376395 Ga0157371_103763951 154
28 3300037418 Ga0395900_0372424 Ga0395900_0372424_597_1151 154
29 3300042005 Ga0439448_0034436 Ga0439448_0034436_802_1356 154
30 3300042008 Ga0439450_003658 Ga0439450_003658_1170_1724 154
31 3300042012 Ga0439455_0002204 Ga0439455_0002204_916_1470 154
32 3300044658 Ga0466972_0031399 Ga0466972_0031399_856_1425 154
33 3300044683 Ga0466965_0001710 Ga0466965_0001710_5438_6007 154
34 3300044706 Ga0466964_0023327 Ga0466964_0023327_646_1215 154
35 3300044735 Ga0466968_0005176 Ga0466968_0005176_1271_1840 154
36 3300005289 Ga0065704_10286848 Ga0065704_102868482 155
37 3300047469 Ga0495673_0000033 Ga0495673_0000033_71757_72311 155
38 3300048929 Ga0496126_0086756 Ga0496126_0086756_1551_2105 155
39 3300059503 Ga0587080_003903 Ga0587080_003903_656_1210 155
40 3300059644 Ga0587075_042694 Ga0587075_042694_128_682 155
41 3300059647 Ga0587079_015290 Ga0587079_015290_320_874 155
42 3300059647 Ga0587079_016520 Ga0587079_016520_649_1203 155
43 3300060247 Ga0587096_00172 Ga0587096_00172_422_976 155
44 3300046524 Ga0495648_0071327 Ga0495648_0071327_1403_1966 156
45 3300048091 Ga0495626_0058687 Ga0495626_0058687_527_1090 156
46 3300059605 Ga0587106_009761 Ga0587106_009761_116_685 156
47 3300002774 JGI25150J39212_1001267 JGI25150J39212_10012678 157
48 3300002987 JGI25159J45721_1011470 JGI25159J45721_10114703 157
49 3300003322 rootL2_10003812 rootL2_1000381211 157
50 3300003374 JGI25161J50226_1010203 JGI25161J50226_10102032 157
51 3300003771 Ga0055526_1005886 Ga0055526_10058867 157
52 3300003773 Ga0055537_1003974 Ga0055537_10039741 157
53 3300003775 Ga0055524_1010165 Ga0055524_10101652 157
54 3300003784 Ga0055534_1003282 Ga0055534_10032823 157
55 3300003790 Ga0055528_1010434 Ga0055528_10104342 157
56 3300003791 Ga0055530_10010428 Ga0055530_100104281 157
57 3300003791 Ga0055530_10037080 Ga0055530_100370801 157
58 3300005328 Ga0070676_10074194 Ga0070676_100741942 157
59 3300006237 Ga0097621_100672441 Ga0097621_1006724412 157
60 3300009098 Ga0105245_10095866 Ga0105245_100958663 157
61 3300013297 Ga0157378_11587540 Ga0157378_115875401 157
62 3300025208 Ga0209436_104714 Ga0209436_1047142 157
63 3300025245 Ga0207425_1000205 Ga0207425_10002053 157
64 3300025263 Ga0209565_1000163 Ga0209565_100016326 157
65 3300025263 Ga0209565_1003524 Ga0209565_10035244 157
66 3300025273 Ga0209673_1013569 Ga0209673_10135692 157
67 3300025284 Ga0209130_1001475 Ga0209130_10014755 157
68 3300025291 Ga0209675_1000635 Ga0209675_100063524 157
69 3300025295 Ga0209564_1010469 Ga0209564_10104693 157
70 3300025298 Ga0209050_1000183 Ga0209050_100018352 157
71 3300025298 Ga0209050_1000753 Ga0209050_10007531 157
72 3300025299 Ga0209256_1003724 Ga0209256_10037246 157
73 3300025302 Ga0207426_1008085 Ga0207426_10080856 157
74 3300025303 Ga0209051_1033169 Ga0209051_10331693 157
75 3300025304 Ga0209257_1000010 Ga0209257_100001089 157
76 3300031548 Ga0307408_100030099 Ga0307408_1000300996 157
77 3300031548 Ga0307408_100039064 Ga0307408_1000390645 157
78 3300042439 Ga0439464_0093207 Ga0439464_0093207_237_782 157
79 3300048915 Ga0496112_0625724 Ga0496112_0625724_47_613 157
80 3300048924 Ga0496121_0022185 Ga0496121_0022185_1157_1711 157
81 3300049515 Ga0501292_027335 Ga0501292_027335_307_852 157
82 3300049657 Ga0501210_017290 Ga0501210_017290_83_628 157
83 3300059645 Ga0587076_007597 Ga0587076_007597_682_1236 157
84 3300002987 JGI25159J45721_1035208 JGI25159J45721_10352082 158
85 3300003374 JGI25161J50226_1017073 JGI25161J50226_10170732 158
86 3300003574 Ga0007410J51695_1021115 Ga0007410J51695_10211152 158
87 3300003575 Ga0007409J51694_1006046 Ga0007409J51694_10060462 158
88 3300003577 Ga0007416J51690_1029903 Ga0007416J51690_10299032 158
89 3300003751 Ga0055538_1000002 Ga0055538_1000002361 158
90 3300003752 Ga0055539_1000002 Ga0055539_1000002361 158
91 3300003756 Ga0055533_1000004 Ga0055533_1000004361 158
92 3300003759 Ga0055525_1000002 Ga0055525_1000002361 158
93 3300003771 Ga0055526_1064010 Ga0055526_10640102 158
94 3300003841 Ga0055541_1000002 Ga0055541_1000002482 158
95 3300004625 Ga0055543_1004724 Ga0055543_10047241 158
96 3300005262 Ga0065165_1011662 Ga0065165_10116621 158
97 3300005327 Ga0070658_10310880 Ga0070658_103108802 158
98 3300014969 Ga0157376_11137173 Ga0157376_111371732 158
99 3300025224 Ga0209784_100002 Ga0209784_100002591 158
100 3300025225 Ga0209566_100003 Ga0209566_100003591 158
101 3300025226 Ga0209674_100004 Ga0209674_100004591 158
102 3300025230 Ga0209563_100006 Ga0209563_100006591 158
103 3300025253 Ga0209677_100003 Ga0209677_100003591 158
104 3300037418 Ga0395900_0860748 Ga0395900_0860748_108_662 158
105 3300037471 Ga0395905_0290802 Ga0395905_0290802_614_1168 158
106 3300038443 Ga0395901_0319235 Ga0395901_0319235_909_1463 158
107 3300044694 Ga0466963_0077203 Ga0466963_0077203_227_781 158
108 3300044706 Ga0466964_0213964 Ga0466964_0213964_19_573 158
109 3300045836 Ga0466958_0044719 Ga0466958_0044719_1125_1679 158
110 3300045976 Ga0466967_0027416 Ga0466967_0027416_4026_4580 158
111 3300048912 Ga0496109_0136903 Ga0496109_0136903_942_1508 158
112 3300059508 Ga0587088_001642 Ga0587088_001642_1162_1716 158
113 3300059647 Ga0587079_023657 Ga0587079_023657_417_971 158
114 3300005327 Ga0070658_11289576 Ga0070658_112895761 159
115 3300005339 Ga0070660_100019039 Ga0070660_1000190396 159
116 3300005344 Ga0070661_100016272 Ga0070661_1000162725 159
117 3300005366 Ga0070659_100248247 Ga0070659_1002482472 159
118 3300005459 Ga0068867_100808148 Ga0068867_1008081481 159
119 3300005539 Ga0068853_101402260 Ga0068853_1014022601 159
120 3300005578 Ga0068854_100351826 Ga0068854_1003518262 159
121 3300006358 Ga0068871_100961585 Ga0068871_1009615852 159
122 3300009093 Ga0105240_10255882 Ga0105240_102558822 159
123 3300009148 Ga0105243_10069287 Ga0105243_100692873 159
124 3300009176 Ga0105242_10002231 Ga0105242_1000223112 159
125 3300009551 Ga0105238_10028613 Ga0105238_100286133 159
126 3300010375 Ga0105239_10093891 Ga0105239_100938915 159
127 3300011119 Ga0105246_10495530 Ga0105246_104955302 159
128 3300025913 Ga0207695_10694482 Ga0207695_106944822 159
129 3300025932 Ga0207690_10315843 Ga0207690_103158432 159
130 3300025933 Ga0207706_10096998 Ga0207706_100969982 159
131 3300025934 Ga0207686_10004796 Ga0207686_100047966 159
132 3300025944 Ga0207661_10315241 Ga0207661_103152412 159
133 3300025945 Ga0207679_10087306 Ga0207679_100873062 159
134 3300025981 Ga0207640_10205995 Ga0207640_102059952 159
135 3300026041 Ga0207639_10224640 Ga0207639_102246402 159
136 3300026089 Ga0207648_10224184 Ga0207648_102241843 159
137 3300026142 Ga0207698_10826271 Ga0207698_108262712 159
138 3300032002 Ga0307416_100654254 Ga0307416_1006542542 159
139 3300037312 Ga0395899_0573065 Ga0395899_0573065_153_707 159
140 3300037418 Ga0395900_0011395 Ga0395900_0011395_3791_4345 159
141 3300037466 Ga0395898_0017582 Ga0395898_0017582_4130_4684 159
142 3300037471 Ga0395905_0916846 Ga0395905_0916846_96_647 159
143 3300038443 Ga0395901_0009241 Ga0395901_0009241_195_749 159
144 3300042005 Ga0439448_0024773 Ga0439448_0024773_261_815 159
145 3300042012 Ga0439455_0070868 Ga0439455_0070868_200_754 159
146 3300044735 Ga0466968_0168236 Ga0466968_0168236_167_721 159
147 3300046501 Ga0495607_0052064 Ga0495607_0052064_631_1182 159
148 3300046506 Ga0495583_0052003 Ga0495583_0052003_668_1222 159
149 3300046507 Ga0495606_0000547 Ga0495606_0000547_58335_58886 159
150 3300046507 Ga0495606_0119684 Ga0495606_0119684_96_647 159
151 3300046558 Ga0495633_0071185 Ga0495633_0071185_126_686 159
152 3300046558 Ga0495633_0215978 Ga0495633_0215978_208_759 159
153 3300046616 Ga0495668_0001106 Ga0495668_0001106_2326_2877 159
154 3300047318 Ga0495636_0004688 Ga0495636_0004688_710_1264 159
155 3300047472 Ga0495686_0034550 Ga0495686_0034550_2047_2598 159
156 3300048905 Ga0496102_0599882 Ga0496102_0599882_89_643 159
157 3300048906 Ga0496103_0174887 Ga0496103_0174887_669_1223 159
158 3300048910 Ga0496107_0110383 Ga0496107_0110383_845_1399 159
159 3300048910 Ga0496107_0341651 Ga0496107_0341651_123_677 159
160 3300048917 Ga0496114_0427586 Ga0496114_0427586_531_1085 159
161 3300049129 Ga0501309_002863 Ga0501309_002863_768_1313 159
162 3300059491 Ga0587070_004835 Ga0587070_004835_523_1077 159
163 3300059505 Ga0587083_0001972 Ga0587083_0001972_1107_1661 159
164 3300059509 Ga0587089_007506 Ga0587089_007506_99_653 159
165 3300059605 Ga0587106_007225 Ga0587106_007225_394_948 159
166 3300059642 Ga0587069_007957 Ga0587069_007957_289_858 159
167 3300059642 Ga0587069_014580 Ga0587069_014580_426_980 159
168 3300059649 Ga0587102_001965 Ga0587102_001965_833_1387 159
169 3300002774 JGI25150J39212_1035054 JGI25150J39212_10350541 160
170 3300003215 JGI25153J46596_10021808 JGI25153J46596_100218083 160
171 3300003759 Ga0055525_1000081 Ga0055525_100008111 160
172 3300005336 Ga0070680_100399210 Ga0070680_1003992102 160
173 3300005339 Ga0070660_100019636 Ga0070660_1000196363 160
174 3300005366 Ga0070659_100027283 Ga0070659_1000272833 160
175 3300005563 Ga0068855_100654854 Ga0068855_1006548542 160
176 3300009174 Ga0105241_10134982 Ga0105241_101349823 160
177 3300017792 Ga0163161_10127977 Ga0163161_101279773 160
178 3300025230 Ga0209563_100015 Ga0209563_100015777 160
179 3300025245 Ga0207425_1001881 Ga0207425_10018815 160
180 3300025253 Ga0209677_109110 Ga0209677_1091103 160
181 3300025294 Ga0209025_1007316 Ga0209025_10073163 160
182 3300025297 Ga0209758_1000270 Ga0209758_100027023 160
183 3300025911 Ga0207654_10003120 Ga0207654_100031209 160
184 3300025917 Ga0207660_10242713 Ga0207660_102427132 160
185 3300025919 Ga0207657_10004403 Ga0207657_1000440310 160
186 3300025932 Ga0207690_10017481 Ga0207690_100174814 160
187 3300026142 Ga0207698_11889844 Ga0207698_118898441 160
188 3300046491 Ga0495584_0000381 Ga0495584_0000381_16263_16814 160
189 3300048903 Ga0496100_0773637 Ga0496100_0773637_50_604 160
190 3300048916 Ga0496113_0026839 Ga0496113_0026839_1364_1918 160
191 3300048925 Ga0496122_0018308 Ga0496122_0018308_2656_3210 160
192 3300048926 Ga0496123_0052096 Ga0496123_0052096_1642_2196 160
193 3300048928 Ga0496125_0172039 Ga0496125_0172039_494_1048 160
194 3300049706 Ga0501229_048866 Ga0501229_048866_52_606 160
195 3300003784 Ga0055534_1002884 Ga0055534_10028847 161
196 3300009036 Ga0105244_10017619 Ga0105244_100176193 161
197 3300015261 Ga0182006_1000010 Ga0182006_1000010323 161
198 3300015262 Ga0182007_10000021 Ga0182007_10000021112 161
199 3300015265 Ga0182005_1000009 Ga0182005_100000960 161
200 3300025291 Ga0209675_1004769 Ga0209675_10047693 161
201 3300025295 Ga0209564_1000098 Ga0209564_100009890 161
202 3300025299 Ga0209256_1001083 Ga0209256_10010833 161
203 3300025728 Ga0207655_1072617 Ga0207655_10726172 161
204 3300025914 Ga0207671_10084328 Ga0207671_100843283 161
205 3300046530 Ga0495654_0011080 Ga0495654_0011080_1211_1780 161
206 3300046530 Ga0495654_0028810 Ga0495654_0028810_1250_1804 161
207 3300046557 Ga0495622_0054503 Ga0495622_0054503_199_753 161
208 3300046558 Ga0495633_0002184 Ga0495633_0002184_12266_12820 161
209 3300048919 Ga0496116_0071545 Ga0496116_0071545_602_1156 161
210 3300048920 Ga0496117_0000010 Ga0496117_0000010_538779_539333 161
211 3300048921 Ga0496118_0000009 Ga0496118_0000009_72622_73176 161
212 3300048924 Ga0496121_0016466 Ga0496121_0016466_2586_3140 161
213 3300048925 Ga0496122_0025832 Ga0496122_0025832_3468_4022 161
214 3300048926 Ga0496123_0004642 Ga0496123_0004642_12579_13133 161
215 3300048927 Ga0496124_0118031 Ga0496124_0118031_859_1413 161
216 3300049460 Ga0495682_0001244 Ga0495682_0001244_12603_13157 161
217 3300059644 Ga0587075_002311 Ga0587075_002311_796_1365 161
218 3300005327 Ga0070658_11126602 Ga0070658_111266021 162
219 3300005563 Ga0068855_100023836 Ga0068855_1000238362 162
220 3300025909 Ga0207705_10015832 Ga0207705_100158323 162
221 3300025949 Ga0207667_10015769 Ga0207667_100157697 162
222 3300039447 Ga0436361_0480035 Ga0436361_0480035_2073_2627 162
223 3300044693 Ga0466961_0485655 Ga0466961_0485655_74_643 162
224 3300044706 Ga0466964_0012691 Ga0466964_0012691_1449_2003 162
225 3300044719 Ga0466971_0182658 Ga0466971_0182658_225_794 162
226 3300046457 Ga0495590_0093492 Ga0495590_0093492_483_1034 162
227 3300046492 Ga0495585_0000889 Ga0495585_0000889_1193_1744 162
228 3300046492 Ga0495585_0011129 Ga0495585_0011129_953_1522 162
229 3300046522 Ga0495643_0077756 Ga0495643_0077756_991_1542 162
230 3300046648 Ga0495611_0165269 Ga0495611_0165269_106_675 162
231 3300046665 Ga0495661_0012263 Ga0495661_0012263_1902_2471 162
232 3300046691 Ga0495670_0022250 Ga0495670_0022250_572_1141 162
233 3300047320 Ga0495672_0025841 Ga0495672_0025841_1990_2544 162
234 3300047323 Ga0495683_0214538 Ga0495683_0214538_40_609 162
235 3300047445 Ga0495677_0013167 Ga0495677_0013167_1817_2386 162
236 3300047470 Ga0495681_0016409 Ga0495681_0016409_237_806 162
237 3300047673 Ga0495593_0071856 Ga0495593_0071856_252_806 162
238 3300048088 Ga0495602_0002022 Ga0495602_0002022_16932_17486 162
239 3300048905 Ga0496102_0000977 Ga0496102_0000977_16799_17350 162
240 3300059639 Ga0587062_031699 Ga0587062_031699_180_734 162
241 3300059642 Ga0587069_003497 Ga0587069_003497_843_1412 162
242 3300005337 Ga0070682_100209046 Ga0070682_1002090462 163
243 3300005355 Ga0070671_100000025 Ga0070671_1000000254 163
244 3300005616 Ga0068852_100470435 Ga0068852_1004704351 163
245 3300006028 Ga0070717_10329720 Ga0070717_103297202 163
246 3300010375 Ga0105239_10566910 Ga0105239_105669102 163
247 3300025931 Ga0207644_10000312 Ga0207644_1000031212 163
248 3300037418 Ga0395900_0000532 Ga0395900_0000532_5572_6141 163
249 3300037471 Ga0395905_0131813 Ga0395905_0131813_259_837 163
250 3300038443 Ga0395901_0000765 Ga0395901_0000765_9623_10192 163
251 3300044656 Ga0466969_0401196 Ga0466969_0401196_12_581 163
252 3300044683 Ga0466965_0006716 Ga0466965_0006716_1449_2018 163
253 3300044684 Ga0466966_0010145 Ga0466966_0010145_3920_4489 163
254 3300044842 Ga0466957_0003305 Ga0466957_0003305_2146_2715 163
255 3300045049 Ga0466959_0235373 Ga0466959_0235373_200_769 163
256 3300046463 Ga0495653_0135297 Ga0495653_0135297_883_1437 163
257 3300046472 Ga0495580_0024981 Ga0495580_0024981_2554_3108 163
258 3300046473 Ga0495582_0005030 Ga0495582_0005030_797_1351 163
259 3300046474 Ga0495605_0000005 Ga0495605_0000005_78206_78760 163
260 3300046474 Ga0495605_0027564 Ga0495605_0027564_1414_1965 163
261 3300046475 Ga0495639_0228194 Ga0495639_0228194_209_763 163
262 3300046491 Ga0495584_0070048 Ga0495584_0070048_423_974 163
263 3300046492 Ga0495585_0092311 Ga0495585_0092311_625_1176 163
264 3300046492 Ga0495585_0135032 Ga0495585_0135032_424_978 163
265 3300046499 Ga0495594_0016435 Ga0495594_0016435_2682_3236 163
266 3300046500 Ga0495596_0044212 Ga0495596_0044212_748_1299 163
267 3300046506 Ga0495583_0108125 Ga0495583_0108125_405_956 163
268 3300046507 Ga0495606_0002788 Ga0495606_0002788_16083_16634 163
269 3300046513 Ga0495616_0040738 Ga0495616_0040738_471_1022 163
270 3300046517 Ga0495630_0005271 Ga0495630_0005271_5908_6462 163
271 3300046518 Ga0495631_0019628 Ga0495631_0019628_1847_2398 163
272 3300046519 Ga0495632_0059363 Ga0495632_0059363_462_1013 163
273 3300046522 Ga0495643_0036792 Ga0495643_0036792_1288_1839 163
274 3300046526 Ga0495666_0007083 Ga0495666_0007083_3746_4300 163
275 3300046528 Ga0495642_0088467 Ga0495642_0088467_534_1085 163
276 3300046529 Ga0495652_0032215 Ga0495652_0032215_2620_3174 163
277 3300046530 Ga0495654_0142868 Ga0495654_0142868_74_625 163
278 3300046535 Ga0495586_0021007 Ga0495586_0021007_1863_2417 163
279 3300046536 Ga0495587_0015121 Ga0495587_0015121_217_771 163
280 3300046538 Ga0495609_0058074 Ga0495609_0058074_424_975 163
281 3300046616 Ga0495668_0145246 Ga0495668_0145246_405_956 163
282 3300046642 Ga0495634_0000991 Ga0495634_0000991_9627_10181 163
283 3300046648 Ga0495611_0093809 Ga0495611_0093809_613_1164 163
284 3300046660 Ga0495625_0149084 Ga0495625_0149084_671_1222 163
285 3300046664 Ga0495659_0037958 Ga0495659_0037958_464_1015 163
286 3300046665 Ga0495661_0210518 Ga0495661_0210518_225_776 163
287 3300046674 Ga0495588_0010764 Ga0495588_0010764_714_1268 163
288 3300046679 Ga0495623_0016264 Ga0495623_0016264_2242_2796 163
289 3300046794 Ga0495589_0080904 Ga0495589_0080904_566_1117 163
290 3300046809 Ga0495600_0199116 Ga0495600_0199116_288_842 163
291 3300047315 Ga0495581_0099725 Ga0495581_0099725_567_1121 163
292 3300047317 Ga0495604_0009665 Ga0495604_0009665_2307_2861 163
293 3300047322 Ga0495680_0090337 Ga0495680_0090337_227_781 163
294 3300047444 Ga0495675_0000641 Ga0495675_0000641_5178_5732 163
295 3300047447 Ga0495685_016278 Ga0495685_016278_776_1327 163
296 3300047470 Ga0495681_0023598 Ga0495681_0023598_2689_3243 163
297 3300048089 Ga0495614_0186182 Ga0495614_0186182_358_912 163
298 3300048091 Ga0495626_0092477 Ga0495626_0092477_565_1116 163
299 3300048918 Ga0496115_0268235 Ga0496115_0268235_637_1188 163
300 3300048927 Ga0496124_0148865 Ga0496124_0148865_221_784 163
301 3300049460 Ga0495682_0011867 Ga0495682_0011867_1592_2143 163
302 3300049822 Ga0501035_0000816 Ga0501035_0000816_29446_30015 163
303 3300059646 Ga0587078_008471 Ga0587078_008471_357_911 163
304 3300003320 rootH2_10293157 rootH2_102931572 164
305 3300017792 Ga0163161_10013082 Ga0163161_100130824 164
306 3300032004 Ga0307414_10045777 Ga0307414_100457772 164
307 3300044765 Ga0466970_0033906 Ga0466970_0033906_978_1550 164
308 3300045049 Ga0466959_0057388 Ga0466959_0057388_1269_1841 164
309 3300046518 Ga0495631_0187925 Ga0495631_0187925_199_756 164
310 3300046531 Ga0495665_0381375 Ga0495665_0381375_99_653 164
311 3300046535 Ga0495586_0022390 Ga0495586_0022390_1227_1781 164
312 3300046663 Ga0495635_0001964 Ga0495635_0001964_8923_9477 164
313 3300046689 Ga0495613_0167143 Ga0495613_0167143_667_1221 164
314 3300046809 Ga0495600_0070875 Ga0495600_0070875_1368_1922 164
315 3300047317 Ga0495604_0008392 Ga0495604_0008392_4971_5525 164
316 3300047320 Ga0495672_0102790 Ga0495672_0102790_55_618 164
317 3300047322 Ga0495680_0005963 Ga0495680_0005963_8867_9421 164
318 3300047445 Ga0495677_0033535 Ga0495677_0033535_458_1015 164
319 3300047673 Ga0495593_0007821 Ga0495593_0007821_1116_1670 164
320 3300048089 Ga0495614_0006176 Ga0495614_0006176_2567_3121 164
321 3300046674 Ga0495588_0323176 Ga0495588_0323176_16_546 165
322 3300003775 Ga0055524_1000026 Ga0055524_100002670 166
323 3300021361 Ga0213872_10039352 Ga0213872_100393521 166
324 3300025263 Ga0209565_1002537 Ga0209565_10025376 166
325 3300025291 Ga0209675_1035477 Ga0209675_10354772 166
326 3300025299 Ga0209256_1000013 Ga0209256_1000013586 166
327 3300031548 Ga0307408_100120973 Ga0307408_1001209732 166
328 3300039447 Ga0436361_0065289 Ga0436361_0065289_3067_3630 166
329 3300041413 Ga0439465_0139031 Ga0439465_0139031_166_720 166
330 3300046512 Ga0495610_0000021 Ga0495610_0000021_74742_75296 166
331 3300046518 Ga0495631_0182652 Ga0495631_0182652_131_700 166
332 3300046524 Ga0495648_0090475 Ga0495648_0090475_103_654 166
333 3300046528 Ga0495642_0206597 Ga0495642_0206597_160_711 166
334 3300046557 Ga0495622_0053142 Ga0495622_0053142_870_1427 166
335 3300046694 Ga0495649_0113557 Ga0495649_0113557_73_624 166
336 3300047320 Ga0495672_0131295 Ga0495672_0131295_312_881 166
337 3300047323 Ga0495683_0038289 Ga0495683_0038289_1678_2247 166
338 3300053118 Ga0500594_0011747 Ga0500594_0011747_533_1084 166
339 3300032004 Ga0307414_10817207 Ga0307414_108172072 167
340 3300046499 Ga0495594_0365398 Ga0495594_0365398_229_780 167
341 3300046501 Ga0495607_0090256 Ga0495607_0090256_711_1280 167
342 3300046531 Ga0495665_0020394 Ga0495665_0020394_603_1154 167
343 3300046535 Ga0495586_0172270 Ga0495586_0172270_632_1183 167
344 3300046538 Ga0495609_0146116 Ga0495609_0146116_61_630 167
345 3300046616 Ga0495668_0397196 Ga0495668_0397196_130_699 167
346 3300046660 Ga0495625_0065254 Ga0495625_0065254_610_1164 167
347 3300046660 Ga0495625_0186517 Ga0495625_0186517_343_897 167
348 3300046665 Ga0495661_0120669 Ga0495661_0120669_577_1146 167
349 3300046665 Ga0495661_0273676 Ga0495661_0273676_146_700 167
350 3300046674 Ga0495588_0000113 Ga0495588_0000113_58741_59295 167
351 3300046674 Ga0495588_0471139 Ga0495588_0471139_42_593 167
352 3300046684 Ga0495669_0000075 Ga0495669_0000075_3904_4473 167
353 3300046694 Ga0495649_0378468 Ga0495649_0378468_103_672 167
354 3300046794 Ga0495589_0072985 Ga0495589_0072985_198_767 167
355 3300047319 Ga0495674_0001330 Ga0495674_0001330_9416_9967 167
356 3300047321 Ga0495676_0433009 Ga0495676_0433009_128_679 167
357 3300047446 Ga0495679_017776 Ga0495679_017776_766_1335 167
358 3300047447 Ga0495685_105721 Ga0495685_105721_128_697 167
359 3300048091 Ga0495626_0090112 Ga0495626_0090112_198_767 167
360 3300048906 Ga0496103_0007002 Ga0496103_0007002_4825_5379 167
361 3300049766 Ga0501269_000437 Ga0501269_000437_733_1287 167
362 3300015261 Ga0182006_1000070 Ga0182006_100007066 168
363 3300015265 Ga0182005_1000003 Ga0182005_100000367 168
364 3300027111 Ga0209281_1027586 Ga0209281_10275862 168
365 3300031838 Ga0307518_10093594 Ga0307518_100935943 168
366 3300037312 Ga0395899_0023733 Ga0395899_0023733_903_1457 168
367 3300037418 Ga0395900_0044333 Ga0395900_0044333_491_1045 168
368 3300046455 Ga0495603_0127264 Ga0495603_0127264_782_1333 168
369 3300046459 Ga0495629_0008589 Ga0495629_0008589_254_805 168
370 3300046491 Ga0495584_0001114 Ga0495584_0001114_1009_1560 168
371 3300046491 Ga0495584_0007663 Ga0495584_0007663_3961_4512 168
372 3300046491 Ga0495584_0094776 Ga0495584_0094776_771_1322 168
373 3300046491 Ga0495584_0224600 Ga0495584_0224600_359_910 168
374 3300046492 Ga0495585_0008221 Ga0495585_0008221_4753_5304 168
375 3300046492 Ga0495585_0235050 Ga0495585_0235050_97_648 168
376 3300046499 Ga0495594_0293937 Ga0495594_0293937_206_757 168
377 3300046500 Ga0495596_0036442 Ga0495596_0036442_255_806 168
378 3300046513 Ga0495616_0105541 Ga0495616_0105541_710_1261 168
379 3300046518 Ga0495631_0221516 Ga0495631_0221516_128_697 168
380 3300046523 Ga0495644_0030512 Ga0495644_0030512_896_1447 168
381 3300046524 Ga0495648_0301215 Ga0495648_0301215_122_691 168
382 3300046526 Ga0495666_0000293 Ga0495666_0000293_7402_7971 168
383 3300046531 Ga0495665_0027126 Ga0495665_0027126_1672_2241 168
384 3300046531 Ga0495665_0272221 Ga0495665_0272221_168_719 168
385 3300046533 Ga0495640_0004944 Ga0495640_0004944_8029_8598 168
386 3300046535 Ga0495586_0127766 Ga0495586_0127766_106_675 168
387 3300046535 Ga0495586_0318063 Ga0495586_0318063_321_872 168
388 3300046538 Ga0495609_0048276 Ga0495609_0048276_424_975 168
389 3300046538 Ga0495609_0051016 Ga0495609_0051016_266_817 168
390 3300046542 Ga0495597_0012024 Ga0495597_0012024_2863_3414 168
391 3300046558 Ga0495633_0009027 Ga0495633_0009027_1896_2447 168
392 3300046616 Ga0495668_0047044 Ga0495668_0047044_1170_1721 168
393 3300046660 Ga0495625_0403729 Ga0495625_0403729_161_712 168
394 3300046689 Ga0495613_0147015 Ga0495613_0147015_1018_1569 168
395 3300046691 Ga0495670_0003298 Ga0495670_0003298_6198_6749 168
396 3300046691 Ga0495670_0065209 Ga0495670_0065209_1055_1606 168
397 3300046694 Ga0495649_0090343 Ga0495649_0090343_751_1302 168
398 3300047321 Ga0495676_0032442 Ga0495676_0032442_1536_2087 168
399 3300047323 Ga0495683_0000112 Ga0495683_0000112_3902_4453 168
400 3300047469 Ga0495673_0000034 Ga0495673_0000034_249638_250189 168
401 3300047470 Ga0495681_0030386 Ga0495681_0030386_566_1117 168
402 3300047470 Ga0495681_0035504 Ga0495681_0035504_1020_1571 168
403 3300048088 Ga0495602_0151365 Ga0495602_0151365_721_1272 168
404 3300048091 Ga0495626_0010381 Ga0495626_0010381_4347_4898 168
405 3300048913 Ga0496110_0007252 Ga0496110_0007252_4864_5418 168
406 3300048914 Ga0496111_0249845 Ga0496111_0249845_404_958 168
407 3300049460 Ga0495682_0063027 Ga0495682_0063027_648_1199 168
408 3300044669 Ga0466981_0558362 Ga0466981_0558362_12_554 169
409 3300044765 Ga0466970_0077320 Ga0466970_0077320_410_952 169
410 3300046474 Ga0495605_0047131 Ga0495605_0047131_1347_1916 169
411 3300046501 Ga0495607_0034188 Ga0495607_0034188_1393_1968 169
412 3300046506 Ga0495583_0019099 Ga0495583_0019099_341_895 169
413 3300046522 Ga0495643_0230749 Ga0495643_0230749_277_828 169
414 3300046538 Ga0495609_0129126 Ga0495609_0129126_170_724 169
415 3300046674 Ga0495588_0297746 Ga0495588_0297746_144_698 169
416 3300046679 Ga0495623_0233308 Ga0495623_0233308_94_645 169
417 3300046810 Ga0495660_0003778 Ga0495660_0003778_1659_2210 169
418 3300047470 Ga0495681_0037873 Ga0495681_0037873_1237_1788 169
419 3300047472 Ga0495686_0040470 Ga0495686_0040470_332_904 169
420 3300048927 Ga0496124_0133675 Ga0496124_0133675_495_1046 169
421 3300049459 Ga0495678_000076 Ga0495678_000076_43210_43761 169
422 3300003751 Ga0055538_1000117 Ga0055538_100011749 170
423 3300003752 Ga0055539_1000163 Ga0055539_100016349 170
424 3300003756 Ga0055533_1000166 Ga0055533_100016649 170
425 3300003759 Ga0055525_1000227 Ga0055525_100022749 170
426 3300003763 Ga0055529_1000565 Ga0055529_100056518 170
427 3300003841 Ga0055541_1000109 Ga0055541_100010914 170
428 3300009093 Ga0105240_10003355 Ga0105240_1000335523 170
429 3300013100 Ga0157373_10065917 Ga0157373_100659173 170
430 3300025224 Ga0209784_100153 Ga0209784_10015316 170
431 3300025225 Ga0209566_100195 Ga0209566_10019516 170
432 3300025226 Ga0209674_100198 Ga0209674_10019816 170
433 3300025230 Ga0209563_100157 Ga0209563_10015716 170
434 3300025253 Ga0209677_100156 Ga0209677_10015616 170
435 3300025272 Ga0209455_1000063 Ga0209455_1000063249 170
436 3300048919 Ga0496116_0010763 Ga0496116_0010763_2870_3427 170
437 3300048921 Ga0496118_0089671 Ga0496118_0089671_164_721 170
438 3300048924 Ga0496121_0118573 Ga0496121_0118573_1216_1773 170
439 3300048925 Ga0496122_0000513 Ga0496122_0000513_10850_11407 170
440 3300048926 Ga0496123_0000145 Ga0496123_0000145_68623_69180 170
441 3300048928 Ga0496125_0032436 Ga0496125_0032436_3911_4468 170
442 3300046471 Ga0495650_0033656 Ga0495650_0033656_1113_1664 171
443 3300046507 Ga0495606_0115547 Ga0495606_0115547_18_572 171
444 3300046519 Ga0495632_0001724 Ga0495632_0001724_3799_4353 171
445 3300046520 Ga0495637_0000305 Ga0495637_0000305_1009_1560 171
446 3300046530 Ga0495654_0000005 Ga0495654_0000005_68319_68870 171
447 3300046542 Ga0495597_0000310 Ga0495597_0000310_42237_42791 171
448 3300046542 Ga0495597_0002547 Ga0495597_0002547_7682_8236 171
449 3300046542 Ga0495597_0148467 Ga0495597_0148467_243_797 171
450 3300046558 Ga0495633_0123596 Ga0495633_0123596_144_698 171
451 3300046660 Ga0495625_0022179 Ga0495625_0022179_1417_1968 171
452 3300046665 Ga0495661_0032622 Ga0495661_0032622_1760_2314 171
453 3300046794 Ga0495589_0001253 Ga0495589_0001253_11222_11776 171
454 3300046810 Ga0495660_0065622 Ga0495660_0065622_428_979 171
455 3300047470 Ga0495681_0302280 Ga0495681_0302280_26_577 171
456 3300048928 Ga0496125_0274243 Ga0496125_0274243_127_678 171
457 3300059510 Ga0587090_031712 Ga0587090_031712_232_786 171
458 3300003771 Ga0055526_1004232 Ga0055526_10042323 172
459 3300046452 Ga0495617_075766 Ga0495617_075766_251_796 172
460 3300046459 Ga0495629_0056479 Ga0495629_0056479_671_1222 172
461 3300046460 Ga0495638_0117589 Ga0495638_0117589_49_600 172
462 3300046463 Ga0495653_0036769 Ga0495653_0036769_2459_3010 172
463 3300046471 Ga0495650_0000712 Ga0495650_0000712_21626_22177 172
464 3300046491 Ga0495584_0019150 Ga0495584_0019150_2142_2687 172
465 3300046501 Ga0495607_0063189 Ga0495607_0063189_461_1006 172
466 3300046506 Ga0495583_0018489 Ga0495583_0018489_981_1526 172
467 3300046513 Ga0495616_0084167 Ga0495616_0084167_956_1501 172
468 3300046517 Ga0495630_0021183 Ga0495630_0021183_3741_4292 172
469 3300046528 Ga0495642_0052284 Ga0495642_0052284_1062_1607 172
470 3300046529 Ga0495652_0041820 Ga0495652_0041820_1833_2384 172
471 3300046531 Ga0495665_0137168 Ga0495665_0137168_151_702 172
472 3300046535 Ga0495586_0016302 Ga0495586_0016302_2412_2963 172
473 3300046536 Ga0495587_0033763 Ga0495587_0033763_722_1273 172
474 3300046538 Ga0495609_0044718 Ga0495609_0044718_1294_1839 172
475 3300046542 Ga0495597_0003418 Ga0495597_0003418_3188_3739 172
476 3300046542 Ga0495597_0004282 Ga0495597_0004282_2486_3049 172
477 3300046557 Ga0495622_0187524 Ga0495622_0187524_169_720 172
478 3300046558 Ga0495633_0000357 Ga0495633_0000357_1136_1690 172
479 3300046559 Ga0495667_0108419 Ga0495667_0108419_552_1103 172
480 3300046615 Ga0495656_0216050 Ga0495656_0216050_190_735 172
481 3300046616 Ga0495668_0000008 Ga0495668_0000008_400934_401482 172
482 3300046616 Ga0495668_0034818 Ga0495668_0034818_29_574 172
483 3300046642 Ga0495634_0117670 Ga0495634_0117670_912_1463 172
484 3300046660 Ga0495625_0001934 Ga0495625_0001934_15240_15785 172
485 3300046660 Ga0495625_0002185 Ga0495625_0002185_19650_20201 172
486 3300046664 Ga0495659_0002967 Ga0495659_0002967_3862_4407 172
487 3300046665 Ga0495661_0096991 Ga0495661_0096991_217_762 172
488 3300046679 Ga0495623_0170724 Ga0495623_0170724_551_1102 172
489 3300046680 Ga0495646_0175128 Ga0495646_0175128_57_608 172
490 3300046684 Ga0495669_0006448 Ga0495669_0006448_412_957 172
491 3300046694 Ga0495649_0007384 Ga0495649_0007384_3896_4441 172
492 3300046809 Ga0495600_0194477 Ga0495600_0194477_143_694 172
493 3300046810 Ga0495660_0053711 Ga0495660_0053711_947_1492 172
494 3300047315 Ga0495581_0040566 Ga0495581_0040566_853_1404 172
495 3300047320 Ga0495672_0000014 Ga0495672_0000014_100180_100767 172
496 3300047444 Ga0495675_0114778 Ga0495675_0114778_140_691 172
497 3300047445 Ga0495677_0008437 Ga0495677_0008437_3140_3685 172
498 3300047447 Ga0495685_009277 Ga0495685_009277_1647_2192 172
499 3300047470 Ga0495681_0014139 Ga0495681_0014139_978_1523 172
500 3300047470 Ga0495681_0093372 Ga0495681_0093372_747_1298 172
501 3300047472 Ga0495686_0001306 Ga0495686_0001306_1378_1926 172
502 3300047472 Ga0495686_0041735 Ga0495686_0041735_1231_1818 172
503 3300047673 Ga0495593_0060082 Ga0495593_0060082_30_581 172
504 3300048089 Ga0495614_0099458 Ga0495614_0099458_237_788 172
505 3300048091 Ga0495626_0000044 Ga0495626_0000044_94677_95231 172
506 3300048091 Ga0495626_0028057 Ga0495626_0028057_1180_1731 172
507 3300048928 Ga0496125_0001481 Ga0496125_0001481_13768_14331 172
508 3300003544 Ga0007417J51691_1016591 Ga0007417J51691_10165912 173
509 3300003574 Ga0007410J51695_1024144 Ga0007410J51695_10241441 173
510 3300003771 Ga0055526_1015143 Ga0055526_10151433 173
511 3300005295 Ga0065707_10223324 Ga0065707_102233242 173
512 3300005548 Ga0070665_100150604 Ga0070665_1001506043 173
513 3300005844 Ga0068862_100068501 Ga0068862_1000685013 173
514 3300006177 Ga0075362_10006912 Ga0075362_100069124 173
515 3300009036 Ga0105244_10002846 Ga0105244_100028469 173
516 3300009036 Ga0105244_10004702 Ga0105244_100047028 173
517 3300009177 Ga0105248_10148536 Ga0105248_101485362 173
518 3300009553 Ga0105249_10146050 Ga0105249_101460502 173
519 3300025263 Ga0209565_1019823 Ga0209565_10198233 173
520 3300025295 Ga0209564_1000026 Ga0209564_1000026414 173
521 3300025728 Ga0207655_1006312 Ga0207655_10063123 173
522 3300025728 Ga0207655_1007374 Ga0207655_10073743 173
523 3300025903 Ga0207680_10007523 Ga0207680_100075234 173
524 3300025941 Ga0207711_10002080 Ga0207711_100020806 173
525 3300025941 Ga0207711_10008967 Ga0207711_100089674 173
526 3300025961 Ga0207712_10142307 Ga0207712_101423072 173
527 3300028379 Ga0268266_10060143 Ga0268266_100601433 173
528 3300028380 Ga0268265_10001641 Ga0268265_100016414 173
529 3300039447 Ga0436361_0179116 Ga0436361_0179116_156_695 173
530 3300042139 Ga0450904_000854 Ga0450904_000854_2704_3255 173
531 3300044658 Ga0466972_0000283 Ga0466972_0000283_26416_26970 173
532 3300046460 Ga0495638_0083406 Ga0495638_0083406_605_1156 173
533 3300046471 Ga0495650_0000212 Ga0495650_0000212_48341_48892 173
534 3300046474 Ga0495605_0026659 Ga0495605_0026659_943_1497 173
535 3300046491 Ga0495584_0099702 Ga0495584_0099702_331_885 173
536 3300046500 Ga0495596_0005456 Ga0495596_0005456_826_1380 173
537 3300046506 Ga0495583_0000983 Ga0495583_0000983_2949_3503 173
538 3300046506 Ga0495583_0038221 Ga0495583_0038221_213_764 173
539 3300046506 Ga0495583_0170507 Ga0495583_0170507_329_880 173
540 3300046507 Ga0495606_0050389 Ga0495606_0050389_2163_2714 173
541 3300046512 Ga0495610_0006777 Ga0495610_0006777_6586_7140 173
542 3300046513 Ga0495616_0000093 Ga0495616_0000093_72081_72635 173
543 3300046515 Ga0495620_0020297 Ga0495620_0020297_2411_2962 173
544 3300046522 Ga0495643_0000096 Ga0495643_0000096_113341_113895 173
545 3300046522 Ga0495643_0000181 Ga0495643_0000181_46312_46866 173
546 3300046522 Ga0495643_0001269 Ga0495643_0001269_20170_20724 173
547 3300046524 Ga0495648_0037553 Ga0495648_0037553_1333_1887 173
548 3300046530 Ga0495654_0021618 Ga0495654_0021618_675_1238 173
549 3300046536 Ga0495587_0174471 Ga0495587_0174471_460_1011 173
550 3300046538 Ga0495609_0008303 Ga0495609_0008303_1269_1823 173
551 3300046615 Ga0495656_0075758 Ga0495656_0075758_686_1237 173
552 3300046616 Ga0495668_0021698 Ga0495668_0021698_872_1423 173
553 3300046692 Ga0495671_0077195 Ga0495671_0077195_124_678 173
554 3300046694 Ga0495649_0059791 Ga0495649_0059791_551_1105 173
555 3300046694 Ga0495649_0078012 Ga0495649_0078012_1211_1762 173
556 3300046809 Ga0495600_0524328 Ga0495600_0524328_83_634 173
557 3300047317 Ga0495604_0169591 Ga0495604_0169591_914_1465 173
558 3300047320 Ga0495672_0000285 Ga0495672_0000285_1233_1787 173
559 3300047323 Ga0495683_0055612 Ga0495683_0055612_429_983 173
560 3300047445 Ga0495677_0091042 Ga0495677_0091042_125_679 173
561 3300048091 Ga0495626_0000974 Ga0495626_0000974_786_1340 173
562 3300048910 Ga0496107_0163164 Ga0496107_0163164_77_628 173
563 3300048914 Ga0496111_0264928 Ga0496111_0264928_15_566 173
564 3300048919 Ga0496116_0016976 Ga0496116_0016976_4067_4618 173
565 3300048927 Ga0496124_0190102 Ga0496124_0190102_622_1173 173
566 3300048927 Ga0496124_0261593 Ga0496124_0261593_540_1088 173
567 3300048928 Ga0496125_0167339 Ga0496125_0167339_604_1152 173
568 3300049459 Ga0495678_000780 Ga0495678_000780_21192_21746 173
569 3300053118 Ga0500594_0048637 Ga0500594_0048637_390_944 173
570 3300053125 Ga0500618_001000 Ga0500618_001000_13063_13617 173
571 3300038443 Ga0395901_0002028 Ga0395901_0002028_4869_5450 174
572 3300044706 Ga0466964_0005209 Ga0466964_0005209_192_761 174
573 3300046501 Ga0495607_0011208 Ga0495607_0011208_1289_1843 174
574 3300046507 Ga0495606_0072842 Ga0495606_0072842_689_1252 174
575 3300046513 Ga0495616_0024971 Ga0495616_0024971_2039_2593 174
576 3300046519 Ga0495632_0008471 Ga0495632_0008471_1325_1879 174
577 3300046522 Ga0495643_0000983 Ga0495643_0000983_8510_9064 174
578 3300046665 Ga0495661_0012374 Ga0495661_0012374_4862_5416 174
579 3300047323 Ga0495683_0182017 Ga0495683_0182017_183_737 174
580 3300047445 Ga0495677_0004197 Ga0495677_0004197_912_1466 174
581 3300048091 Ga0495626_0007753 Ga0495626_0007753_4380_4934 174
582 3300048903 Ga0496100_0014602 Ga0496100_0014602_3874_4452 174
583 3300048904 Ga0496101_0133907 Ga0496101_0133907_1153_1731 174
584 3300053161 Ga0500634_0164240 Ga0500634_0164240_479_1003 174
585 3300013102 Ga0157371_10000064 Ga0157371_1000006453 175
586 3300014497 Ga0182008_10012348 Ga0182008_100123484 175
587 3300015261 Ga0182006_1137093 Ga0182006_11370931 175
588 3300015262 Ga0182007_10039625 Ga0182007_100396252 175
589 3300015262 Ga0182007_10047837 Ga0182007_100478371 175
590 3300044656 Ga0466969_0024922 Ga0466969_0024922_1555_2124 175
591 3300044683 Ga0466965_0047069 Ga0466965_0047069_960_1529 175
592 3300044693 Ga0466961_0286026 Ga0466961_0286026_234_803 175
593 3300044719 Ga0466971_0224141 Ga0466971_0224141_58_627 175
594 3300045049 Ga0466959_0082530 Ga0466959_0082530_562_1131 175
595 3300046492 Ga0495585_0097505 Ga0495585_0097505_239_790 175
596 3300046500 Ga0495596_0004154 Ga0495596_0004154_1153_1707 175
597 3300046500 Ga0495596_0017944 Ga0495596_0017944_2001_2555 175
598 3300046500 Ga0495596_0175637 Ga0495596_0175637_67_618 175
599 3300046507 Ga0495606_0003771 Ga0495606_0003771_11900_12451 175
600 3300046507 Ga0495606_0036377 Ga0495606_0036377_2138_2692 175
601 3300046518 Ga0495631_0014034 Ga0495631_0014034_91_642 175
602 3300046528 Ga0495642_0097643 Ga0495642_0097643_108_659 175
603 3300046615 Ga0495656_0497204 Ga0495656_0497204_13_576 175
604 3300046648 Ga0495611_0093887 Ga0495611_0093887_709_1260 175
605 3300046660 Ga0495625_0353390 Ga0495625_0353390_167_721 175
606 3300046665 Ga0495661_0037214 Ga0495661_0037214_454_1017 175
607 3300046684 Ga0495669_0258688 Ga0495669_0258688_130_681 175
608 3300046691 Ga0495670_0053351 Ga0495670_0053351_127_678 175
609 3300046692 Ga0495671_0007599 Ga0495671_0007599_4630_5184 175
610 3300046692 Ga0495671_0048958 Ga0495671_0048958_298_849 175
611 3300046810 Ga0495660_0184307 Ga0495660_0184307_375_929 175
612 3300048917 Ga0496114_0137840 Ga0496114_0137840_1404_1979 175
613 3300048928 Ga0496125_0035873 Ga0496125_0035873_3589_4164 175
614 3300048929 Ga0496126_0277185 Ga0496126_0277185_116_691 175
615 3300049459 Ga0495678_000175 Ga0495678_000175_17892_18446 175
616 3300053098 Ga0500650_0000107 Ga0500650_0000107_15301_15828 175
617 3300059477 Ga0587084_004887 Ga0587084_004887_382_936 175
618 3300002737 JGI25162J39368_1005347 JGI25162J39368_10053472 176
619 3300005262 Ga0065165_1000557 Ga0065165_100055728 176
620 3300014497 Ga0182008_10022337 Ga0182008_100223373 176
621 3300015261 Ga0182006_1003847 Ga0182006_10038473 176
622 3300025233 Ga0209437_100084 Ga0209437_100084134 176
623 3300046473 Ga0495582_0214083 Ga0495582_0214083_219_770 176
624 3300046522 Ga0495643_0106851 Ga0495643_0106851_508_1062 176
625 3300046535 Ga0495586_0042318 Ga0495586_0042318_814_1365 176
626 3300046615 Ga0495656_0069076 Ga0495656_0069076_708_1271 176
627 3300046694 Ga0495649_0073599 Ga0495649_0073599_160_714 176
628 3300047315 Ga0495581_0065186 Ga0495581_0065186_1142_1693 176
629 3300047444 Ga0495675_0102882 Ga0495675_0102882_758_1309 176
630 3300047673 Ga0495593_0021382 Ga0495593_0021382_2324_2875 176
631 3300048089 Ga0495614_0024164 Ga0495614_0024164_724_1275 176
632 3300013306 Ga0163162_10090756 Ga0163162_100907562 177
633 3300031911 Ga0307412_10912337 Ga0307412_109123372 177
634 3300046453 Ga0495627_004698 Ga0495627_004698_5078_5632 177
635 3300046491 Ga0495584_0018616 Ga0495584_0018616_1129_1698 177
636 3300046492 Ga0495585_0007941 Ga0495585_0007941_4600_5151 177
637 3300046518 Ga0495631_0022012 Ga0495631_0022012_2388_2942 177
638 3300046528 Ga0495642_0036277 Ga0495642_0036277_1246_1815 177
639 3300046558 Ga0495633_0022770 Ga0495633_0022770_1153_1704 177
640 3300046558 Ga0495633_0040898 Ga0495633_0040898_1161_1715 177
641 3300046665 Ga0495661_0071706 Ga0495661_0071706_498_1049 177
642 3300046689 Ga0495613_0021937 Ga0495613_0021937_916_1485 177
643 3300046691 Ga0495670_0056475 Ga0495670_0056475_810_1364 177
644 3300046691 Ga0495670_0160614 Ga0495670_0160614_102_653 177
645 3300046692 Ga0495671_0014178 Ga0495671_0014178_1223_1777 177
646 3300047443 Ga0495687_010203 Ga0495687_010203_722_1276 177
647 3300047470 Ga0495681_0005423 Ga0495681_0005423_2501_3055 177
648 3300048091 Ga0495626_0023256 Ga0495626_0023256_2343_2897 177
649 3300048924 Ga0496121_0544422 Ga0496121_0544422_39_614 177
650 iso_pu_bacteria 2842711865 2842714022 177
651 3300005563 Ga0068855_100002941 Ga0068855_10000294113 178
652 3300005614 Ga0068856_100196880 Ga0068856_1001968803 178
653 3300005834 Ga0068851_10118595 Ga0068851_101185953 178
654 3300025949 Ga0207667_10000019 Ga0207667_10000019181 178
655 3300026078 Ga0207702_10314059 Ga0207702_103140592 178
656 3300046492 Ga0495585_0017446 Ga0495585_0017446_432_998 178
657 3300046506 Ga0495583_0044743 Ga0495583_0044743_881_1447 178
658 3300046522 Ga0495643_0253848 Ga0495643_0253848_95_661 178
659 3300046524 Ga0495648_0019268 Ga0495648_0019268_816_1382 178
660 3300046538 Ga0495609_0017904 Ga0495609_0017904_2508_3074 178
661 3300046660 Ga0495625_0087883 Ga0495625_0087883_1057_1623 178
662 3300046665 Ga0495661_0044067 Ga0495661_0044067_1265_1831 178
663 3300047443 Ga0495687_000060 Ga0495687_000060_110757_111323 178
664 3300047445 Ga0495677_0036290 Ga0495677_0036290_599_1165 178
665 3300048905 Ga0496102_0000279 Ga0496102_0000279_1283_1849 178
666 3300048906 Ga0496103_0001678 Ga0496103_0001678_2502_3068 178
667 3300037471 Ga0395905_0072918 Ga0395905_0072918_685_1251 179
668 3300047315 Ga0495581_0007750 Ga0495581_0007750_270_839 179
669 iso_pu_bacteria 2600255292 2601666747 179
670 iso_pu_bacteria 2643221645 2644249236 179
671 iso_pu_bacteria 2857547612 2857548513 179
672 iso_pu_bacteria 2857564685 2857566349 179
673 iso_pu_bacteria 2885080285 2885083693 179
674 iso_pu_bacteria 2932410948 2932413108 179
675 iso_pu_bacteria 2932416698 2932420623 179
676 3300005563 Ga0068855_100113778 Ga0068855_1001137782 180
677 3300005616 Ga0068852_100105451 Ga0068852_1001054512 180
678 3300009093 Ga0105240_10007797 Ga0105240_1000779717 180
679 3300013307 Ga0157372_11872767 Ga0157372_118727671 180
680 3300025913 Ga0207695_10001902 Ga0207695_1000190214 180
681 3300025913 Ga0207695_10032133 Ga0207695_100321333 180
682 3300025925 Ga0207650_10071357 Ga0207650_100713572 180
683 3300025949 Ga0207667_10287065 Ga0207667_102870653 180
684 3300026116 Ga0207674_10193579 Ga0207674_101935792 180
685 3300026142 Ga0207698_10002422 Ga0207698_1000242210 180
686 3300048905 Ga0496102_0065912 Ga0496102_0065912_1069_1620 180
687 3300048924 Ga0496121_0018662 Ga0496121_0018662_1244_1825 180
688 iso_pu_bacteria 2643221603 2644027961 180
689 iso_pu_bacteria 2738541280 2738740665 180
690 iso_pu_bacteria 2738541297 2738825951 180
691 iso_pu_bacteria 2738541300 2738844986 180
692 iso_pu_bacteria 2738541357 2739149748 180
693 iso_pu_bacteria 2738543003 2739191667 180
694 iso_pu_bacteria 2738543018 2739277401 180
695 iso_pu_bacteria 2738543026 2739318144 180
696 iso_pu_bacteria 2738543029 2739336385 180
697 iso_pu_bacteria 2738543030 2739346444 180
698 iso_pu_bacteria 2821131069 2821135594 180
699 iso_pu_bacteria 2857558681 2857562487 180
700 iso_pu_bacteria 2904424332 2904430742 180
701 3300021361 Ga0213872_10142017 Ga0213872_101420171 181
702 3300039447 Ga0436361_1087377 Ga0436361_1087377_1741_2295 181
703 3300005331 Ga0070670_100000002 Ga0070670_100000002533 182
704 3300005353 Ga0070669_100005576 Ga0070669_10000557610 182
705 3300005365 Ga0070688_100004285 Ga0070688_1000042857 182
706 3300005367 Ga0070667_100000394 Ga0070667_1000003948 182
707 3300005466 Ga0070685_10000005 Ga0070685_1000000599 182
708 3300005617 Ga0068859_100041050 Ga0068859_1000410504 182
709 3300005618 Ga0068864_100000003 Ga0068864_100000003546 182
710 3300005843 Ga0068860_100000326 Ga0068860_10000032631 182
711 3300006931 Ga0097620_100041051 Ga0097620_1000410514 182
712 3300014325 Ga0163163_10000136 Ga0163163_1000013614 182
713 3300014968 Ga0157379_10845278 Ga0157379_108452782 182
714 3300025923 Ga0207681_10000156 Ga0207681_1000015640 182
715 3300025925 Ga0207650_10000003 Ga0207650_100000031080 182
716 3300025986 Ga0207658_10000004 Ga0207658_10000004527 182
717 3300026035 Ga0207703_10607025 Ga0207703_106070252 182
718 3300026088 Ga0207641_10190748 Ga0207641_101907483 182
719 3300026088 Ga0207641_10661571 Ga0207641_106615712 182
720 3300026095 Ga0207676_10000003 Ga0207676_1000000314 182
721 3300028381 Ga0268264_10000123 Ga0268264_1000012383 182
722 3300037471 Ga0395905_0000589 Ga0395905_0000589_34361_34924 182
723 3300046453 Ga0495627_005183 Ga0495627_005183_4222_4773 182
724 3300046460 Ga0495638_0036578 Ga0495638_0036578_1184_1735 182
725 3300046491 Ga0495584_0021044 Ga0495584_0021044_1425_1976 182
726 3300046507 Ga0495606_0259831 Ga0495606_0259831_318_869 182
727 3300046513 Ga0495616_0106310 Ga0495616_0106310_499_1050 182
728 3300046518 Ga0495631_0020566 Ga0495631_0020566_1665_2216 182
729 3300046520 Ga0495637_0051276 Ga0495637_0051276_1035_1601 182
730 3300046523 Ga0495644_0014817 Ga0495644_0014817_2343_2897 182
731 3300046523 Ga0495644_0029509 Ga0495644_0029509_1338_1889 182
732 3300046525 Ga0495663_0104318 Ga0495663_0104318_205_756 182
733 3300046528 Ga0495642_0022230 Ga0495642_0022230_653_1204 182
734 3300046530 Ga0495654_0166524 Ga0495654_0166524_297_863 182
735 3300046542 Ga0495597_0050362 Ga0495597_0050362_683_1234 182
736 3300046558 Ga0495633_0034395 Ga0495633_0034395_429_980 182
737 3300046615 Ga0495656_0001209 Ga0495656_0001209_6381_6932 182
738 3300046616 Ga0495668_0048141 Ga0495668_0048141_1302_1853 182
739 3300046616 Ga0495668_0344287 Ga0495668_0344287_217_771 182
740 3300046648 Ga0495611_0096401 Ga0495611_0096401_685_1236 182
741 3300046660 Ga0495625_0463312 Ga0495625_0463312_211_762 182
742 3300046665 Ga0495661_0194571 Ga0495661_0194571_56_607 182
743 3300046691 Ga0495670_0087202 Ga0495670_0087202_549_1100 182
744 3300046794 Ga0495589_0027732 Ga0495589_0027732_981_1532 182
745 3300047318 Ga0495636_0207537 Ga0495636_0207537_198_749 182
746 3300047445 Ga0495677_0003569 Ga0495677_0003569_4515_5066 182
747 3300047470 Ga0495681_0039116 Ga0495681_0039116_429_980 182
748 3300048091 Ga0495626_0001091 Ga0495626_0001091_7645_8211 182
749 iso_pu_bacteria 2818991436 2819543071 182
750 3300003316 rootH1_10018115 rootH1_100181154 183
751 3300003322 rootL2_10025871 rootL2_100258712 183
752 3300045049 Ga0466959_0147587 Ga0466959_0147587_533_1099 183
753 3300046501 Ga0495607_0039793 Ga0495607_0039793_2099_2653 183
754 3300047472 Ga0495686_0001600 Ga0495686_0001600_20257_20811 183
755 3300059477 Ga0587084_010006 Ga0587084_010006_619_1170 183
756 3300059478 Ga0587093_004214 Ga0587093_004214_666_1217 183
757 3300059513 Ga0587094_004612 Ga0587094_004612_386_937 183
758 3300060344 Ga0587071_009863 Ga0587071_009863_453_1004 183
759 iso_pu_bacteria 2521172590 2521556704 183
760 iso_pu_bacteria 2551306416 2553006704 183
761 iso_pu_bacteria 2919046199 2919049474 183
762 iso_pu_bacteria 2923510766 2923515296 183
763 iso_pu_bacteria 2928130867 2928132254 183
764 3300028800 Ga0265338_10000251 Ga0265338_1000025144 184
765 3300031238 Ga0265332_10140284 Ga0265332_101402842 184
766 3300047470 Ga0495681_0127366 Ga0495681_0127366_189_743 184
767 iso_pu_bacteria 2765235838 2765567885 184
768 iso_pu_bacteria 2839094727 2839097828 184
769 3300046462 Ga0495651_0154334 Ga0495651_0154334_20_589 185
770 3300046516 Ga0495628_0006086 Ga0495628_0006086_8053_8622 185
771 3300046529 Ga0495652_0060251 Ga0495652_0060251_983_1552 185
772 3300046660 Ga0495625_0004513 Ga0495625_0004513_10786_11343 185
773 3300046679 Ga0495623_0273114 Ga0495623_0273114_44_613 185
774 3300048088 Ga0495602_0345020 Ga0495602_0345020_235_804 185
775 3300053077 Ga0495601_0316794 Ga0495601_0316794_231_800 185
776 iso_pu_bacteria 2818991449 2819618069 185
777 iso_pu_bacteria 2904439833 2904441913 185
778 iso_pu_bacteria 2904530477 2904533211 185
779 iso_pu_bacteria 2904584206 2904586158 185
780 iso_pu_bacteria 2904589729 2904592028 185
781 iso_pu_bacteria 2904601388 2904601810 185
782 iso_pu_bacteria 2919079590 2919083863 185
783 3300002737 JGI25162J39368_1000025 JGI25162J39368_100002563 186
784 3300003214 JGI25165J46597_1000054 JGI25165J46597_100005463 186
785 3300003751 Ga0055538_1000026 Ga0055538_1000026163 186
786 3300003752 Ga0055539_1000033 Ga0055539_1000033163 186
787 3300003756 Ga0055533_1000044 Ga0055533_1000044163 186
788 3300003759 Ga0055525_1000052 Ga0055525_1000052162 186
789 3300003841 Ga0055541_1000069 Ga0055541_100006925 186
790 3300015261 Ga0182006_1019017 Ga0182006_10190173 186
791 3300015262 Ga0182007_10005022 Ga0182007_100050225 186
792 3300015265 Ga0182005_1000140 Ga0182005_100014013 186
793 3300021361 Ga0213872_10001180 Ga0213872_100011803 186
794 3300025224 Ga0209784_100020 Ga0209784_100020129 186
795 3300025225 Ga0209566_100020 Ga0209566_100020129 186
796 3300025226 Ga0209674_100035 Ga0209674_100035129 186
797 3300025230 Ga0209563_100038 Ga0209563_100038129 186
798 3300025231 Ga0207427_100803 Ga0207427_1008037 186
799 3300025233 Ga0209437_100066 Ga0209437_100066252 186
800 3300025253 Ga0209677_100031 Ga0209677_10003169 186
801 3300025261 Ga0209233_1000060 Ga0209233_1000060129 186
802 3300037312 Ga0395899_0006725 Ga0395899_0006725_2957_3529 186
803 3300037418 Ga0395900_0004176 Ga0395900_0004176_5335_5907 186
804 3300037471 Ga0395905_0010271 Ga0395905_0010271_6414_6986 186
805 3300039447 Ga0436361_0239425 Ga0436361_0239425_23238_23804 186
806 3300046454 Ga0495592_0086444 Ga0495592_0086444_1063_1635 186
807 3300046463 Ga0495653_0041862 Ga0495653_0041862_2270_2842 186
808 3300046471 Ga0495650_0000051 Ga0495650_0000051_143717_144283 186
809 3300046511 Ga0495608_0011730 Ga0495608_0011730_3422_3994 186
810 3300046514 Ga0495618_0043922 Ga0495618_0043922_541_1113 186
811 3300046516 Ga0495628_0013454 Ga0495628_0013454_5028_5600 186
812 3300046529 Ga0495652_0089342 Ga0495652_0089342_1601_2173 186
813 3300046529 Ga0495652_0127906 Ga0495652_0127906_120_692 186
814 3300046543 Ga0495645_0231595 Ga0495645_0231595_118_690 186
815 3300046557 Ga0495622_0067145 Ga0495622_0067145_20_592 186
816 3300046642 Ga0495634_0337122 Ga0495634_0337122_98_670 186
817 3300046675 Ga0495657_0064926 Ga0495657_0064926_1309_1881 186
818 3300046678 Ga0495599_0027691 Ga0495599_0027691_2249_2821 186
819 3300046680 Ga0495646_0020393 Ga0495646_0020393_1642_2214 186
820 3300046809 Ga0495600_0011825 Ga0495600_0011825_873_1445 186
821 3300047317 Ga0495604_0025743 Ga0495604_0025743_1217_1789 186
822 3300048088 Ga0495602_0166569 Ga0495602_0166569_604_1176 186
823 3300053077 Ga0495601_0006228 Ga0495601_0006228_5547_6119 186
824 3300053119 Ga0500595_001191 Ga0500595_001191_2561_3133 186
825 3300053141 Ga0500574_001023 Ga0500574_001023_2306_2878 186
826 iso_pu_bacteria 2511231026 2511387194 186
827 3300039447 Ga0436361_0370552 Ga0436361_0370552_251_814 187
828 3300003323 rootH1_10041734 rootH1_100417344 188
829 iso_pu_bacteria 2808606386 2808982747 188
830 iso_pu_bacteria 2808606415 2809130249 188
831 iso_pu_bacteria 2808606419 2809150274 188
832 iso_pu_bacteria 2852618963 2852621503 188
833 3300049571 Ga0501034_0144066 Ga0501034_0144066_1629_2219 189
834 iso_pu_bacteria 2511231003 2511249160 189
835 3300006175 Ga0070712_100003941 Ga0070712_1000039414 190
836 3300006946 Ga0079104_1003938 Ga0079104_10039384 190
837 3300053125 Ga0500618_000954 Ga0500618_000954_1260_1832 190
838 3300025228 Ga0209672_110782 Ga0209672_1107822 191
839 3300046529 Ga0495652_0014252 Ga0495652_0014252_2725_3312 191
840 3300046543 Ga0495645_0026559 Ga0495645_0026559_2561_3148 191
841 3300046680 Ga0495646_0041520 Ga0495646_0041520_1146_1733 191
842 3300046690 Ga0495624_0177809 Ga0495624_0177809_95_682 191
843 3300053125 Ga0500618_001616 Ga0500618_001616_7842_8438 191
844 iso_pu_bacteria 2548876994 2550692417 191
845 iso_pu_bacteria 2818991445 2819592561 191
846 iso_pu_bacteria 2884811622 2884812348 191
847 iso_pu_bacteria 2884836552 2884838950 191
848 iso_pu_bacteria 2884852848 2884855242 191
849 iso_pu_bacteria 2896154374 2896156089 191
850 3300002704 JGI25155J39150_1000219 JGI25155J39150_100021918 193
851 3300002705 JGI25156J39149_1003054 JGI25156J39149_10030544 193
852 3300002738 JGI25154J39366_1000432 JGI25154J39366_100043212 193
853 3300025206 Ga0209435_100214 Ga0209435_10021411 193
854 3300025246 Ga0209646_1000283 Ga0209646_100028336 193
855 3300025250 Ga0209026_1001071 Ga0209026_100107112 193
856 3300025256 Ga0209759_1000548 Ga0209759_100054812 193
857 3300002704 JGI25155J39150_1000142 JGI25155J39150_100014218 195
858 3300002705 JGI25156J39149_1000497 JGI25156J39149_100049713 195
859 3300002738 JGI25154J39366_1000423 JGI25154J39366_100042318 195
860 3300002741 JGI25157J39369_1000158 JGI25157J39369_100015813 195
861 3300002741 JGI25157J39369_1000203 JGI25157J39369_100020328 195
862 3300003758 Ga0055532_1000005 Ga0055532_1000005141 195
863 3300003761 Ga0055535_1024759 Ga0055535_10247591 195
864 3300014497 Ga0182008_10290110 Ga0182008_102901102 195
865 3300025206 Ga0209435_100004 Ga0209435_100004194 195
866 3300025229 Ga0209147_100011 Ga0209147_100011292 195
867 3300025242 Ga0209258_100560 Ga0209258_10056021 195
868 3300025246 Ga0209646_1000032 Ga0209646_1000032168 195
869 3300025250 Ga0209026_1000062 Ga0209026_100006228 195
870 3300025256 Ga0209759_1000054 Ga0209759_100005413 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

35

197

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.9606 32 194
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.9548 32 194
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.8755 29 193
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.8711 29 195
3hpe-assembly1.cif.gz_B crystal structure of ycei (hp1286) from helicobacter pylori 0.8566 30 193
ID Description Score Start End Superfamily
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8737 29 195 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8603 32 192 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8591 29 195 2.40.128.110
3hpeB00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8566 30 193 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.839 51 195 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A4T0UWZ2-F1-model_v4 YceI family protein 0.936 49 195
AF-A0A1M7K1K0-F1-model_v4 Polyisoprenoid-binding protein YceI 0.9359 30 194
AF-A0A0H2M9W2-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9356 22 194
AF-A0A7Y6YXP6-F1-model_v4 YceI family protein 0.9348 23 193 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A1E8FJS6-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9316 75 192

Feature Viewer

pLDDT pTM Quality
85.95 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map