F484166
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 870 | 389 | 823 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_001616|Ga0500618_001616_7842_8438 |
| Length | 198 |
| Sequence | MKAQMMVRTTLEKTMIAGAVAAIALASSAAFAAPLKVDAAKSTVGATFKQLNVPVDAKLKKFSAVIDFDAAKPESSKASVDIDVASFDLGDAEYNKEVQKKEWFNAAQFPKATFVTSSIKPSAGAAAGTKYDVAGKLTIKGKSTDVSFPLTVKKEGATQVFDGTLPIKRLTYNIGEGEWKDTSMVADEVSIKFHFVAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 4 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 5 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 6 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 7 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 8 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 9 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 10 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 11 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 12 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 13 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 14 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 15 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 16 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 17 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 18 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 19 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 20 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 21 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 22 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 23 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 24 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 25 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 26 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 27 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 28 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 29 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 30 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 31 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 32 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 33 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 34 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 35 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 36 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 37 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 38 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 39 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 40 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 41 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 42 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 43 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 44 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 45 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 46 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 47 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 48 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 49 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 50 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 51 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 52 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 53 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 54 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 55 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 56 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 57 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 58 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 59 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 60 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 61 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 62 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 63 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 64 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 65 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 66 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 67 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 75 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 77 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 80 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 83 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 95 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 98 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 104 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 221 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 222 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 223 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 224 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 225 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 226 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 227 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 228 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 229 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 230 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 236 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 237 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 238 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 347 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 348 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 351 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 352 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 353 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 354 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 355 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 361 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 362 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 366 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 370 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 371 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.8 |
| Metatranscriptomes | 3.68 |
| Isolates | 5.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.95 |
| Nodule | 0.57 |
| Rhizoplane | 2.76 |
| Rhizosphere | 75.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000142 | 3300002704 | Bacteria | 33693 |
| 2 | JGI25155J39150_1000219 | 3300002704 | Bacteria | 22984 |
| 3 | JGI25156J39149_1000497 | 3300002705 | Bacteria | 23452 |
| 4 | JGI25156J39149_1003054 | 3300002705 | Bacteria | 5671 |
| 5 | JGI25162J39368_1000025 | 3300002737 | Bacteria | 228879 |
| 6 | JGI25162J39368_1005347 | 3300002737 | Bacteria | 2559 |
| 7 | JGI25154J39366_1000423 | 3300002738 | Bacteria | 22650 |
| 8 | JGI25154J39366_1000432 | 3300002738 | Bacteria | 22245 |
| 9 | JGI25157J39369_1000158 | 3300002741 | Bacteria | 56328 |
| 10 | JGI25157J39369_1000203 | 3300002741 | Bacteria | 49480 |
| 11 | JGI25150J39212_1001267 | 3300002774 | Bacteria | 7274 |
| 12 | JGI25150J39212_1035054 | 3300002774 | Bacteria | 672 |
| 13 | JGI25159J45721_1011470 | 3300002987 | Bacteria | 2169 |
| 14 | JGI25159J45721_1035208 | 3300002987 | Bacteria | 768 |
| 15 | JGI25165J46597_1000054 | 3300003214 | Bacteria | 228891 |
| 16 | JGI25153J46596_10021808 | 3300003215 | Bacteria | 2379 |
| 17 | rootH1_10018115 | 3300003316 | Bacteria | 3845 |
| 18 | rootH2_10293157 | 3300003320 | Bacteria | 1472 |
| 19 | rootL2_10003812 | 3300003322 | Bacteria | 12708 |
| 20 | rootL2_10025871 | 3300003322 | Bacteria | 5171 |
| 21 | rootH1_10041734 | 3300003316 | Bacteria | 4023 |
| 22 | rootH1_10041734 | 3300003323 | Bacteria | 3489 |
| 23 | JGI25161J50226_1010203 | 3300003374 | Bacteria | 1272 |
| 24 | JGI25161J50226_1017073 | 3300003374 | Bacteria | 768 |
| 25 | Ga0007417J51691_1016591 | 3300003544 | Bacteria | 1408 |
| 26 | Ga0007410J51695_1021115 | 3300003574 | Bacteria | 1068 |
| 27 | Ga0007410J51695_1024144 | 3300003574 | Bacteria | 1299 |
| 28 | Ga0007409J51694_1006046 | 3300003575 | Bacteria | 1202 |
| 29 | Ga0007416J51690_1029903 | 3300003577 | Bacteria | 1827 |
| 30 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 31 | Ga0055538_1000026 | 3300003751 | Bacteria | 228891 |
| 32 | Ga0055538_1000117 | 3300003751 | Bacteria | 60939 |
| 33 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 34 | Ga0055539_1000033 | 3300003752 | Bacteria | 228891 |
| 35 | Ga0055539_1000163 | 3300003752 | Bacteria | 60939 |
| 36 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 37 | Ga0055533_1000044 | 3300003756 | Bacteria | 228891 |
| 38 | Ga0055533_1000166 | 3300003756 | Bacteria | 60939 |
| 39 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 40 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 41 | Ga0055525_1000052 | 3300003759 | Bacteria | 228891 |
| 42 | Ga0055525_1000081 | 3300003759 | Bacteria | 161329 |
| 43 | Ga0055525_1000227 | 3300003759 | Bacteria | 60939 |
| 44 | Ga0055535_1024759 | 3300003761 | Bacteria | 685 |
| 45 | Ga0055529_1000565 | 3300003763 | Bacteria | 30558 |
| 46 | Ga0055526_1004232 | 3300003771 | Bacteria | 8712 |
| 47 | Ga0055526_1005886 | 3300003771 | Bacteria | 6868 |
| 48 | Ga0055526_1015143 | 3300003771 | Bacteria | 3113 |
| 49 | Ga0055526_1064010 | 3300003771 | Bacteria | 771 |
| 50 | Ga0055537_1003974 | 3300003773 | Bacteria | 4369 |
| 51 | Ga0055524_1000026 | 3300003775 | Bacteria | 214653 |
| 52 | Ga0055524_1010165 | 3300003775 | Bacteria | 3766 |
| 53 | Ga0055534_1002884 | 3300003784 | Bacteria | 5709 |
| 54 | Ga0055534_1003282 | 3300003784 | Bacteria | 5146 |
| 55 | Ga0055528_1010434 | 3300003790 | Bacteria | 3777 |
| 56 | Ga0055530_10010428 | 3300003791 | Bacteria | 3435 |
| 57 | Ga0055530_10037080 | 3300003791 | Bacteria | 1222 |
| 58 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 59 | Ga0055541_1000069 | 3300003841 | Bacteria | 94648 |
| 60 | Ga0055541_1000109 | 3300003841 | Bacteria | 60939 |
| 61 | Ga0055543_1004724 | 3300004625 | Bacteria | 3637 |
| 62 | Ga0065165_1000557 | 3300005262 | Bacteria | 55476 |
| 63 | Ga0065165_1011662 | 3300005262 | Bacteria | 3637 |
| 64 | Ga0065704_10286848 | 3300005289 | Bacteria | 911 |
| 65 | Ga0065707_10223324 | 3300005295 | Bacteria | 1216 |
| 66 | Ga0070658_10310880 | 3300005327 | Bacteria | 1344 |
| 67 | Ga0070658_11126602 | 3300005327 | Bacteria | 682 |
| 68 | Ga0070658_11289576 | 3300005327 | Bacteria | 634 |
| 69 | Ga0070676_10074194 | 3300005328 | Bacteria | 2048 |
| 70 | Ga0070670_100000002 | 3300005331 | Bacteria | 568775 |
| 71 | Ga0070680_100399210 | 3300005336 | Bacteria | 1172 |
| 72 | Ga0070682_100209046 | 3300005337 | Bacteria | 1382 |
| 73 | Ga0070660_100019039 | 3300005339 | Bacteria | 5025 |
| 74 | Ga0070660_100019636 | 3300005339 | Bacteria | 4955 |
| 75 | Ga0070660_100878083 | 3300005339 | Bacteria | 756 |
| 76 | Ga0070661_100016272 | 3300005344 | Bacteria | 5256 |
| 77 | Ga0070661_100471047 | 3300005344 | Bacteria | 1002 |
| 78 | Ga0070669_100005576 | 3300005353 | Bacteria | 9091 |
| 79 | Ga0070671_100000025 | 3300005355 | Bacteria | 121912 |
| 80 | Ga0070688_100004285 | 3300005365 | Bacteria | 7416 |
| 81 | Ga0070659_100027283 | 3300005366 | Bacteria | 4399 |
| 82 | Ga0070659_100248247 | 3300005366 | Bacteria | 1474 |
| 83 | Ga0070667_100000394 | 3300005367 | Bacteria | 47270 |
| 84 | Ga0068867_100808148 | 3300005459 | Bacteria | 837 |
| 85 | Ga0070685_10000005 | 3300005466 | Bacteria | 190119 |
| 86 | Ga0068853_101402260 | 3300005539 | Bacteria | 676 |
| 87 | Ga0070665_100150604 | 3300005548 | Bacteria | 2329 |
| 88 | Ga0068855_100002941 | 3300005563 | Bacteria | 20811 |
| 89 | Ga0068855_100023836 | 3300005563 | Bacteria | 7331 |
| 90 | Ga0068855_100113778 | 3300005563 | Bacteria | 3103 |
| 91 | Ga0068855_100654854 | 3300005563 | Bacteria | 1127 |
| 92 | Ga0070664_100107270 | 3300005564 | Bacteria | 2435 |
| 93 | Ga0068854_100007911 | 3300005578 | Bacteria | 6804 |
| 94 | Ga0068854_100351826 | 3300005578 | Bacteria | 1206 |
| 95 | Ga0068856_100196880 | 3300005614 | Bacteria | 2029 |
| 96 | Ga0068856_100577120 | 3300005614 | Bacteria | 1146 |
| 97 | Ga0068852_100105451 | 3300005616 | Bacteria | 2554 |
| 98 | Ga0068852_100470435 | 3300005616 | Bacteria | 1247 |
| 99 | Ga0068859_100041050 | 3300005617 | Bacteria | 4648 |
| 100 | Ga0068864_100000003 | 3300005618 | Bacteria | 568775 |
| 101 | Ga0068851_10118595 | 3300005834 | Bacteria | 1420 |
| 102 | Ga0068860_100000326 | 3300005843 | Bacteria | 64692 |
| 103 | Ga0068862_100068501 | 3300005844 | Bacteria | 3061 |
| 104 | Ga0070717_10329720 | 3300006028 | Bacteria | 1361 |
| 105 | Ga0070712_100003941 | 3300006175 | Bacteria | 9138 |
| 106 | Ga0075362_10006912 | 3300006177 | Bacteria | 4254 |
| 107 | Ga0097621_100672441 | 3300006237 | Bacteria | 951 |
| 108 | Ga0068871_100961585 | 3300006358 | Bacteria | 794 |
| 109 | Ga0097620_100041051 | 3300006931 | Bacteria | 4648 |
| 110 | Ga0079104_1003938 | 3300006946 | Bacteria | 6622 |
| 111 | Ga0105244_10002846 | 3300009036 | Bacteria | 12839 |
| 112 | Ga0105244_10004702 | 3300009036 | Bacteria | 9297 |
| 113 | Ga0105244_10017619 | 3300009036 | Bacteria | 4031 |
| 114 | Ga0105244_10082230 | 3300009036 | Bacteria | 1593 |
| 115 | Ga0105240_10003355 | 3300009093 | Bacteria | 24916 |
| 116 | Ga0105240_10007797 | 3300009093 | Bacteria | 15467 |
| 117 | Ga0105240_10076139 | 3300009093 | Bacteria | 4137 |
| 118 | Ga0105240_10255882 | 3300009093 | Bacteria | 2022 |
| 119 | Ga0105245_10095866 | 3300009098 | Bacteria | 2737 |
| 120 | Ga0105243_10069287 | 3300009148 | Bacteria | 2845 |
| 121 | Ga0105241_10134982 | 3300009174 | Bacteria | 2002 |
| 122 | Ga0105242_10002231 | 3300009176 | Bacteria | 15286 |
| 123 | Ga0105248_10148536 | 3300009177 | Unclassified | 2644 |
| 124 | Ga0105237_10006971 | 3300009545 | Bacteria | 12457 |
| 125 | Ga0105238_10000505 | 3300009551 | Bacteria | 41099 |
| 126 | Ga0105238_10028613 | 3300009551 | Bacteria | 5677 |
| 127 | Ga0105249_10146050 | 3300009553 | Unclassified | 2273 |
| 128 | Ga0105239_10003532 | 3300010375 | Bacteria | 19140 |
| 129 | Ga0105239_10093891 | 3300010375 | Bacteria | 3313 |
| 130 | Ga0105239_10566910 | 3300010375 | Bacteria | 1294 |
| 131 | Ga0105246_10495530 | 3300011119 | Bacteria | 1036 |
| 132 | Ga0157373_10065917 | 3300013100 | Bacteria | 2562 |
| 133 | Ga0157371_10000064 | 3300013102 | Bacteria | 169056 |
| 134 | Ga0157371_10376395 | 3300013102 | Bacteria | 1036 |
| 135 | Ga0157378_11587540 | 3300013297 | Bacteria | 700 |
| 136 | Ga0163162_10090756 | 3300013306 | Bacteria | 3137 |
| 137 | Ga0157372_10418475 | 3300013307 | Bacteria | 1562 |
| 138 | Ga0157372_11872767 | 3300013307 | Bacteria | 690 |
| 139 | Ga0163163_10000136 | 3300014325 | Bacteria | 75532 |
| 140 | Ga0182008_10012348 | 3300014497 | Bacteria | 4509 |
| 141 | Ga0182008_10022337 | 3300014497 | Bacteria | 3241 |
| 142 | Ga0182008_10290110 | 3300014497 | Bacteria | 853 |
| 143 | Ga0157379_10845278 | 3300014968 | Unclassified | 866 |
| 144 | Ga0157376_11137173 | 3300014969 | Bacteria | 807 |
| 145 | Ga0182006_1000010 | 3300015261 | Bacteria | 413414 |
| 146 | Ga0182006_1000070 | 3300015261 | Bacteria | 137793 |
| 147 | Ga0182006_1003847 | 3300015261 | Bacteria | 7537 |
| 148 | Ga0182006_1011302 | 3300015261 | Bacteria | 3933 |
| 149 | Ga0182006_1019017 | 3300015261 | Bacteria | 2897 |
| 150 | Ga0182006_1137093 | 3300015261 | Bacteria | 838 |
| 151 | Ga0182007_10000021 | 3300015262 | Bacteria | 193408 |
| 152 | Ga0182007_10005022 | 3300015262 | Bacteria | 5877 |
| 153 | Ga0182007_10028545 | 3300015262 | Bacteria | 1916 |
| 154 | Ga0182007_10039625 | 3300015262 | Bacteria | 1576 |
| 155 | Ga0182007_10047837 | 3300015262 | Bacteria | 1414 |
| 156 | Ga0182005_1000003 | 3300015265 | Bacteria | 683269 |
| 157 | Ga0182005_1000009 | 3300015265 | Bacteria | 455334 |
| 158 | Ga0182005_1000140 | 3300015265 | Bacteria | 51063 |
| 159 | Ga0163161_10013082 | 3300017792 | Bacteria | 5767 |
| 160 | Ga0163161_10127977 | 3300017792 | Bacteria | 1914 |
| 161 | Ga0213872_10001180 | 3300021361 | Bacteria | 17725 |
| 162 | Ga0213872_10039352 | 3300021361 | Bacteria | 2157 |
| 163 | Ga0213872_10142017 | 3300021361 | Bacteria | 1053 |
| 164 | Ga0209435_100004 | 3300025206 | Bacteria | 633417 |
| 165 | Ga0209435_100214 | 3300025206 | Bacteria | 16487 |
| 166 | Ga0209436_104714 | 3300025208 | Bacteria | 3303 |
| 167 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 168 | Ga0209784_100020 | 3300025224 | Bacteria | 412353 |
| 169 | Ga0209784_100153 | 3300025224 | Bacteria | 62664 |
| 170 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 171 | Ga0209566_100020 | 3300025225 | Bacteria | 412353 |
| 172 | Ga0209566_100195 | 3300025225 | Bacteria | 62664 |
| 173 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 174 | Ga0209674_100035 | 3300025226 | Bacteria | 412353 |
| 175 | Ga0209674_100198 | 3300025226 | Bacteria | 62664 |
| 176 | Ga0209672_110782 | 3300025228 | Bacteria | 1217 |
| 177 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 178 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 179 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 180 | Ga0209563_100038 | 3300025230 | Bacteria | 412353 |
| 181 | Ga0209563_100157 | 3300025230 | Bacteria | 62664 |
| 182 | Ga0207427_100803 | 3300025231 | Bacteria | 14223 |
| 183 | Ga0209437_100066 | 3300025233 | Bacteria | 327883 |
| 184 | Ga0209437_100084 | 3300025233 | Bacteria | 255423 |
| 185 | Ga0209258_100560 | 3300025242 | Bacteria | 32331 |
| 186 | Ga0207425_1000205 | 3300025245 | Bacteria | 47028 |
| 187 | Ga0207425_1001881 | 3300025245 | Bacteria | 8024 |
| 188 | Ga0209646_1000032 | 3300025246 | Bacteria | 375315 |
| 189 | Ga0209646_1000283 | 3300025246 | Bacteria | 44163 |
| 190 | Ga0209026_1000062 | 3300025250 | Bacteria | 213298 |
| 191 | Ga0209026_1001071 | 3300025250 | Bacteria | 13234 |
| 192 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 193 | Ga0209677_100031 | 3300025253 | Bacteria | 329719 |
| 194 | Ga0209677_100156 | 3300025253 | Bacteria | 62664 |
| 195 | Ga0209677_109110 | 3300025253 | Bacteria | 1824 |
| 196 | Ga0209759_1000054 | 3300025256 | Bacteria | 211422 |
| 197 | Ga0209759_1000548 | 3300025256 | Bacteria | 38674 |
| 198 | Ga0209233_1000060 | 3300025261 | Bacteria | 412379 |
| 199 | Ga0209565_1000163 | 3300025263 | Bacteria | 87185 |
| 200 | Ga0209565_1002537 | 3300025263 | Bacteria | 6491 |
| 201 | Ga0209565_1003524 | 3300025263 | Bacteria | 5022 |
| 202 | Ga0209565_1019823 | 3300025263 | Bacteria | 1429 |
| 203 | Ga0209455_1000063 | 3300025272 | Bacteria | 333019 |
| 204 | Ga0209673_1013569 | 3300025273 | Bacteria | 3207 |
| 205 | Ga0209130_1001475 | 3300025284 | Bacteria | 15380 |
| 206 | Ga0209675_1000635 | 3300025291 | Bacteria | 24937 |
| 207 | Ga0209675_1004769 | 3300025291 | Bacteria | 5897 |
| 208 | Ga0209675_1035477 | 3300025291 | Bacteria | 1137 |
| 209 | Ga0209025_1007316 | 3300025294 | Bacteria | 8276 |
| 210 | Ga0209564_1000026 | 3300025295 | Bacteria | 519154 |
| 211 | Ga0209564_1000098 | 3300025295 | Bacteria | 228906 |
| 212 | Ga0209564_1010469 | 3300025295 | Bacteria | 4266 |
| 213 | Ga0209758_1000270 | 3300025297 | Bacteria | 102973 |
| 214 | Ga0209050_1000183 | 3300025298 | Bacteria | 142357 |
| 215 | Ga0209050_1000753 | 3300025298 | Bacteria | 46582 |
| 216 | Ga0209256_1000013 | 3300025299 | Bacteria | 689442 |
| 217 | Ga0209256_1001083 | 3300025299 | Bacteria | 31411 |
| 218 | Ga0209256_1003724 | 3300025299 | Bacteria | 10323 |
| 219 | Ga0207426_1008085 | 3300025302 | Bacteria | 4309 |
| 220 | Ga0209051_1033169 | 3300025303 | Bacteria | 1956 |
| 221 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 222 | Ga0207655_1006312 | 3300025728 | Bacteria | 7876 |
| 223 | Ga0207655_1007374 | 3300025728 | Bacteria | 7136 |
| 224 | Ga0207655_1072617 | 3300025728 | Bacteria | 1272 |
| 225 | Ga0207655_1102042 | 3300025728 | Bacteria | 985 |
| 226 | Ga0207680_10007523 | 3300025903 | Bacteria | 5318 |
| 227 | Ga0207705_10015832 | 3300025909 | Bacteria | 5416 |
| 228 | Ga0207705_10573990 | 3300025909 | Bacteria | 877 |
| 229 | Ga0207654_10003120 | 3300025911 | Bacteria | 8391 |
| 230 | Ga0207695_10001902 | 3300025913 | Bacteria | 32583 |
| 231 | Ga0207695_10006732 | 3300025913 | Bacteria | 14831 |
| 232 | Ga0207695_10032133 | 3300025913 | Bacteria | 5747 |
| 233 | Ga0207695_10694482 | 3300025913 | Bacteria | 898 |
| 234 | Ga0207671_10007433 | 3300025914 | Bacteria | 9507 |
| 235 | Ga0207671_10084328 | 3300025914 | Bacteria | 2386 |
| 236 | Ga0207660_10242713 | 3300025917 | Bacteria | 1420 |
| 237 | Ga0207657_10004403 | 3300025919 | Bacteria | 14895 |
| 238 | Ga0207681_10000156 | 3300025923 | Bacteria | 56382 |
| 239 | Ga0207694_10000392 | 3300025924 | Bacteria | 40819 |
| 240 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 241 | Ga0207650_10071357 | 3300025925 | Bacteria | 2612 |
| 242 | Ga0207644_10000312 | 3300025931 | Bacteria | 31641 |
| 243 | Ga0207690_10017481 | 3300025932 | Bacteria | 4379 |
| 244 | Ga0207690_10315843 | 3300025932 | Bacteria | 1227 |
| 245 | Ga0207706_10096998 | 3300025933 | Bacteria | 2592 |
| 246 | Ga0207686_10004796 | 3300025934 | Bacteria | 7259 |
| 247 | Ga0207711_10002080 | 3300025941 | Bacteria | 18084 |
| 248 | Ga0207711_10008967 | 3300025941 | Bacteria | 8363 |
| 249 | Ga0207661_10315241 | 3300025944 | Bacteria | 1405 |
| 250 | Ga0207679_10087306 | 3300025945 | Bacteria | 2401 |
| 251 | Ga0207667_10000019 | 3300025949 | Bacteria | 386233 |
| 252 | Ga0207667_10015769 | 3300025949 | Bacteria | 8568 |
| 253 | Ga0207667_10287065 | 3300025949 | Bacteria | 1681 |
| 254 | Ga0207712_10142307 | 3300025961 | Unclassified | 1842 |
| 255 | Ga0207640_10002070 | 3300025981 | Bacteria | 10810 |
| 256 | Ga0207640_10205995 | 3300025981 | Bacteria | 1494 |
| 257 | Ga0207658_10000004 | 3300025986 | Bacteria | 569357 |
| 258 | Ga0207703_10607025 | 3300026035 | Unclassified | 1035 |
| 259 | Ga0207639_10224640 | 3300026041 | Bacteria | 1624 |
| 260 | Ga0207702_10314059 | 3300026078 | Bacteria | 1491 |
| 261 | Ga0207641_10190748 | 3300026088 | Bacteria | 1883 |
| 262 | Ga0207641_10661571 | 3300026088 | Unclassified | 1026 |
| 263 | Ga0207648_10224184 | 3300026089 | Bacteria | 1671 |
| 264 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 265 | Ga0207674_10193579 | 3300026116 | Bacteria | 1983 |
| 266 | Ga0207674_10502681 | 3300026116 | Bacteria | 1171 |
| 267 | Ga0207698_10002422 | 3300026142 | Bacteria | 11040 |
| 268 | Ga0207698_10826271 | 3300026142 | Bacteria | 930 |
| 269 | Ga0207698_11889844 | 3300026142 | Bacteria | 612 |
| 270 | Ga0209281_1027586 | 3300027111 | Bacteria | 1039 |
| 271 | Ga0268266_10060143 | 3300028379 | Bacteria | 3274 |
| 272 | Ga0268265_10001641 | 3300028380 | Bacteria | 18332 |
| 273 | Ga0268264_10000123 | 3300028381 | Bacteria | 189361 |
| 274 | Ga0265338_10000251 | 3300028800 | Bacteria | 98343 |
| 275 | Ga0265332_10140284 | 3300031238 | Bacteria | 1013 |
| 276 | Ga0307408_100030099 | 3300031548 | Bacteria | 3767 |
| 277 | Ga0307408_100039064 | 3300031548 | Bacteria | 3352 |
| 278 | Ga0307408_100120973 | 3300031548 | Bacteria | 2028 |
| 279 | Ga0307518_10093594 | 3300031838 | Bacteria | 2159 |
| 280 | Ga0307412_10912337 | 3300031911 | Bacteria | 771 |
| 281 | Ga0307416_100654254 | 3300032002 | Bacteria | 1136 |
| 282 | Ga0307414_10045777 | 3300032004 | Bacteria | 2998 |
| 283 | Ga0307414_10817207 | 3300032004 | Bacteria | 851 |
| 284 | Ga0395899_0006725 | 3300037312 | Bacteria | 8904 |
| 285 | Ga0395899_0023733 | 3300037312 | Bacteria | 4641 |
| 286 | Ga0395899_0573065 | 3300037312 | Bacteria | 723 |
| 287 | Ga0395900_0000532 | 3300037418 | Bacteria | 53751 |
| 288 | Ga0395900_0004176 | 3300037418 | Bacteria | 15339 |
| 289 | Ga0395900_0011395 | 3300037418 | Bacteria | 9100 |
| 290 | Ga0395900_0044333 | 3300037418 | Bacteria | 4583 |
| 291 | Ga0395900_0372424 | 3300037418 | Bacteria | 1397 |
| 292 | Ga0395900_0860748 | 3300037418 | Bacteria | 831 |
| 293 | Ga0395898_0017582 | 3300037466 | Bacteria | 7296 |
| 294 | Ga0395905_0000589 | 3300037471 | Bacteria | 48792 |
| 295 | Ga0395905_0010271 | 3300037471 | Bacteria | 9115 |
| 296 | Ga0395905_0072918 | 3300037471 | Bacteria | 3218 |
| 297 | Ga0395905_0131813 | 3300037471 | Bacteria | 2350 |
| 298 | Ga0395905_0290802 | 3300037471 | Bacteria | 1521 |
| 299 | Ga0395905_0916846 | 3300037471 | Bacteria | 779 |
| 300 | Ga0395901_0000765 | 3300038443 | Bacteria | 36025 |
| 301 | Ga0395901_0002028 | 3300038443 | Bacteria | 20821 |
| 302 | Ga0395901_0009241 | 3300038443 | Bacteria | 9990 |
| 303 | Ga0395901_0319235 | 3300038443 | Bacteria | 1607 |
| 304 | Ga0436361_0065289 | 3300039447 | Bacteria | 15724 |
| 305 | Ga0436361_0179116 | 3300039447 | Bacteria | 893 |
| 306 | Ga0436361_0239425 | 3300039447 | Bacteria | 40455 |
| 307 | Ga0436361_0370552 | 3300039447 | Bacteria | 1375 |
| 308 | Ga0436361_0480035 | 3300039447 | Bacteria | 16007 |
| 309 | Ga0436361_1087377 | 3300039447 | Bacteria | 2723 |
| 310 | Ga0439465_0139031 | 3300041413 | Bacteria | 862 |
| 311 | Ga0439448_0024773 | 3300042005 | Bacteria | 1878 |
| 312 | Ga0439448_0034436 | 3300042005 | Bacteria | 1618 |
| 313 | Ga0439450_003658 | 3300042008 | Bacteria | 2563 |
| 314 | Ga0439455_0002204 | 3300042012 | Bacteria | 3488 |
| 315 | Ga0439455_0070868 | 3300042012 | Bacteria | 936 |
| 316 | Ga0450904_000854 | 3300042139 | Bacteria | 5015 |
| 317 | Ga0450906_092126 | 3300042145 | Bacteria | 550 |
| 318 | Ga0439464_0093207 | 3300042439 | Bacteria | 910 |
| 319 | Ga0466969_0024922 | 3300044656 | Bacteria | 3076 |
| 320 | Ga0466969_0401196 | 3300044656 | Bacteria | 622 |
| 321 | Ga0466972_0000283 | 3300044658 | Bacteria | 31634 |
| 322 | Ga0466972_0031399 | 3300044658 | Bacteria | 2612 |
| 323 | Ga0466981_0558362 | 3300044669 | Bacteria | 627 |
| 324 | Ga0466965_0001710 | 3300044683 | Bacteria | 9017 |
| 325 | Ga0466965_0006716 | 3300044683 | Bacteria | 5248 |
| 326 | Ga0466965_0047069 | 3300044683 | Bacteria | 2135 |
| 327 | Ga0466966_0010145 | 3300044684 | Bacteria | 6247 |
| 328 | Ga0466961_0286026 | 3300044693 | Bacteria | 1008 |
| 329 | Ga0466961_0485655 | 3300044693 | Bacteria | 746 |
| 330 | Ga0466963_0077203 | 3300044694 | Bacteria | 2250 |
| 331 | Ga0466964_0005209 | 3300044706 | Bacteria | 4821 |
| 332 | Ga0466964_0012691 | 3300044706 | Bacteria | 3189 |
| 333 | Ga0466964_0023327 | 3300044706 | Bacteria | 2406 |
| 334 | Ga0466964_0213964 | 3300044706 | Bacteria | 932 |
| 335 | Ga0466971_0182658 | 3300044719 | Bacteria | 986 |
| 336 | Ga0466971_0224141 | 3300044719 | Bacteria | 891 |
| 337 | Ga0466968_0005176 | 3300044735 | Bacteria | 4879 |
| 338 | Ga0466968_0168236 | 3300044735 | Bacteria | 1015 |
| 339 | Ga0466970_0033906 | 3300044765 | Bacteria | 2700 |
| 340 | Ga0466970_0077320 | 3300044765 | Bacteria | 1794 |
| 341 | Ga0466957_0003305 | 3300044842 | Bacteria | 8825 |
| 342 | Ga0466959_0057388 | 3300045049 | Bacteria | 2838 |
| 343 | Ga0466959_0082530 | 3300045049 | Bacteria | 2315 |
| 344 | Ga0466959_0147587 | 3300045049 | Bacteria | 1659 |
| 345 | Ga0466959_0235373 | 3300045049 | Bacteria | 1266 |
| 346 | Ga0466958_0044719 | 3300045836 | Bacteria | 2669 |
| 347 | Ga0466967_0027416 | 3300045976 | Bacteria | 4738 |
| 348 | Ga0495617_075766 | 3300046452 | Bacteria | 1104 |
| 349 | Ga0495627_004698 | 3300046453 | Bacteria | 5650 |
| 350 | Ga0495627_005183 | 3300046453 | Bacteria | 5303 |
| 351 | Ga0495592_0086444 | 3300046454 | Bacteria | 2258 |
| 352 | Ga0495603_0127264 | 3300046455 | Bacteria | 1484 |
| 353 | Ga0495590_0093492 | 3300046457 | Bacteria | 1065 |
| 354 | Ga0495629_0008589 | 3300046459 | Bacteria | 7521 |
| 355 | Ga0495629_0056479 | 3300046459 | Bacteria | 2744 |
| 356 | Ga0495638_0036578 | 3300046460 | Bacteria | 3127 |
| 357 | Ga0495638_0083406 | 3300046460 | Bacteria | 1936 |
| 358 | Ga0495638_0117589 | 3300046460 | Bacteria | 1573 |
| 359 | Ga0495651_0154334 | 3300046462 | Bacteria | 1651 |
| 360 | Ga0495653_0036769 | 3300046463 | Bacteria | 3853 |
| 361 | Ga0495653_0041862 | 3300046463 | Bacteria | 3572 |
| 362 | Ga0495653_0135297 | 3300046463 | Bacteria | 1739 |
| 363 | Ga0495650_0000051 | 3300046471 | Bacteria | 318297 |
| 364 | Ga0495650_0000212 | 3300046471 | Bacteria | 124622 |
| 365 | Ga0495650_0000712 | 3300046471 | Bacteria | 42514 |
| 366 | Ga0495650_0033656 | 3300046471 | Bacteria | 2278 |
| 367 | Ga0495580_0024981 | 3300046472 | Bacteria | 4368 |
| 368 | Ga0495582_0005030 | 3300046473 | Bacteria | 7408 |
| 369 | Ga0495582_0214083 | 3300046473 | Bacteria | 1102 |
| 370 | Ga0495605_0000005 | 3300046474 | Bacteria | 376973 |
| 371 | Ga0495605_0026659 | 3300046474 | Bacteria | 3002 |
| 372 | Ga0495605_0027564 | 3300046474 | Bacteria | 2942 |
| 373 | Ga0495605_0047131 | 3300046474 | Bacteria | 2114 |
| 374 | Ga0495639_0228194 | 3300046475 | Bacteria | 917 |
| 375 | Ga0495584_0000381 | 3300046491 | Bacteria | 30594 |
| 376 | Ga0495584_0000755 | 3300046491 | Bacteria | 21387 |
| 377 | Ga0495584_0001114 | 3300046491 | Bacteria | 16663 |
| 378 | Ga0495584_0007663 | 3300046491 | Bacteria | 5625 |
| 379 | Ga0495584_0018616 | 3300046491 | Bacteria | 3530 |
| 380 | Ga0495584_0019150 | 3300046491 | Bacteria | 3476 |
| 381 | Ga0495584_0021044 | 3300046491 | Bacteria | 3312 |
| 382 | Ga0495584_0070048 | 3300046491 | Bacteria | 1762 |
| 383 | Ga0495584_0094776 | 3300046491 | Bacteria | 1507 |
| 384 | Ga0495584_0099702 | 3300046491 | Bacteria | 1468 |
| 385 | Ga0495584_0224600 | 3300046491 | Bacteria | 954 |
| 386 | Ga0495585_0000889 | 3300046492 | Bacteria | 25313 |
| 387 | Ga0495585_0007941 | 3300046492 | Bacteria | 6449 |
| 388 | Ga0495585_0008221 | 3300046492 | Bacteria | 6333 |
| 389 | Ga0495585_0011129 | 3300046492 | Bacteria | 5335 |
| 390 | Ga0495585_0017446 | 3300046492 | Bacteria | 4147 |
| 391 | Ga0495585_0092311 | 3300046492 | Bacteria | 1629 |
| 392 | Ga0495585_0097505 | 3300046492 | Bacteria | 1576 |
| 393 | Ga0495585_0135032 | 3300046492 | Bacteria | 1295 |
| 394 | Ga0495585_0235050 | 3300046492 | Bacteria | 919 |
| 395 | Ga0495594_0016435 | 3300046499 | Bacteria | 3898 |
| 396 | Ga0495594_0293937 | 3300046499 | Bacteria | 925 |
| 397 | Ga0495594_0365398 | 3300046499 | Bacteria | 821 |
| 398 | Ga0495596_0004154 | 3300046500 | Bacteria | 7112 |
| 399 | Ga0495596_0005456 | 3300046500 | Bacteria | 6007 |
| 400 | Ga0495596_0017944 | 3300046500 | Bacteria | 2922 |
| 401 | Ga0495596_0036442 | 3300046500 | Bacteria | 1948 |
| 402 | Ga0495596_0044212 | 3300046500 | Bacteria | 1753 |
| 403 | Ga0495596_0175637 | 3300046500 | Bacteria | 833 |
| 404 | Ga0495607_0011208 | 3300046501 | Bacteria | 5980 |
| 405 | Ga0495607_0034188 | 3300046501 | Bacteria | 3086 |
| 406 | Ga0495607_0039793 | 3300046501 | Bacteria | 2805 |
| 407 | Ga0495607_0052064 | 3300046501 | Bacteria | 2373 |
| 408 | Ga0495607_0063189 | 3300046501 | Bacteria | 2095 |
| 409 | Ga0495607_0090256 | 3300046501 | Bacteria | 1662 |
| 410 | Ga0495583_0000983 | 3300046506 | Bacteria | 32667 |
| 411 | Ga0495583_0018489 | 3300046506 | Bacteria | 3667 |
| 412 | Ga0495583_0019099 | 3300046506 | Bacteria | 3587 |
| 413 | Ga0495583_0038221 | 3300046506 | Bacteria | 2269 |
| 414 | Ga0495583_0044743 | 3300046506 | Bacteria | 2051 |
| 415 | Ga0495583_0052003 | 3300046506 | Bacteria | 1865 |
| 416 | Ga0495583_0108125 | 3300046506 | Bacteria | 1180 |
| 417 | Ga0495583_0170507 | 3300046506 | Bacteria | 894 |
| 418 | Ga0495606_0000547 | 3300046507 | Bacteria | 60321 |
| 419 | Ga0495606_0002788 | 3300046507 | Bacteria | 19515 |
| 420 | Ga0495606_0003771 | 3300046507 | Bacteria | 15756 |
| 421 | Ga0495606_0036377 | 3300046507 | Bacteria | 3353 |
| 422 | Ga0495606_0050389 | 3300046507 | Bacteria | 2724 |
| 423 | Ga0495606_0072842 | 3300046507 | Bacteria | 2157 |
| 424 | Ga0495606_0115547 | 3300046507 | Bacteria | 1613 |
| 425 | Ga0495606_0119684 | 3300046507 | Bacteria | 1577 |
| 426 | Ga0495606_0259831 | 3300046507 | Bacteria | 959 |
| 427 | Ga0495606_0346055 | 3300046507 | Bacteria | 790 |
| 428 | Ga0495608_0011730 | 3300046511 | Bacteria | 6093 |
| 429 | Ga0495610_0000021 | 3300046512 | Bacteria | 336300 |
| 430 | Ga0495610_0006777 | 3300046512 | Bacteria | 7771 |
| 431 | Ga0495616_0000093 | 3300046513 | Bacteria | 75781 |
| 432 | Ga0495616_0024971 | 3300046513 | Bacteria | 3197 |
| 433 | Ga0495616_0026678 | 3300046513 | Bacteria | 3071 |
| 434 | Ga0495616_0040738 | 3300046513 | Bacteria | 2371 |
| 435 | Ga0495616_0084167 | 3300046513 | Bacteria | 1516 |
| 436 | Ga0495616_0105541 | 3300046513 | Bacteria | 1315 |
| 437 | Ga0495616_0106310 | 3300046513 | Bacteria | 1309 |
| 438 | Ga0495618_0043922 | 3300046514 | Bacteria | 2819 |
| 439 | Ga0495620_0020297 | 3300046515 | Bacteria | 3247 |
| 440 | Ga0495628_0006086 | 3300046516 | Bacteria | 10550 |
| 441 | Ga0495628_0013454 | 3300046516 | Bacteria | 6883 |
| 442 | Ga0495630_0005271 | 3300046517 | Bacteria | 9123 |
| 443 | Ga0495630_0021183 | 3300046517 | Bacteria | 4800 |
| 444 | Ga0495631_0014034 | 3300046518 | Bacteria | 3872 |
| 445 | Ga0495631_0019628 | 3300046518 | Bacteria | 3168 |
| 446 | Ga0495631_0020566 | 3300046518 | Bacteria | 3082 |
| 447 | Ga0495631_0022012 | 3300046518 | Bacteria | 2965 |
| 448 | Ga0495631_0182652 | 3300046518 | Bacteria | 898 |
| 449 | Ga0495631_0187925 | 3300046518 | Bacteria | 884 |
| 450 | Ga0495631_0221516 | 3300046518 | Bacteria | 807 |
| 451 | Ga0495632_0001724 | 3300046519 | Bacteria | 17773 |
| 452 | Ga0495632_0008471 | 3300046519 | Bacteria | 6306 |
| 453 | Ga0495632_0059363 | 3300046519 | Bacteria | 1861 |
| 454 | Ga0495637_0000305 | 3300046520 | Bacteria | 38029 |
| 455 | Ga0495637_0051276 | 3300046520 | Bacteria | 1728 |
| 456 | Ga0495643_0000096 | 3300046522 | Bacteria | 146041 |
| 457 | Ga0495643_0000181 | 3300046522 | Bacteria | 100368 |
| 458 | Ga0495643_0000983 | 3300046522 | Bacteria | 29263 |
| 459 | Ga0495643_0001269 | 3300046522 | Bacteria | 24190 |
| 460 | Ga0495643_0036792 | 3300046522 | Bacteria | 2687 |
| 461 | Ga0495643_0077756 | 3300046522 | Bacteria | 1733 |
| 462 | Ga0495643_0106851 | 3300046522 | Bacteria | 1427 |
| 463 | Ga0495643_0230749 | 3300046522 | Bacteria | 873 |
| 464 | Ga0495643_0253848 | 3300046522 | Bacteria | 819 |
| 465 | Ga0495644_0014817 | 3300046523 | Bacteria | 2985 |
| 466 | Ga0495644_0029509 | 3300046523 | Bacteria | 2072 |
| 467 | Ga0495644_0030512 | 3300046523 | Bacteria | 2035 |
| 468 | Ga0495648_0019268 | 3300046524 | Bacteria | 4804 |
| 469 | Ga0495648_0037553 | 3300046524 | Bacteria | 3110 |
| 470 | Ga0495648_0071327 | 3300046524 | Bacteria | 2014 |
| 471 | Ga0495648_0090475 | 3300046524 | Bacteria | 1715 |
| 472 | Ga0495648_0301215 | 3300046524 | Bacteria | 751 |
| 473 | Ga0495663_0104318 | 3300046525 | Bacteria | 936 |
| 474 | Ga0495666_0000293 | 3300046526 | Bacteria | 21877 |
| 475 | Ga0495666_0007083 | 3300046526 | Bacteria | 5634 |
| 476 | Ga0495642_0022230 | 3300046528 | Bacteria | 2498 |
| 477 | Ga0495642_0036277 | 3300046528 | Bacteria | 1992 |
| 478 | Ga0495642_0052284 | 3300046528 | Bacteria | 1682 |
| 479 | Ga0495642_0088467 | 3300046528 | Bacteria | 1309 |
| 480 | Ga0495642_0097643 | 3300046528 | Bacteria | 1248 |
| 481 | Ga0495642_0206597 | 3300046528 | Bacteria | 856 |
| 482 | Ga0495652_0014252 | 3300046529 | Bacteria | 7138 |
| 483 | Ga0495652_0032215 | 3300046529 | Bacteria | 4585 |
| 484 | Ga0495652_0041820 | 3300046529 | Bacteria | 3954 |
| 485 | Ga0495652_0060251 | 3300046529 | Bacteria | 3208 |
| 486 | Ga0495652_0089342 | 3300046529 | Bacteria | 2522 |
| 487 | Ga0495652_0127906 | 3300046529 | Bacteria | 2015 |
| 488 | Ga0495654_0000005 | 3300046530 | Bacteria | 491381 |
| 489 | Ga0495654_0011080 | 3300046530 | Bacteria | 4895 |
| 490 | Ga0495654_0021618 | 3300046530 | Bacteria | 3346 |
| 491 | Ga0495654_0028810 | 3300046530 | Bacteria | 2836 |
| 492 | Ga0495654_0142868 | 3300046530 | Bacteria | 1065 |
| 493 | Ga0495654_0166524 | 3300046530 | Bacteria | 964 |
| 494 | Ga0495665_0020394 | 3300046531 | Bacteria | 3560 |
| 495 | Ga0495665_0027126 | 3300046531 | Bacteria | 3075 |
| 496 | Ga0495665_0137168 | 3300046531 | Bacteria | 1279 |
| 497 | Ga0495665_0272221 | 3300046531 | Bacteria | 869 |
| 498 | Ga0495665_0381375 | 3300046531 | Bacteria | 716 |
| 499 | Ga0495640_0004944 | 3300046533 | Bacteria | 10598 |
| 500 | Ga0495586_0016302 | 3300046535 | Bacteria | 3951 |
| 501 | Ga0495586_0021007 | 3300046535 | Bacteria | 3479 |
| 502 | Ga0495586_0022390 | 3300046535 | Bacteria | 3372 |
| 503 | Ga0495586_0042318 | 3300046535 | Bacteria | 2453 |
| 504 | Ga0495586_0127766 | 3300046535 | Bacteria | 1422 |
| 505 | Ga0495586_0172270 | 3300046535 | Bacteria | 1223 |
| 506 | Ga0495586_0318063 | 3300046535 | Bacteria | 892 |
| 507 | Ga0495587_0015121 | 3300046536 | Bacteria | 4823 |
| 508 | Ga0495587_0033763 | 3300046536 | Bacteria | 3086 |
| 509 | Ga0495587_0174471 | 3300046536 | Bacteria | 1220 |
| 510 | Ga0495609_0008303 | 3300046538 | Bacteria | 5092 |
| 511 | Ga0495609_0017904 | 3300046538 | Bacteria | 3287 |
| 512 | Ga0495609_0044718 | 3300046538 | Bacteria | 1985 |
| 513 | Ga0495609_0048276 | 3300046538 | Bacteria | 1903 |
| 514 | Ga0495609_0051016 | 3300046538 | Bacteria | 1843 |
| 515 | Ga0495609_0058074 | 3300046538 | Bacteria | 1711 |
| 516 | Ga0495609_0129126 | 3300046538 | Bacteria | 1083 |
| 517 | Ga0495609_0146116 | 3300046538 | Bacteria | 1007 |
| 518 | Ga0495597_0000310 | 3300046542 | Bacteria | 43852 |
| 519 | Ga0495597_0002547 | 3300046542 | Bacteria | 11430 |
| 520 | Ga0495597_0003418 | 3300046542 | Bacteria | 9274 |
| 521 | Ga0495597_0004282 | 3300046542 | Bacteria | 7887 |
| 522 | Ga0495597_0012024 | 3300046542 | Bacteria | 4183 |
| 523 | Ga0495597_0050362 | 3300046542 | Bacteria | 1839 |
| 524 | Ga0495597_0148467 | 3300046542 | Bacteria | 963 |
| 525 | Ga0495645_0026559 | 3300046543 | Bacteria | 4204 |
| 526 | Ga0495645_0231595 | 3300046543 | Bacteria | 1237 |
| 527 | Ga0495622_0053142 | 3300046557 | Bacteria | 1879 |
| 528 | Ga0495622_0054503 | 3300046557 | Bacteria | 1855 |
| 529 | Ga0495622_0067145 | 3300046557 | Bacteria | 1657 |
| 530 | Ga0495622_0187524 | 3300046557 | Bacteria | 925 |
| 531 | Ga0495633_0000357 | 3300046558 | Bacteria | 49514 |
| 532 | Ga0495633_0002184 | 3300046558 | Bacteria | 14032 |
| 533 | Ga0495633_0009027 | 3300046558 | Bacteria | 5546 |
| 534 | Ga0495633_0022770 | 3300046558 | Bacteria | 3111 |
| 535 | Ga0495633_0034395 | 3300046558 | Bacteria | 2437 |
| 536 | Ga0495633_0040898 | 3300046558 | Bacteria | 2206 |
| 537 | Ga0495633_0071185 | 3300046558 | Bacteria | 1622 |
| 538 | Ga0495633_0123596 | 3300046558 | Bacteria | 1198 |
| 539 | Ga0495633_0215978 | 3300046558 | Bacteria | 878 |
| 540 | Ga0495667_0108419 | 3300046559 | Bacteria | 1794 |
| 541 | Ga0495656_0001209 | 3300046615 | Bacteria | 8415 |
| 542 | Ga0495656_0069076 | 3300046615 | Bacteria | 1564 |
| 543 | Ga0495656_0075758 | 3300046615 | Bacteria | 1506 |
| 544 | Ga0495656_0216050 | 3300046615 | Bacteria | 957 |
| 545 | Ga0495656_0497204 | 3300046615 | Bacteria | 646 |
| 546 | Ga0495668_0000008 | 3300046616 | Bacteria | 498364 |
| 547 | Ga0495668_0001106 | 3300046616 | Bacteria | 27873 |
| 548 | Ga0495668_0021698 | 3300046616 | Bacteria | 3678 |
| 549 | Ga0495668_0034818 | 3300046616 | Bacteria | 2823 |
| 550 | Ga0495668_0047044 | 3300046616 | Bacteria | 2395 |
| 551 | Ga0495668_0048141 | 3300046616 | Bacteria | 2365 |
| 552 | Ga0495668_0145246 | 3300046616 | Bacteria | 1298 |
| 553 | Ga0495668_0344287 | 3300046616 | Bacteria | 818 |
| 554 | Ga0495668_0397196 | 3300046616 | Bacteria | 757 |
| 555 | Ga0495634_0000991 | 3300046642 | Bacteria | 26768 |
| 556 | Ga0495634_0117670 | 3300046642 | Bacteria | 1704 |
| 557 | Ga0495634_0337122 | 3300046642 | Bacteria | 905 |
| 558 | Ga0495611_0093809 | 3300046648 | Bacteria | 1388 |
| 559 | Ga0495611_0093887 | 3300046648 | Bacteria | 1388 |
| 560 | Ga0495611_0096401 | 3300046648 | Bacteria | 1369 |
| 561 | Ga0495611_0165269 | 3300046648 | Bacteria | 1034 |
| 562 | Ga0495625_0001934 | 3300046660 | Bacteria | 23417 |
| 563 | Ga0495625_0002185 | 3300046660 | Bacteria | 21708 |
| 564 | Ga0495625_0004513 | 3300046660 | Bacteria | 13131 |
| 565 | Ga0495625_0022179 | 3300046660 | Bacteria | 4872 |
| 566 | Ga0495625_0065254 | 3300046660 | Bacteria | 2567 |
| 567 | Ga0495625_0087883 | 3300046660 | Bacteria | 2154 |
| 568 | Ga0495625_0149084 | 3300046660 | Bacteria | 1573 |
| 569 | Ga0495625_0186517 | 3300046660 | Bacteria | 1376 |
| 570 | Ga0495625_0353390 | 3300046660 | Bacteria | 928 |
| 571 | Ga0495625_0403729 | 3300046660 | Bacteria | 853 |
| 572 | Ga0495625_0463312 | 3300046660 | Bacteria | 781 |
| 573 | Ga0495635_0001964 | 3300046663 | Bacteria | 13979 |
| 574 | Ga0495659_0002967 | 3300046664 | Bacteria | 5444 |
| 575 | Ga0495659_0037958 | 3300046664 | Bacteria | 1709 |
| 576 | Ga0495661_0012263 | 3300046665 | Bacteria | 5789 |
| 577 | Ga0495661_0012374 | 3300046665 | Bacteria | 5759 |
| 578 | Ga0495661_0032622 | 3300046665 | Bacteria | 3291 |
| 579 | Ga0495661_0037214 | 3300046665 | Bacteria | 3040 |
| 580 | Ga0495661_0044067 | 3300046665 | Bacteria | 2737 |
| 581 | Ga0495661_0071706 | 3300046665 | Bacteria | 2023 |
| 582 | Ga0495661_0096991 | 3300046665 | Bacteria | 1666 |
| 583 | Ga0495661_0120669 | 3300046665 | Bacteria | 1448 |
| 584 | Ga0495661_0194571 | 3300046665 | Bacteria | 1065 |
| 585 | Ga0495661_0210518 | 3300046665 | Bacteria | 1012 |
| 586 | Ga0495661_0273676 | 3300046665 | Bacteria | 853 |
| 587 | Ga0495588_0000113 | 3300046674 | Bacteria | 137279 |
| 588 | Ga0495588_0010764 | 3300046674 | Bacteria | 4269 |
| 589 | Ga0495588_0297746 | 3300046674 | Bacteria | 849 |
| 590 | Ga0495588_0323176 | 3300046674 | Bacteria | 811 |
| 591 | Ga0495588_0471139 | 3300046674 | Bacteria | 658 |
| 592 | Ga0495657_0064926 | 3300046675 | Bacteria | 2402 |
| 593 | Ga0495599_0027691 | 3300046678 | Bacteria | 3551 |
| 594 | Ga0495623_0016264 | 3300046679 | Bacteria | 4805 |
| 595 | Ga0495623_0170724 | 3300046679 | Bacteria | 1270 |
| 596 | Ga0495623_0233308 | 3300046679 | Bacteria | 1042 |
| 597 | Ga0495623_0273114 | 3300046679 | Bacteria | 943 |
| 598 | Ga0495646_0020393 | 3300046680 | Bacteria | 4194 |
| 599 | Ga0495646_0041520 | 3300046680 | Bacteria | 2826 |
| 600 | Ga0495646_0175128 | 3300046680 | Bacteria | 1180 |
| 601 | Ga0495669_0000075 | 3300046684 | Bacteria | 65812 |
| 602 | Ga0495669_0006448 | 3300046684 | Bacteria | 4899 |
| 603 | Ga0495669_0258688 | 3300046684 | Bacteria | 836 |
| 604 | Ga0495613_0021937 | 3300046689 | Bacteria | 4760 |
| 605 | Ga0495613_0147015 | 3300046689 | Bacteria | 1682 |
| 606 | Ga0495613_0167143 | 3300046689 | Bacteria | 1562 |
| 607 | Ga0495624_0177809 | 3300046690 | Bacteria | 1297 |
| 608 | Ga0495670_0003298 | 3300046691 | Bacteria | 7954 |
| 609 | Ga0495670_0022250 | 3300046691 | Bacteria | 3130 |
| 610 | Ga0495670_0053351 | 3300046691 | Bacteria | 2025 |
| 611 | Ga0495670_0056475 | 3300046691 | Bacteria | 1969 |
| 612 | Ga0495670_0065209 | 3300046691 | Bacteria | 1835 |
| 613 | Ga0495670_0087202 | 3300046691 | Bacteria | 1594 |
| 614 | Ga0495670_0160614 | 3300046691 | Bacteria | 1180 |
| 615 | Ga0495671_0007599 | 3300046692 | Bacteria | 6162 |
| 616 | Ga0495671_0014178 | 3300046692 | Bacteria | 4295 |
| 617 | Ga0495671_0048958 | 3300046692 | Bacteria | 2107 |
| 618 | Ga0495671_0077195 | 3300046692 | Bacteria | 1633 |
| 619 | Ga0495649_0007384 | 3300046694 | Bacteria | 6710 |
| 620 | Ga0495649_0059791 | 3300046694 | Bacteria | 2051 |
| 621 | Ga0495649_0073599 | 3300046694 | Bacteria | 1830 |
| 622 | Ga0495649_0078012 | 3300046694 | Bacteria | 1773 |
| 623 | Ga0495649_0090343 | 3300046694 | Bacteria | 1633 |
| 624 | Ga0495649_0113557 | 3300046694 | Bacteria | 1435 |
| 625 | Ga0495649_0378468 | 3300046694 | Bacteria | 712 |
| 626 | Ga0495589_0001253 | 3300046794 | Bacteria | 15034 |
| 627 | Ga0495589_0027732 | 3300046794 | Bacteria | 2862 |
| 628 | Ga0495589_0072985 | 3300046794 | Bacteria | 1675 |
| 629 | Ga0495589_0080904 | 3300046794 | Bacteria | 1580 |
| 630 | Ga0495600_0011825 | 3300046809 | Bacteria | 5450 |
| 631 | Ga0495600_0070875 | 3300046809 | Bacteria | 2278 |
| 632 | Ga0495600_0194477 | 3300046809 | Bacteria | 1303 |
| 633 | Ga0495600_0199116 | 3300046809 | Bacteria | 1287 |
| 634 | Ga0495600_0524328 | 3300046809 | Bacteria | 726 |
| 635 | Ga0495660_0003778 | 3300046810 | Bacteria | 9283 |
| 636 | Ga0495660_0053711 | 3300046810 | Bacteria | 2186 |
| 637 | Ga0495660_0065622 | 3300046810 | Bacteria | 1937 |
| 638 | Ga0495660_0184307 | 3300046810 | Bacteria | 1007 |
| 639 | Ga0495581_0007750 | 3300047315 | Bacteria | 6214 |
| 640 | Ga0495581_0040566 | 3300047315 | Bacteria | 2693 |
| 641 | Ga0495581_0065186 | 3300047315 | Bacteria | 2105 |
| 642 | Ga0495581_0099725 | 3300047315 | Bacteria | 1687 |
| 643 | Ga0495604_0008392 | 3300047317 | Bacteria | 8170 |
| 644 | Ga0495604_0009665 | 3300047317 | Bacteria | 7624 |
| 645 | Ga0495604_0025743 | 3300047317 | Bacteria | 4686 |
| 646 | Ga0495604_0169591 | 3300047317 | Bacteria | 1536 |
| 647 | Ga0495636_0004688 | 3300047318 | Bacteria | 5362 |
| 648 | Ga0495636_0207537 | 3300047318 | Bacteria | 896 |
| 649 | Ga0495636_0295009 | 3300047318 | Bacteria | 757 |
| 650 | Ga0495674_0001330 | 3300047319 | Bacteria | 24082 |
| 651 | Ga0495672_0000014 | 3300047320 | Bacteria | 505636 |
| 652 | Ga0495672_0000285 | 3300047320 | Bacteria | 70145 |
| 653 | Ga0495672_0025841 | 3300047320 | Bacteria | 3754 |
| 654 | Ga0495672_0102790 | 3300047320 | Bacteria | 1547 |
| 655 | Ga0495672_0131295 | 3300047320 | Bacteria | 1317 |
| 656 | Ga0495676_0032442 | 3300047321 | Bacteria | 4408 |
| 657 | Ga0495676_0433009 | 3300047321 | Bacteria | 869 |
| 658 | Ga0495680_0005963 | 3300047322 | Bacteria | 11395 |
| 659 | Ga0495680_0090337 | 3300047322 | Bacteria | 2298 |
| 660 | Ga0495683_0000112 | 3300047323 | Bacteria | 82903 |
| 661 | Ga0495683_0038289 | 3300047323 | Bacteria | 2428 |
| 662 | Ga0495683_0055612 | 3300047323 | Bacteria | 1969 |
| 663 | Ga0495683_0182017 | 3300047323 | Bacteria | 959 |
| 664 | Ga0495683_0214538 | 3300047323 | Bacteria | 861 |
| 665 | Ga0495687_000060 | 3300047443 | Bacteria | 179124 |
| 666 | Ga0495687_010203 | 3300047443 | Bacteria | 5167 |
| 667 | Ga0495675_0000641 | 3300047444 | Bacteria | 22216 |
| 668 | Ga0495675_0102882 | 3300047444 | Bacteria | 1786 |
| 669 | Ga0495675_0114778 | 3300047444 | Bacteria | 1679 |
| 670 | Ga0495677_0003569 | 3300047445 | Bacteria | 6034 |
| 671 | Ga0495677_0004197 | 3300047445 | Bacteria | 5558 |
| 672 | Ga0495677_0008437 | 3300047445 | Bacteria | 3825 |
| 673 | Ga0495677_0013167 | 3300047445 | Bacteria | 3009 |
| 674 | Ga0495677_0033535 | 3300047445 | Bacteria | 1871 |
| 675 | Ga0495677_0036290 | 3300047445 | Bacteria | 1800 |
| 676 | Ga0495677_0091042 | 3300047445 | Bacteria | 1149 |
| 677 | Ga0495679_017776 | 3300047446 | Bacteria | 2539 |
| 678 | Ga0495685_009277 | 3300047447 | Bacteria | 3281 |
| 679 | Ga0495685_016278 | 3300047447 | Bacteria | 2539 |
| 680 | Ga0495685_105721 | 3300047447 | Bacteria | 928 |
| 681 | Ga0495673_0000033 | 3300047469 | Bacteria | 354152 |
| 682 | Ga0495673_0000034 | 3300047469 | Bacteria | 326920 |
| 683 | Ga0495681_0005423 | 3300047470 | Bacteria | 8541 |
| 684 | Ga0495681_0014139 | 3300047470 | Bacteria | 4593 |
| 685 | Ga0495681_0016409 | 3300047470 | Bacteria | 4153 |
| 686 | Ga0495681_0023598 | 3300047470 | Bacteria | 3264 |
| 687 | Ga0495681_0030386 | 3300047470 | Bacteria | 2751 |
| 688 | Ga0495681_0035504 | 3300047470 | Bacteria | 2474 |
| 689 | Ga0495681_0037873 | 3300047470 | Bacteria | 2370 |
| 690 | Ga0495681_0039116 | 3300047470 | Bacteria | 2318 |
| 691 | Ga0495681_0093372 | 3300047470 | Bacteria | 1325 |
| 692 | Ga0495681_0127366 | 3300047470 | Bacteria | 1087 |
| 693 | Ga0495681_0302280 | 3300047470 | Bacteria | 619 |
| 694 | Ga0495686_0001306 | 3300047472 | Bacteria | 28040 |
| 695 | Ga0495686_0001600 | 3300047472 | Bacteria | 23919 |
| 696 | Ga0495686_0034550 | 3300047472 | Bacteria | 3255 |
| 697 | Ga0495686_0040470 | 3300047472 | Bacteria | 2971 |
| 698 | Ga0495686_0041735 | 3300047472 | Bacteria | 2920 |
| 699 | Ga0495593_0007821 | 3300047673 | Bacteria | 6230 |
| 700 | Ga0495593_0021382 | 3300047673 | Bacteria | 3615 |
| 701 | Ga0495593_0060082 | 3300047673 | Bacteria | 1990 |
| 702 | Ga0495593_0071856 | 3300047673 | Bacteria | 1797 |
| 703 | Ga0495602_0002022 | 3300048088 | Bacteria | 20408 |
| 704 | Ga0495602_0151365 | 3300048088 | Bacteria | 1823 |
| 705 | Ga0495602_0166569 | 3300048088 | Bacteria | 1714 |
| 706 | Ga0495602_0345020 | 3300048088 | Bacteria | 1076 |
| 707 | Ga0495614_0006176 | 3300048089 | Bacteria | 5382 |
| 708 | Ga0495614_0024164 | 3300048089 | Bacteria | 2624 |
| 709 | Ga0495614_0099458 | 3300048089 | Bacteria | 1270 |
| 710 | Ga0495614_0186182 | 3300048089 | Bacteria | 935 |
| 711 | Ga0495626_0000044 | 3300048091 | Bacteria | 165533 |
| 712 | Ga0495626_0000974 | 3300048091 | Bacteria | 24662 |
| 713 | Ga0495626_0001091 | 3300048091 | Bacteria | 22989 |
| 714 | Ga0495626_0007753 | 3300048091 | Bacteria | 5948 |
| 715 | Ga0495626_0010381 | 3300048091 | Bacteria | 4971 |
| 716 | Ga0495626_0023256 | 3300048091 | Bacteria | 3054 |
| 717 | Ga0495626_0028057 | 3300048091 | Bacteria | 2732 |
| 718 | Ga0495626_0058687 | 3300048091 | Bacteria | 1757 |
| 719 | Ga0495626_0090112 | 3300048091 | Bacteria | 1349 |
| 720 | Ga0495626_0092477 | 3300048091 | Bacteria | 1328 |
| 721 | Ga0496100_0014602 | 3300048903 | Bacteria | 4564 |
| 722 | Ga0496100_0773637 | 3300048903 | Bacteria | 751 |
| 723 | Ga0496101_0133907 | 3300048904 | Bacteria | 1884 |
| 724 | Ga0496102_0000279 | 3300048905 | Bacteria | 65185 |
| 725 | Ga0496102_0000977 | 3300048905 | Bacteria | 26896 |
| 726 | Ga0496102_0065912 | 3300048905 | Bacteria | 3319 |
| 727 | Ga0496102_0599882 | 3300048905 | Bacteria | 1024 |
| 728 | Ga0496102_0778555 | 3300048905 | Bacteria | 879 |
| 729 | Ga0496103_0001678 | 3300048906 | Bacteria | 14484 |
| 730 | Ga0496103_0007002 | 3300048906 | Bacteria | 6727 |
| 731 | Ga0496103_0174887 | 3300048906 | Bacteria | 1379 |
| 732 | Ga0496107_0110383 | 3300048910 | Bacteria | 2021 |
| 733 | Ga0496107_0163164 | 3300048910 | Bacteria | 1652 |
| 734 | Ga0496107_0341651 | 3300048910 | Bacteria | 1114 |
| 735 | Ga0496109_0136903 | 3300048912 | Bacteria | 2289 |
| 736 | Ga0496110_0007252 | 3300048913 | Bacteria | 8836 |
| 737 | Ga0496111_0249845 | 3300048914 | Bacteria | 1317 |
| 738 | Ga0496111_0264928 | 3300048914 | Bacteria | 1275 |
| 739 | Ga0496112_0625724 | 3300048915 | Bacteria | 1007 |
| 740 | Ga0496113_0026839 | 3300048916 | Bacteria | 4122 |
| 741 | Ga0496114_0137840 | 3300048917 | Bacteria | 2110 |
| 742 | Ga0496114_0427586 | 3300048917 | Bacteria | 1173 |
| 743 | Ga0496115_0268235 | 3300048918 | Bacteria | 1403 |
| 744 | Ga0496116_0010763 | 3300048919 | Bacteria | 7634 |
| 745 | Ga0496116_0016976 | 3300048919 | Bacteria | 5674 |
| 746 | Ga0496116_0071545 | 3300048919 | Bacteria | 2195 |
| 747 | Ga0496117_0000010 | 3300048920 | Bacteria | 611954 |
| 748 | Ga0496118_0000009 | 3300048921 | Bacteria | 611954 |
| 749 | Ga0496118_0089671 | 3300048921 | Bacteria | 2122 |
| 750 | Ga0496121_0016466 | 3300048924 | Bacteria | 7632 |
| 751 | Ga0496121_0018662 | 3300048924 | Bacteria | 6981 |
| 752 | Ga0496121_0022185 | 3300048924 | Bacteria | 6176 |
| 753 | Ga0496121_0118573 | 3300048924 | Bacteria | 2003 |
| 754 | Ga0496121_0544422 | 3300048924 | Bacteria | 727 |
| 755 | Ga0496122_0000513 | 3300048925 | Bacteria | 80013 |
| 756 | Ga0496122_0018308 | 3300048925 | Bacteria | 6482 |
| 757 | Ga0496122_0025832 | 3300048925 | Bacteria | 5085 |
| 758 | Ga0496123_0000145 | 3300048926 | Bacteria | 144475 |
| 759 | Ga0496123_0004642 | 3300048926 | Bacteria | 14267 |
| 760 | Ga0496123_0052096 | 3300048926 | Bacteria | 2719 |
| 761 | Ga0496124_0118031 | 3300048927 | Bacteria | 2124 |
| 762 | Ga0496124_0133675 | 3300048927 | Bacteria | 1967 |
| 763 | Ga0496124_0148865 | 3300048927 | Bacteria | 1839 |
| 764 | Ga0496124_0190102 | 3300048927 | Bacteria | 1572 |
| 765 | Ga0496124_0261593 | 3300048927 | Unclassified | 1273 |
| 766 | Ga0496125_0001481 | 3300048928 | Bacteria | 33868 |
| 767 | Ga0496125_0032436 | 3300048928 | Bacteria | 4640 |
| 768 | Ga0496125_0035873 | 3300048928 | Bacteria | 4340 |
| 769 | Ga0496125_0167339 | 3300048928 | Unclassified | 1483 |
| 770 | Ga0496125_0172039 | 3300048928 | Bacteria | 1454 |
| 771 | Ga0496125_0274243 | 3300048928 | Bacteria | 1049 |
| 772 | Ga0496126_0086756 | 3300048929 | Bacteria | 2758 |
| 773 | Ga0496126_0277185 | 3300048929 | Bacteria | 1390 |
| 774 | Ga0501309_002863 | 3300049129 | Bacteria | 1909 |
| 775 | Ga0495678_000076 | 3300049459 | Bacteria | 125077 |
| 776 | Ga0495678_000175 | 3300049459 | Bacteria | 73523 |
| 777 | Ga0495678_000780 | 3300049459 | Bacteria | 28573 |
| 778 | Ga0495682_0001244 | 3300049460 | Bacteria | 14408 |
| 779 | Ga0495682_0011867 | 3300049460 | Bacteria | 3349 |
| 780 | Ga0495682_0063027 | 3300049460 | Bacteria | 1337 |
| 781 | Ga0501292_027335 | 3300049515 | Bacteria | 945 |
| 782 | Ga0501034_0144066 | 3300049571 | Bacteria | 2361 |
| 783 | Ga0501210_017290 | 3300049657 | Bacteria | 650 |
| 784 | Ga0501229_048866 | 3300049706 | Bacteria | 620 |
| 785 | Ga0501269_000437 | 3300049766 | Bacteria | 9300 |
| 786 | Ga0501035_0000816 | 3300049822 | Bacteria | 33256 |
| 787 | Ga0495601_0006228 | 3300053077 | Bacteria | 6965 |
| 788 | Ga0495601_0316794 | 3300053077 | Bacteria | 1016 |
| 789 | Ga0500650_0000107 | 3300053098 | Bacteria | 22912 |
| 790 | Ga0500594_0011747 | 3300053118 | Bacteria | 2049 |
| 791 | Ga0500594_0048637 | 3300053118 | Bacteria | 1186 |
| 792 | Ga0500595_001191 | 3300053119 | Bacteria | 14359 |
| 793 | Ga0500618_000954 | 3300053125 | Bacteria | 14768 |
| 794 | Ga0500618_001000 | 3300053125 | Bacteria | 14271 |
| 795 | Ga0500618_001616 | 3300053125 | Bacteria | 9759 |
| 796 | Ga0500574_001023 | 3300053141 | Bacteria | 3935 |
| 797 | Ga0500634_0164240 | 3300053161 | Bacteria | 1021 |
| 798 | Ga0587084_004887 | 3300059477 | Bacteria | 1559 |
| 799 | Ga0587084_010006 | 3300059477 | Bacteria | 1236 |
| 800 | Ga0587093_004214 | 3300059478 | Bacteria | 1454 |
| 801 | Ga0587070_004835 | 3300059491 | Bacteria | 1730 |
| 802 | Ga0587080_003903 | 3300059503 | Bacteria | 1895 |
| 803 | Ga0587083_0001972 | 3300059505 | Bacteria | 2453 |
| 804 | Ga0587088_001642 | 3300059508 | Bacteria | 2372 |
| 805 | Ga0587089_007506 | 3300059509 | Bacteria | 1295 |
| 806 | Ga0587090_031712 | 3300059510 | Bacteria | 887 |
| 807 | Ga0587094_004612 | 3300059513 | Bacteria | 1574 |
| 808 | Ga0587106_007225 | 3300059605 | Bacteria | 1342 |
| 809 | Ga0587106_009761 | 3300059605 | Bacteria | 1228 |
| 810 | Ga0587062_031699 | 3300059639 | Bacteria | 813 |
| 811 | Ga0587069_003497 | 3300059642 | Bacteria | 1700 |
| 812 | Ga0587069_007957 | 3300059642 | Bacteria | 1326 |
| 813 | Ga0587069_014580 | 3300059642 | Bacteria | 1098 |
| 814 | Ga0587075_002311 | 3300059644 | Bacteria | 2000 |
| 815 | Ga0587075_042694 | 3300059644 | Bacteria | 766 |
| 816 | Ga0587076_007597 | 3300059645 | Bacteria | 1486 |
| 817 | Ga0587078_008471 | 3300059646 | Bacteria | 1153 |
| 818 | Ga0587079_015290 | 3300059647 | Bacteria | 1301 |
| 819 | Ga0587079_016520 | 3300059647 | Bacteria | 1268 |
| 820 | Ga0587079_023657 | 3300059647 | Bacteria | 1126 |
| 821 | Ga0587102_001965 | 3300059649 | Bacteria | 1531 |
| 822 | Ga0587096_00172 | 3300060247 | Bacteria | 1445 |
| 823 | Ga0587071_009863 | 3300060344 | Bacteria | 1582 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300015262 | Ga0182007_10028545 | Ga0182007_100285452 | 142 |
| 2 | 3300042145 | Ga0450906_092126 | Ga0450906_092126_19_456 | 145 |
| 3 | 3300009036 | Ga0105244_10082230 | Ga0105244_100822302 | 147 |
| 4 | 3300025728 | Ga0207655_1102042 | Ga0207655_11020422 | 147 |
| 5 | 3300013307 | Ga0157372_10418475 | Ga0157372_104184752 | 150 |
| 6 | 3300025909 | Ga0207705_10573990 | Ga0207705_105739902 | 150 |
| 7 | 3300046491 | Ga0495584_0000755 | Ga0495584_0000755_3702_4256 | 150 |
| 8 | 3300046507 | Ga0495606_0346055 | Ga0495606_0346055_133_687 | 150 |
| 9 | 3300046513 | Ga0495616_0026678 | Ga0495616_0026678_2504_3058 | 150 |
| 10 | 3300048905 | Ga0496102_0778555 | Ga0496102_0778555_66_620 | 150 |
| 11 | 3300005578 | Ga0068854_100007911 | Ga0068854_1000079112 | 151 |
| 12 | 3300005614 | Ga0068856_100577120 | Ga0068856_1005771202 | 151 |
| 13 | 3300009093 | Ga0105240_10076139 | Ga0105240_100761394 | 151 |
| 14 | 3300009545 | Ga0105237_10006971 | Ga0105237_100069715 | 151 |
| 15 | 3300009551 | Ga0105238_10000505 | Ga0105238_1000050544 | 151 |
| 16 | 3300010375 | Ga0105239_10003532 | Ga0105239_1000353215 | 151 |
| 17 | 3300015261 | Ga0182006_1011302 | Ga0182006_10113024 | 151 |
| 18 | 3300025913 | Ga0207695_10006732 | Ga0207695_100067328 | 151 |
| 19 | 3300025914 | Ga0207671_10007433 | Ga0207671_100074334 | 151 |
| 20 | 3300025924 | Ga0207694_10000392 | Ga0207694_1000039244 | 151 |
| 21 | 3300025981 | Ga0207640_10002070 | Ga0207640_100020705 | 151 |
| 22 | 3300026116 | Ga0207674_10502681 | Ga0207674_105026812 | 151 |
| 23 | 3300047318 | Ga0495636_0295009 | Ga0495636_0295009_186_737 | 151 |
| 24 | 3300005339 | Ga0070660_100878083 | Ga0070660_1008780831 | 154 |
| 25 | 3300005344 | Ga0070661_100471047 | Ga0070661_1004710472 | 154 |
| 26 | 3300005564 | Ga0070664_100107270 | Ga0070664_1001072702 | 154 |
| 27 | 3300013102 | Ga0157371_10376395 | Ga0157371_103763951 | 154 |
| 28 | 3300037418 | Ga0395900_0372424 | Ga0395900_0372424_597_1151 | 154 |
| 29 | 3300042005 | Ga0439448_0034436 | Ga0439448_0034436_802_1356 | 154 |
| 30 | 3300042008 | Ga0439450_003658 | Ga0439450_003658_1170_1724 | 154 |
| 31 | 3300042012 | Ga0439455_0002204 | Ga0439455_0002204_916_1470 | 154 |
| 32 | 3300044658 | Ga0466972_0031399 | Ga0466972_0031399_856_1425 | 154 |
| 33 | 3300044683 | Ga0466965_0001710 | Ga0466965_0001710_5438_6007 | 154 |
| 34 | 3300044706 | Ga0466964_0023327 | Ga0466964_0023327_646_1215 | 154 |
| 35 | 3300044735 | Ga0466968_0005176 | Ga0466968_0005176_1271_1840 | 154 |
| 36 | 3300005289 | Ga0065704_10286848 | Ga0065704_102868482 | 155 |
| 37 | 3300047469 | Ga0495673_0000033 | Ga0495673_0000033_71757_72311 | 155 |
| 38 | 3300048929 | Ga0496126_0086756 | Ga0496126_0086756_1551_2105 | 155 |
| 39 | 3300059503 | Ga0587080_003903 | Ga0587080_003903_656_1210 | 155 |
| 40 | 3300059644 | Ga0587075_042694 | Ga0587075_042694_128_682 | 155 |
| 41 | 3300059647 | Ga0587079_015290 | Ga0587079_015290_320_874 | 155 |
| 42 | 3300059647 | Ga0587079_016520 | Ga0587079_016520_649_1203 | 155 |
| 43 | 3300060247 | Ga0587096_00172 | Ga0587096_00172_422_976 | 155 |
| 44 | 3300046524 | Ga0495648_0071327 | Ga0495648_0071327_1403_1966 | 156 |
| 45 | 3300048091 | Ga0495626_0058687 | Ga0495626_0058687_527_1090 | 156 |
| 46 | 3300059605 | Ga0587106_009761 | Ga0587106_009761_116_685 | 156 |
| 47 | 3300002774 | JGI25150J39212_1001267 | JGI25150J39212_10012678 | 157 |
| 48 | 3300002987 | JGI25159J45721_1011470 | JGI25159J45721_10114703 | 157 |
| 49 | 3300003322 | rootL2_10003812 | rootL2_1000381211 | 157 |
| 50 | 3300003374 | JGI25161J50226_1010203 | JGI25161J50226_10102032 | 157 |
| 51 | 3300003771 | Ga0055526_1005886 | Ga0055526_10058867 | 157 |
| 52 | 3300003773 | Ga0055537_1003974 | Ga0055537_10039741 | 157 |
| 53 | 3300003775 | Ga0055524_1010165 | Ga0055524_10101652 | 157 |
| 54 | 3300003784 | Ga0055534_1003282 | Ga0055534_10032823 | 157 |
| 55 | 3300003790 | Ga0055528_1010434 | Ga0055528_10104342 | 157 |
| 56 | 3300003791 | Ga0055530_10010428 | Ga0055530_100104281 | 157 |
| 57 | 3300003791 | Ga0055530_10037080 | Ga0055530_100370801 | 157 |
| 58 | 3300005328 | Ga0070676_10074194 | Ga0070676_100741942 | 157 |
| 59 | 3300006237 | Ga0097621_100672441 | Ga0097621_1006724412 | 157 |
| 60 | 3300009098 | Ga0105245_10095866 | Ga0105245_100958663 | 157 |
| 61 | 3300013297 | Ga0157378_11587540 | Ga0157378_115875401 | 157 |
| 62 | 3300025208 | Ga0209436_104714 | Ga0209436_1047142 | 157 |
| 63 | 3300025245 | Ga0207425_1000205 | Ga0207425_10002053 | 157 |
| 64 | 3300025263 | Ga0209565_1000163 | Ga0209565_100016326 | 157 |
| 65 | 3300025263 | Ga0209565_1003524 | Ga0209565_10035244 | 157 |
| 66 | 3300025273 | Ga0209673_1013569 | Ga0209673_10135692 | 157 |
| 67 | 3300025284 | Ga0209130_1001475 | Ga0209130_10014755 | 157 |
| 68 | 3300025291 | Ga0209675_1000635 | Ga0209675_100063524 | 157 |
| 69 | 3300025295 | Ga0209564_1010469 | Ga0209564_10104693 | 157 |
| 70 | 3300025298 | Ga0209050_1000183 | Ga0209050_100018352 | 157 |
| 71 | 3300025298 | Ga0209050_1000753 | Ga0209050_10007531 | 157 |
| 72 | 3300025299 | Ga0209256_1003724 | Ga0209256_10037246 | 157 |
| 73 | 3300025302 | Ga0207426_1008085 | Ga0207426_10080856 | 157 |
| 74 | 3300025303 | Ga0209051_1033169 | Ga0209051_10331693 | 157 |
| 75 | 3300025304 | Ga0209257_1000010 | Ga0209257_100001089 | 157 |
| 76 | 3300031548 | Ga0307408_100030099 | Ga0307408_1000300996 | 157 |
| 77 | 3300031548 | Ga0307408_100039064 | Ga0307408_1000390645 | 157 |
| 78 | 3300042439 | Ga0439464_0093207 | Ga0439464_0093207_237_782 | 157 |
| 79 | 3300048915 | Ga0496112_0625724 | Ga0496112_0625724_47_613 | 157 |
| 80 | 3300048924 | Ga0496121_0022185 | Ga0496121_0022185_1157_1711 | 157 |
| 81 | 3300049515 | Ga0501292_027335 | Ga0501292_027335_307_852 | 157 |
| 82 | 3300049657 | Ga0501210_017290 | Ga0501210_017290_83_628 | 157 |
| 83 | 3300059645 | Ga0587076_007597 | Ga0587076_007597_682_1236 | 157 |
| 84 | 3300002987 | JGI25159J45721_1035208 | JGI25159J45721_10352082 | 158 |
| 85 | 3300003374 | JGI25161J50226_1017073 | JGI25161J50226_10170732 | 158 |
| 86 | 3300003574 | Ga0007410J51695_1021115 | Ga0007410J51695_10211152 | 158 |
| 87 | 3300003575 | Ga0007409J51694_1006046 | Ga0007409J51694_10060462 | 158 |
| 88 | 3300003577 | Ga0007416J51690_1029903 | Ga0007416J51690_10299032 | 158 |
| 89 | 3300003751 | Ga0055538_1000002 | Ga0055538_1000002361 | 158 |
| 90 | 3300003752 | Ga0055539_1000002 | Ga0055539_1000002361 | 158 |
| 91 | 3300003756 | Ga0055533_1000004 | Ga0055533_1000004361 | 158 |
| 92 | 3300003759 | Ga0055525_1000002 | Ga0055525_1000002361 | 158 |
| 93 | 3300003771 | Ga0055526_1064010 | Ga0055526_10640102 | 158 |
| 94 | 3300003841 | Ga0055541_1000002 | Ga0055541_1000002482 | 158 |
| 95 | 3300004625 | Ga0055543_1004724 | Ga0055543_10047241 | 158 |
| 96 | 3300005262 | Ga0065165_1011662 | Ga0065165_10116621 | 158 |
| 97 | 3300005327 | Ga0070658_10310880 | Ga0070658_103108802 | 158 |
| 98 | 3300014969 | Ga0157376_11137173 | Ga0157376_111371732 | 158 |
| 99 | 3300025224 | Ga0209784_100002 | Ga0209784_100002591 | 158 |
| 100 | 3300025225 | Ga0209566_100003 | Ga0209566_100003591 | 158 |
| 101 | 3300025226 | Ga0209674_100004 | Ga0209674_100004591 | 158 |
| 102 | 3300025230 | Ga0209563_100006 | Ga0209563_100006591 | 158 |
| 103 | 3300025253 | Ga0209677_100003 | Ga0209677_100003591 | 158 |
| 104 | 3300037418 | Ga0395900_0860748 | Ga0395900_0860748_108_662 | 158 |
| 105 | 3300037471 | Ga0395905_0290802 | Ga0395905_0290802_614_1168 | 158 |
| 106 | 3300038443 | Ga0395901_0319235 | Ga0395901_0319235_909_1463 | 158 |
| 107 | 3300044694 | Ga0466963_0077203 | Ga0466963_0077203_227_781 | 158 |
| 108 | 3300044706 | Ga0466964_0213964 | Ga0466964_0213964_19_573 | 158 |
| 109 | 3300045836 | Ga0466958_0044719 | Ga0466958_0044719_1125_1679 | 158 |
| 110 | 3300045976 | Ga0466967_0027416 | Ga0466967_0027416_4026_4580 | 158 |
| 111 | 3300048912 | Ga0496109_0136903 | Ga0496109_0136903_942_1508 | 158 |
| 112 | 3300059508 | Ga0587088_001642 | Ga0587088_001642_1162_1716 | 158 |
| 113 | 3300059647 | Ga0587079_023657 | Ga0587079_023657_417_971 | 158 |
| 114 | 3300005327 | Ga0070658_11289576 | Ga0070658_112895761 | 159 |
| 115 | 3300005339 | Ga0070660_100019039 | Ga0070660_1000190396 | 159 |
| 116 | 3300005344 | Ga0070661_100016272 | Ga0070661_1000162725 | 159 |
| 117 | 3300005366 | Ga0070659_100248247 | Ga0070659_1002482472 | 159 |
| 118 | 3300005459 | Ga0068867_100808148 | Ga0068867_1008081481 | 159 |
| 119 | 3300005539 | Ga0068853_101402260 | Ga0068853_1014022601 | 159 |
| 120 | 3300005578 | Ga0068854_100351826 | Ga0068854_1003518262 | 159 |
| 121 | 3300006358 | Ga0068871_100961585 | Ga0068871_1009615852 | 159 |
| 122 | 3300009093 | Ga0105240_10255882 | Ga0105240_102558822 | 159 |
| 123 | 3300009148 | Ga0105243_10069287 | Ga0105243_100692873 | 159 |
| 124 | 3300009176 | Ga0105242_10002231 | Ga0105242_1000223112 | 159 |
| 125 | 3300009551 | Ga0105238_10028613 | Ga0105238_100286133 | 159 |
| 126 | 3300010375 | Ga0105239_10093891 | Ga0105239_100938915 | 159 |
| 127 | 3300011119 | Ga0105246_10495530 | Ga0105246_104955302 | 159 |
| 128 | 3300025913 | Ga0207695_10694482 | Ga0207695_106944822 | 159 |
| 129 | 3300025932 | Ga0207690_10315843 | Ga0207690_103158432 | 159 |
| 130 | 3300025933 | Ga0207706_10096998 | Ga0207706_100969982 | 159 |
| 131 | 3300025934 | Ga0207686_10004796 | Ga0207686_100047966 | 159 |
| 132 | 3300025944 | Ga0207661_10315241 | Ga0207661_103152412 | 159 |
| 133 | 3300025945 | Ga0207679_10087306 | Ga0207679_100873062 | 159 |
| 134 | 3300025981 | Ga0207640_10205995 | Ga0207640_102059952 | 159 |
| 135 | 3300026041 | Ga0207639_10224640 | Ga0207639_102246402 | 159 |
| 136 | 3300026089 | Ga0207648_10224184 | Ga0207648_102241843 | 159 |
| 137 | 3300026142 | Ga0207698_10826271 | Ga0207698_108262712 | 159 |
| 138 | 3300032002 | Ga0307416_100654254 | Ga0307416_1006542542 | 159 |
| 139 | 3300037312 | Ga0395899_0573065 | Ga0395899_0573065_153_707 | 159 |
| 140 | 3300037418 | Ga0395900_0011395 | Ga0395900_0011395_3791_4345 | 159 |
| 141 | 3300037466 | Ga0395898_0017582 | Ga0395898_0017582_4130_4684 | 159 |
| 142 | 3300037471 | Ga0395905_0916846 | Ga0395905_0916846_96_647 | 159 |
| 143 | 3300038443 | Ga0395901_0009241 | Ga0395901_0009241_195_749 | 159 |
| 144 | 3300042005 | Ga0439448_0024773 | Ga0439448_0024773_261_815 | 159 |
| 145 | 3300042012 | Ga0439455_0070868 | Ga0439455_0070868_200_754 | 159 |
| 146 | 3300044735 | Ga0466968_0168236 | Ga0466968_0168236_167_721 | 159 |
| 147 | 3300046501 | Ga0495607_0052064 | Ga0495607_0052064_631_1182 | 159 |
| 148 | 3300046506 | Ga0495583_0052003 | Ga0495583_0052003_668_1222 | 159 |
| 149 | 3300046507 | Ga0495606_0000547 | Ga0495606_0000547_58335_58886 | 159 |
| 150 | 3300046507 | Ga0495606_0119684 | Ga0495606_0119684_96_647 | 159 |
| 151 | 3300046558 | Ga0495633_0071185 | Ga0495633_0071185_126_686 | 159 |
| 152 | 3300046558 | Ga0495633_0215978 | Ga0495633_0215978_208_759 | 159 |
| 153 | 3300046616 | Ga0495668_0001106 | Ga0495668_0001106_2326_2877 | 159 |
| 154 | 3300047318 | Ga0495636_0004688 | Ga0495636_0004688_710_1264 | 159 |
| 155 | 3300047472 | Ga0495686_0034550 | Ga0495686_0034550_2047_2598 | 159 |
| 156 | 3300048905 | Ga0496102_0599882 | Ga0496102_0599882_89_643 | 159 |
| 157 | 3300048906 | Ga0496103_0174887 | Ga0496103_0174887_669_1223 | 159 |
| 158 | 3300048910 | Ga0496107_0110383 | Ga0496107_0110383_845_1399 | 159 |
| 159 | 3300048910 | Ga0496107_0341651 | Ga0496107_0341651_123_677 | 159 |
| 160 | 3300048917 | Ga0496114_0427586 | Ga0496114_0427586_531_1085 | 159 |
| 161 | 3300049129 | Ga0501309_002863 | Ga0501309_002863_768_1313 | 159 |
| 162 | 3300059491 | Ga0587070_004835 | Ga0587070_004835_523_1077 | 159 |
| 163 | 3300059505 | Ga0587083_0001972 | Ga0587083_0001972_1107_1661 | 159 |
| 164 | 3300059509 | Ga0587089_007506 | Ga0587089_007506_99_653 | 159 |
| 165 | 3300059605 | Ga0587106_007225 | Ga0587106_007225_394_948 | 159 |
| 166 | 3300059642 | Ga0587069_007957 | Ga0587069_007957_289_858 | 159 |
| 167 | 3300059642 | Ga0587069_014580 | Ga0587069_014580_426_980 | 159 |
| 168 | 3300059649 | Ga0587102_001965 | Ga0587102_001965_833_1387 | 159 |
| 169 | 3300002774 | JGI25150J39212_1035054 | JGI25150J39212_10350541 | 160 |
| 170 | 3300003215 | JGI25153J46596_10021808 | JGI25153J46596_100218083 | 160 |
| 171 | 3300003759 | Ga0055525_1000081 | Ga0055525_100008111 | 160 |
| 172 | 3300005336 | Ga0070680_100399210 | Ga0070680_1003992102 | 160 |
| 173 | 3300005339 | Ga0070660_100019636 | Ga0070660_1000196363 | 160 |
| 174 | 3300005366 | Ga0070659_100027283 | Ga0070659_1000272833 | 160 |
| 175 | 3300005563 | Ga0068855_100654854 | Ga0068855_1006548542 | 160 |
| 176 | 3300009174 | Ga0105241_10134982 | Ga0105241_101349823 | 160 |
| 177 | 3300017792 | Ga0163161_10127977 | Ga0163161_101279773 | 160 |
| 178 | 3300025230 | Ga0209563_100015 | Ga0209563_100015777 | 160 |
| 179 | 3300025245 | Ga0207425_1001881 | Ga0207425_10018815 | 160 |
| 180 | 3300025253 | Ga0209677_109110 | Ga0209677_1091103 | 160 |
| 181 | 3300025294 | Ga0209025_1007316 | Ga0209025_10073163 | 160 |
| 182 | 3300025297 | Ga0209758_1000270 | Ga0209758_100027023 | 160 |
| 183 | 3300025911 | Ga0207654_10003120 | Ga0207654_100031209 | 160 |
| 184 | 3300025917 | Ga0207660_10242713 | Ga0207660_102427132 | 160 |
| 185 | 3300025919 | Ga0207657_10004403 | Ga0207657_1000440310 | 160 |
| 186 | 3300025932 | Ga0207690_10017481 | Ga0207690_100174814 | 160 |
| 187 | 3300026142 | Ga0207698_11889844 | Ga0207698_118898441 | 160 |
| 188 | 3300046491 | Ga0495584_0000381 | Ga0495584_0000381_16263_16814 | 160 |
| 189 | 3300048903 | Ga0496100_0773637 | Ga0496100_0773637_50_604 | 160 |
| 190 | 3300048916 | Ga0496113_0026839 | Ga0496113_0026839_1364_1918 | 160 |
| 191 | 3300048925 | Ga0496122_0018308 | Ga0496122_0018308_2656_3210 | 160 |
| 192 | 3300048926 | Ga0496123_0052096 | Ga0496123_0052096_1642_2196 | 160 |
| 193 | 3300048928 | Ga0496125_0172039 | Ga0496125_0172039_494_1048 | 160 |
| 194 | 3300049706 | Ga0501229_048866 | Ga0501229_048866_52_606 | 160 |
| 195 | 3300003784 | Ga0055534_1002884 | Ga0055534_10028847 | 161 |
| 196 | 3300009036 | Ga0105244_10017619 | Ga0105244_100176193 | 161 |
| 197 | 3300015261 | Ga0182006_1000010 | Ga0182006_1000010323 | 161 |
| 198 | 3300015262 | Ga0182007_10000021 | Ga0182007_10000021112 | 161 |
| 199 | 3300015265 | Ga0182005_1000009 | Ga0182005_100000960 | 161 |
| 200 | 3300025291 | Ga0209675_1004769 | Ga0209675_10047693 | 161 |
| 201 | 3300025295 | Ga0209564_1000098 | Ga0209564_100009890 | 161 |
| 202 | 3300025299 | Ga0209256_1001083 | Ga0209256_10010833 | 161 |
| 203 | 3300025728 | Ga0207655_1072617 | Ga0207655_10726172 | 161 |
| 204 | 3300025914 | Ga0207671_10084328 | Ga0207671_100843283 | 161 |
| 205 | 3300046530 | Ga0495654_0011080 | Ga0495654_0011080_1211_1780 | 161 |
| 206 | 3300046530 | Ga0495654_0028810 | Ga0495654_0028810_1250_1804 | 161 |
| 207 | 3300046557 | Ga0495622_0054503 | Ga0495622_0054503_199_753 | 161 |
| 208 | 3300046558 | Ga0495633_0002184 | Ga0495633_0002184_12266_12820 | 161 |
| 209 | 3300048919 | Ga0496116_0071545 | Ga0496116_0071545_602_1156 | 161 |
| 210 | 3300048920 | Ga0496117_0000010 | Ga0496117_0000010_538779_539333 | 161 |
| 211 | 3300048921 | Ga0496118_0000009 | Ga0496118_0000009_72622_73176 | 161 |
| 212 | 3300048924 | Ga0496121_0016466 | Ga0496121_0016466_2586_3140 | 161 |
| 213 | 3300048925 | Ga0496122_0025832 | Ga0496122_0025832_3468_4022 | 161 |
| 214 | 3300048926 | Ga0496123_0004642 | Ga0496123_0004642_12579_13133 | 161 |
| 215 | 3300048927 | Ga0496124_0118031 | Ga0496124_0118031_859_1413 | 161 |
| 216 | 3300049460 | Ga0495682_0001244 | Ga0495682_0001244_12603_13157 | 161 |
| 217 | 3300059644 | Ga0587075_002311 | Ga0587075_002311_796_1365 | 161 |
| 218 | 3300005327 | Ga0070658_11126602 | Ga0070658_111266021 | 162 |
| 219 | 3300005563 | Ga0068855_100023836 | Ga0068855_1000238362 | 162 |
| 220 | 3300025909 | Ga0207705_10015832 | Ga0207705_100158323 | 162 |
| 221 | 3300025949 | Ga0207667_10015769 | Ga0207667_100157697 | 162 |
| 222 | 3300039447 | Ga0436361_0480035 | Ga0436361_0480035_2073_2627 | 162 |
| 223 | 3300044693 | Ga0466961_0485655 | Ga0466961_0485655_74_643 | 162 |
| 224 | 3300044706 | Ga0466964_0012691 | Ga0466964_0012691_1449_2003 | 162 |
| 225 | 3300044719 | Ga0466971_0182658 | Ga0466971_0182658_225_794 | 162 |
| 226 | 3300046457 | Ga0495590_0093492 | Ga0495590_0093492_483_1034 | 162 |
| 227 | 3300046492 | Ga0495585_0000889 | Ga0495585_0000889_1193_1744 | 162 |
| 228 | 3300046492 | Ga0495585_0011129 | Ga0495585_0011129_953_1522 | 162 |
| 229 | 3300046522 | Ga0495643_0077756 | Ga0495643_0077756_991_1542 | 162 |
| 230 | 3300046648 | Ga0495611_0165269 | Ga0495611_0165269_106_675 | 162 |
| 231 | 3300046665 | Ga0495661_0012263 | Ga0495661_0012263_1902_2471 | 162 |
| 232 | 3300046691 | Ga0495670_0022250 | Ga0495670_0022250_572_1141 | 162 |
| 233 | 3300047320 | Ga0495672_0025841 | Ga0495672_0025841_1990_2544 | 162 |
| 234 | 3300047323 | Ga0495683_0214538 | Ga0495683_0214538_40_609 | 162 |
| 235 | 3300047445 | Ga0495677_0013167 | Ga0495677_0013167_1817_2386 | 162 |
| 236 | 3300047470 | Ga0495681_0016409 | Ga0495681_0016409_237_806 | 162 |
| 237 | 3300047673 | Ga0495593_0071856 | Ga0495593_0071856_252_806 | 162 |
| 238 | 3300048088 | Ga0495602_0002022 | Ga0495602_0002022_16932_17486 | 162 |
| 239 | 3300048905 | Ga0496102_0000977 | Ga0496102_0000977_16799_17350 | 162 |
| 240 | 3300059639 | Ga0587062_031699 | Ga0587062_031699_180_734 | 162 |
| 241 | 3300059642 | Ga0587069_003497 | Ga0587069_003497_843_1412 | 162 |
| 242 | 3300005337 | Ga0070682_100209046 | Ga0070682_1002090462 | 163 |
| 243 | 3300005355 | Ga0070671_100000025 | Ga0070671_1000000254 | 163 |
| 244 | 3300005616 | Ga0068852_100470435 | Ga0068852_1004704351 | 163 |
| 245 | 3300006028 | Ga0070717_10329720 | Ga0070717_103297202 | 163 |
| 246 | 3300010375 | Ga0105239_10566910 | Ga0105239_105669102 | 163 |
| 247 | 3300025931 | Ga0207644_10000312 | Ga0207644_1000031212 | 163 |
| 248 | 3300037418 | Ga0395900_0000532 | Ga0395900_0000532_5572_6141 | 163 |
| 249 | 3300037471 | Ga0395905_0131813 | Ga0395905_0131813_259_837 | 163 |
| 250 | 3300038443 | Ga0395901_0000765 | Ga0395901_0000765_9623_10192 | 163 |
| 251 | 3300044656 | Ga0466969_0401196 | Ga0466969_0401196_12_581 | 163 |
| 252 | 3300044683 | Ga0466965_0006716 | Ga0466965_0006716_1449_2018 | 163 |
| 253 | 3300044684 | Ga0466966_0010145 | Ga0466966_0010145_3920_4489 | 163 |
| 254 | 3300044842 | Ga0466957_0003305 | Ga0466957_0003305_2146_2715 | 163 |
| 255 | 3300045049 | Ga0466959_0235373 | Ga0466959_0235373_200_769 | 163 |
| 256 | 3300046463 | Ga0495653_0135297 | Ga0495653_0135297_883_1437 | 163 |
| 257 | 3300046472 | Ga0495580_0024981 | Ga0495580_0024981_2554_3108 | 163 |
| 258 | 3300046473 | Ga0495582_0005030 | Ga0495582_0005030_797_1351 | 163 |
| 259 | 3300046474 | Ga0495605_0000005 | Ga0495605_0000005_78206_78760 | 163 |
| 260 | 3300046474 | Ga0495605_0027564 | Ga0495605_0027564_1414_1965 | 163 |
| 261 | 3300046475 | Ga0495639_0228194 | Ga0495639_0228194_209_763 | 163 |
| 262 | 3300046491 | Ga0495584_0070048 | Ga0495584_0070048_423_974 | 163 |
| 263 | 3300046492 | Ga0495585_0092311 | Ga0495585_0092311_625_1176 | 163 |
| 264 | 3300046492 | Ga0495585_0135032 | Ga0495585_0135032_424_978 | 163 |
| 265 | 3300046499 | Ga0495594_0016435 | Ga0495594_0016435_2682_3236 | 163 |
| 266 | 3300046500 | Ga0495596_0044212 | Ga0495596_0044212_748_1299 | 163 |
| 267 | 3300046506 | Ga0495583_0108125 | Ga0495583_0108125_405_956 | 163 |
| 268 | 3300046507 | Ga0495606_0002788 | Ga0495606_0002788_16083_16634 | 163 |
| 269 | 3300046513 | Ga0495616_0040738 | Ga0495616_0040738_471_1022 | 163 |
| 270 | 3300046517 | Ga0495630_0005271 | Ga0495630_0005271_5908_6462 | 163 |
| 271 | 3300046518 | Ga0495631_0019628 | Ga0495631_0019628_1847_2398 | 163 |
| 272 | 3300046519 | Ga0495632_0059363 | Ga0495632_0059363_462_1013 | 163 |
| 273 | 3300046522 | Ga0495643_0036792 | Ga0495643_0036792_1288_1839 | 163 |
| 274 | 3300046526 | Ga0495666_0007083 | Ga0495666_0007083_3746_4300 | 163 |
| 275 | 3300046528 | Ga0495642_0088467 | Ga0495642_0088467_534_1085 | 163 |
| 276 | 3300046529 | Ga0495652_0032215 | Ga0495652_0032215_2620_3174 | 163 |
| 277 | 3300046530 | Ga0495654_0142868 | Ga0495654_0142868_74_625 | 163 |
| 278 | 3300046535 | Ga0495586_0021007 | Ga0495586_0021007_1863_2417 | 163 |
| 279 | 3300046536 | Ga0495587_0015121 | Ga0495587_0015121_217_771 | 163 |
| 280 | 3300046538 | Ga0495609_0058074 | Ga0495609_0058074_424_975 | 163 |
| 281 | 3300046616 | Ga0495668_0145246 | Ga0495668_0145246_405_956 | 163 |
| 282 | 3300046642 | Ga0495634_0000991 | Ga0495634_0000991_9627_10181 | 163 |
| 283 | 3300046648 | Ga0495611_0093809 | Ga0495611_0093809_613_1164 | 163 |
| 284 | 3300046660 | Ga0495625_0149084 | Ga0495625_0149084_671_1222 | 163 |
| 285 | 3300046664 | Ga0495659_0037958 | Ga0495659_0037958_464_1015 | 163 |
| 286 | 3300046665 | Ga0495661_0210518 | Ga0495661_0210518_225_776 | 163 |
| 287 | 3300046674 | Ga0495588_0010764 | Ga0495588_0010764_714_1268 | 163 |
| 288 | 3300046679 | Ga0495623_0016264 | Ga0495623_0016264_2242_2796 | 163 |
| 289 | 3300046794 | Ga0495589_0080904 | Ga0495589_0080904_566_1117 | 163 |
| 290 | 3300046809 | Ga0495600_0199116 | Ga0495600_0199116_288_842 | 163 |
| 291 | 3300047315 | Ga0495581_0099725 | Ga0495581_0099725_567_1121 | 163 |
| 292 | 3300047317 | Ga0495604_0009665 | Ga0495604_0009665_2307_2861 | 163 |
| 293 | 3300047322 | Ga0495680_0090337 | Ga0495680_0090337_227_781 | 163 |
| 294 | 3300047444 | Ga0495675_0000641 | Ga0495675_0000641_5178_5732 | 163 |
| 295 | 3300047447 | Ga0495685_016278 | Ga0495685_016278_776_1327 | 163 |
| 296 | 3300047470 | Ga0495681_0023598 | Ga0495681_0023598_2689_3243 | 163 |
| 297 | 3300048089 | Ga0495614_0186182 | Ga0495614_0186182_358_912 | 163 |
| 298 | 3300048091 | Ga0495626_0092477 | Ga0495626_0092477_565_1116 | 163 |
| 299 | 3300048918 | Ga0496115_0268235 | Ga0496115_0268235_637_1188 | 163 |
| 300 | 3300048927 | Ga0496124_0148865 | Ga0496124_0148865_221_784 | 163 |
| 301 | 3300049460 | Ga0495682_0011867 | Ga0495682_0011867_1592_2143 | 163 |
| 302 | 3300049822 | Ga0501035_0000816 | Ga0501035_0000816_29446_30015 | 163 |
| 303 | 3300059646 | Ga0587078_008471 | Ga0587078_008471_357_911 | 163 |
| 304 | 3300003320 | rootH2_10293157 | rootH2_102931572 | 164 |
| 305 | 3300017792 | Ga0163161_10013082 | Ga0163161_100130824 | 164 |
| 306 | 3300032004 | Ga0307414_10045777 | Ga0307414_100457772 | 164 |
| 307 | 3300044765 | Ga0466970_0033906 | Ga0466970_0033906_978_1550 | 164 |
| 308 | 3300045049 | Ga0466959_0057388 | Ga0466959_0057388_1269_1841 | 164 |
| 309 | 3300046518 | Ga0495631_0187925 | Ga0495631_0187925_199_756 | 164 |
| 310 | 3300046531 | Ga0495665_0381375 | Ga0495665_0381375_99_653 | 164 |
| 311 | 3300046535 | Ga0495586_0022390 | Ga0495586_0022390_1227_1781 | 164 |
| 312 | 3300046663 | Ga0495635_0001964 | Ga0495635_0001964_8923_9477 | 164 |
| 313 | 3300046689 | Ga0495613_0167143 | Ga0495613_0167143_667_1221 | 164 |
| 314 | 3300046809 | Ga0495600_0070875 | Ga0495600_0070875_1368_1922 | 164 |
| 315 | 3300047317 | Ga0495604_0008392 | Ga0495604_0008392_4971_5525 | 164 |
| 316 | 3300047320 | Ga0495672_0102790 | Ga0495672_0102790_55_618 | 164 |
| 317 | 3300047322 | Ga0495680_0005963 | Ga0495680_0005963_8867_9421 | 164 |
| 318 | 3300047445 | Ga0495677_0033535 | Ga0495677_0033535_458_1015 | 164 |
| 319 | 3300047673 | Ga0495593_0007821 | Ga0495593_0007821_1116_1670 | 164 |
| 320 | 3300048089 | Ga0495614_0006176 | Ga0495614_0006176_2567_3121 | 164 |
| 321 | 3300046674 | Ga0495588_0323176 | Ga0495588_0323176_16_546 | 165 |
| 322 | 3300003775 | Ga0055524_1000026 | Ga0055524_100002670 | 166 |
| 323 | 3300021361 | Ga0213872_10039352 | Ga0213872_100393521 | 166 |
| 324 | 3300025263 | Ga0209565_1002537 | Ga0209565_10025376 | 166 |
| 325 | 3300025291 | Ga0209675_1035477 | Ga0209675_10354772 | 166 |
| 326 | 3300025299 | Ga0209256_1000013 | Ga0209256_1000013586 | 166 |
| 327 | 3300031548 | Ga0307408_100120973 | Ga0307408_1001209732 | 166 |
| 328 | 3300039447 | Ga0436361_0065289 | Ga0436361_0065289_3067_3630 | 166 |
| 329 | 3300041413 | Ga0439465_0139031 | Ga0439465_0139031_166_720 | 166 |
| 330 | 3300046512 | Ga0495610_0000021 | Ga0495610_0000021_74742_75296 | 166 |
| 331 | 3300046518 | Ga0495631_0182652 | Ga0495631_0182652_131_700 | 166 |
| 332 | 3300046524 | Ga0495648_0090475 | Ga0495648_0090475_103_654 | 166 |
| 333 | 3300046528 | Ga0495642_0206597 | Ga0495642_0206597_160_711 | 166 |
| 334 | 3300046557 | Ga0495622_0053142 | Ga0495622_0053142_870_1427 | 166 |
| 335 | 3300046694 | Ga0495649_0113557 | Ga0495649_0113557_73_624 | 166 |
| 336 | 3300047320 | Ga0495672_0131295 | Ga0495672_0131295_312_881 | 166 |
| 337 | 3300047323 | Ga0495683_0038289 | Ga0495683_0038289_1678_2247 | 166 |
| 338 | 3300053118 | Ga0500594_0011747 | Ga0500594_0011747_533_1084 | 166 |
| 339 | 3300032004 | Ga0307414_10817207 | Ga0307414_108172072 | 167 |
| 340 | 3300046499 | Ga0495594_0365398 | Ga0495594_0365398_229_780 | 167 |
| 341 | 3300046501 | Ga0495607_0090256 | Ga0495607_0090256_711_1280 | 167 |
| 342 | 3300046531 | Ga0495665_0020394 | Ga0495665_0020394_603_1154 | 167 |
| 343 | 3300046535 | Ga0495586_0172270 | Ga0495586_0172270_632_1183 | 167 |
| 344 | 3300046538 | Ga0495609_0146116 | Ga0495609_0146116_61_630 | 167 |
| 345 | 3300046616 | Ga0495668_0397196 | Ga0495668_0397196_130_699 | 167 |
| 346 | 3300046660 | Ga0495625_0065254 | Ga0495625_0065254_610_1164 | 167 |
| 347 | 3300046660 | Ga0495625_0186517 | Ga0495625_0186517_343_897 | 167 |
| 348 | 3300046665 | Ga0495661_0120669 | Ga0495661_0120669_577_1146 | 167 |
| 349 | 3300046665 | Ga0495661_0273676 | Ga0495661_0273676_146_700 | 167 |
| 350 | 3300046674 | Ga0495588_0000113 | Ga0495588_0000113_58741_59295 | 167 |
| 351 | 3300046674 | Ga0495588_0471139 | Ga0495588_0471139_42_593 | 167 |
| 352 | 3300046684 | Ga0495669_0000075 | Ga0495669_0000075_3904_4473 | 167 |
| 353 | 3300046694 | Ga0495649_0378468 | Ga0495649_0378468_103_672 | 167 |
| 354 | 3300046794 | Ga0495589_0072985 | Ga0495589_0072985_198_767 | 167 |
| 355 | 3300047319 | Ga0495674_0001330 | Ga0495674_0001330_9416_9967 | 167 |
| 356 | 3300047321 | Ga0495676_0433009 | Ga0495676_0433009_128_679 | 167 |
| 357 | 3300047446 | Ga0495679_017776 | Ga0495679_017776_766_1335 | 167 |
| 358 | 3300047447 | Ga0495685_105721 | Ga0495685_105721_128_697 | 167 |
| 359 | 3300048091 | Ga0495626_0090112 | Ga0495626_0090112_198_767 | 167 |
| 360 | 3300048906 | Ga0496103_0007002 | Ga0496103_0007002_4825_5379 | 167 |
| 361 | 3300049766 | Ga0501269_000437 | Ga0501269_000437_733_1287 | 167 |
| 362 | 3300015261 | Ga0182006_1000070 | Ga0182006_100007066 | 168 |
| 363 | 3300015265 | Ga0182005_1000003 | Ga0182005_100000367 | 168 |
| 364 | 3300027111 | Ga0209281_1027586 | Ga0209281_10275862 | 168 |
| 365 | 3300031838 | Ga0307518_10093594 | Ga0307518_100935943 | 168 |
| 366 | 3300037312 | Ga0395899_0023733 | Ga0395899_0023733_903_1457 | 168 |
| 367 | 3300037418 | Ga0395900_0044333 | Ga0395900_0044333_491_1045 | 168 |
| 368 | 3300046455 | Ga0495603_0127264 | Ga0495603_0127264_782_1333 | 168 |
| 369 | 3300046459 | Ga0495629_0008589 | Ga0495629_0008589_254_805 | 168 |
| 370 | 3300046491 | Ga0495584_0001114 | Ga0495584_0001114_1009_1560 | 168 |
| 371 | 3300046491 | Ga0495584_0007663 | Ga0495584_0007663_3961_4512 | 168 |
| 372 | 3300046491 | Ga0495584_0094776 | Ga0495584_0094776_771_1322 | 168 |
| 373 | 3300046491 | Ga0495584_0224600 | Ga0495584_0224600_359_910 | 168 |
| 374 | 3300046492 | Ga0495585_0008221 | Ga0495585_0008221_4753_5304 | 168 |
| 375 | 3300046492 | Ga0495585_0235050 | Ga0495585_0235050_97_648 | 168 |
| 376 | 3300046499 | Ga0495594_0293937 | Ga0495594_0293937_206_757 | 168 |
| 377 | 3300046500 | Ga0495596_0036442 | Ga0495596_0036442_255_806 | 168 |
| 378 | 3300046513 | Ga0495616_0105541 | Ga0495616_0105541_710_1261 | 168 |
| 379 | 3300046518 | Ga0495631_0221516 | Ga0495631_0221516_128_697 | 168 |
| 380 | 3300046523 | Ga0495644_0030512 | Ga0495644_0030512_896_1447 | 168 |
| 381 | 3300046524 | Ga0495648_0301215 | Ga0495648_0301215_122_691 | 168 |
| 382 | 3300046526 | Ga0495666_0000293 | Ga0495666_0000293_7402_7971 | 168 |
| 383 | 3300046531 | Ga0495665_0027126 | Ga0495665_0027126_1672_2241 | 168 |
| 384 | 3300046531 | Ga0495665_0272221 | Ga0495665_0272221_168_719 | 168 |
| 385 | 3300046533 | Ga0495640_0004944 | Ga0495640_0004944_8029_8598 | 168 |
| 386 | 3300046535 | Ga0495586_0127766 | Ga0495586_0127766_106_675 | 168 |
| 387 | 3300046535 | Ga0495586_0318063 | Ga0495586_0318063_321_872 | 168 |
| 388 | 3300046538 | Ga0495609_0048276 | Ga0495609_0048276_424_975 | 168 |
| 389 | 3300046538 | Ga0495609_0051016 | Ga0495609_0051016_266_817 | 168 |
| 390 | 3300046542 | Ga0495597_0012024 | Ga0495597_0012024_2863_3414 | 168 |
| 391 | 3300046558 | Ga0495633_0009027 | Ga0495633_0009027_1896_2447 | 168 |
| 392 | 3300046616 | Ga0495668_0047044 | Ga0495668_0047044_1170_1721 | 168 |
| 393 | 3300046660 | Ga0495625_0403729 | Ga0495625_0403729_161_712 | 168 |
| 394 | 3300046689 | Ga0495613_0147015 | Ga0495613_0147015_1018_1569 | 168 |
| 395 | 3300046691 | Ga0495670_0003298 | Ga0495670_0003298_6198_6749 | 168 |
| 396 | 3300046691 | Ga0495670_0065209 | Ga0495670_0065209_1055_1606 | 168 |
| 397 | 3300046694 | Ga0495649_0090343 | Ga0495649_0090343_751_1302 | 168 |
| 398 | 3300047321 | Ga0495676_0032442 | Ga0495676_0032442_1536_2087 | 168 |
| 399 | 3300047323 | Ga0495683_0000112 | Ga0495683_0000112_3902_4453 | 168 |
| 400 | 3300047469 | Ga0495673_0000034 | Ga0495673_0000034_249638_250189 | 168 |
| 401 | 3300047470 | Ga0495681_0030386 | Ga0495681_0030386_566_1117 | 168 |
| 402 | 3300047470 | Ga0495681_0035504 | Ga0495681_0035504_1020_1571 | 168 |
| 403 | 3300048088 | Ga0495602_0151365 | Ga0495602_0151365_721_1272 | 168 |
| 404 | 3300048091 | Ga0495626_0010381 | Ga0495626_0010381_4347_4898 | 168 |
| 405 | 3300048913 | Ga0496110_0007252 | Ga0496110_0007252_4864_5418 | 168 |
| 406 | 3300048914 | Ga0496111_0249845 | Ga0496111_0249845_404_958 | 168 |
| 407 | 3300049460 | Ga0495682_0063027 | Ga0495682_0063027_648_1199 | 168 |
| 408 | 3300044669 | Ga0466981_0558362 | Ga0466981_0558362_12_554 | 169 |
| 409 | 3300044765 | Ga0466970_0077320 | Ga0466970_0077320_410_952 | 169 |
| 410 | 3300046474 | Ga0495605_0047131 | Ga0495605_0047131_1347_1916 | 169 |
| 411 | 3300046501 | Ga0495607_0034188 | Ga0495607_0034188_1393_1968 | 169 |
| 412 | 3300046506 | Ga0495583_0019099 | Ga0495583_0019099_341_895 | 169 |
| 413 | 3300046522 | Ga0495643_0230749 | Ga0495643_0230749_277_828 | 169 |
| 414 | 3300046538 | Ga0495609_0129126 | Ga0495609_0129126_170_724 | 169 |
| 415 | 3300046674 | Ga0495588_0297746 | Ga0495588_0297746_144_698 | 169 |
| 416 | 3300046679 | Ga0495623_0233308 | Ga0495623_0233308_94_645 | 169 |
| 417 | 3300046810 | Ga0495660_0003778 | Ga0495660_0003778_1659_2210 | 169 |
| 418 | 3300047470 | Ga0495681_0037873 | Ga0495681_0037873_1237_1788 | 169 |
| 419 | 3300047472 | Ga0495686_0040470 | Ga0495686_0040470_332_904 | 169 |
| 420 | 3300048927 | Ga0496124_0133675 | Ga0496124_0133675_495_1046 | 169 |
| 421 | 3300049459 | Ga0495678_000076 | Ga0495678_000076_43210_43761 | 169 |
| 422 | 3300003751 | Ga0055538_1000117 | Ga0055538_100011749 | 170 |
| 423 | 3300003752 | Ga0055539_1000163 | Ga0055539_100016349 | 170 |
| 424 | 3300003756 | Ga0055533_1000166 | Ga0055533_100016649 | 170 |
| 425 | 3300003759 | Ga0055525_1000227 | Ga0055525_100022749 | 170 |
| 426 | 3300003763 | Ga0055529_1000565 | Ga0055529_100056518 | 170 |
| 427 | 3300003841 | Ga0055541_1000109 | Ga0055541_100010914 | 170 |
| 428 | 3300009093 | Ga0105240_10003355 | Ga0105240_1000335523 | 170 |
| 429 | 3300013100 | Ga0157373_10065917 | Ga0157373_100659173 | 170 |
| 430 | 3300025224 | Ga0209784_100153 | Ga0209784_10015316 | 170 |
| 431 | 3300025225 | Ga0209566_100195 | Ga0209566_10019516 | 170 |
| 432 | 3300025226 | Ga0209674_100198 | Ga0209674_10019816 | 170 |
| 433 | 3300025230 | Ga0209563_100157 | Ga0209563_10015716 | 170 |
| 434 | 3300025253 | Ga0209677_100156 | Ga0209677_10015616 | 170 |
| 435 | 3300025272 | Ga0209455_1000063 | Ga0209455_1000063249 | 170 |
| 436 | 3300048919 | Ga0496116_0010763 | Ga0496116_0010763_2870_3427 | 170 |
| 437 | 3300048921 | Ga0496118_0089671 | Ga0496118_0089671_164_721 | 170 |
| 438 | 3300048924 | Ga0496121_0118573 | Ga0496121_0118573_1216_1773 | 170 |
| 439 | 3300048925 | Ga0496122_0000513 | Ga0496122_0000513_10850_11407 | 170 |
| 440 | 3300048926 | Ga0496123_0000145 | Ga0496123_0000145_68623_69180 | 170 |
| 441 | 3300048928 | Ga0496125_0032436 | Ga0496125_0032436_3911_4468 | 170 |
| 442 | 3300046471 | Ga0495650_0033656 | Ga0495650_0033656_1113_1664 | 171 |
| 443 | 3300046507 | Ga0495606_0115547 | Ga0495606_0115547_18_572 | 171 |
| 444 | 3300046519 | Ga0495632_0001724 | Ga0495632_0001724_3799_4353 | 171 |
| 445 | 3300046520 | Ga0495637_0000305 | Ga0495637_0000305_1009_1560 | 171 |
| 446 | 3300046530 | Ga0495654_0000005 | Ga0495654_0000005_68319_68870 | 171 |
| 447 | 3300046542 | Ga0495597_0000310 | Ga0495597_0000310_42237_42791 | 171 |
| 448 | 3300046542 | Ga0495597_0002547 | Ga0495597_0002547_7682_8236 | 171 |
| 449 | 3300046542 | Ga0495597_0148467 | Ga0495597_0148467_243_797 | 171 |
| 450 | 3300046558 | Ga0495633_0123596 | Ga0495633_0123596_144_698 | 171 |
| 451 | 3300046660 | Ga0495625_0022179 | Ga0495625_0022179_1417_1968 | 171 |
| 452 | 3300046665 | Ga0495661_0032622 | Ga0495661_0032622_1760_2314 | 171 |
| 453 | 3300046794 | Ga0495589_0001253 | Ga0495589_0001253_11222_11776 | 171 |
| 454 | 3300046810 | Ga0495660_0065622 | Ga0495660_0065622_428_979 | 171 |
| 455 | 3300047470 | Ga0495681_0302280 | Ga0495681_0302280_26_577 | 171 |
| 456 | 3300048928 | Ga0496125_0274243 | Ga0496125_0274243_127_678 | 171 |
| 457 | 3300059510 | Ga0587090_031712 | Ga0587090_031712_232_786 | 171 |
| 458 | 3300003771 | Ga0055526_1004232 | Ga0055526_10042323 | 172 |
| 459 | 3300046452 | Ga0495617_075766 | Ga0495617_075766_251_796 | 172 |
| 460 | 3300046459 | Ga0495629_0056479 | Ga0495629_0056479_671_1222 | 172 |
| 461 | 3300046460 | Ga0495638_0117589 | Ga0495638_0117589_49_600 | 172 |
| 462 | 3300046463 | Ga0495653_0036769 | Ga0495653_0036769_2459_3010 | 172 |
| 463 | 3300046471 | Ga0495650_0000712 | Ga0495650_0000712_21626_22177 | 172 |
| 464 | 3300046491 | Ga0495584_0019150 | Ga0495584_0019150_2142_2687 | 172 |
| 465 | 3300046501 | Ga0495607_0063189 | Ga0495607_0063189_461_1006 | 172 |
| 466 | 3300046506 | Ga0495583_0018489 | Ga0495583_0018489_981_1526 | 172 |
| 467 | 3300046513 | Ga0495616_0084167 | Ga0495616_0084167_956_1501 | 172 |
| 468 | 3300046517 | Ga0495630_0021183 | Ga0495630_0021183_3741_4292 | 172 |
| 469 | 3300046528 | Ga0495642_0052284 | Ga0495642_0052284_1062_1607 | 172 |
| 470 | 3300046529 | Ga0495652_0041820 | Ga0495652_0041820_1833_2384 | 172 |
| 471 | 3300046531 | Ga0495665_0137168 | Ga0495665_0137168_151_702 | 172 |
| 472 | 3300046535 | Ga0495586_0016302 | Ga0495586_0016302_2412_2963 | 172 |
| 473 | 3300046536 | Ga0495587_0033763 | Ga0495587_0033763_722_1273 | 172 |
| 474 | 3300046538 | Ga0495609_0044718 | Ga0495609_0044718_1294_1839 | 172 |
| 475 | 3300046542 | Ga0495597_0003418 | Ga0495597_0003418_3188_3739 | 172 |
| 476 | 3300046542 | Ga0495597_0004282 | Ga0495597_0004282_2486_3049 | 172 |
| 477 | 3300046557 | Ga0495622_0187524 | Ga0495622_0187524_169_720 | 172 |
| 478 | 3300046558 | Ga0495633_0000357 | Ga0495633_0000357_1136_1690 | 172 |
| 479 | 3300046559 | Ga0495667_0108419 | Ga0495667_0108419_552_1103 | 172 |
| 480 | 3300046615 | Ga0495656_0216050 | Ga0495656_0216050_190_735 | 172 |
| 481 | 3300046616 | Ga0495668_0000008 | Ga0495668_0000008_400934_401482 | 172 |
| 482 | 3300046616 | Ga0495668_0034818 | Ga0495668_0034818_29_574 | 172 |
| 483 | 3300046642 | Ga0495634_0117670 | Ga0495634_0117670_912_1463 | 172 |
| 484 | 3300046660 | Ga0495625_0001934 | Ga0495625_0001934_15240_15785 | 172 |
| 485 | 3300046660 | Ga0495625_0002185 | Ga0495625_0002185_19650_20201 | 172 |
| 486 | 3300046664 | Ga0495659_0002967 | Ga0495659_0002967_3862_4407 | 172 |
| 487 | 3300046665 | Ga0495661_0096991 | Ga0495661_0096991_217_762 | 172 |
| 488 | 3300046679 | Ga0495623_0170724 | Ga0495623_0170724_551_1102 | 172 |
| 489 | 3300046680 | Ga0495646_0175128 | Ga0495646_0175128_57_608 | 172 |
| 490 | 3300046684 | Ga0495669_0006448 | Ga0495669_0006448_412_957 | 172 |
| 491 | 3300046694 | Ga0495649_0007384 | Ga0495649_0007384_3896_4441 | 172 |
| 492 | 3300046809 | Ga0495600_0194477 | Ga0495600_0194477_143_694 | 172 |
| 493 | 3300046810 | Ga0495660_0053711 | Ga0495660_0053711_947_1492 | 172 |
| 494 | 3300047315 | Ga0495581_0040566 | Ga0495581_0040566_853_1404 | 172 |
| 495 | 3300047320 | Ga0495672_0000014 | Ga0495672_0000014_100180_100767 | 172 |
| 496 | 3300047444 | Ga0495675_0114778 | Ga0495675_0114778_140_691 | 172 |
| 497 | 3300047445 | Ga0495677_0008437 | Ga0495677_0008437_3140_3685 | 172 |
| 498 | 3300047447 | Ga0495685_009277 | Ga0495685_009277_1647_2192 | 172 |
| 499 | 3300047470 | Ga0495681_0014139 | Ga0495681_0014139_978_1523 | 172 |
| 500 | 3300047470 | Ga0495681_0093372 | Ga0495681_0093372_747_1298 | 172 |
| 501 | 3300047472 | Ga0495686_0001306 | Ga0495686_0001306_1378_1926 | 172 |
| 502 | 3300047472 | Ga0495686_0041735 | Ga0495686_0041735_1231_1818 | 172 |
| 503 | 3300047673 | Ga0495593_0060082 | Ga0495593_0060082_30_581 | 172 |
| 504 | 3300048089 | Ga0495614_0099458 | Ga0495614_0099458_237_788 | 172 |
| 505 | 3300048091 | Ga0495626_0000044 | Ga0495626_0000044_94677_95231 | 172 |
| 506 | 3300048091 | Ga0495626_0028057 | Ga0495626_0028057_1180_1731 | 172 |
| 507 | 3300048928 | Ga0496125_0001481 | Ga0496125_0001481_13768_14331 | 172 |
| 508 | 3300003544 | Ga0007417J51691_1016591 | Ga0007417J51691_10165912 | 173 |
| 509 | 3300003574 | Ga0007410J51695_1024144 | Ga0007410J51695_10241441 | 173 |
| 510 | 3300003771 | Ga0055526_1015143 | Ga0055526_10151433 | 173 |
| 511 | 3300005295 | Ga0065707_10223324 | Ga0065707_102233242 | 173 |
| 512 | 3300005548 | Ga0070665_100150604 | Ga0070665_1001506043 | 173 |
| 513 | 3300005844 | Ga0068862_100068501 | Ga0068862_1000685013 | 173 |
| 514 | 3300006177 | Ga0075362_10006912 | Ga0075362_100069124 | 173 |
| 515 | 3300009036 | Ga0105244_10002846 | Ga0105244_100028469 | 173 |
| 516 | 3300009036 | Ga0105244_10004702 | Ga0105244_100047028 | 173 |
| 517 | 3300009177 | Ga0105248_10148536 | Ga0105248_101485362 | 173 |
| 518 | 3300009553 | Ga0105249_10146050 | Ga0105249_101460502 | 173 |
| 519 | 3300025263 | Ga0209565_1019823 | Ga0209565_10198233 | 173 |
| 520 | 3300025295 | Ga0209564_1000026 | Ga0209564_1000026414 | 173 |
| 521 | 3300025728 | Ga0207655_1006312 | Ga0207655_10063123 | 173 |
| 522 | 3300025728 | Ga0207655_1007374 | Ga0207655_10073743 | 173 |
| 523 | 3300025903 | Ga0207680_10007523 | Ga0207680_100075234 | 173 |
| 524 | 3300025941 | Ga0207711_10002080 | Ga0207711_100020806 | 173 |
| 525 | 3300025941 | Ga0207711_10008967 | Ga0207711_100089674 | 173 |
| 526 | 3300025961 | Ga0207712_10142307 | Ga0207712_101423072 | 173 |
| 527 | 3300028379 | Ga0268266_10060143 | Ga0268266_100601433 | 173 |
| 528 | 3300028380 | Ga0268265_10001641 | Ga0268265_100016414 | 173 |
| 529 | 3300039447 | Ga0436361_0179116 | Ga0436361_0179116_156_695 | 173 |
| 530 | 3300042139 | Ga0450904_000854 | Ga0450904_000854_2704_3255 | 173 |
| 531 | 3300044658 | Ga0466972_0000283 | Ga0466972_0000283_26416_26970 | 173 |
| 532 | 3300046460 | Ga0495638_0083406 | Ga0495638_0083406_605_1156 | 173 |
| 533 | 3300046471 | Ga0495650_0000212 | Ga0495650_0000212_48341_48892 | 173 |
| 534 | 3300046474 | Ga0495605_0026659 | Ga0495605_0026659_943_1497 | 173 |
| 535 | 3300046491 | Ga0495584_0099702 | Ga0495584_0099702_331_885 | 173 |
| 536 | 3300046500 | Ga0495596_0005456 | Ga0495596_0005456_826_1380 | 173 |
| 537 | 3300046506 | Ga0495583_0000983 | Ga0495583_0000983_2949_3503 | 173 |
| 538 | 3300046506 | Ga0495583_0038221 | Ga0495583_0038221_213_764 | 173 |
| 539 | 3300046506 | Ga0495583_0170507 | Ga0495583_0170507_329_880 | 173 |
| 540 | 3300046507 | Ga0495606_0050389 | Ga0495606_0050389_2163_2714 | 173 |
| 541 | 3300046512 | Ga0495610_0006777 | Ga0495610_0006777_6586_7140 | 173 |
| 542 | 3300046513 | Ga0495616_0000093 | Ga0495616_0000093_72081_72635 | 173 |
| 543 | 3300046515 | Ga0495620_0020297 | Ga0495620_0020297_2411_2962 | 173 |
| 544 | 3300046522 | Ga0495643_0000096 | Ga0495643_0000096_113341_113895 | 173 |
| 545 | 3300046522 | Ga0495643_0000181 | Ga0495643_0000181_46312_46866 | 173 |
| 546 | 3300046522 | Ga0495643_0001269 | Ga0495643_0001269_20170_20724 | 173 |
| 547 | 3300046524 | Ga0495648_0037553 | Ga0495648_0037553_1333_1887 | 173 |
| 548 | 3300046530 | Ga0495654_0021618 | Ga0495654_0021618_675_1238 | 173 |
| 549 | 3300046536 | Ga0495587_0174471 | Ga0495587_0174471_460_1011 | 173 |
| 550 | 3300046538 | Ga0495609_0008303 | Ga0495609_0008303_1269_1823 | 173 |
| 551 | 3300046615 | Ga0495656_0075758 | Ga0495656_0075758_686_1237 | 173 |
| 552 | 3300046616 | Ga0495668_0021698 | Ga0495668_0021698_872_1423 | 173 |
| 553 | 3300046692 | Ga0495671_0077195 | Ga0495671_0077195_124_678 | 173 |
| 554 | 3300046694 | Ga0495649_0059791 | Ga0495649_0059791_551_1105 | 173 |
| 555 | 3300046694 | Ga0495649_0078012 | Ga0495649_0078012_1211_1762 | 173 |
| 556 | 3300046809 | Ga0495600_0524328 | Ga0495600_0524328_83_634 | 173 |
| 557 | 3300047317 | Ga0495604_0169591 | Ga0495604_0169591_914_1465 | 173 |
| 558 | 3300047320 | Ga0495672_0000285 | Ga0495672_0000285_1233_1787 | 173 |
| 559 | 3300047323 | Ga0495683_0055612 | Ga0495683_0055612_429_983 | 173 |
| 560 | 3300047445 | Ga0495677_0091042 | Ga0495677_0091042_125_679 | 173 |
| 561 | 3300048091 | Ga0495626_0000974 | Ga0495626_0000974_786_1340 | 173 |
| 562 | 3300048910 | Ga0496107_0163164 | Ga0496107_0163164_77_628 | 173 |
| 563 | 3300048914 | Ga0496111_0264928 | Ga0496111_0264928_15_566 | 173 |
| 564 | 3300048919 | Ga0496116_0016976 | Ga0496116_0016976_4067_4618 | 173 |
| 565 | 3300048927 | Ga0496124_0190102 | Ga0496124_0190102_622_1173 | 173 |
| 566 | 3300048927 | Ga0496124_0261593 | Ga0496124_0261593_540_1088 | 173 |
| 567 | 3300048928 | Ga0496125_0167339 | Ga0496125_0167339_604_1152 | 173 |
| 568 | 3300049459 | Ga0495678_000780 | Ga0495678_000780_21192_21746 | 173 |
| 569 | 3300053118 | Ga0500594_0048637 | Ga0500594_0048637_390_944 | 173 |
| 570 | 3300053125 | Ga0500618_001000 | Ga0500618_001000_13063_13617 | 173 |
| 571 | 3300038443 | Ga0395901_0002028 | Ga0395901_0002028_4869_5450 | 174 |
| 572 | 3300044706 | Ga0466964_0005209 | Ga0466964_0005209_192_761 | 174 |
| 573 | 3300046501 | Ga0495607_0011208 | Ga0495607_0011208_1289_1843 | 174 |
| 574 | 3300046507 | Ga0495606_0072842 | Ga0495606_0072842_689_1252 | 174 |
| 575 | 3300046513 | Ga0495616_0024971 | Ga0495616_0024971_2039_2593 | 174 |
| 576 | 3300046519 | Ga0495632_0008471 | Ga0495632_0008471_1325_1879 | 174 |
| 577 | 3300046522 | Ga0495643_0000983 | Ga0495643_0000983_8510_9064 | 174 |
| 578 | 3300046665 | Ga0495661_0012374 | Ga0495661_0012374_4862_5416 | 174 |
| 579 | 3300047323 | Ga0495683_0182017 | Ga0495683_0182017_183_737 | 174 |
| 580 | 3300047445 | Ga0495677_0004197 | Ga0495677_0004197_912_1466 | 174 |
| 581 | 3300048091 | Ga0495626_0007753 | Ga0495626_0007753_4380_4934 | 174 |
| 582 | 3300048903 | Ga0496100_0014602 | Ga0496100_0014602_3874_4452 | 174 |
| 583 | 3300048904 | Ga0496101_0133907 | Ga0496101_0133907_1153_1731 | 174 |
| 584 | 3300053161 | Ga0500634_0164240 | Ga0500634_0164240_479_1003 | 174 |
| 585 | 3300013102 | Ga0157371_10000064 | Ga0157371_1000006453 | 175 |
| 586 | 3300014497 | Ga0182008_10012348 | Ga0182008_100123484 | 175 |
| 587 | 3300015261 | Ga0182006_1137093 | Ga0182006_11370931 | 175 |
| 588 | 3300015262 | Ga0182007_10039625 | Ga0182007_100396252 | 175 |
| 589 | 3300015262 | Ga0182007_10047837 | Ga0182007_100478371 | 175 |
| 590 | 3300044656 | Ga0466969_0024922 | Ga0466969_0024922_1555_2124 | 175 |
| 591 | 3300044683 | Ga0466965_0047069 | Ga0466965_0047069_960_1529 | 175 |
| 592 | 3300044693 | Ga0466961_0286026 | Ga0466961_0286026_234_803 | 175 |
| 593 | 3300044719 | Ga0466971_0224141 | Ga0466971_0224141_58_627 | 175 |
| 594 | 3300045049 | Ga0466959_0082530 | Ga0466959_0082530_562_1131 | 175 |
| 595 | 3300046492 | Ga0495585_0097505 | Ga0495585_0097505_239_790 | 175 |
| 596 | 3300046500 | Ga0495596_0004154 | Ga0495596_0004154_1153_1707 | 175 |
| 597 | 3300046500 | Ga0495596_0017944 | Ga0495596_0017944_2001_2555 | 175 |
| 598 | 3300046500 | Ga0495596_0175637 | Ga0495596_0175637_67_618 | 175 |
| 599 | 3300046507 | Ga0495606_0003771 | Ga0495606_0003771_11900_12451 | 175 |
| 600 | 3300046507 | Ga0495606_0036377 | Ga0495606_0036377_2138_2692 | 175 |
| 601 | 3300046518 | Ga0495631_0014034 | Ga0495631_0014034_91_642 | 175 |
| 602 | 3300046528 | Ga0495642_0097643 | Ga0495642_0097643_108_659 | 175 |
| 603 | 3300046615 | Ga0495656_0497204 | Ga0495656_0497204_13_576 | 175 |
| 604 | 3300046648 | Ga0495611_0093887 | Ga0495611_0093887_709_1260 | 175 |
| 605 | 3300046660 | Ga0495625_0353390 | Ga0495625_0353390_167_721 | 175 |
| 606 | 3300046665 | Ga0495661_0037214 | Ga0495661_0037214_454_1017 | 175 |
| 607 | 3300046684 | Ga0495669_0258688 | Ga0495669_0258688_130_681 | 175 |
| 608 | 3300046691 | Ga0495670_0053351 | Ga0495670_0053351_127_678 | 175 |
| 609 | 3300046692 | Ga0495671_0007599 | Ga0495671_0007599_4630_5184 | 175 |
| 610 | 3300046692 | Ga0495671_0048958 | Ga0495671_0048958_298_849 | 175 |
| 611 | 3300046810 | Ga0495660_0184307 | Ga0495660_0184307_375_929 | 175 |
| 612 | 3300048917 | Ga0496114_0137840 | Ga0496114_0137840_1404_1979 | 175 |
| 613 | 3300048928 | Ga0496125_0035873 | Ga0496125_0035873_3589_4164 | 175 |
| 614 | 3300048929 | Ga0496126_0277185 | Ga0496126_0277185_116_691 | 175 |
| 615 | 3300049459 | Ga0495678_000175 | Ga0495678_000175_17892_18446 | 175 |
| 616 | 3300053098 | Ga0500650_0000107 | Ga0500650_0000107_15301_15828 | 175 |
| 617 | 3300059477 | Ga0587084_004887 | Ga0587084_004887_382_936 | 175 |
| 618 | 3300002737 | JGI25162J39368_1005347 | JGI25162J39368_10053472 | 176 |
| 619 | 3300005262 | Ga0065165_1000557 | Ga0065165_100055728 | 176 |
| 620 | 3300014497 | Ga0182008_10022337 | Ga0182008_100223373 | 176 |
| 621 | 3300015261 | Ga0182006_1003847 | Ga0182006_10038473 | 176 |
| 622 | 3300025233 | Ga0209437_100084 | Ga0209437_100084134 | 176 |
| 623 | 3300046473 | Ga0495582_0214083 | Ga0495582_0214083_219_770 | 176 |
| 624 | 3300046522 | Ga0495643_0106851 | Ga0495643_0106851_508_1062 | 176 |
| 625 | 3300046535 | Ga0495586_0042318 | Ga0495586_0042318_814_1365 | 176 |
| 626 | 3300046615 | Ga0495656_0069076 | Ga0495656_0069076_708_1271 | 176 |
| 627 | 3300046694 | Ga0495649_0073599 | Ga0495649_0073599_160_714 | 176 |
| 628 | 3300047315 | Ga0495581_0065186 | Ga0495581_0065186_1142_1693 | 176 |
| 629 | 3300047444 | Ga0495675_0102882 | Ga0495675_0102882_758_1309 | 176 |
| 630 | 3300047673 | Ga0495593_0021382 | Ga0495593_0021382_2324_2875 | 176 |
| 631 | 3300048089 | Ga0495614_0024164 | Ga0495614_0024164_724_1275 | 176 |
| 632 | 3300013306 | Ga0163162_10090756 | Ga0163162_100907562 | 177 |
| 633 | 3300031911 | Ga0307412_10912337 | Ga0307412_109123372 | 177 |
| 634 | 3300046453 | Ga0495627_004698 | Ga0495627_004698_5078_5632 | 177 |
| 635 | 3300046491 | Ga0495584_0018616 | Ga0495584_0018616_1129_1698 | 177 |
| 636 | 3300046492 | Ga0495585_0007941 | Ga0495585_0007941_4600_5151 | 177 |
| 637 | 3300046518 | Ga0495631_0022012 | Ga0495631_0022012_2388_2942 | 177 |
| 638 | 3300046528 | Ga0495642_0036277 | Ga0495642_0036277_1246_1815 | 177 |
| 639 | 3300046558 | Ga0495633_0022770 | Ga0495633_0022770_1153_1704 | 177 |
| 640 | 3300046558 | Ga0495633_0040898 | Ga0495633_0040898_1161_1715 | 177 |
| 641 | 3300046665 | Ga0495661_0071706 | Ga0495661_0071706_498_1049 | 177 |
| 642 | 3300046689 | Ga0495613_0021937 | Ga0495613_0021937_916_1485 | 177 |
| 643 | 3300046691 | Ga0495670_0056475 | Ga0495670_0056475_810_1364 | 177 |
| 644 | 3300046691 | Ga0495670_0160614 | Ga0495670_0160614_102_653 | 177 |
| 645 | 3300046692 | Ga0495671_0014178 | Ga0495671_0014178_1223_1777 | 177 |
| 646 | 3300047443 | Ga0495687_010203 | Ga0495687_010203_722_1276 | 177 |
| 647 | 3300047470 | Ga0495681_0005423 | Ga0495681_0005423_2501_3055 | 177 |
| 648 | 3300048091 | Ga0495626_0023256 | Ga0495626_0023256_2343_2897 | 177 |
| 649 | 3300048924 | Ga0496121_0544422 | Ga0496121_0544422_39_614 | 177 |
| 650 | iso_pu_bacteria | 2842711865 | 2842714022 | 177 |
| 651 | 3300005563 | Ga0068855_100002941 | Ga0068855_10000294113 | 178 |
| 652 | 3300005614 | Ga0068856_100196880 | Ga0068856_1001968803 | 178 |
| 653 | 3300005834 | Ga0068851_10118595 | Ga0068851_101185953 | 178 |
| 654 | 3300025949 | Ga0207667_10000019 | Ga0207667_10000019181 | 178 |
| 655 | 3300026078 | Ga0207702_10314059 | Ga0207702_103140592 | 178 |
| 656 | 3300046492 | Ga0495585_0017446 | Ga0495585_0017446_432_998 | 178 |
| 657 | 3300046506 | Ga0495583_0044743 | Ga0495583_0044743_881_1447 | 178 |
| 658 | 3300046522 | Ga0495643_0253848 | Ga0495643_0253848_95_661 | 178 |
| 659 | 3300046524 | Ga0495648_0019268 | Ga0495648_0019268_816_1382 | 178 |
| 660 | 3300046538 | Ga0495609_0017904 | Ga0495609_0017904_2508_3074 | 178 |
| 661 | 3300046660 | Ga0495625_0087883 | Ga0495625_0087883_1057_1623 | 178 |
| 662 | 3300046665 | Ga0495661_0044067 | Ga0495661_0044067_1265_1831 | 178 |
| 663 | 3300047443 | Ga0495687_000060 | Ga0495687_000060_110757_111323 | 178 |
| 664 | 3300047445 | Ga0495677_0036290 | Ga0495677_0036290_599_1165 | 178 |
| 665 | 3300048905 | Ga0496102_0000279 | Ga0496102_0000279_1283_1849 | 178 |
| 666 | 3300048906 | Ga0496103_0001678 | Ga0496103_0001678_2502_3068 | 178 |
| 667 | 3300037471 | Ga0395905_0072918 | Ga0395905_0072918_685_1251 | 179 |
| 668 | 3300047315 | Ga0495581_0007750 | Ga0495581_0007750_270_839 | 179 |
| 669 | iso_pu_bacteria | 2600255292 | 2601666747 | 179 |
| 670 | iso_pu_bacteria | 2643221645 | 2644249236 | 179 |
| 671 | iso_pu_bacteria | 2857547612 | 2857548513 | 179 |
| 672 | iso_pu_bacteria | 2857564685 | 2857566349 | 179 |
| 673 | iso_pu_bacteria | 2885080285 | 2885083693 | 179 |
| 674 | iso_pu_bacteria | 2932410948 | 2932413108 | 179 |
| 675 | iso_pu_bacteria | 2932416698 | 2932420623 | 179 |
| 676 | 3300005563 | Ga0068855_100113778 | Ga0068855_1001137782 | 180 |
| 677 | 3300005616 | Ga0068852_100105451 | Ga0068852_1001054512 | 180 |
| 678 | 3300009093 | Ga0105240_10007797 | Ga0105240_1000779717 | 180 |
| 679 | 3300013307 | Ga0157372_11872767 | Ga0157372_118727671 | 180 |
| 680 | 3300025913 | Ga0207695_10001902 | Ga0207695_1000190214 | 180 |
| 681 | 3300025913 | Ga0207695_10032133 | Ga0207695_100321333 | 180 |
| 682 | 3300025925 | Ga0207650_10071357 | Ga0207650_100713572 | 180 |
| 683 | 3300025949 | Ga0207667_10287065 | Ga0207667_102870653 | 180 |
| 684 | 3300026116 | Ga0207674_10193579 | Ga0207674_101935792 | 180 |
| 685 | 3300026142 | Ga0207698_10002422 | Ga0207698_1000242210 | 180 |
| 686 | 3300048905 | Ga0496102_0065912 | Ga0496102_0065912_1069_1620 | 180 |
| 687 | 3300048924 | Ga0496121_0018662 | Ga0496121_0018662_1244_1825 | 180 |
| 688 | iso_pu_bacteria | 2643221603 | 2644027961 | 180 |
| 689 | iso_pu_bacteria | 2738541280 | 2738740665 | 180 |
| 690 | iso_pu_bacteria | 2738541297 | 2738825951 | 180 |
| 691 | iso_pu_bacteria | 2738541300 | 2738844986 | 180 |
| 692 | iso_pu_bacteria | 2738541357 | 2739149748 | 180 |
| 693 | iso_pu_bacteria | 2738543003 | 2739191667 | 180 |
| 694 | iso_pu_bacteria | 2738543018 | 2739277401 | 180 |
| 695 | iso_pu_bacteria | 2738543026 | 2739318144 | 180 |
| 696 | iso_pu_bacteria | 2738543029 | 2739336385 | 180 |
| 697 | iso_pu_bacteria | 2738543030 | 2739346444 | 180 |
| 698 | iso_pu_bacteria | 2821131069 | 2821135594 | 180 |
| 699 | iso_pu_bacteria | 2857558681 | 2857562487 | 180 |
| 700 | iso_pu_bacteria | 2904424332 | 2904430742 | 180 |
| 701 | 3300021361 | Ga0213872_10142017 | Ga0213872_101420171 | 181 |
| 702 | 3300039447 | Ga0436361_1087377 | Ga0436361_1087377_1741_2295 | 181 |
| 703 | 3300005331 | Ga0070670_100000002 | Ga0070670_100000002533 | 182 |
| 704 | 3300005353 | Ga0070669_100005576 | Ga0070669_10000557610 | 182 |
| 705 | 3300005365 | Ga0070688_100004285 | Ga0070688_1000042857 | 182 |
| 706 | 3300005367 | Ga0070667_100000394 | Ga0070667_1000003948 | 182 |
| 707 | 3300005466 | Ga0070685_10000005 | Ga0070685_1000000599 | 182 |
| 708 | 3300005617 | Ga0068859_100041050 | Ga0068859_1000410504 | 182 |
| 709 | 3300005618 | Ga0068864_100000003 | Ga0068864_100000003546 | 182 |
| 710 | 3300005843 | Ga0068860_100000326 | Ga0068860_10000032631 | 182 |
| 711 | 3300006931 | Ga0097620_100041051 | Ga0097620_1000410514 | 182 |
| 712 | 3300014325 | Ga0163163_10000136 | Ga0163163_1000013614 | 182 |
| 713 | 3300014968 | Ga0157379_10845278 | Ga0157379_108452782 | 182 |
| 714 | 3300025923 | Ga0207681_10000156 | Ga0207681_1000015640 | 182 |
| 715 | 3300025925 | Ga0207650_10000003 | Ga0207650_100000031080 | 182 |
| 716 | 3300025986 | Ga0207658_10000004 | Ga0207658_10000004527 | 182 |
| 717 | 3300026035 | Ga0207703_10607025 | Ga0207703_106070252 | 182 |
| 718 | 3300026088 | Ga0207641_10190748 | Ga0207641_101907483 | 182 |
| 719 | 3300026088 | Ga0207641_10661571 | Ga0207641_106615712 | 182 |
| 720 | 3300026095 | Ga0207676_10000003 | Ga0207676_1000000314 | 182 |
| 721 | 3300028381 | Ga0268264_10000123 | Ga0268264_1000012383 | 182 |
| 722 | 3300037471 | Ga0395905_0000589 | Ga0395905_0000589_34361_34924 | 182 |
| 723 | 3300046453 | Ga0495627_005183 | Ga0495627_005183_4222_4773 | 182 |
| 724 | 3300046460 | Ga0495638_0036578 | Ga0495638_0036578_1184_1735 | 182 |
| 725 | 3300046491 | Ga0495584_0021044 | Ga0495584_0021044_1425_1976 | 182 |
| 726 | 3300046507 | Ga0495606_0259831 | Ga0495606_0259831_318_869 | 182 |
| 727 | 3300046513 | Ga0495616_0106310 | Ga0495616_0106310_499_1050 | 182 |
| 728 | 3300046518 | Ga0495631_0020566 | Ga0495631_0020566_1665_2216 | 182 |
| 729 | 3300046520 | Ga0495637_0051276 | Ga0495637_0051276_1035_1601 | 182 |
| 730 | 3300046523 | Ga0495644_0014817 | Ga0495644_0014817_2343_2897 | 182 |
| 731 | 3300046523 | Ga0495644_0029509 | Ga0495644_0029509_1338_1889 | 182 |
| 732 | 3300046525 | Ga0495663_0104318 | Ga0495663_0104318_205_756 | 182 |
| 733 | 3300046528 | Ga0495642_0022230 | Ga0495642_0022230_653_1204 | 182 |
| 734 | 3300046530 | Ga0495654_0166524 | Ga0495654_0166524_297_863 | 182 |
| 735 | 3300046542 | Ga0495597_0050362 | Ga0495597_0050362_683_1234 | 182 |
| 736 | 3300046558 | Ga0495633_0034395 | Ga0495633_0034395_429_980 | 182 |
| 737 | 3300046615 | Ga0495656_0001209 | Ga0495656_0001209_6381_6932 | 182 |
| 738 | 3300046616 | Ga0495668_0048141 | Ga0495668_0048141_1302_1853 | 182 |
| 739 | 3300046616 | Ga0495668_0344287 | Ga0495668_0344287_217_771 | 182 |
| 740 | 3300046648 | Ga0495611_0096401 | Ga0495611_0096401_685_1236 | 182 |
| 741 | 3300046660 | Ga0495625_0463312 | Ga0495625_0463312_211_762 | 182 |
| 742 | 3300046665 | Ga0495661_0194571 | Ga0495661_0194571_56_607 | 182 |
| 743 | 3300046691 | Ga0495670_0087202 | Ga0495670_0087202_549_1100 | 182 |
| 744 | 3300046794 | Ga0495589_0027732 | Ga0495589_0027732_981_1532 | 182 |
| 745 | 3300047318 | Ga0495636_0207537 | Ga0495636_0207537_198_749 | 182 |
| 746 | 3300047445 | Ga0495677_0003569 | Ga0495677_0003569_4515_5066 | 182 |
| 747 | 3300047470 | Ga0495681_0039116 | Ga0495681_0039116_429_980 | 182 |
| 748 | 3300048091 | Ga0495626_0001091 | Ga0495626_0001091_7645_8211 | 182 |
| 749 | iso_pu_bacteria | 2818991436 | 2819543071 | 182 |
| 750 | 3300003316 | rootH1_10018115 | rootH1_100181154 | 183 |
| 751 | 3300003322 | rootL2_10025871 | rootL2_100258712 | 183 |
| 752 | 3300045049 | Ga0466959_0147587 | Ga0466959_0147587_533_1099 | 183 |
| 753 | 3300046501 | Ga0495607_0039793 | Ga0495607_0039793_2099_2653 | 183 |
| 754 | 3300047472 | Ga0495686_0001600 | Ga0495686_0001600_20257_20811 | 183 |
| 755 | 3300059477 | Ga0587084_010006 | Ga0587084_010006_619_1170 | 183 |
| 756 | 3300059478 | Ga0587093_004214 | Ga0587093_004214_666_1217 | 183 |
| 757 | 3300059513 | Ga0587094_004612 | Ga0587094_004612_386_937 | 183 |
| 758 | 3300060344 | Ga0587071_009863 | Ga0587071_009863_453_1004 | 183 |
| 759 | iso_pu_bacteria | 2521172590 | 2521556704 | 183 |
| 760 | iso_pu_bacteria | 2551306416 | 2553006704 | 183 |
| 761 | iso_pu_bacteria | 2919046199 | 2919049474 | 183 |
| 762 | iso_pu_bacteria | 2923510766 | 2923515296 | 183 |
| 763 | iso_pu_bacteria | 2928130867 | 2928132254 | 183 |
| 764 | 3300028800 | Ga0265338_10000251 | Ga0265338_1000025144 | 184 |
| 765 | 3300031238 | Ga0265332_10140284 | Ga0265332_101402842 | 184 |
| 766 | 3300047470 | Ga0495681_0127366 | Ga0495681_0127366_189_743 | 184 |
| 767 | iso_pu_bacteria | 2765235838 | 2765567885 | 184 |
| 768 | iso_pu_bacteria | 2839094727 | 2839097828 | 184 |
| 769 | 3300046462 | Ga0495651_0154334 | Ga0495651_0154334_20_589 | 185 |
| 770 | 3300046516 | Ga0495628_0006086 | Ga0495628_0006086_8053_8622 | 185 |
| 771 | 3300046529 | Ga0495652_0060251 | Ga0495652_0060251_983_1552 | 185 |
| 772 | 3300046660 | Ga0495625_0004513 | Ga0495625_0004513_10786_11343 | 185 |
| 773 | 3300046679 | Ga0495623_0273114 | Ga0495623_0273114_44_613 | 185 |
| 774 | 3300048088 | Ga0495602_0345020 | Ga0495602_0345020_235_804 | 185 |
| 775 | 3300053077 | Ga0495601_0316794 | Ga0495601_0316794_231_800 | 185 |
| 776 | iso_pu_bacteria | 2818991449 | 2819618069 | 185 |
| 777 | iso_pu_bacteria | 2904439833 | 2904441913 | 185 |
| 778 | iso_pu_bacteria | 2904530477 | 2904533211 | 185 |
| 779 | iso_pu_bacteria | 2904584206 | 2904586158 | 185 |
| 780 | iso_pu_bacteria | 2904589729 | 2904592028 | 185 |
| 781 | iso_pu_bacteria | 2904601388 | 2904601810 | 185 |
| 782 | iso_pu_bacteria | 2919079590 | 2919083863 | 185 |
| 783 | 3300002737 | JGI25162J39368_1000025 | JGI25162J39368_100002563 | 186 |
| 784 | 3300003214 | JGI25165J46597_1000054 | JGI25165J46597_100005463 | 186 |
| 785 | 3300003751 | Ga0055538_1000026 | Ga0055538_1000026163 | 186 |
| 786 | 3300003752 | Ga0055539_1000033 | Ga0055539_1000033163 | 186 |
| 787 | 3300003756 | Ga0055533_1000044 | Ga0055533_1000044163 | 186 |
| 788 | 3300003759 | Ga0055525_1000052 | Ga0055525_1000052162 | 186 |
| 789 | 3300003841 | Ga0055541_1000069 | Ga0055541_100006925 | 186 |
| 790 | 3300015261 | Ga0182006_1019017 | Ga0182006_10190173 | 186 |
| 791 | 3300015262 | Ga0182007_10005022 | Ga0182007_100050225 | 186 |
| 792 | 3300015265 | Ga0182005_1000140 | Ga0182005_100014013 | 186 |
| 793 | 3300021361 | Ga0213872_10001180 | Ga0213872_100011803 | 186 |
| 794 | 3300025224 | Ga0209784_100020 | Ga0209784_100020129 | 186 |
| 795 | 3300025225 | Ga0209566_100020 | Ga0209566_100020129 | 186 |
| 796 | 3300025226 | Ga0209674_100035 | Ga0209674_100035129 | 186 |
| 797 | 3300025230 | Ga0209563_100038 | Ga0209563_100038129 | 186 |
| 798 | 3300025231 | Ga0207427_100803 | Ga0207427_1008037 | 186 |
| 799 | 3300025233 | Ga0209437_100066 | Ga0209437_100066252 | 186 |
| 800 | 3300025253 | Ga0209677_100031 | Ga0209677_10003169 | 186 |
| 801 | 3300025261 | Ga0209233_1000060 | Ga0209233_1000060129 | 186 |
| 802 | 3300037312 | Ga0395899_0006725 | Ga0395899_0006725_2957_3529 | 186 |
| 803 | 3300037418 | Ga0395900_0004176 | Ga0395900_0004176_5335_5907 | 186 |
| 804 | 3300037471 | Ga0395905_0010271 | Ga0395905_0010271_6414_6986 | 186 |
| 805 | 3300039447 | Ga0436361_0239425 | Ga0436361_0239425_23238_23804 | 186 |
| 806 | 3300046454 | Ga0495592_0086444 | Ga0495592_0086444_1063_1635 | 186 |
| 807 | 3300046463 | Ga0495653_0041862 | Ga0495653_0041862_2270_2842 | 186 |
| 808 | 3300046471 | Ga0495650_0000051 | Ga0495650_0000051_143717_144283 | 186 |
| 809 | 3300046511 | Ga0495608_0011730 | Ga0495608_0011730_3422_3994 | 186 |
| 810 | 3300046514 | Ga0495618_0043922 | Ga0495618_0043922_541_1113 | 186 |
| 811 | 3300046516 | Ga0495628_0013454 | Ga0495628_0013454_5028_5600 | 186 |
| 812 | 3300046529 | Ga0495652_0089342 | Ga0495652_0089342_1601_2173 | 186 |
| 813 | 3300046529 | Ga0495652_0127906 | Ga0495652_0127906_120_692 | 186 |
| 814 | 3300046543 | Ga0495645_0231595 | Ga0495645_0231595_118_690 | 186 |
| 815 | 3300046557 | Ga0495622_0067145 | Ga0495622_0067145_20_592 | 186 |
| 816 | 3300046642 | Ga0495634_0337122 | Ga0495634_0337122_98_670 | 186 |
| 817 | 3300046675 | Ga0495657_0064926 | Ga0495657_0064926_1309_1881 | 186 |
| 818 | 3300046678 | Ga0495599_0027691 | Ga0495599_0027691_2249_2821 | 186 |
| 819 | 3300046680 | Ga0495646_0020393 | Ga0495646_0020393_1642_2214 | 186 |
| 820 | 3300046809 | Ga0495600_0011825 | Ga0495600_0011825_873_1445 | 186 |
| 821 | 3300047317 | Ga0495604_0025743 | Ga0495604_0025743_1217_1789 | 186 |
| 822 | 3300048088 | Ga0495602_0166569 | Ga0495602_0166569_604_1176 | 186 |
| 823 | 3300053077 | Ga0495601_0006228 | Ga0495601_0006228_5547_6119 | 186 |
| 824 | 3300053119 | Ga0500595_001191 | Ga0500595_001191_2561_3133 | 186 |
| 825 | 3300053141 | Ga0500574_001023 | Ga0500574_001023_2306_2878 | 186 |
| 826 | iso_pu_bacteria | 2511231026 | 2511387194 | 186 |
| 827 | 3300039447 | Ga0436361_0370552 | Ga0436361_0370552_251_814 | 187 |
| 828 | 3300003323 | rootH1_10041734 | rootH1_100417344 | 188 |
| 829 | iso_pu_bacteria | 2808606386 | 2808982747 | 188 |
| 830 | iso_pu_bacteria | 2808606415 | 2809130249 | 188 |
| 831 | iso_pu_bacteria | 2808606419 | 2809150274 | 188 |
| 832 | iso_pu_bacteria | 2852618963 | 2852621503 | 188 |
| 833 | 3300049571 | Ga0501034_0144066 | Ga0501034_0144066_1629_2219 | 189 |
| 834 | iso_pu_bacteria | 2511231003 | 2511249160 | 189 |
| 835 | 3300006175 | Ga0070712_100003941 | Ga0070712_1000039414 | 190 |
| 836 | 3300006946 | Ga0079104_1003938 | Ga0079104_10039384 | 190 |
| 837 | 3300053125 | Ga0500618_000954 | Ga0500618_000954_1260_1832 | 190 |
| 838 | 3300025228 | Ga0209672_110782 | Ga0209672_1107822 | 191 |
| 839 | 3300046529 | Ga0495652_0014252 | Ga0495652_0014252_2725_3312 | 191 |
| 840 | 3300046543 | Ga0495645_0026559 | Ga0495645_0026559_2561_3148 | 191 |
| 841 | 3300046680 | Ga0495646_0041520 | Ga0495646_0041520_1146_1733 | 191 |
| 842 | 3300046690 | Ga0495624_0177809 | Ga0495624_0177809_95_682 | 191 |
| 843 | 3300053125 | Ga0500618_001616 | Ga0500618_001616_7842_8438 | 191 |
| 844 | iso_pu_bacteria | 2548876994 | 2550692417 | 191 |
| 845 | iso_pu_bacteria | 2818991445 | 2819592561 | 191 |
| 846 | iso_pu_bacteria | 2884811622 | 2884812348 | 191 |
| 847 | iso_pu_bacteria | 2884836552 | 2884838950 | 191 |
| 848 | iso_pu_bacteria | 2884852848 | 2884855242 | 191 |
| 849 | iso_pu_bacteria | 2896154374 | 2896156089 | 191 |
| 850 | 3300002704 | JGI25155J39150_1000219 | JGI25155J39150_100021918 | 193 |
| 851 | 3300002705 | JGI25156J39149_1003054 | JGI25156J39149_10030544 | 193 |
| 852 | 3300002738 | JGI25154J39366_1000432 | JGI25154J39366_100043212 | 193 |
| 853 | 3300025206 | Ga0209435_100214 | Ga0209435_10021411 | 193 |
| 854 | 3300025246 | Ga0209646_1000283 | Ga0209646_100028336 | 193 |
| 855 | 3300025250 | Ga0209026_1001071 | Ga0209026_100107112 | 193 |
| 856 | 3300025256 | Ga0209759_1000548 | Ga0209759_100054812 | 193 |
| 857 | 3300002704 | JGI25155J39150_1000142 | JGI25155J39150_100014218 | 195 |
| 858 | 3300002705 | JGI25156J39149_1000497 | JGI25156J39149_100049713 | 195 |
| 859 | 3300002738 | JGI25154J39366_1000423 | JGI25154J39366_100042318 | 195 |
| 860 | 3300002741 | JGI25157J39369_1000158 | JGI25157J39369_100015813 | 195 |
| 861 | 3300002741 | JGI25157J39369_1000203 | JGI25157J39369_100020328 | 195 |
| 862 | 3300003758 | Ga0055532_1000005 | Ga0055532_1000005141 | 195 |
| 863 | 3300003761 | Ga0055535_1024759 | Ga0055535_10247591 | 195 |
| 864 | 3300014497 | Ga0182008_10290110 | Ga0182008_102901102 | 195 |
| 865 | 3300025206 | Ga0209435_100004 | Ga0209435_100004194 | 195 |
| 866 | 3300025229 | Ga0209147_100011 | Ga0209147_100011292 | 195 |
| 867 | 3300025242 | Ga0209258_100560 | Ga0209258_10056021 | 195 |
| 868 | 3300025246 | Ga0209646_1000032 | Ga0209646_1000032168 | 195 |
| 869 | 3300025250 | Ga0209026_1000062 | Ga0209026_100006228 | 195 |
| 870 | 3300025256 | Ga0209759_1000054 | Ga0209759_100005413 | 195 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ixh-assembly1.cif.gz_A | crystal structure of burkholderia cenocepacia bcna | 0.9606 | 32 | 194 |
| 5ixh-assembly1.cif.gz_A | crystal structure of burkholderia cenocepacia bcna | 0.9548 | 32 | 194 |
| 7bwl-assembly1.cif.gz_A | structure of antibiotic sequester from pseudomonas aerurinosa | 0.8755 | 29 | 193 |
| 1y0g-assembly2.cif.gz_D | crystal structure of the escherichia coli ycei protein, structural genomics | 0.8711 | 29 | 195 |
| 3hpe-assembly1.cif.gz_B | crystal structure of ycei (hp1286) from helicobacter pylori | 0.8566 | 30 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8737 | 29 | 195 | 2.40.128.110 |
| af_Q2FUS9_3_167_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8603 | 32 | 192 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8591 | 29 | 195 | 2.40.128.110 |
| 3hpeB00 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8566 | 30 | 193 | 2.40.128.110 |
| 5w2dA01 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.839 | 51 | 195 | 2.40.128.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4T0UWZ2-F1-model_v4 | YceI family protein | 0.936 | 49 | 195 |
|
| AF-A0A1M7K1K0-F1-model_v4 | Polyisoprenoid-binding protein YceI | 0.9359 | 30 | 194 |
|
| AF-A0A0H2M9W2-F1-model_v4 | Lipid/polyisoprenoid-binding YceI-like domain-containing protein | 0.9356 | 22 | 194 |
|
| AF-A0A7Y6YXP6-F1-model_v4 | YceI family protein | 0.9348 | 23 | 193 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A1E8FJS6-F1-model_v4 | Lipid/polyisoprenoid-binding YceI-like domain-containing protein | 0.9316 | 75 | 192 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar