F484121
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 869 | 377 | 1738 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300025929|Ga0207664_10103929|Ga0207664_101039293 |
| Length | 371 |
| Sequence | MKRGLFLFPSPLWGGNRDGGGKVKSRASSPQHFSATPFPTLPHKGGGKRICRRSLLTALAGAALIRPRQARAQANWPTRPVRVMVPYPPAGGADTTARIVYARVSETLGQQFAIENRGGAGGTIGEEAVAKSAPDGYTILHDATAFSVNGSLYSNLPFDYRKDFDPVFLVALVPNILVVTPSVPANTVADVIALAKATPGGIDMASSGNGTLQHLLLELFRQRTGITINHVPYRGGGLALTDVMAGQVKFFFANGSSAVGLIKGGKVKAIAHTGKGRLASLPDIPPLSDTLPGFEGYDWNGVFVPHGTPGPIVKKLNAALNAAIVAPQVTARFTELNIESRQNSPQEFRAYVEDQMALWSRVVKEANIKLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 139 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 219 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 227 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 229 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 230 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 231 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 251 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 258 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 262 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 263 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 264 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 267 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 268 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 275 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 339 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 343 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 344 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 347 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 348 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 349 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 350 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 351 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 352 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 353 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 354 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 355 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 375 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 376 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 377 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.23 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.46 |
| Nodule | 0 |
| Rhizoplane | 6.67 |
| Rhizosphere | 91.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207664_10103929 | 3300025929 | Bacteria | 2351 |
| 2 | 2214884080 | 2209111006 | Bacteria | 7769 |
| 3 | ARSoilYngRDRAFT_c00087 | 3300000042 | Bacteria | 15429 |
| 4 | ARSoilYngRDRAFT_c00489 | 3300000042 | Bacteria | 4689 |
| 5 | ARcpr5yngRDRAFT_c000053 | 3300000043 | Bacteria | 18314 |
| 6 | ARSoilOldRDRAFT_c000064 | 3300000044 | Bacteria | 21027 |
| 7 | ARCol0oldRDRAFT_c00196 | 3300000045 | Bacteria | 5558 |
| 8 | ARCol0yngRDRAFT_1000047 | 3300000652 | Bacteria | 21004 |
| 9 | JGI24746J21847_1000312 | 3300001977 | Bacteria | 6997 |
| 10 | JGI24739J22299_10000985 | 3300001989 | Bacteria | 10619 |
| 11 | JGI24737J22298_10001495 | 3300001990 | Bacteria | 8328 |
| 12 | JGI24750J21931_1000203 | 3300002070 | Bacteria | 10051 |
| 13 | JGI24745J21846_1000249 | 3300002073 | Bacteria | 4490 |
| 14 | JGI24748J21848_1000789 | 3300002074 | Bacteria | 3426 |
| 15 | JGI24738J21930_10001441 | 3300002075 | Bacteria | 6608 |
| 16 | JGI24035J26624_1000103 | 3300002126 | Bacteria | 7219 |
| 17 | rootH1_10120293 | 3300003323 | Bacteria | 2746 |
| 18 | JGI25405J52794_10015249 | 3300003911 | Bacteria | 1508 |
| 19 | Ga0065704_10080382 | 3300005289 | Bacteria | 3939 |
| 20 | Ga0065712_10017123 | 3300005290 | Bacteria | 2004 |
| 21 | Ga0065712_10134843 | 3300005290 | Bacteria | 1503 |
| 22 | Ga0065712_10146592 | 3300005290 | Bacteria | 1397 |
| 23 | Ga0065715_10090502 | 3300005293 | Bacteria | 6878 |
| 24 | Ga0070676_10001056 | 3300005328 | Bacteria | 13713 |
| 25 | Ga0070683_100003491 | 3300005329 | Bacteria | 12781 |
| 26 | Ga0070690_100008492 | 3300005330 | Bacteria | 5919 |
| 27 | Ga0070670_100007890 | 3300005331 | Bacteria | 9055 |
| 28 | Ga0070670_100196981 | 3300005331 | Bacteria | 1750 |
| 29 | Ga0070670_100288925 | 3300005331 | Bacteria | 1433 |
| 30 | Ga0070677_10000206 | 3300005333 | Bacteria | 20279 |
| 31 | Ga0068869_100012026 | 3300005334 | Bacteria | 5700 |
| 32 | Ga0068869_100375119 | 3300005334 | Bacteria | 1165 |
| 33 | Ga0070666_10005855 | 3300005335 | Bacteria | 7552 |
| 34 | Ga0070666_10007454 | 3300005335 | Bacteria | 6746 |
| 35 | Ga0070680_100014216 | 3300005336 | Bacteria | 6216 |
| 36 | Ga0070680_100031681 | 3300005336 | Bacteria | 4252 |
| 37 | Ga0070682_100001749 | 3300005337 | Bacteria | 12085 |
| 38 | Ga0068868_100019471 | 3300005338 | Bacteria | 5086 |
| 39 | Ga0070660_100002617 | 3300005339 | Bacteria | 12364 |
| 40 | Ga0070689_100006306 | 3300005340 | Bacteria | 8192 |
| 41 | Ga0070689_100045727 | 3300005340 | Bacteria | 3371 |
| 42 | Ga0070691_10004394 | 3300005341 | Bacteria | 6405 |
| 43 | Ga0070687_100005432 | 3300005343 | Bacteria | 5159 |
| 44 | Ga0070687_100089785 | 3300005343 | Bacteria | 1697 |
| 45 | Ga0070687_100138053 | 3300005343 | Bacteria | 1416 |
| 46 | Ga0070661_100006928 | 3300005344 | Bacteria | 7823 |
| 47 | Ga0070692_10002854 | 3300005345 | Bacteria | 6843 |
| 48 | Ga0070692_10079654 | 3300005345 | Bacteria | 1762 |
| 49 | Ga0070668_100000882 | 3300005347 | Bacteria | 20845 |
| 50 | Ga0070669_100002256 | 3300005353 | Bacteria | 13985 |
| 51 | Ga0070675_100001384 | 3300005354 | Bacteria | 17776 |
| 52 | Ga0070675_100126887 | 3300005354 | Bacteria | 2171 |
| 53 | Ga0070671_100001328 | 3300005355 | Bacteria | 18586 |
| 54 | Ga0070671_100038217 | 3300005355 | Bacteria | 3984 |
| 55 | Ga0070671_100081005 | 3300005355 | Unclassified | 2714 |
| 56 | Ga0070674_100002239 | 3300005356 | Bacteria | 10647 |
| 57 | Ga0070674_100023992 | 3300005356 | Bacteria | 3956 |
| 58 | Ga0070674_100027750 | 3300005356 | Bacteria | 3712 |
| 59 | Ga0070674_100051249 | 3300005356 | Bacteria | 2844 |
| 60 | Ga0070673_100002806 | 3300005364 | Bacteria | 10711 |
| 61 | Ga0070673_100005819 | 3300005364 | Bacteria | 7943 |
| 62 | Ga0070688_100007431 | 3300005365 | Bacteria | 5907 |
| 63 | Ga0070688_100012208 | 3300005365 | Bacteria | 4807 |
| 64 | Ga0070688_100022305 | 3300005365 | Bacteria | 3707 |
| 65 | Ga0070688_100064310 | 3300005365 | Bacteria | 2328 |
| 66 | Ga0070659_100007170 | 3300005366 | Bacteria | 8089 |
| 67 | Ga0070659_100103368 | 3300005366 | Unclassified | 2294 |
| 68 | Ga0070667_100003216 | 3300005367 | Bacteria | 13985 |
| 69 | Ga0070703_10006414 | 3300005406 | Bacteria | 3298 |
| 70 | Ga0070714_100034654 | 3300005435 | Bacteria | 4228 |
| 71 | Ga0070714_100154904 | 3300005435 | Bacteria | 2068 |
| 72 | Ga0070713_100045738 | 3300005436 | Bacteria | 3588 |
| 73 | Ga0070713_100131207 | 3300005436 | Bacteria | 2210 |
| 74 | Ga0070713_100302116 | 3300005436 | Bacteria | 1473 |
| 75 | Ga0070710_10021309 | 3300005437 | Bacteria | 3375 |
| 76 | Ga0070710_10089656 | 3300005437 | Bacteria | 1812 |
| 77 | Ga0070701_10007610 | 3300005438 | Bacteria | 4639 |
| 78 | Ga0070701_10093006 | 3300005438 | Unclassified | 1656 |
| 79 | Ga0070711_100058095 | 3300005439 | Bacteria | 2681 |
| 80 | Ga0070711_100087855 | 3300005439 | Bacteria | 2233 |
| 81 | Ga0070711_100129259 | 3300005439 | Bacteria | 1879 |
| 82 | Ga0070711_100228874 | 3300005439 | Bacteria | 1449 |
| 83 | Ga0070711_100239739 | 3300005439 | Bacteria | 1417 |
| 84 | Ga0070705_100012725 | 3300005440 | Bacteria | 4285 |
| 85 | Ga0070700_100000556 | 3300005441 | Bacteria | 18754 |
| 86 | Ga0070700_100198484 | 3300005441 | Bacteria | 1408 |
| 87 | Ga0070694_100001349 | 3300005444 | Bacteria | 14317 |
| 88 | Ga0070694_100216223 | 3300005444 | Bacteria | 1436 |
| 89 | Ga0070708_100026811 | 3300005445 | Bacteria | 4936 |
| 90 | Ga0070708_100321334 | 3300005445 | Bacteria | 1458 |
| 91 | Ga0070663_100006533 | 3300005455 | Bacteria | 7022 |
| 92 | Ga0070663_100010686 | 3300005455 | Bacteria | 5728 |
| 93 | Ga0070663_100040889 | 3300005455 | Bacteria | 3248 |
| 94 | Ga0070663_100086354 | 3300005455 | Bacteria | 2317 |
| 95 | Ga0070663_100128263 | 3300005455 | Unclassified | 1923 |
| 96 | Ga0070678_100028145 | 3300005456 | Bacteria | 3828 |
| 97 | Ga0070678_100055277 | 3300005456 | Bacteria | 2897 |
| 98 | Ga0070678_100171754 | 3300005456 | Bacteria | 1766 |
| 99 | Ga0070662_100006933 | 3300005457 | Bacteria | 7336 |
| 100 | Ga0070662_100168810 | 3300005457 | Bacteria | 1717 |
| 101 | Ga0070681_10013387 | 3300005458 | Bacteria | 8150 |
| 102 | Ga0070681_10048783 | 3300005458 | Bacteria | 4229 |
| 103 | Ga0070681_10075267 | 3300005458 | Bacteria | 3336 |
| 104 | Ga0068867_100002573 | 3300005459 | Bacteria | 12785 |
| 105 | Ga0068867_100091628 | 3300005459 | Bacteria | 2308 |
| 106 | Ga0068867_100287083 | 3300005459 | Bacteria | 1351 |
| 107 | Ga0070685_10001130 | 3300005466 | Bacteria | 14275 |
| 108 | Ga0070685_10037180 | 3300005466 | Unclassified | 2756 |
| 109 | Ga0070679_100012382 | 3300005530 | Bacteria | 8150 |
| 110 | Ga0070679_100057663 | 3300005530 | Bacteria | 3871 |
| 111 | Ga0070679_100163207 | 3300005530 | Bacteria | 2202 |
| 112 | Ga0070684_100021825 | 3300005535 | Bacteria | 5333 |
| 113 | Ga0070684_100026880 | 3300005535 | Bacteria | 4851 |
| 114 | Ga0070684_100087654 | 3300005535 | Bacteria | 2764 |
| 115 | Ga0070697_100049880 | 3300005536 | Bacteria | 3397 |
| 116 | Ga0068853_100000906 | 3300005539 | Bacteria | 20662 |
| 117 | Ga0070672_100000679 | 3300005543 | Bacteria | 20002 |
| 118 | Ga0070686_100001681 | 3300005544 | Bacteria | 12352 |
| 119 | Ga0070686_100029763 | 3300005544 | Bacteria | 3325 |
| 120 | Ga0070686_100059649 | 3300005544 | Bacteria | 2459 |
| 121 | Ga0070695_100007010 | 3300005545 | Bacteria | 6679 |
| 122 | Ga0070696_100035611 | 3300005546 | Bacteria | 3428 |
| 123 | Ga0070696_100335150 | 3300005546 | Bacteria | 1168 |
| 124 | Ga0070693_100003374 | 3300005547 | Bacteria | 7428 |
| 125 | Ga0070665_100107509 | 3300005548 | Bacteria | 2792 |
| 126 | Ga0070665_100131945 | 3300005548 | Unclassified | 2500 |
| 127 | Ga0070665_100157786 | 3300005548 | Bacteria | 2270 |
| 128 | Ga0070704_100011666 | 3300005549 | Bacteria | 5396 |
| 129 | Ga0070704_100063568 | 3300005549 | Bacteria | 2649 |
| 130 | Ga0068855_100005213 | 3300005563 | Bacteria | 15852 |
| 131 | Ga0068855_100067138 | 3300005563 | Bacteria | 4180 |
| 132 | Ga0070664_100008267 | 3300005564 | Bacteria | 8418 |
| 133 | Ga0070664_100071818 | 3300005564 | Bacteria | 2967 |
| 134 | Ga0070664_100184007 | 3300005564 | Bacteria | 1858 |
| 135 | Ga0068857_100024411 | 3300005577 | Bacteria | 5322 |
| 136 | Ga0068857_100089731 | 3300005577 | Bacteria | 2750 |
| 137 | Ga0068857_100379340 | 3300005577 | Bacteria | 1313 |
| 138 | Ga0068854_100001485 | 3300005578 | Bacteria | 14204 |
| 139 | Ga0068856_100000013 | 3300005614 | Bacteria | 165611 |
| 140 | Ga0068856_100004080 | 3300005614 | Bacteria | 14604 |
| 141 | Ga0070702_100004190 | 3300005615 | Bacteria | 6561 |
| 142 | Ga0070702_100143723 | 3300005615 | Bacteria | 1523 |
| 143 | Ga0068852_100009647 | 3300005616 | Bacteria | 7170 |
| 144 | Ga0068859_100003498 | 3300005617 | Bacteria | 15989 |
| 145 | Ga0068859_100068433 | 3300005617 | Bacteria | 3585 |
| 146 | Ga0068859_100304340 | 3300005617 | Bacteria | 1688 |
| 147 | Ga0068864_100006196 | 3300005618 | Bacteria | 9806 |
| 148 | Ga0068864_100097020 | 3300005618 | Bacteria | 2609 |
| 149 | Ga0068864_100110565 | 3300005618 | Bacteria | 2447 |
| 150 | Ga0068864_100134900 | 3300005618 | Bacteria | 2221 |
| 151 | Ga0068864_100258890 | 3300005618 | Bacteria | 1618 |
| 152 | Ga0068866_10002003 | 3300005718 | Bacteria | 8477 |
| 153 | Ga0068866_10062811 | 3300005718 | Unclassified | 1933 |
| 154 | Ga0068866_10262732 | 3300005718 | Bacteria | 1062 |
| 155 | Ga0068861_100029256 | 3300005719 | Bacteria | 4029 |
| 156 | Ga0068870_10004133 | 3300005840 | Bacteria | 6216 |
| 157 | Ga0068870_10140008 | 3300005840 | Bacteria | 1415 |
| 158 | Ga0068863_100002935 | 3300005841 | Bacteria | 16858 |
| 159 | Ga0068863_100398028 | 3300005841 | Bacteria | 1347 |
| 160 | Ga0068858_100013279 | 3300005842 | Bacteria | 7764 |
| 161 | Ga0068858_100102721 | 3300005842 | Bacteria | 2666 |
| 162 | Ga0068860_100002542 | 3300005843 | Bacteria | 19093 |
| 163 | Ga0068860_100072832 | 3300005843 | Unclassified | 3265 |
| 164 | Ga0068860_100414830 | 3300005843 | Bacteria | 1334 |
| 165 | Ga0068862_100006476 | 3300005844 | Bacteria | 9725 |
| 166 | Ga0081455_10001284 | 3300005937 | Bacteria | 31217 |
| 167 | Ga0081455_10004026 | 3300005937 | Bacteria | 16661 |
| 168 | Ga0081455_10026742 | 3300005937 | Bacteria | 5298 |
| 169 | Ga0081540_1051714 | 3300005983 | Bacteria | 2029 |
| 170 | Ga0070717_10154874 | 3300006028 | Bacteria | 1984 |
| 171 | Ga0070717_10331340 | 3300006028 | Bacteria | 1358 |
| 172 | Ga0075432_10007074 | 3300006058 | Bacteria | 3822 |
| 173 | Ga0070715_10068129 | 3300006163 | Bacteria | 1582 |
| 174 | Ga0070716_100009608 | 3300006173 | Bacteria | 4823 |
| 175 | Ga0070712_100015646 | 3300006175 | Bacteria | 4890 |
| 176 | Ga0070712_100147720 | 3300006175 | Bacteria | 1801 |
| 177 | Ga0075367_10076810 | 3300006178 | Bacteria | 2016 |
| 178 | Ga0097621_100011406 | 3300006237 | Bacteria | 6543 |
| 179 | Ga0068871_100018905 | 3300006358 | Bacteria | 5250 |
| 180 | Ga0075428_100004320 | 3300006844 | Bacteria | 15659 |
| 181 | Ga0075430_100231934 | 3300006846 | Bacteria | 1530 |
| 182 | Ga0075431_100185504 | 3300006847 | Bacteria | 2133 |
| 183 | Ga0075433_10000029 | 3300006852 | Bacteria | 55893 |
| 184 | Ga0075433_10007719 | 3300006852 | Bacteria | 8547 |
| 185 | Ga0075433_10023855 | 3300006852 | Bacteria | 5155 |
| 186 | Ga0075433_10055372 | 3300006852 | Bacteria | 3462 |
| 187 | Ga0075434_100000208 | 3300006871 | Bacteria | 39868 |
| 188 | Ga0075434_100001333 | 3300006871 | Bacteria | 20677 |
| 189 | Ga0075434_100037538 | 3300006871 | Bacteria | 4797 |
| 190 | Ga0075434_100037751 | 3300006871 | Bacteria | 4782 |
| 191 | Ga0075434_100126033 | 3300006871 | Bacteria | 2578 |
| 192 | Ga0075434_100202518 | 3300006871 | Unclassified | 2005 |
| 193 | Ga0075429_100207077 | 3300006880 | Bacteria | 1718 |
| 194 | Ga0068865_100001418 | 3300006881 | Bacteria | 13966 |
| 195 | Ga0068865_100065230 | 3300006881 | Bacteria | 2565 |
| 196 | Ga0068865_100255669 | 3300006881 | Bacteria | 1384 |
| 197 | Ga0075436_100059762 | 3300006914 | Bacteria | 2633 |
| 198 | Ga0097620_100003498 | 3300006931 | Bacteria | 15989 |
| 199 | Ga0097620_100068431 | 3300006931 | Bacteria | 3585 |
| 200 | Ga0097620_100304332 | 3300006931 | Bacteria | 1688 |
| 201 | Ga0075435_100010419 | 3300007076 | Bacteria | 6801 |
| 202 | Ga0075435_100081701 | 3300007076 | Bacteria | 2655 |
| 203 | Ga0075435_100215619 | 3300007076 | Bacteria | 1629 |
| 204 | Ga0105250_10023895 | 3300009092 | Bacteria | 2464 |
| 205 | Ga0105240_10012832 | 3300009093 | Bacteria | 11542 |
| 206 | Ga0105240_10041886 | 3300009093 | Bacteria | 5840 |
| 207 | Ga0105240_10411823 | 3300009093 | Bacteria | 1520 |
| 208 | Ga0111539_10000345 | 3300009094 | Bacteria | 57093 |
| 209 | Ga0111539_10002114 | 3300009094 | Bacteria | 26555 |
| 210 | Ga0111539_10066957 | 3300009094 | Bacteria | 4242 |
| 211 | Ga0111539_10191820 | 3300009094 | Bacteria | 2384 |
| 212 | Ga0105245_10002739 | 3300009098 | Bacteria | 15848 |
| 213 | Ga0105245_10093138 | 3300009098 | Bacteria | 2776 |
| 214 | Ga0105245_10098474 | 3300009098 | Unclassified | 2702 |
| 215 | Ga0105247_10004019 | 3300009101 | Bacteria | 9465 |
| 216 | Ga0105247_10013262 | 3300009101 | Bacteria | 4946 |
| 217 | Ga0105247_10186717 | 3300009101 | Bacteria | 1386 |
| 218 | Ga0114129_10035787 | 3300009147 | Bacteria | 7013 |
| 219 | Ga0114129_10333964 | 3300009147 | Bacteria | 2012 |
| 220 | Ga0114129_10532762 | 3300009147 | Bacteria | 1530 |
| 221 | Ga0105243_10002166 | 3300009148 | Bacteria | 16594 |
| 222 | Ga0105241_10004380 | 3300009174 | Bacteria | 10436 |
| 223 | Ga0105241_10061853 | 3300009174 | Bacteria | 2885 |
| 224 | Ga0105241_10085225 | 3300009174 | Unclassified | 2482 |
| 225 | Ga0105242_10037470 | 3300009176 | Bacteria | 3895 |
| 226 | Ga0105248_10002844 | 3300009177 | Bacteria | 19207 |
| 227 | Ga0105248_10057459 | 3300009177 | Bacteria | 4367 |
| 228 | Ga0105248_10091855 | 3300009177 | Bacteria | 3419 |
| 229 | Ga0105248_10295214 | 3300009177 | Bacteria | 1825 |
| 230 | Ga0105248_10489030 | 3300009177 | Bacteria | 1387 |
| 231 | Ga0105248_10525166 | 3300009177 | Bacteria | 1335 |
| 232 | Ga0105237_10013429 | 3300009545 | Bacteria | 8589 |
| 233 | Ga0105237_10021168 | 3300009545 | Bacteria | 6689 |
| 234 | Ga0105237_10073702 | 3300009545 | Bacteria | 3406 |
| 235 | Ga0105237_10445792 | 3300009545 | Bacteria | 1300 |
| 236 | Ga0105238_10057687 | 3300009551 | Bacteria | 3893 |
| 237 | Ga0105238_10134819 | 3300009551 | Bacteria | 2447 |
| 238 | Ga0105249_10010187 | 3300009553 | Bacteria | 8255 |
| 239 | Ga0105239_10005997 | 3300010375 | Bacteria | 14140 |
| 240 | Ga0105239_10073245 | 3300010375 | Bacteria | 3766 |
| 241 | Ga0105239_10076690 | 3300010375 | Bacteria | 3677 |
| 242 | Ga0105239_10186134 | 3300010375 | Bacteria | 2324 |
| 243 | Ga0105246_10004149 | 3300011119 | Bacteria | 8800 |
| 244 | Ga0105246_10124323 | 3300011119 | Bacteria | 1917 |
| 245 | Ga0157373_10006523 | 3300013100 | Bacteria | 8705 |
| 246 | Ga0157369_10000848 | 3300013105 | Bacteria | 39040 |
| 247 | Ga0157369_10062683 | 3300013105 | Bacteria | 4006 |
| 248 | Ga0157374_10008496 | 3300013296 | Bacteria | 8784 |
| 249 | Ga0157374_10015440 | 3300013296 | Bacteria | 6698 |
| 250 | Ga0157374_10208350 | 3300013296 | Bacteria | 1916 |
| 251 | Ga0157378_10011772 | 3300013297 | Bacteria | 7659 |
| 252 | Ga0157378_10059516 | 3300013297 | Bacteria | 3408 |
| 253 | Ga0163162_10004494 | 3300013306 | Bacteria | 13434 |
| 254 | Ga0163162_10106664 | 3300013306 | Bacteria | 2897 |
| 255 | Ga0163162_10685782 | 3300013306 | Bacteria | 1147 |
| 256 | Ga0157372_10046139 | 3300013307 | Bacteria | 4837 |
| 257 | Ga0157375_10038679 | 3300013308 | Bacteria | 4582 |
| 258 | Ga0157375_10038977 | 3300013308 | Bacteria | 4568 |
| 259 | Ga0157375_10115203 | 3300013308 | Bacteria | 2791 |
| 260 | Ga0163163_10010926 | 3300014325 | Bacteria | 8202 |
| 261 | Ga0163163_10025845 | 3300014325 | Bacteria | 5602 |
| 262 | Ga0163163_10050056 | 3300014325 | Bacteria | 4114 |
| 263 | Ga0163163_10321653 | 3300014325 | Bacteria | 1601 |
| 264 | Ga0157380_10009077 | 3300014326 | Bacteria | 7105 |
| 265 | Ga0157377_10002192 | 3300014745 | Bacteria | 8583 |
| 266 | Ga0157377_10162636 | 3300014745 | Bacteria | 1389 |
| 267 | Ga0157379_10002658 | 3300014968 | Bacteria | 15053 |
| 268 | Ga0157379_10027483 | 3300014968 | Bacteria | 5066 |
| 269 | Ga0157379_10124319 | 3300014968 | Bacteria | 2321 |
| 270 | Ga0157376_10003174 | 3300014969 | Bacteria | 11291 |
| 271 | Ga0157376_10005599 | 3300014969 | Bacteria | 8786 |
| 272 | Ga0163161_10001452 | 3300017792 | Bacteria | 17532 |
| 273 | Ga0163161_10035410 | 3300017792 | Bacteria | 3573 |
| 274 | Ga0213876_10023662 | 3300021384 | Bacteria | 3244 |
| 275 | Ga0228598_1014983 | 3300024227 | Bacteria | 1532 |
| 276 | Ga0207666_1000032 | 3300025271 | Bacteria | 28987 |
| 277 | Ga0207673_1000021 | 3300025290 | Bacteria | 12087 |
| 278 | Ga0207697_10000192 | 3300025315 | Bacteria | 32162 |
| 279 | Ga0207656_10042008 | 3300025321 | Bacteria | 1944 |
| 280 | Ga0207656_10051615 | 3300025321 | Unclassified | 1779 |
| 281 | Ga0207713_1021420 | 3300025735 | Bacteria | 3099 |
| 282 | Ga0207653_10001002 | 3300025885 | Bacteria | 9306 |
| 283 | Ga0207682_10000056 | 3300025893 | Bacteria | 48265 |
| 284 | Ga0207692_10007243 | 3300025898 | Bacteria | 4536 |
| 285 | Ga0207642_10028901 | 3300025899 | Bacteria | 2289 |
| 286 | Ga0207710_10014280 | 3300025900 | Bacteria | 3346 |
| 287 | Ga0207710_10048604 | 3300025900 | Bacteria | 1899 |
| 288 | Ga0207688_10000066 | 3300025901 | Bacteria | 38551 |
| 289 | Ga0207688_10039303 | 3300025901 | Bacteria | 2628 |
| 290 | Ga0207688_10113063 | 3300025901 | Bacteria | 1578 |
| 291 | Ga0207680_10007602 | 3300025903 | Bacteria | 5292 |
| 292 | Ga0207647_10004193 | 3300025904 | Bacteria | 10694 |
| 293 | Ga0207647_10078582 | 3300025904 | Bacteria | 1981 |
| 294 | Ga0207647_10082832 | 3300025904 | Bacteria | 1921 |
| 295 | Ga0207699_10024636 | 3300025906 | Bacteria | 3293 |
| 296 | Ga0207645_10006176 | 3300025907 | Bacteria | 8601 |
| 297 | Ga0207645_10027343 | 3300025907 | Bacteria | 3684 |
| 298 | Ga0207645_10029375 | 3300025907 | Bacteria | 3545 |
| 299 | Ga0207643_10000187 | 3300025908 | Bacteria | 42567 |
| 300 | Ga0207643_10022074 | 3300025908 | Bacteria | 3502 |
| 301 | Ga0207654_10003683 | 3300025911 | Bacteria | 7725 |
| 302 | Ga0207707_10009866 | 3300025912 | Bacteria | 8276 |
| 303 | Ga0207707_10018653 | 3300025912 | Bacteria | 6049 |
| 304 | Ga0207707_10080750 | 3300025912 | Bacteria | 2839 |
| 305 | Ga0207707_10095117 | 3300025912 | Bacteria | 2604 |
| 306 | Ga0207695_10290248 | 3300025913 | Bacteria | 1528 |
| 307 | Ga0207695_10298115 | 3300025913 | Bacteria | 1504 |
| 308 | Ga0207671_10178498 | 3300025914 | Bacteria | 1652 |
| 309 | Ga0207693_10001676 | 3300025915 | Bacteria | 19527 |
| 310 | Ga0207693_10015923 | 3300025915 | Bacteria | 6021 |
| 311 | Ga0207693_10075345 | 3300025915 | Bacteria | 2642 |
| 312 | Ga0207693_10115587 | 3300025915 | Bacteria | 2106 |
| 313 | Ga0207663_10011824 | 3300025916 | Bacteria | 4699 |
| 314 | Ga0207663_10091766 | 3300025916 | Bacteria | 2017 |
| 315 | Ga0207663_10143380 | 3300025916 | Bacteria | 1667 |
| 316 | Ga0207660_10006714 | 3300025917 | Bacteria | 7452 |
| 317 | Ga0207662_10000292 | 3300025918 | Bacteria | 23122 |
| 318 | Ga0207662_10052636 | 3300025918 | Bacteria | 2423 |
| 319 | Ga0207662_10067919 | 3300025918 | Bacteria | 2151 |
| 320 | Ga0207662_10095023 | 3300025918 | Bacteria | 1839 |
| 321 | Ga0207657_10001630 | 3300025919 | Bacteria | 24165 |
| 322 | Ga0207657_10077442 | 3300025919 | Bacteria | 2802 |
| 323 | Ga0207649_10001002 | 3300025920 | Bacteria | 17465 |
| 324 | Ga0207652_10090398 | 3300025921 | Bacteria | 2690 |
| 325 | Ga0207652_10091832 | 3300025921 | Bacteria | 2670 |
| 326 | Ga0207652_10100881 | 3300025921 | Bacteria | 2549 |
| 327 | Ga0207652_10472992 | 3300025921 | Bacteria | 1129 |
| 328 | Ga0207681_10006515 | 3300025923 | Bacteria | 7166 |
| 329 | Ga0207650_10048649 | 3300025925 | Bacteria | 3128 |
| 330 | Ga0207650_10119341 | 3300025925 | Bacteria | 2051 |
| 331 | Ga0207659_10002407 | 3300025926 | Bacteria | 11134 |
| 332 | Ga0207659_10055975 | 3300025926 | Bacteria | 2823 |
| 333 | Ga0207687_10003001 | 3300025927 | Bacteria | 11444 |
| 334 | Ga0207687_10140247 | 3300025927 | Bacteria | 1833 |
| 335 | Ga0207687_10203058 | 3300025927 | Unclassified | 1551 |
| 336 | Ga0207700_10007834 | 3300025928 | Bacteria | 6567 |
| 337 | Ga0207700_10124688 | 3300025928 | Bacteria | 2093 |
| 338 | Ga0207700_10157349 | 3300025928 | Bacteria | 1884 |
| 339 | Ga0207700_10214902 | 3300025928 | Bacteria | 1627 |
| 340 | Ga0207664_10124765 | 3300025929 | Bacteria | 2160 |
| 341 | Ga0207664_10136882 | 3300025929 | Bacteria | 2068 |
| 342 | Ga0207644_10003646 | 3300025931 | Bacteria | 9990 |
| 343 | Ga0207644_10007286 | 3300025931 | Bacteria | 7200 |
| 344 | Ga0207644_10026516 | 3300025931 | Bacteria | 3994 |
| 345 | Ga0207690_10001213 | 3300025932 | Bacteria | 16283 |
| 346 | Ga0207706_10009370 | 3300025933 | Bacteria | 8991 |
| 347 | Ga0207706_10042486 | 3300025933 | Bacteria | 4029 |
| 348 | Ga0207706_10081753 | 3300025933 | Bacteria | 2839 |
| 349 | Ga0207686_10007500 | 3300025934 | Bacteria | 5872 |
| 350 | Ga0207709_10001124 | 3300025935 | Bacteria | 19613 |
| 351 | Ga0207709_10069079 | 3300025935 | Bacteria | 2235 |
| 352 | Ga0207670_10001034 | 3300025936 | Bacteria | 14694 |
| 353 | Ga0207670_10007190 | 3300025936 | Bacteria | 6202 |
| 354 | Ga0207670_10078691 | 3300025936 | Bacteria | 2300 |
| 355 | Ga0207669_10000578 | 3300025937 | Bacteria | 15956 |
| 356 | Ga0207669_10033689 | 3300025937 | Bacteria | 2893 |
| 357 | Ga0207669_10035046 | 3300025937 | Bacteria | 2851 |
| 358 | Ga0207669_10060100 | 3300025937 | Bacteria | 2328 |
| 359 | Ga0207704_10001542 | 3300025938 | Bacteria | 10343 |
| 360 | Ga0207704_10059216 | 3300025938 | Bacteria | 2363 |
| 361 | Ga0207665_10002127 | 3300025939 | Bacteria | 13403 |
| 362 | Ga0207665_10074485 | 3300025939 | Bacteria | 2323 |
| 363 | Ga0207691_10002805 | 3300025940 | Bacteria | 16985 |
| 364 | Ga0207711_10009683 | 3300025941 | Bacteria | 8028 |
| 365 | Ga0207711_10011676 | 3300025941 | Bacteria | 7297 |
| 366 | Ga0207711_10019987 | 3300025941 | Bacteria | 5581 |
| 367 | Ga0207689_10001239 | 3300025942 | Bacteria | 24599 |
| 368 | Ga0207689_10197242 | 3300025942 | Unclassified | 1662 |
| 369 | Ga0207661_10002038 | 3300025944 | Bacteria | 13934 |
| 370 | Ga0207661_10213555 | 3300025944 | Bacteria | 1702 |
| 371 | Ga0207679_10000128 | 3300025945 | Bacteria | 61823 |
| 372 | Ga0207679_10000187 | 3300025945 | Bacteria | 49895 |
| 373 | Ga0207679_10000529 | 3300025945 | Bacteria | 25850 |
| 374 | Ga0207667_10035917 | 3300025949 | Bacteria | 5315 |
| 375 | Ga0207667_10293448 | 3300025949 | Bacteria | 1661 |
| 376 | Ga0207651_10005107 | 3300025960 | Bacteria | 6701 |
| 377 | Ga0207712_10000520 | 3300025961 | Bacteria | 31665 |
| 378 | Ga0207668_10000260 | 3300025972 | Bacteria | 35239 |
| 379 | Ga0207640_10006747 | 3300025981 | Bacteria | 6313 |
| 380 | Ga0207640_10051876 | 3300025981 | Bacteria | 2669 |
| 381 | Ga0207658_10005448 | 3300025986 | Bacteria | 8727 |
| 382 | Ga0207677_10032773 | 3300026023 | Bacteria | 3344 |
| 383 | Ga0207703_10016150 | 3300026035 | Bacteria | 5819 |
| 384 | Ga0207703_10152689 | 3300026035 | Bacteria | 2015 |
| 385 | Ga0207639_10008245 | 3300026041 | Bacteria | 7136 |
| 386 | Ga0207639_10318692 | 3300026041 | Bacteria | 1380 |
| 387 | Ga0207678_10007149 | 3300026067 | Bacteria | 9905 |
| 388 | Ga0207678_10014682 | 3300026067 | Bacteria | 6891 |
| 389 | Ga0207678_10053436 | 3300026067 | Bacteria | 3481 |
| 390 | Ga0207678_10182125 | 3300026067 | Bacteria | 1794 |
| 391 | Ga0207708_10001080 | 3300026075 | Bacteria | 20427 |
| 392 | Ga0207708_10091141 | 3300026075 | Bacteria | 2350 |
| 393 | Ga0207708_10113557 | 3300026075 | Unclassified | 2105 |
| 394 | Ga0207702_10000090 | 3300026078 | Bacteria | 104566 |
| 395 | Ga0207702_10326241 | 3300026078 | Bacteria | 1463 |
| 396 | Ga0207641_10006255 | 3300026088 | Bacteria | 10076 |
| 397 | Ga0207641_10103942 | 3300026088 | Bacteria | 2507 |
| 398 | Ga0207641_10292024 | 3300026088 | Bacteria | 1537 |
| 399 | Ga0207648_10001031 | 3300026089 | Bacteria | 31313 |
| 400 | Ga0207648_10036632 | 3300026089 | Bacteria | 4322 |
| 401 | Ga0207676_10007274 | 3300026095 | Bacteria | 7843 |
| 402 | Ga0207674_10000686 | 3300026116 | Bacteria | 44016 |
| 403 | Ga0207674_10033888 | 3300026116 | Bacteria | 5343 |
| 404 | Ga0207674_10056651 | 3300026116 | Bacteria | 3978 |
| 405 | Ga0207674_10111775 | 3300026116 | Bacteria | 2706 |
| 406 | Ga0207675_100002806 | 3300026118 | Bacteria | 17123 |
| 407 | Ga0207675_100171011 | 3300026118 | Bacteria | 2077 |
| 408 | Ga0207683_10001686 | 3300026121 | Bacteria | 19759 |
| 409 | Ga0207683_10002136 | 3300026121 | Bacteria | 17378 |
| 410 | Ga0207683_10006803 | 3300026121 | Bacteria | 9792 |
| 411 | Ga0207683_10036985 | 3300026121 | Bacteria | 4251 |
| 412 | Ga0207698_10007006 | 3300026142 | Bacteria | 7060 |
| 413 | Ga0207698_10244519 | 3300026142 | Unclassified | 1638 |
| 414 | Ga0207698_10245318 | 3300026142 | Bacteria | 1635 |
| 415 | Ga0209998_10001494 | 3300027717 | Bacteria | 5629 |
| 416 | Ga0209974_10000101 | 3300027876 | Bacteria | 24130 |
| 417 | Ga0207428_10000360 | 3300027907 | Bacteria | 58478 |
| 418 | Ga0207428_10000556 | 3300027907 | Bacteria | 44098 |
| 419 | Ga0207428_10006906 | 3300027907 | Bacteria | 10403 |
| 420 | Ga0268266_10110354 | 3300028379 | Bacteria | 2437 |
| 421 | Ga0268265_10000526 | 3300028380 | Bacteria | 39043 |
| 422 | Ga0268264_10002582 | 3300028381 | Bacteria | 15846 |
| 423 | Ga0265337_1000923 | 3300028556 | Bacteria | 15408 |
| 424 | Ga0265318_10009497 | 3300028577 | Bacteria | 4276 |
| 425 | Ga0265338_10075379 | 3300028800 | Bacteria | 2862 |
| 426 | Ga0265338_10086764 | 3300028800 | Bacteria | 2602 |
| 427 | Ga0265763_1000022 | 3300030763 | Bacteria | 5983 |
| 428 | Ga0265760_10049290 | 3300031090 | Bacteria | 1266 |
| 429 | Ga0265330_10056518 | 3300031235 | Bacteria | 1712 |
| 430 | Ga0265332_10107931 | 3300031238 | Bacteria | 1173 |
| 431 | Ga0265320_10009858 | 3300031240 | Bacteria | 5724 |
| 432 | Ga0265325_10022783 | 3300031241 | Bacteria | 3426 |
| 433 | Ga0265325_10030323 | 3300031241 | Bacteria | 2900 |
| 434 | Ga0265325_10068982 | 3300031241 | Bacteria | 1779 |
| 435 | Ga0265329_10010635 | 3300031242 | Bacteria | 3368 |
| 436 | Ga0265340_10016642 | 3300031247 | Bacteria | 3805 |
| 437 | Ga0265339_10000038 | 3300031249 | Bacteria | 121961 |
| 438 | Ga0265339_10009421 | 3300031249 | Bacteria | 6141 |
| 439 | Ga0265339_10010951 | 3300031249 | Bacteria | 5606 |
| 440 | Ga0265339_10023221 | 3300031249 | Bacteria | 3587 |
| 441 | Ga0265316_10188829 | 3300031344 | Bacteria | 1531 |
| 442 | Ga0265316_10213857 | 3300031344 | Bacteria | 1425 |
| 443 | Ga0265316_10216877 | 3300031344 | Bacteria | 1413 |
| 444 | Ga0265313_10000034 | 3300031595 | Bacteria | 126370 |
| 445 | Ga0265313_10002885 | 3300031595 | Bacteria | 14411 |
| 446 | Ga0265313_10026895 | 3300031595 | Bacteria | 3020 |
| 447 | Ga0265314_10002042 | 3300031711 | Bacteria | 21355 |
| 448 | Ga0265314_10005437 | 3300031711 | Bacteria | 11503 |
| 449 | Ga0265314_10027527 | 3300031711 | Bacteria | 4256 |
| 450 | Ga0265342_10115049 | 3300031712 | Bacteria | 1519 |
| 451 | Ga0307516_10284070 | 3300031730 | Bacteria | 1336 |
| 452 | Ga0373930_0005389 | 3300034816 | Bacteria | 2125 |
| 453 | Ga0373948_0000653 | 3300034817 | Bacteria | 4495 |
| 454 | Ga0373950_0002536 | 3300034818 | Bacteria | 2519 |
| 455 | Ga0373950_0010850 | 3300034818 | Bacteria | 1479 |
| 456 | Ga0373958_0000128 | 3300034819 | Bacteria | 8458 |
| 457 | Ga0373958_0001016 | 3300034819 | Bacteria | 3672 |
| 458 | Ga0373959_0001211 | 3300034820 | Bacteria | 4170 |
| 459 | Ga0373938_0000039 | 3300034957 | Bacteria | 17106 |
| 460 | Ga0373938_0003571 | 3300034957 | Bacteria | 2558 |
| 461 | Ga0373926_0036813 | 3300035083 | Bacteria | 1740 |
| 462 | Ga0373928_0000780 | 3300035084 | Bacteria | 6190 |
| 463 | Ga0373928_0000840 | 3300035084 | Bacteria | 6012 |
| 464 | Ga0373929_0000209 | 3300035085 | Bacteria | 10585 |
| 465 | Ga0373929_0001461 | 3300035085 | Bacteria | 4503 |
| 466 | Ga0373940_0001653 | 3300035088 | Bacteria | 4110 |
| 467 | Ga0373944_0072813 | 3300035089 | Bacteria | 1122 |
| 468 | Ga0373949_0003694 | 3300035090 | Bacteria | 3588 |
| 469 | Ga0373949_0004971 | 3300035090 | Bacteria | 2999 |
| 470 | Ga0373949_0010465 | 3300035090 | Bacteria | 2034 |
| 471 | Ga0373951_0001984 | 3300035091 | Bacteria | 5243 |
| 472 | Ga0373951_0003922 | 3300035091 | Bacteria | 3574 |
| 473 | Ga0373952_0000127 | 3300035092 | Bacteria | 10765 |
| 474 | Ga0373952_0006066 | 3300035092 | Bacteria | 2228 |
| 475 | Ga0373952_0012769 | 3300035092 | Bacteria | 1658 |
| 476 | Ga0373923_0002024 | 3300035111 | Bacteria | 6102 |
| 477 | Ga0373932_0000284 | 3300035112 | Bacteria | 15261 |
| 478 | Ga0373932_0000942 | 3300035112 | Bacteria | 8521 |
| 479 | Ga0373936_0011642 | 3300035113 | Bacteria | 3336 |
| 480 | Ga0373939_0001563 | 3300035114 | Bacteria | 5560 |
| 481 | Ga0373939_0010809 | 3300035114 | Bacteria | 2293 |
| 482 | Ga0373941_0000214 | 3300035115 | Bacteria | 11102 |
| 483 | Ga0373941_0021725 | 3300035115 | Bacteria | 1815 |
| 484 | Ga0373945_0001162 | 3300035116 | Bacteria | 7988 |
| 485 | Ga0373945_0024944 | 3300035116 | Unclassified | 2074 |
| 486 | Ga0373945_0028582 | 3300035116 | Bacteria | 1954 |
| 487 | Ga0373945_0032981 | 3300035116 | Bacteria | 1837 |
| 488 | Ga0373953_0018375 | 3300035117 | Unclassified | 2586 |
| 489 | Ga0373953_0065617 | 3300035117 | Bacteria | 1490 |
| 490 | Ga0373953_0091158 | 3300035117 | Bacteria | 1275 |
| 491 | Ga0373954_0000797 | 3300035118 | Bacteria | 12188 |
| 492 | Ga0373954_0001989 | 3300035118 | Bacteria | 8486 |
| 493 | Ga0373956_0029526 | 3300035119 | Unclassified | 2392 |
| 494 | Ga0373957_0006608 | 3300035120 | Bacteria | 3664 |
| 495 | Ga0373957_0013318 | 3300035120 | Bacteria | 2788 |
| 496 | Ga0373957_0021825 | 3300035120 | Bacteria | 2277 |
| 497 | Ga0373960_0004672 | 3300035121 | Bacteria | 3147 |
| 498 | Ga0373960_0005071 | 3300035121 | Bacteria | 3034 |
| 499 | Ga0373943_0003311 | 3300035170 | Bacteria | 7320 |
| 500 | Ga0373943_0005072 | 3300035170 | Bacteria | 5938 |
| 501 | Ga0373943_0024444 | 3300035170 | Unclassified | 2816 |
| 502 | Ga0373943_0030273 | 3300035170 | Bacteria | 2560 |
| 503 | Ga0373946_0000764 | 3300035171 | Bacteria | 10957 |
| 504 | Ga0373946_0009266 | 3300035171 | Bacteria | 3621 |
| 505 | Ga0373946_0033861 | 3300035171 | Bacteria | 2059 |
| 506 | Ga0373955_0000425 | 3300035172 | Bacteria | 17797 |
| 507 | Ga0373955_0001166 | 3300035172 | Bacteria | 11157 |
| 508 | Ga0373955_0008057 | 3300035172 | Bacteria | 4873 |
| 509 | Ga0373942_0000702 | 3300035207 | Bacteria | 9287 |
| 510 | Ga0373942_0002546 | 3300035207 | Bacteria | 4410 |
| 511 | Ga0373961_0003562 | 3300035241 | Bacteria | 3832 |
| 512 | Ga0373962_0000320 | 3300035242 | Bacteria | 10433 |
| 513 | Ga0373962_0000506 | 3300035242 | Bacteria | 8687 |
| 514 | Ga0373924_0056104 | 3300035410 | Unclassified | 1640 |
| 515 | Ga0373931_0006810 | 3300035691 | Bacteria | 5370 |
| 516 | Ga0373931_0007585 | 3300035691 | Bacteria | 5110 |
| 517 | Ga0373931_0086171 | 3300035691 | Bacteria | 1742 |
| 518 | Ga0373931_0266514 | 3300035691 | Bacteria | 1047 |
| 519 | Ga0373935_0000337 | 3300035692 | Bacteria | 23756 |
| 520 | Ga0373935_0021184 | 3300035692 | Bacteria | 3978 |
| 521 | Ga0373935_0041444 | 3300035692 | Bacteria | 2892 |
| 522 | Ga0373935_0055426 | 3300035692 | Plasmid | 2525 |
| 523 | Ga0373935_0061923 | 3300035692 | Bacteria | 2396 |
| 524 | Ga0373927_0000699 | 3300035695 | Bacteria | 25690 |
| 525 | Ga0373927_0022633 | 3300035695 | Bacteria | 4115 |
| 526 | Ga0373927_0050128 | 3300035695 | Bacteria | 2699 |
| 527 | Ga0373927_0080021 | 3300035695 | Bacteria | 2117 |
| 528 | Ga0373927_0170494 | 3300035695 | Unclassified | 1426 |
| 529 | Ga0373927_0176248 | 3300035695 | Bacteria | 1402 |
| 530 | Ga0373927_0180697 | 3300035695 | Bacteria | 1384 |
| 531 | Ga0373933_0001172 | 3300035724 | Bacteria | 15550 |
| 532 | Ga0373933_0003551 | 3300035724 | Bacteria | 8665 |
| 533 | Ga0373933_0003679 | 3300035724 | Bacteria | 8489 |
| 534 | Ga0373933_0017476 | 3300035724 | Bacteria | 4024 |
| 535 | Ga0373933_0196324 | 3300035724 | Bacteria | 1290 |
| 536 | Ga0373947_0000274 | 3300035725 | Bacteria | 29259 |
| 537 | Ga0373947_0001536 | 3300035725 | Bacteria | 14154 |
| 538 | Ga0373947_0056467 | 3300035725 | Bacteria | 2373 |
| 539 | Ga0373947_0057811 | 3300035725 | Bacteria | 2348 |
| 540 | Ga0373937_0000597 | 3300036401 | Bacteria | 31969 |
| 541 | Ga0373937_0002771 | 3300036401 | Bacteria | 14631 |
| 542 | Ga0373937_0006032 | 3300036401 | Bacteria | 10436 |
| 543 | Ga0373937_0046150 | 3300036401 | Bacteria | 3983 |
| 544 | Ga0373937_0073593 | 3300036401 | Bacteria | 3152 |
| 545 | Ga0373937_0135835 | 3300036401 | Unclassified | 2299 |
| 546 | Ga0373925_0000741 | 3300037068 | Bacteria | 29997 |
| 547 | Ga0373925_0001836 | 3300037068 | Bacteria | 17719 |
| 548 | Ga0373925_0009897 | 3300037068 | Bacteria | 6928 |
| 549 | Ga0373925_0028027 | 3300037068 | Bacteria | 4125 |
| 550 | Ga0373925_0175301 | 3300037068 | Bacteria | 1694 |
| 551 | Ga0373925_0372685 | 3300037068 | Bacteria | 1162 |
| 552 | Ga0395899_0007276 | 3300037312 | Bacteria | 8562 |
| 553 | Ga0395899_0173053 | 3300037312 | Bacteria | 1519 |
| 554 | Ga0395900_0003202 | 3300037418 | Bacteria | 17723 |
| 555 | Ga0395900_0010704 | 3300037418 | Bacteria | 9381 |
| 556 | Ga0395900_0054446 | 3300037418 | Bacteria | 4120 |
| 557 | Ga0395900_0104076 | 3300037418 | Bacteria | 2916 |
| 558 | Ga0395898_0029199 | 3300037466 | Bacteria | 5525 |
| 559 | Ga0395898_0030701 | 3300037466 | Bacteria | 5375 |
| 560 | Ga0395901_0024663 | 3300038443 | Bacteria | 6175 |
| 561 | Ga0395901_0064016 | 3300038443 | Bacteria | 3827 |
| 562 | Ga0436365_0590132 | 3300039437 | Bacteria | 5387 |
| 563 | Ga0466966_0160596 | 3300044684 | Bacteria | 1368 |
| 564 | Ga0466966_0175618 | 3300044684 | Bacteria | 1301 |
| 565 | Ga0466963_0053798 | 3300044694 | Bacteria | 2674 |
| 566 | Ga0466963_0147173 | 3300044694 | Bacteria | 1635 |
| 567 | Ga0466964_0041270 | 3300044706 | Bacteria | 1866 |
| 568 | Ga0453684_0443164 | 3300044712 | Bacteria | 1447 |
| 569 | Ga0466971_0022105 | 3300044719 | Bacteria | 2832 |
| 570 | Ga0466957_0025668 | 3300044842 | Bacteria | 3493 |
| 571 | Ga0466957_0063764 | 3300044842 | Bacteria | 2266 |
| 572 | Ga0495592_0000188 | 3300046454 | Bacteria | 54485 |
| 573 | Ga0495592_0003488 | 3300046454 | Bacteria | 11285 |
| 574 | Ga0495592_0003644 | 3300046454 | Bacteria | 11088 |
| 575 | Ga0495592_0181229 | 3300046454 | Bacteria | 1434 |
| 576 | Ga0495603_0063474 | 3300046455 | Bacteria | 2179 |
| 577 | Ga0495629_0002114 | 3300046459 | Bacteria | 15386 |
| 578 | Ga0495629_0051344 | 3300046459 | Bacteria | 2886 |
| 579 | Ga0495629_0051389 | 3300046459 | Bacteria | 2885 |
| 580 | Ga0495641_0006360 | 3300046461 | Bacteria | 7668 |
| 581 | Ga0495651_0001439 | 3300046462 | Bacteria | 18418 |
| 582 | Ga0495651_0074300 | 3300046462 | Bacteria | 2579 |
| 583 | Ga0495651_0075602 | 3300046462 | Bacteria | 2553 |
| 584 | Ga0495651_0085288 | 3300046462 | Bacteria | 2378 |
| 585 | Ga0495653_0000198 | 3300046463 | Bacteria | 49009 |
| 586 | Ga0495653_0010944 | 3300046463 | Bacteria | 7428 |
| 587 | Ga0495653_0017035 | 3300046463 | Bacteria | 5911 |
| 588 | Ga0495653_0257998 | 3300046463 | Bacteria | 1154 |
| 589 | Ga0495580_0006784 | 3300046472 | Bacteria | 9280 |
| 590 | Ga0495580_0090746 | 3300046472 | Bacteria | 2127 |
| 591 | Ga0495580_0105681 | 3300046472 | Bacteria | 1956 |
| 592 | Ga0495582_0001989 | 3300046473 | Bacteria | 11451 |
| 593 | Ga0495582_0010759 | 3300046473 | Bacteria | 5035 |
| 594 | Ga0495639_0019753 | 3300046475 | Unclassified | 2940 |
| 595 | Ga0495639_0055054 | 3300046475 | Bacteria | 1814 |
| 596 | Ga0495639_0079858 | 3300046475 | Bacteria | 1522 |
| 597 | Ga0495639_0228400 | 3300046475 | Bacteria | 917 |
| 598 | Ga0495662_0000720 | 3300046476 | Bacteria | 15794 |
| 599 | Ga0495662_0005913 | 3300046476 | Bacteria | 6118 |
| 600 | Ga0495662_0015270 | 3300046476 | Bacteria | 3731 |
| 601 | Ga0495662_0019754 | 3300046476 | Bacteria | 3259 |
| 602 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 603 | Ga0495664_0000584 | 3300046477 | Bacteria | 18401 |
| 604 | Ga0495664_0004997 | 3300046477 | Bacteria | 7262 |
| 605 | Ga0495664_0081533 | 3300046477 | Bacteria | 1939 |
| 606 | Ga0495664_0116827 | 3300046477 | Bacteria | 1613 |
| 607 | Ga0495664_0127500 | 3300046477 | Bacteria | 1540 |
| 608 | Ga0495584_0047311 | 3300046491 | Unclassified | 2169 |
| 609 | Ga0495585_0009108 | 3300046492 | Bacteria | 5978 |
| 610 | Ga0495594_0099009 | 3300046499 | Unclassified | 1639 |
| 611 | Ga0495607_0018871 | 3300046501 | Bacteria | 4386 |
| 612 | Ga0495607_0170636 | 3300046501 | Bacteria | 1099 |
| 613 | Ga0495608_0000009 | 3300046511 | Bacteria | 266614 |
| 614 | Ga0495608_0048818 | 3300046511 | Bacteria | 2811 |
| 615 | Ga0495608_0073249 | 3300046511 | Bacteria | 2234 |
| 616 | Ga0495618_0000005 | 3300046514 | Bacteria | 230421 |
| 617 | Ga0495618_0002882 | 3300046514 | Bacteria | 10903 |
| 618 | Ga0495618_0033591 | 3300046514 | Bacteria | 3216 |
| 619 | Ga0495618_0058446 | 3300046514 | Unclassified | 2442 |
| 620 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 621 | Ga0495628_0009056 | 3300046516 | Bacteria | 8514 |
| 622 | Ga0495628_0033882 | 3300046516 | Bacteria | 4112 |
| 623 | Ga0495628_0059495 | 3300046516 | Unclassified | 2999 |
| 624 | Ga0495630_0000614 | 3300046517 | Bacteria | 25848 |
| 625 | Ga0495630_0025217 | 3300046517 | Bacteria | 4395 |
| 626 | Ga0495630_0061694 | 3300046517 | Bacteria | 2815 |
| 627 | Ga0495630_0110416 | 3300046517 | Bacteria | 2083 |
| 628 | Ga0495630_0132387 | 3300046517 | Bacteria | 1894 |
| 629 | Ga0495631_0060519 | 3300046518 | Unclassified | 1643 |
| 630 | Ga0495644_0001230 | 3300046523 | Bacteria | 10480 |
| 631 | Ga0495666_0005058 | 3300046526 | Bacteria | 6673 |
| 632 | Ga0495666_0043477 | 3300046526 | Bacteria | 2171 |
| 633 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 634 | Ga0495652_0009251 | 3300046529 | Bacteria | 8956 |
| 635 | Ga0495652_0019750 | 3300046529 | Bacteria | 5994 |
| 636 | Ga0495652_0045220 | 3300046529 | Bacteria | 3787 |
| 637 | Ga0495652_0060267 | 3300046529 | Bacteria | 3208 |
| 638 | Ga0495652_0187831 | 3300046529 | Bacteria | 1580 |
| 639 | Ga0495665_0005753 | 3300046531 | Bacteria | 6691 |
| 640 | Ga0495665_0006707 | 3300046531 | Bacteria | 6207 |
| 641 | Ga0495665_0034270 | 3300046531 | Bacteria | 2714 |
| 642 | Ga0495665_0056695 | 3300046531 | Bacteria | 2068 |
| 643 | Ga0495640_0000005 | 3300046533 | Bacteria | 318271 |
| 644 | Ga0495640_0009209 | 3300046533 | Bacteria | 7703 |
| 645 | Ga0495640_0017003 | 3300046533 | Bacteria | 5429 |
| 646 | Ga0495640_0031918 | 3300046533 | Bacteria | 3755 |
| 647 | Ga0495640_0069901 | 3300046533 | Unclassified | 2360 |
| 648 | Ga0495640_0110465 | 3300046533 | Bacteria | 1797 |
| 649 | Ga0495586_0027039 | 3300046535 | Unclassified | 3070 |
| 650 | Ga0495586_0048545 | 3300046535 | Bacteria | 2294 |
| 651 | Ga0495586_0106107 | 3300046535 | Bacteria | 1562 |
| 652 | Ga0495587_0000007 | 3300046536 | Bacteria | 290788 |
| 653 | Ga0495587_0027972 | 3300046536 | Bacteria | 3432 |
| 654 | Ga0495598_0034709 | 3300046537 | Unclassified | 1440 |
| 655 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 656 | Ga0495645_0004356 | 3300046543 | Bacteria | 9673 |
| 657 | Ga0495645_0004437 | 3300046543 | Bacteria | 9581 |
| 658 | Ga0495645_0062811 | 3300046543 | Unclassified | 2690 |
| 659 | Ga0495645_0110853 | 3300046543 | Bacteria | 1942 |
| 660 | Ga0495622_0032570 | 3300046557 | Unclassified | 2433 |
| 661 | Ga0495633_0010995 | 3300046558 | Bacteria | 4913 |
| 662 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 663 | Ga0495667_0006822 | 3300046559 | Bacteria | 7752 |
| 664 | Ga0495667_0009615 | 3300046559 | Bacteria | 6556 |
| 665 | Ga0495667_0034173 | 3300046559 | Bacteria | 3399 |
| 666 | Ga0495667_0120959 | 3300046559 | Bacteria | 1690 |
| 667 | Ga0495667_0157123 | 3300046559 | Bacteria | 1463 |
| 668 | Ga0495656_0012639 | 3300046615 | Unclassified | 3121 |
| 669 | Ga0495634_0000129 | 3300046642 | Bacteria | 65082 |
| 670 | Ga0495634_0003005 | 3300046642 | Bacteria | 13730 |
| 671 | Ga0495634_0021910 | 3300046642 | Bacteria | 4507 |
| 672 | Ga0495634_0022328 | 3300046642 | Bacteria | 4459 |
| 673 | Ga0495634_0047801 | 3300046642 | Bacteria | 2882 |
| 674 | Ga0495635_0000289 | 3300046663 | Bacteria | 32189 |
| 675 | Ga0495635_0003450 | 3300046663 | Bacteria | 10929 |
| 676 | Ga0495635_0014790 | 3300046663 | Bacteria | 5459 |
| 677 | Ga0495635_0023231 | 3300046663 | Bacteria | 4321 |
| 678 | Ga0495635_0073532 | 3300046663 | Bacteria | 2341 |
| 679 | Ga0495659_0008534 | 3300046664 | Unclassified | 3261 |
| 680 | Ga0495661_0068880 | 3300046665 | Unclassified | 2075 |
| 681 | Ga0495588_0006106 | 3300046674 | Bacteria | 5408 |
| 682 | Ga0495657_0000781 | 3300046675 | Bacteria | 28299 |
| 683 | Ga0495657_0015892 | 3300046675 | Bacteria | 5494 |
| 684 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 685 | Ga0495599_0003681 | 3300046678 | Bacteria | 8984 |
| 686 | Ga0495599_0070954 | 3300046678 | Unclassified | 2174 |
| 687 | Ga0495623_0000001 | 3300046679 | Bacteria | 313861 |
| 688 | Ga0495623_0000394 | 3300046679 | Bacteria | 28821 |
| 689 | Ga0495646_0000013 | 3300046680 | Bacteria | 159700 |
| 690 | Ga0495646_0032905 | 3300046680 | Unclassified | 3224 |
| 691 | Ga0495646_0059294 | 3300046680 | Bacteria | 2286 |
| 692 | Ga0495647_0010228 | 3300046681 | Unclassified | 3192 |
| 693 | Ga0495658_0006676 | 3300046683 | Bacteria | 5671 |
| 694 | Ga0495658_0141296 | 3300046683 | Bacteria | 1472 |
| 695 | Ga0495658_0321906 | 3300046683 | Bacteria | 980 |
| 696 | Ga0495669_0015622 | 3300046684 | Bacteria | 3252 |
| 697 | Ga0495613_0028472 | 3300046689 | Bacteria | 4155 |
| 698 | Ga0495613_0061029 | 3300046689 | Plasmid | 2761 |
| 699 | Ga0495613_0105583 | 3300046689 | Bacteria | 2033 |
| 700 | Ga0495613_0110366 | 3300046689 | Bacteria | 1982 |
| 701 | Ga0495613_0129215 | 3300046689 | Bacteria | 1810 |
| 702 | Ga0495624_0015339 | 3300046690 | Bacteria | 5176 |
| 703 | Ga0495624_0025903 | 3300046690 | Bacteria | 3848 |
| 704 | Ga0495624_0050311 | 3300046690 | Unclassified | 2640 |
| 705 | Ga0495670_0029795 | 3300046691 | Unclassified | 2710 |
| 706 | Ga0495600_0000233 | 3300046809 | Bacteria | 30755 |
| 707 | Ga0495600_0015332 | 3300046809 | Bacteria | 4843 |
| 708 | Ga0495600_0019167 | 3300046809 | Bacteria | 4366 |
| 709 | Ga0495600_0024552 | 3300046809 | Bacteria | 3881 |
| 710 | Ga0495581_0013725 | 3300047315 | Bacteria | 4697 |
| 711 | Ga0495581_0026833 | 3300047315 | Bacteria | 3339 |
| 712 | Ga0495581_0026866 | 3300047315 | Bacteria | 3337 |
| 713 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 714 | Ga0495604_0009872 | 3300047317 | Bacteria | 7557 |
| 715 | Ga0495604_0034454 | 3300047317 | Bacteria | 4005 |
| 716 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 717 | Ga0495674_0015111 | 3300047319 | Bacteria | 7221 |
| 718 | Ga0495674_0068941 | 3300047319 | Bacteria | 3059 |
| 719 | Ga0495674_0093827 | 3300047319 | Bacteria | 2561 |
| 720 | Ga0495676_0041502 | 3300047321 | Bacteria | 3786 |
| 721 | Ga0495676_0092904 | 3300047321 | Bacteria | 2251 |
| 722 | Ga0495680_0000002 | 3300047322 | Bacteria | 197533 |
| 723 | Ga0495680_0021224 | 3300047322 | Bacteria | 5440 |
| 724 | Ga0495680_0100223 | 3300047322 | Bacteria | 2158 |
| 725 | Ga0495680_0228873 | 3300047322 | Unclassified | 1324 |
| 726 | Ga0495675_0000437 | 3300047444 | Bacteria | 27820 |
| 727 | Ga0495675_0001877 | 3300047444 | Bacteria | 12518 |
| 728 | Ga0495675_0016951 | 3300047444 | Bacteria | 4610 |
| 729 | Ga0495684_0000020 | 3300047471 | Bacteria | 148507 |
| 730 | Ga0495684_0002213 | 3300047471 | Bacteria | 15573 |
| 731 | Ga0495684_0011003 | 3300047471 | Bacteria | 6996 |
| 732 | Ga0495684_0021760 | 3300047471 | Bacteria | 4936 |
| 733 | Ga0495684_0044532 | 3300047471 | Bacteria | 3397 |
| 734 | Ga0495684_0122904 | 3300047471 | Bacteria | 1954 |
| 735 | Ga0495684_0126168 | 3300047471 | Bacteria | 1925 |
| 736 | Ga0495593_0003922 | 3300047673 | Bacteria | 8887 |
| 737 | Ga0495593_0004406 | 3300047673 | Bacteria | 8369 |
| 738 | Ga0495593_0034613 | 3300047673 | Bacteria | 2746 |
| 739 | Ga0495593_0058377 | 3300047673 | Bacteria | 2024 |
| 740 | Ga0495593_0130745 | 3300047673 | Unclassified | 1274 |
| 741 | Ga0495602_0000027 | 3300048088 | Bacteria | 145010 |
| 742 | Ga0495602_0009963 | 3300048088 | Bacteria | 9858 |
| 743 | Ga0495602_0145462 | 3300048088 | Unclassified | 1871 |
| 744 | Ga0495602_0185619 | 3300048088 | Bacteria | 1599 |
| 745 | Ga0495614_0002867 | 3300048089 | Bacteria | 7668 |
| 746 | Ga0495614_0023625 | 3300048089 | Bacteria | 2654 |
| 747 | Ga0496100_0002706 | 3300048903 | Bacteria | 9055 |
| 748 | Ga0496100_0099817 | 3300048903 | Bacteria | 1998 |
| 749 | Ga0496101_0010321 | 3300048904 | Bacteria | 6167 |
| 750 | Ga0496101_0019659 | 3300048904 | Bacteria | 4615 |
| 751 | Ga0496102_0006904 | 3300048905 | Bacteria | 9684 |
| 752 | Ga0496102_0035844 | 3300048905 | Bacteria | 4468 |
| 753 | Ga0496102_0569395 | 3300048905 | Bacteria | 1055 |
| 754 | Ga0496103_0005233 | 3300048906 | Bacteria | 7791 |
| 755 | Ga0496103_0034477 | 3300048906 | Bacteria | 3095 |
| 756 | Ga0496103_0046547 | 3300048906 | Bacteria | 2678 |
| 757 | Ga0496103_0203148 | 3300048906 | Bacteria | 1274 |
| 758 | Ga0496104_0000878 | 3300048907 | Bacteria | 25861 |
| 759 | Ga0496104_0002100 | 3300048907 | Bacteria | 17311 |
| 760 | Ga0496104_0022878 | 3300048907 | Bacteria | 5742 |
| 761 | Ga0496104_0052079 | 3300048907 | Bacteria | 3866 |
| 762 | Ga0496104_0086886 | 3300048907 | Bacteria | 2986 |
| 763 | Ga0496104_0093798 | 3300048907 | Bacteria | 2872 |
| 764 | Ga0496105_0000170 | 3300048908 | Bacteria | 43535 |
| 765 | Ga0496105_0004296 | 3300048908 | Bacteria | 10727 |
| 766 | Ga0496105_0011194 | 3300048908 | Bacteria | 7077 |
| 767 | Ga0496106_0004983 | 3300048909 | Bacteria | 9830 |
| 768 | Ga0496106_0043954 | 3300048909 | Unclassified | 3353 |
| 769 | Ga0496106_0235488 | 3300048909 | Bacteria | 1462 |
| 770 | Ga0496107_0001176 | 3300048910 | Bacteria | 15887 |
| 771 | Ga0496107_0007124 | 3300048910 | Bacteria | 7703 |
| 772 | Ga0496107_0079984 | 3300048910 | Bacteria | 2383 |
| 773 | Ga0496107_0108662 | 3300048910 | Bacteria | 2037 |
| 774 | Ga0496107_0118703 | 3300048910 | Bacteria | 1947 |
| 775 | Ga0496107_0199491 | 3300048910 | Bacteria | 1487 |
| 776 | Ga0496108_0009970 | 3300048911 | Bacteria | 7699 |
| 777 | Ga0496108_0037853 | 3300048911 | Bacteria | 4019 |
| 778 | Ga0496108_0096768 | 3300048911 | Bacteria | 2515 |
| 779 | Ga0496109_0001667 | 3300048912 | Bacteria | 18509 |
| 780 | Ga0496109_0002262 | 3300048912 | Bacteria | 16001 |
| 781 | Ga0496109_0036424 | 3300048912 | Bacteria | 4441 |
| 782 | Ga0496109_0179807 | 3300048912 | Bacteria | 1986 |
| 783 | Ga0496109_0473724 | 3300048912 | Bacteria | 1182 |
| 784 | Ga0496110_0049803 | 3300048913 | Bacteria | 3677 |
| 785 | Ga0496110_0053814 | 3300048913 | Bacteria | 3539 |
| 786 | Ga0496110_0074654 | 3300048913 | Bacteria | 3012 |
| 787 | Ga0496110_0078260 | 3300048913 | Bacteria | 2944 |
| 788 | Ga0496111_0030563 | 3300048914 | Bacteria | 3831 |
| 789 | Ga0496111_0084373 | 3300048914 | Bacteria | 2322 |
| 790 | Ga0496111_0333084 | 3300048914 | Bacteria | 1124 |
| 791 | Ga0496111_0365899 | 3300048914 | Bacteria | 1067 |
| 792 | Ga0496112_0004283 | 3300048915 | Bacteria | 12045 |
| 793 | Ga0496112_0046052 | 3300048915 | Bacteria | 4277 |
| 794 | Ga0496112_0078905 | 3300048915 | Unclassified | 3255 |
| 795 | Ga0496113_0066655 | 3300048916 | Bacteria | 2727 |
| 796 | Ga0496113_0100310 | 3300048916 | Bacteria | 2243 |
| 797 | Ga0496113_0286237 | 3300048916 | Bacteria | 1318 |
| 798 | Ga0496114_0009491 | 3300048917 | Bacteria | 7724 |
| 799 | Ga0496114_0028590 | 3300048917 | Bacteria | 4576 |
| 800 | Ga0496114_0285316 | 3300048917 | Bacteria | 1456 |
| 801 | Ga0496115_0009601 | 3300048918 | Bacteria | 7193 |
| 802 | Ga0496115_0016506 | 3300048918 | Bacteria | 5624 |
| 803 | Ga0496115_0040096 | 3300048918 | Bacteria | 3721 |
| 804 | Ga0496115_0063742 | 3300048918 | Bacteria | 2973 |
| 805 | Ga0496116_0031972 | 3300048919 | Bacteria | 3757 |
| 806 | Ga0496124_0004131 | 3300048927 | Bacteria | 17151 |
| 807 | Ga0496125_0005718 | 3300048928 | Bacteria | 13695 |
| 808 | Ga0496126_0002146 | 3300048929 | Bacteria | 27491 |
| 809 | Ga0496126_0094588 | 3300048929 | Bacteria | 2622 |
| 810 | Ga0496126_0177570 | 3300048929 | Bacteria | 1811 |
| 811 | Ga0501074_0021786 | 3300049590 | Bacteria | 4652 |
| 812 | Ga0501076_0088713 | 3300049592 | Bacteria | 2486 |
| 813 | Ga0501080_0020639 | 3300049742 | Bacteria | 6102 |
| 814 | nmdc:mga06z11_46105_c1 | 3300050494 | Bacteria | 2207 |
| 815 | nmdc:mga05p37_22220_c1 | 3300050507 | Bacteria | 7692 |
| 816 | nmdc:mga05p37_786_c1 | 3300050507 | Bacteria | 35281 |
| 817 | nmdc:mga09592_11785_c1 | 3300050508 | Bacteria | 7111 |
| 818 | nmdc:mga0qj67_537_c1 | 3300050509 | Bacteria | 25810 |
| 819 | nmdc:mga06r32_121_c1 | 3300050510 | Bacteria | 55968 |
| 820 | nmdc:mga08y16_105144_c1 | 3300050511 | Bacteria | 2939 |
| 821 | nmdc:mga08y16_12146_c1 | 3300050511 | Bacteria | 9052 |
| 822 | nmdc:mga08y16_309_c1 | 3300050511 | Bacteria | 44098 |
| 823 | nmdc:mga08y16_7306_c1 | 3300050511 | Bacteria | 11594 |
| 824 | nmdc:mga0n895_104_c1 | 3300050512 | Bacteria | 49584 |
| 825 | nmdc:mga0n895_10980_c1 | 3300050512 | Bacteria | 8050 |
| 826 | nmdc:mga0n895_110781_c1 | 3300050512 | Bacteria | 2761 |
| 827 | nmdc:mga0n895_156415_c1 | 3300050512 | Bacteria | 2310 |
| 828 | nmdc:mga0n895_183369_c1 | 3300050512 | Bacteria | 2125 |
| 829 | nmdc:mga0n895_1852_c1 | 3300050512 | Bacteria | 16145 |
| 830 | nmdc:mga0n895_470439_c1 | 3300050512 | Bacteria | 1268 |
| 831 | nmdc:mga0rr50_154643_c1 | 3300050513 | Bacteria | 1857 |
| 832 | nmdc:mga0rr50_170358_c1 | 3300050513 | Bacteria | 1774 |
| 833 | nmdc:mga0rr50_8571_c1 | 3300050513 | Bacteria | 6373 |
| 834 | nmdc:mga08x19_334767_c1 | 3300050514 | Bacteria | 1055 |
| 835 | nmdc:mga0a205_126577_c1 | 3300050515 | Bacteria | 2455 |
| 836 | nmdc:mga0a205_1810_c1 | 3300050515 | Bacteria | 18497 |
| 837 | nmdc:mga0a205_2795_c1 | 3300050515 | Bacteria | 15434 |
| 838 | Ga0495601_0000010 | 3300053077 | Bacteria | 266222 |
| 839 | Ga0495601_0000780 | 3300053077 | Bacteria | 17215 |
| 840 | Ga0495601_0011515 | 3300053077 | Bacteria | 5296 |
| 841 | Ga0495601_0021100 | 3300053077 | Bacteria | 3985 |
| 842 | Ga0495601_0023569 | 3300053077 | Bacteria | 3782 |
| 843 | Ga0495601_0047391 | 3300053077 | Bacteria | 2705 |
| 844 | Ga0495601_0090212 | 3300053077 | Unclassified | 1971 |
| 845 | Ga0495601_0115075 | 3300053077 | Bacteria | 1744 |
| 846 | Ga0495612_0000002 | 3300053078 | Bacteria | 310466 |
| 847 | Ga0495612_0002172 | 3300053078 | Bacteria | 8075 |
| 848 | Ga0495612_0006029 | 3300053078 | Bacteria | 4993 |
| 849 | Ga0495612_0006436 | 3300053078 | Bacteria | 4827 |
| 850 | Ga0495612_0019933 | 3300053078 | Bacteria | 2687 |
| 851 | Ga0495612_0038488 | 3300053078 | Bacteria | 1943 |
| 852 | Ga0495595_0000184 | 3300053084 | Bacteria | 25097 |
| 853 | Ga0495595_0001846 | 3300053084 | Bacteria | 8229 |
| 854 | Ga0495595_0001851 | 3300053084 | Bacteria | 8218 |
| 855 | Ga0495595_0002471 | 3300053084 | Bacteria | 7230 |
| 856 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 857 | Ga0495619_0001456 | 3300053085 | Bacteria | 15595 |
| 858 | Ga0495619_0005827 | 3300053085 | Bacteria | 7809 |
| 859 | Ga0495619_0014152 | 3300053085 | Bacteria | 5037 |
| 860 | Ga0495619_0023627 | 3300053085 | Bacteria | 3942 |
| 861 | Ga0495619_0027380 | 3300053085 | Bacteria | 3670 |
| 862 | Ga0495619_0063585 | 3300053085 | Bacteria | 2458 |
| 863 | Ga0495619_0079005 | 3300053085 | Bacteria | 2212 |
| 864 | Ga0500644_0001910 | 3300053088 | Bacteria | 5347 |
| 865 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 866 | Ga0466962_0041137 | 3300061719 | Bacteria | 2212 |
| 867 | Ga0466962_0118041 | 3300061719 | Bacteria | 1279 |
| 868 | 2929205367 | 2929199973 | Bacteria | 7260745 |
| 869 | 8055914195 | 8055909800 | Bacteria | 7278581 |
| 870 | Ga0207664_10103929 | |||
| 871 | 2214884080 | |||
| 872 | ARSoilYngRDRAFT_c00087 | |||
| 873 | ARSoilYngRDRAFT_c00489 | |||
| 874 | ARcpr5yngRDRAFT_c000053 | |||
| 875 | ARSoilOldRDRAFT_c000064 | |||
| 876 | ARCol0oldRDRAFT_c00196 | |||
| 877 | ARCol0yngRDRAFT_1000047 | |||
| 878 | JGI24746J21847_1000312 | |||
| 879 | JGI24739J22299_10000985 | |||
| 880 | JGI24737J22298_10001495 | |||
| 881 | JGI24750J21931_1000203 | |||
| 882 | JGI24745J21846_1000249 | |||
| 883 | JGI24748J21848_1000789 | |||
| 884 | JGI24738J21930_10001441 | |||
| 885 | JGI24035J26624_1000103 | |||
| 886 | rootH1_10120293 | |||
| 887 | JGI25405J52794_10015249 | |||
| 888 | Ga0065704_10080382 | |||
| 889 | Ga0065712_10017123 | |||
| 890 | Ga0065712_10134843 | |||
| 891 | Ga0065712_10146592 | |||
| 892 | Ga0065715_10090502 | |||
| 893 | Ga0070676_10001056 | |||
| 894 | Ga0070683_100003491 | |||
| 895 | Ga0070690_100008492 | |||
| 896 | Ga0070670_100007890 | |||
| 897 | Ga0070670_100196981 | |||
| 898 | Ga0070670_100288925 | |||
| 899 | Ga0070677_10000206 | |||
| 900 | Ga0068869_100012026 | |||
| 901 | Ga0068869_100375119 | |||
| 902 | Ga0070666_10005855 | |||
| 903 | Ga0070666_10007454 | |||
| 904 | Ga0070680_100014216 | |||
| 905 | Ga0070680_100031681 | |||
| 906 | Ga0070682_100001749 | |||
| 907 | Ga0068868_100019471 | |||
| 908 | Ga0070660_100002617 | |||
| 909 | Ga0070689_100006306 | |||
| 910 | Ga0070689_100045727 | |||
| 911 | Ga0070691_10004394 | |||
| 912 | Ga0070687_100005432 | |||
| 913 | Ga0070687_100089785 | |||
| 914 | Ga0070687_100138053 | |||
| 915 | Ga0070661_100006928 | |||
| 916 | Ga0070692_10002854 | |||
| 917 | Ga0070692_10079654 | |||
| 918 | Ga0070668_100000882 | |||
| 919 | Ga0070669_100002256 | |||
| 920 | Ga0070675_100001384 | |||
| 921 | Ga0070675_100126887 | |||
| 922 | Ga0070671_100001328 | |||
| 923 | Ga0070671_100038217 | |||
| 924 | Ga0070671_100081005 | |||
| 925 | Ga0070674_100002239 | |||
| 926 | Ga0070674_100023992 | |||
| 927 | Ga0070674_100027750 | |||
| 928 | Ga0070674_100051249 | |||
| 929 | Ga0070673_100002806 | |||
| 930 | Ga0070673_100005819 | |||
| 931 | Ga0070688_100007431 | |||
| 932 | Ga0070688_100012208 | |||
| 933 | Ga0070688_100022305 | |||
| 934 | Ga0070688_100064310 | |||
| 935 | Ga0070659_100007170 | |||
| 936 | Ga0070659_100103368 | |||
| 937 | Ga0070667_100003216 | |||
| 938 | Ga0070703_10006414 | |||
| 939 | Ga0070714_100034654 | |||
| 940 | Ga0070714_100154904 | |||
| 941 | Ga0070713_100045738 | |||
| 942 | Ga0070713_100131207 | |||
| 943 | Ga0070713_100302116 | |||
| 944 | Ga0070710_10021309 | |||
| 945 | Ga0070710_10089656 | |||
| 946 | Ga0070701_10007610 | |||
| 947 | Ga0070701_10093006 | |||
| 948 | Ga0070711_100058095 | |||
| 949 | Ga0070711_100087855 | |||
| 950 | Ga0070711_100129259 | |||
| 951 | Ga0070711_100228874 | |||
| 952 | Ga0070711_100239739 | |||
| 953 | Ga0070705_100012725 | |||
| 954 | Ga0070700_100000556 | |||
| 955 | Ga0070700_100198484 | |||
| 956 | Ga0070694_100001349 | |||
| 957 | Ga0070694_100216223 | |||
| 958 | Ga0070708_100026811 | |||
| 959 | Ga0070708_100321334 | |||
| 960 | Ga0070663_100006533 | |||
| 961 | Ga0070663_100010686 | |||
| 962 | Ga0070663_100040889 | |||
| 963 | Ga0070663_100086354 | |||
| 964 | Ga0070663_100128263 | |||
| 965 | Ga0070678_100028145 | |||
| 966 | Ga0070678_100055277 | |||
| 967 | Ga0070678_100171754 | |||
| 968 | Ga0070662_100006933 | |||
| 969 | Ga0070662_100168810 | |||
| 970 | Ga0070681_10013387 | |||
| 971 | Ga0070681_10048783 | |||
| 972 | Ga0070681_10075267 | |||
| 973 | Ga0068867_100002573 | |||
| 974 | Ga0068867_100091628 | |||
| 975 | Ga0068867_100287083 | |||
| 976 | Ga0070685_10001130 | |||
| 977 | Ga0070685_10037180 | |||
| 978 | Ga0070679_100012382 | |||
| 979 | Ga0070679_100057663 | |||
| 980 | Ga0070679_100163207 | |||
| 981 | Ga0070684_100021825 | |||
| 982 | Ga0070684_100026880 | |||
| 983 | Ga0070684_100087654 | |||
| 984 | Ga0070697_100049880 | |||
| 985 | Ga0068853_100000906 | |||
| 986 | Ga0070672_100000679 | |||
| 987 | Ga0070686_100001681 | |||
| 988 | Ga0070686_100029763 | |||
| 989 | Ga0070686_100059649 | |||
| 990 | Ga0070695_100007010 | |||
| 991 | Ga0070696_100035611 | |||
| 992 | Ga0070696_100335150 | |||
| 993 | Ga0070693_100003374 | |||
| 994 | Ga0070665_100107509 | |||
| 995 | Ga0070665_100131945 | |||
| 996 | Ga0070665_100157786 | |||
| 997 | Ga0070704_100011666 | |||
| 998 | Ga0070704_100063568 | |||
| 999 | Ga0068855_100005213 | |||
| 1000 | Ga0068855_100067138 | |||
| 1001 | Ga0070664_100008267 | |||
| 1002 | Ga0070664_100071818 | |||
| 1003 | Ga0070664_100184007 | |||
| 1004 | Ga0068857_100024411 | |||
| 1005 | Ga0068857_100089731 | |||
| 1006 | Ga0068857_100379340 | |||
| 1007 | Ga0068854_100001485 | |||
| 1008 | Ga0068856_100000013 | |||
| 1009 | Ga0068856_100004080 | |||
| 1010 | Ga0070702_100004190 | |||
| 1011 | Ga0070702_100143723 | |||
| 1012 | Ga0068852_100009647 | |||
| 1013 | Ga0068859_100003498 | |||
| 1014 | Ga0068859_100068433 | |||
| 1015 | Ga0068859_100304340 | |||
| 1016 | Ga0068864_100006196 | |||
| 1017 | Ga0068864_100097020 | |||
| 1018 | Ga0068864_100110565 | |||
| 1019 | Ga0068864_100134900 | |||
| 1020 | Ga0068864_100258890 | |||
| 1021 | Ga0068866_10002003 | |||
| 1022 | Ga0068866_10062811 | |||
| 1023 | Ga0068866_10262732 | |||
| 1024 | Ga0068861_100029256 | |||
| 1025 | Ga0068870_10004133 | |||
| 1026 | Ga0068870_10140008 | |||
| 1027 | Ga0068863_100002935 | |||
| 1028 | Ga0068863_100398028 | |||
| 1029 | Ga0068858_100013279 | |||
| 1030 | Ga0068858_100102721 | |||
| 1031 | Ga0068860_100002542 | |||
| 1032 | Ga0068860_100072832 | |||
| 1033 | Ga0068860_100414830 | |||
| 1034 | Ga0068862_100006476 | |||
| 1035 | Ga0081455_10001284 | |||
| 1036 | Ga0081455_10004026 | |||
| 1037 | Ga0081455_10026742 | |||
| 1038 | Ga0081540_1051714 | |||
| 1039 | Ga0070717_10154874 | |||
| 1040 | Ga0070717_10331340 | |||
| 1041 | Ga0075432_10007074 | |||
| 1042 | Ga0070715_10068129 | |||
| 1043 | Ga0070716_100009608 | |||
| 1044 | Ga0070712_100015646 | |||
| 1045 | Ga0070712_100147720 | |||
| 1046 | Ga0075367_10076810 | |||
| 1047 | Ga0097621_100011406 | |||
| 1048 | Ga0068871_100018905 | |||
| 1049 | Ga0075428_100004320 | |||
| 1050 | Ga0075430_100231934 | |||
| 1051 | Ga0075431_100185504 | |||
| 1052 | Ga0075433_10000029 | |||
| 1053 | Ga0075433_10007719 | |||
| 1054 | Ga0075433_10023855 | |||
| 1055 | Ga0075433_10055372 | |||
| 1056 | Ga0075434_100000208 | |||
| 1057 | Ga0075434_100001333 | |||
| 1058 | Ga0075434_100037538 | |||
| 1059 | Ga0075434_100037751 | |||
| 1060 | Ga0075434_100126033 | |||
| 1061 | Ga0075434_100202518 | |||
| 1062 | Ga0075429_100207077 | |||
| 1063 | Ga0068865_100001418 | |||
| 1064 | Ga0068865_100065230 | |||
| 1065 | Ga0068865_100255669 | |||
| 1066 | Ga0075436_100059762 | |||
| 1067 | Ga0097620_100003498 | |||
| 1068 | Ga0097620_100068431 | |||
| 1069 | Ga0097620_100304332 | |||
| 1070 | Ga0075435_100010419 | |||
| 1071 | Ga0075435_100081701 | |||
| 1072 | Ga0075435_100215619 | |||
| 1073 | Ga0105250_10023895 | |||
| 1074 | Ga0105240_10012832 | |||
| 1075 | Ga0105240_10041886 | |||
| 1076 | Ga0105240_10411823 | |||
| 1077 | Ga0111539_10000345 | |||
| 1078 | Ga0111539_10002114 | |||
| 1079 | Ga0111539_10066957 | |||
| 1080 | Ga0111539_10191820 | |||
| 1081 | Ga0105245_10002739 | |||
| 1082 | Ga0105245_10093138 | |||
| 1083 | Ga0105245_10098474 | |||
| 1084 | Ga0105247_10004019 | |||
| 1085 | Ga0105247_10013262 | |||
| 1086 | Ga0105247_10186717 | |||
| 1087 | Ga0114129_10035787 | |||
| 1088 | Ga0114129_10333964 | |||
| 1089 | Ga0114129_10532762 | |||
| 1090 | Ga0105243_10002166 | |||
| 1091 | Ga0105241_10004380 | |||
| 1092 | Ga0105241_10061853 | |||
| 1093 | Ga0105241_10085225 | |||
| 1094 | Ga0105242_10037470 | |||
| 1095 | Ga0105248_10002844 | |||
| 1096 | Ga0105248_10057459 | |||
| 1097 | Ga0105248_10091855 | |||
| 1098 | Ga0105248_10295214 | |||
| 1099 | Ga0105248_10489030 | |||
| 1100 | Ga0105248_10525166 | |||
| 1101 | Ga0105237_10013429 | |||
| 1102 | Ga0105237_10021168 | |||
| 1103 | Ga0105237_10073702 | |||
| 1104 | Ga0105237_10445792 | |||
| 1105 | Ga0105238_10057687 | |||
| 1106 | Ga0105238_10134819 | |||
| 1107 | Ga0105249_10010187 | |||
| 1108 | Ga0105239_10005997 | |||
| 1109 | Ga0105239_10073245 | |||
| 1110 | Ga0105239_10076690 | |||
| 1111 | Ga0105239_10186134 | |||
| 1112 | Ga0105246_10004149 | |||
| 1113 | Ga0105246_10124323 | |||
| 1114 | Ga0157373_10006523 | |||
| 1115 | Ga0157369_10000848 | |||
| 1116 | Ga0157369_10062683 | |||
| 1117 | Ga0157374_10008496 | |||
| 1118 | Ga0157374_10015440 | |||
| 1119 | Ga0157374_10208350 | |||
| 1120 | Ga0157378_10011772 | |||
| 1121 | Ga0157378_10059516 | |||
| 1122 | Ga0163162_10004494 | |||
| 1123 | Ga0163162_10106664 | |||
| 1124 | Ga0163162_10685782 | |||
| 1125 | Ga0157372_10046139 | |||
| 1126 | Ga0157375_10038679 | |||
| 1127 | Ga0157375_10038977 | |||
| 1128 | Ga0157375_10115203 | |||
| 1129 | Ga0163163_10010926 | |||
| 1130 | Ga0163163_10025845 | |||
| 1131 | Ga0163163_10050056 | |||
| 1132 | Ga0163163_10321653 | |||
| 1133 | Ga0157380_10009077 | |||
| 1134 | Ga0157377_10002192 | |||
| 1135 | Ga0157377_10162636 | |||
| 1136 | Ga0157379_10002658 | |||
| 1137 | Ga0157379_10027483 | |||
| 1138 | Ga0157379_10124319 | |||
| 1139 | Ga0157376_10003174 | |||
| 1140 | Ga0157376_10005599 | |||
| 1141 | Ga0163161_10001452 | |||
| 1142 | Ga0163161_10035410 | |||
| 1143 | Ga0213876_10023662 | |||
| 1144 | Ga0228598_1014983 | |||
| 1145 | Ga0207666_1000032 | |||
| 1146 | Ga0207673_1000021 | |||
| 1147 | Ga0207697_10000192 | |||
| 1148 | Ga0207656_10042008 | |||
| 1149 | Ga0207656_10051615 | |||
| 1150 | Ga0207713_1021420 | |||
| 1151 | Ga0207653_10001002 | |||
| 1152 | Ga0207682_10000056 | |||
| 1153 | Ga0207692_10007243 | |||
| 1154 | Ga0207642_10028901 | |||
| 1155 | Ga0207710_10014280 | |||
| 1156 | Ga0207710_10048604 | |||
| 1157 | Ga0207688_10000066 | |||
| 1158 | Ga0207688_10039303 | |||
| 1159 | Ga0207688_10113063 | |||
| 1160 | Ga0207680_10007602 | |||
| 1161 | Ga0207647_10004193 | |||
| 1162 | Ga0207647_10078582 | |||
| 1163 | Ga0207647_10082832 | |||
| 1164 | Ga0207699_10024636 | |||
| 1165 | Ga0207645_10006176 | |||
| 1166 | Ga0207645_10027343 | |||
| 1167 | Ga0207645_10029375 | |||
| 1168 | Ga0207643_10000187 | |||
| 1169 | Ga0207643_10022074 | |||
| 1170 | Ga0207654_10003683 | |||
| 1171 | Ga0207707_10009866 | |||
| 1172 | Ga0207707_10018653 | |||
| 1173 | Ga0207707_10080750 | |||
| 1174 | Ga0207707_10095117 | |||
| 1175 | Ga0207695_10290248 | |||
| 1176 | Ga0207695_10298115 | |||
| 1177 | Ga0207671_10178498 | |||
| 1178 | Ga0207693_10001676 | |||
| 1179 | Ga0207693_10015923 | |||
| 1180 | Ga0207693_10075345 | |||
| 1181 | Ga0207693_10115587 | |||
| 1182 | Ga0207663_10011824 | |||
| 1183 | Ga0207663_10091766 | |||
| 1184 | Ga0207663_10143380 | |||
| 1185 | Ga0207660_10006714 | |||
| 1186 | Ga0207662_10000292 | |||
| 1187 | Ga0207662_10052636 | |||
| 1188 | Ga0207662_10067919 | |||
| 1189 | Ga0207662_10095023 | |||
| 1190 | Ga0207657_10001630 | |||
| 1191 | Ga0207657_10077442 | |||
| 1192 | Ga0207649_10001002 | |||
| 1193 | Ga0207652_10090398 | |||
| 1194 | Ga0207652_10091832 | |||
| 1195 | Ga0207652_10100881 | |||
| 1196 | Ga0207652_10472992 | |||
| 1197 | Ga0207681_10006515 | |||
| 1198 | Ga0207650_10048649 | |||
| 1199 | Ga0207650_10119341 | |||
| 1200 | Ga0207659_10002407 | |||
| 1201 | Ga0207659_10055975 | |||
| 1202 | Ga0207687_10003001 | |||
| 1203 | Ga0207687_10140247 | |||
| 1204 | Ga0207687_10203058 | |||
| 1205 | Ga0207700_10007834 | |||
| 1206 | Ga0207700_10124688 | |||
| 1207 | Ga0207700_10157349 | |||
| 1208 | Ga0207700_10214902 | |||
| 1209 | Ga0207664_10124765 | |||
| 1210 | Ga0207664_10136882 | |||
| 1211 | Ga0207644_10003646 | |||
| 1212 | Ga0207644_10007286 | |||
| 1213 | Ga0207644_10026516 | |||
| 1214 | Ga0207690_10001213 | |||
| 1215 | Ga0207706_10009370 | |||
| 1216 | Ga0207706_10042486 | |||
| 1217 | Ga0207706_10081753 | |||
| 1218 | Ga0207686_10007500 | |||
| 1219 | Ga0207709_10001124 | |||
| 1220 | Ga0207709_10069079 | |||
| 1221 | Ga0207670_10001034 | |||
| 1222 | Ga0207670_10007190 | |||
| 1223 | Ga0207670_10078691 | |||
| 1224 | Ga0207669_10000578 | |||
| 1225 | Ga0207669_10033689 | |||
| 1226 | Ga0207669_10035046 | |||
| 1227 | Ga0207669_10060100 | |||
| 1228 | Ga0207704_10001542 | |||
| 1229 | Ga0207704_10059216 | |||
| 1230 | Ga0207665_10002127 | |||
| 1231 | Ga0207665_10074485 | |||
| 1232 | Ga0207691_10002805 | |||
| 1233 | Ga0207711_10009683 | |||
| 1234 | Ga0207711_10011676 | |||
| 1235 | Ga0207711_10019987 | |||
| 1236 | Ga0207689_10001239 | |||
| 1237 | Ga0207689_10197242 | |||
| 1238 | Ga0207661_10002038 | |||
| 1239 | Ga0207661_10213555 | |||
| 1240 | Ga0207679_10000128 | |||
| 1241 | Ga0207679_10000187 | |||
| 1242 | Ga0207679_10000529 | |||
| 1243 | Ga0207667_10035917 | |||
| 1244 | Ga0207667_10293448 | |||
| 1245 | Ga0207651_10005107 | |||
| 1246 | Ga0207712_10000520 | |||
| 1247 | Ga0207668_10000260 | |||
| 1248 | Ga0207640_10006747 | |||
| 1249 | Ga0207640_10051876 | |||
| 1250 | Ga0207658_10005448 | |||
| 1251 | Ga0207677_10032773 | |||
| 1252 | Ga0207703_10016150 | |||
| 1253 | Ga0207703_10152689 | |||
| 1254 | Ga0207639_10008245 | |||
| 1255 | Ga0207639_10318692 | |||
| 1256 | Ga0207678_10007149 | |||
| 1257 | Ga0207678_10014682 | |||
| 1258 | Ga0207678_10053436 | |||
| 1259 | Ga0207678_10182125 | |||
| 1260 | Ga0207708_10001080 | |||
| 1261 | Ga0207708_10091141 | |||
| 1262 | Ga0207708_10113557 | |||
| 1263 | Ga0207702_10000090 | |||
| 1264 | Ga0207702_10326241 | |||
| 1265 | Ga0207641_10006255 | |||
| 1266 | Ga0207641_10103942 | |||
| 1267 | Ga0207641_10292024 | |||
| 1268 | Ga0207648_10001031 | |||
| 1269 | Ga0207648_10036632 | |||
| 1270 | Ga0207676_10007274 | |||
| 1271 | Ga0207674_10000686 | |||
| 1272 | Ga0207674_10033888 | |||
| 1273 | Ga0207674_10056651 | |||
| 1274 | Ga0207674_10111775 | |||
| 1275 | Ga0207675_100002806 | |||
| 1276 | Ga0207675_100171011 | |||
| 1277 | Ga0207683_10001686 | |||
| 1278 | Ga0207683_10002136 | |||
| 1279 | Ga0207683_10006803 | |||
| 1280 | Ga0207683_10036985 | |||
| 1281 | Ga0207698_10007006 | |||
| 1282 | Ga0207698_10244519 | |||
| 1283 | Ga0207698_10245318 | |||
| 1284 | Ga0209998_10001494 | |||
| 1285 | Ga0209974_10000101 | |||
| 1286 | Ga0207428_10000360 | |||
| 1287 | Ga0207428_10000556 | |||
| 1288 | Ga0207428_10006906 | |||
| 1289 | Ga0268266_10110354 | |||
| 1290 | Ga0268265_10000526 | |||
| 1291 | Ga0268264_10002582 | |||
| 1292 | Ga0265337_1000923 | |||
| 1293 | Ga0265318_10009497 | |||
| 1294 | Ga0265338_10075379 | |||
| 1295 | Ga0265338_10086764 | |||
| 1296 | Ga0265763_1000022 | |||
| 1297 | Ga0265760_10049290 | |||
| 1298 | Ga0265330_10056518 | |||
| 1299 | Ga0265332_10107931 | |||
| 1300 | Ga0265320_10009858 | |||
| 1301 | Ga0265325_10022783 | |||
| 1302 | Ga0265325_10030323 | |||
| 1303 | Ga0265325_10068982 | |||
| 1304 | Ga0265329_10010635 | |||
| 1305 | Ga0265340_10016642 | |||
| 1306 | Ga0265339_10000038 | |||
| 1307 | Ga0265339_10009421 | |||
| 1308 | Ga0265339_10010951 | |||
| 1309 | Ga0265339_10023221 | |||
| 1310 | Ga0265316_10188829 | |||
| 1311 | Ga0265316_10213857 | |||
| 1312 | Ga0265316_10216877 | |||
| 1313 | Ga0265313_10000034 | |||
| 1314 | Ga0265313_10002885 | |||
| 1315 | Ga0265313_10026895 | |||
| 1316 | Ga0265314_10002042 | |||
| 1317 | Ga0265314_10005437 | |||
| 1318 | Ga0265314_10027527 | |||
| 1319 | Ga0265342_10115049 | |||
| 1320 | Ga0307516_10284070 | |||
| 1321 | Ga0373930_0005389 | |||
| 1322 | Ga0373948_0000653 | |||
| 1323 | Ga0373950_0002536 | |||
| 1324 | Ga0373950_0010850 | |||
| 1325 | Ga0373958_0000128 | |||
| 1326 | Ga0373958_0001016 | |||
| 1327 | Ga0373959_0001211 | |||
| 1328 | Ga0373938_0000039 | |||
| 1329 | Ga0373938_0003571 | |||
| 1330 | Ga0373926_0036813 | |||
| 1331 | Ga0373928_0000780 | |||
| 1332 | Ga0373928_0000840 | |||
| 1333 | Ga0373929_0000209 | |||
| 1334 | Ga0373929_0001461 | |||
| 1335 | Ga0373940_0001653 | |||
| 1336 | Ga0373944_0072813 | |||
| 1337 | Ga0373949_0003694 | |||
| 1338 | Ga0373949_0004971 | |||
| 1339 | Ga0373949_0010465 | |||
| 1340 | Ga0373951_0001984 | |||
| 1341 | Ga0373951_0003922 | |||
| 1342 | Ga0373952_0000127 | |||
| 1343 | Ga0373952_0006066 | |||
| 1344 | Ga0373952_0012769 | |||
| 1345 | Ga0373923_0002024 | |||
| 1346 | Ga0373932_0000284 | |||
| 1347 | Ga0373932_0000942 | |||
| 1348 | Ga0373936_0011642 | |||
| 1349 | Ga0373939_0001563 | |||
| 1350 | Ga0373939_0010809 | |||
| 1351 | Ga0373941_0000214 | |||
| 1352 | Ga0373941_0021725 | |||
| 1353 | Ga0373945_0001162 | |||
| 1354 | Ga0373945_0024944 | |||
| 1355 | Ga0373945_0028582 | |||
| 1356 | Ga0373945_0032981 | |||
| 1357 | Ga0373953_0018375 | |||
| 1358 | Ga0373953_0065617 | |||
| 1359 | Ga0373953_0091158 | |||
| 1360 | Ga0373954_0000797 | |||
| 1361 | Ga0373954_0001989 | |||
| 1362 | Ga0373956_0029526 | |||
| 1363 | Ga0373957_0006608 | |||
| 1364 | Ga0373957_0013318 | |||
| 1365 | Ga0373957_0021825 | |||
| 1366 | Ga0373960_0004672 | |||
| 1367 | Ga0373960_0005071 | |||
| 1368 | Ga0373943_0003311 | |||
| 1369 | Ga0373943_0005072 | |||
| 1370 | Ga0373943_0024444 | |||
| 1371 | Ga0373943_0030273 | |||
| 1372 | Ga0373946_0000764 | |||
| 1373 | Ga0373946_0009266 | |||
| 1374 | Ga0373946_0033861 | |||
| 1375 | Ga0373955_0000425 | |||
| 1376 | Ga0373955_0001166 | |||
| 1377 | Ga0373955_0008057 | |||
| 1378 | Ga0373942_0000702 | |||
| 1379 | Ga0373942_0002546 | |||
| 1380 | Ga0373961_0003562 | |||
| 1381 | Ga0373962_0000320 | |||
| 1382 | Ga0373962_0000506 | |||
| 1383 | Ga0373924_0056104 | |||
| 1384 | Ga0373931_0006810 | |||
| 1385 | Ga0373931_0007585 | |||
| 1386 | Ga0373931_0086171 | |||
| 1387 | Ga0373931_0266514 | |||
| 1388 | Ga0373935_0000337 | |||
| 1389 | Ga0373935_0021184 | |||
| 1390 | Ga0373935_0041444 | |||
| 1391 | Ga0373935_0055426 | |||
| 1392 | Ga0373935_0061923 | |||
| 1393 | Ga0373927_0000699 | |||
| 1394 | Ga0373927_0022633 | |||
| 1395 | Ga0373927_0050128 | |||
| 1396 | Ga0373927_0080021 | |||
| 1397 | Ga0373927_0170494 | |||
| 1398 | Ga0373927_0176248 | |||
| 1399 | Ga0373927_0180697 | |||
| 1400 | Ga0373933_0001172 | |||
| 1401 | Ga0373933_0003551 | |||
| 1402 | Ga0373933_0003679 | |||
| 1403 | Ga0373933_0017476 | |||
| 1404 | Ga0373933_0196324 | |||
| 1405 | Ga0373947_0000274 | |||
| 1406 | Ga0373947_0001536 | |||
| 1407 | Ga0373947_0056467 | |||
| 1408 | Ga0373947_0057811 | |||
| 1409 | Ga0373937_0000597 | |||
| 1410 | Ga0373937_0002771 | |||
| 1411 | Ga0373937_0006032 | |||
| 1412 | Ga0373937_0046150 | |||
| 1413 | Ga0373937_0073593 | |||
| 1414 | Ga0373937_0135835 | |||
| 1415 | Ga0373925_0000741 | |||
| 1416 | Ga0373925_0001836 | |||
| 1417 | Ga0373925_0009897 | |||
| 1418 | Ga0373925_0028027 | |||
| 1419 | Ga0373925_0175301 | |||
| 1420 | Ga0373925_0372685 | |||
| 1421 | Ga0395899_0007276 | |||
| 1422 | Ga0395899_0173053 | |||
| 1423 | Ga0395900_0003202 | |||
| 1424 | Ga0395900_0010704 | |||
| 1425 | Ga0395900_0054446 | |||
| 1426 | Ga0395900_0104076 | |||
| 1427 | Ga0395898_0029199 | |||
| 1428 | Ga0395898_0030701 | |||
| 1429 | Ga0395901_0024663 | |||
| 1430 | Ga0395901_0064016 | |||
| 1431 | Ga0436365_0590132 | |||
| 1432 | Ga0466966_0160596 | |||
| 1433 | Ga0466966_0175618 | |||
| 1434 | Ga0466963_0053798 | |||
| 1435 | Ga0466963_0147173 | |||
| 1436 | Ga0466964_0041270 | |||
| 1437 | Ga0453684_0443164 | |||
| 1438 | Ga0466971_0022105 | |||
| 1439 | Ga0466957_0025668 | |||
| 1440 | Ga0466957_0063764 | |||
| 1441 | Ga0495592_0000188 | |||
| 1442 | Ga0495592_0003488 | |||
| 1443 | Ga0495592_0003644 | |||
| 1444 | Ga0495592_0181229 | |||
| 1445 | Ga0495603_0063474 | |||
| 1446 | Ga0495629_0002114 | |||
| 1447 | Ga0495629_0051344 | |||
| 1448 | Ga0495629_0051389 | |||
| 1449 | Ga0495641_0006360 | |||
| 1450 | Ga0495651_0001439 | |||
| 1451 | Ga0495651_0074300 | |||
| 1452 | Ga0495651_0075602 | |||
| 1453 | Ga0495651_0085288 | |||
| 1454 | Ga0495653_0000198 | |||
| 1455 | Ga0495653_0010944 | |||
| 1456 | Ga0495653_0017035 | |||
| 1457 | Ga0495653_0257998 | |||
| 1458 | Ga0495580_0006784 | |||
| 1459 | Ga0495580_0090746 | |||
| 1460 | Ga0495580_0105681 | |||
| 1461 | Ga0495582_0001989 | |||
| 1462 | Ga0495582_0010759 | |||
| 1463 | Ga0495639_0019753 | |||
| 1464 | Ga0495639_0055054 | |||
| 1465 | Ga0495639_0079858 | |||
| 1466 | Ga0495639_0228400 | |||
| 1467 | Ga0495662_0000720 | |||
| 1468 | Ga0495662_0005913 | |||
| 1469 | Ga0495662_0015270 | |||
| 1470 | Ga0495662_0019754 | |||
| 1471 | Ga0495664_0000002 | |||
| 1472 | Ga0495664_0000584 | |||
| 1473 | Ga0495664_0004997 | |||
| 1474 | Ga0495664_0081533 | |||
| 1475 | Ga0495664_0116827 | |||
| 1476 | Ga0495664_0127500 | |||
| 1477 | Ga0495584_0047311 | |||
| 1478 | Ga0495585_0009108 | |||
| 1479 | Ga0495594_0099009 | |||
| 1480 | Ga0495607_0018871 | |||
| 1481 | Ga0495607_0170636 | |||
| 1482 | Ga0495608_0000009 | |||
| 1483 | Ga0495608_0048818 | |||
| 1484 | Ga0495608_0073249 | |||
| 1485 | Ga0495618_0000005 | |||
| 1486 | Ga0495618_0002882 | |||
| 1487 | Ga0495618_0033591 | |||
| 1488 | Ga0495618_0058446 | |||
| 1489 | Ga0495628_0000002 | |||
| 1490 | Ga0495628_0009056 | |||
| 1491 | Ga0495628_0033882 | |||
| 1492 | Ga0495628_0059495 | |||
| 1493 | Ga0495630_0000614 | |||
| 1494 | Ga0495630_0025217 | |||
| 1495 | Ga0495630_0061694 | |||
| 1496 | Ga0495630_0110416 | |||
| 1497 | Ga0495630_0132387 | |||
| 1498 | Ga0495631_0060519 | |||
| 1499 | Ga0495644_0001230 | |||
| 1500 | Ga0495666_0005058 | |||
| 1501 | Ga0495666_0043477 | |||
| 1502 | Ga0495652_0000004 | |||
| 1503 | Ga0495652_0009251 | |||
| 1504 | Ga0495652_0019750 | |||
| 1505 | Ga0495652_0045220 | |||
| 1506 | Ga0495652_0060267 | |||
| 1507 | Ga0495652_0187831 | |||
| 1508 | Ga0495665_0005753 | |||
| 1509 | Ga0495665_0006707 | |||
| 1510 | Ga0495665_0034270 | |||
| 1511 | Ga0495665_0056695 | |||
| 1512 | Ga0495640_0000005 | |||
| 1513 | Ga0495640_0009209 | |||
| 1514 | Ga0495640_0017003 | |||
| 1515 | Ga0495640_0031918 | |||
| 1516 | Ga0495640_0069901 | |||
| 1517 | Ga0495640_0110465 | |||
| 1518 | Ga0495586_0027039 | |||
| 1519 | Ga0495586_0048545 | |||
| 1520 | Ga0495586_0106107 | |||
| 1521 | Ga0495587_0000007 | |||
| 1522 | Ga0495587_0027972 | |||
| 1523 | Ga0495598_0034709 | |||
| 1524 | Ga0495645_0000003 | |||
| 1525 | Ga0495645_0004356 | |||
| 1526 | Ga0495645_0004437 | |||
| 1527 | Ga0495645_0062811 | |||
| 1528 | Ga0495645_0110853 | |||
| 1529 | Ga0495622_0032570 | |||
| 1530 | Ga0495633_0010995 | |||
| 1531 | Ga0495667_0000002 | |||
| 1532 | Ga0495667_0006822 | |||
| 1533 | Ga0495667_0009615 | |||
| 1534 | Ga0495667_0034173 | |||
| 1535 | Ga0495667_0120959 | |||
| 1536 | Ga0495667_0157123 | |||
| 1537 | Ga0495656_0012639 | |||
| 1538 | Ga0495634_0000129 | |||
| 1539 | Ga0495634_0003005 | |||
| 1540 | Ga0495634_0021910 | |||
| 1541 | Ga0495634_0022328 | |||
| 1542 | Ga0495634_0047801 | |||
| 1543 | Ga0495635_0000289 | |||
| 1544 | Ga0495635_0003450 | |||
| 1545 | Ga0495635_0014790 | |||
| 1546 | Ga0495635_0023231 | |||
| 1547 | Ga0495635_0073532 | |||
| 1548 | Ga0495659_0008534 | |||
| 1549 | Ga0495661_0068880 | |||
| 1550 | Ga0495588_0006106 | |||
| 1551 | Ga0495657_0000781 | |||
| 1552 | Ga0495657_0015892 | |||
| 1553 | Ga0495599_0000001 | |||
| 1554 | Ga0495599_0003681 | |||
| 1555 | Ga0495599_0070954 | |||
| 1556 | Ga0495623_0000001 | |||
| 1557 | Ga0495623_0000394 | |||
| 1558 | Ga0495646_0000013 | |||
| 1559 | Ga0495646_0032905 | |||
| 1560 | Ga0495646_0059294 | |||
| 1561 | Ga0495647_0010228 | |||
| 1562 | Ga0495658_0006676 | |||
| 1563 | Ga0495658_0141296 | |||
| 1564 | Ga0495658_0321906 | |||
| 1565 | Ga0495669_0015622 | |||
| 1566 | Ga0495613_0028472 | |||
| 1567 | Ga0495613_0061029 | |||
| 1568 | Ga0495613_0105583 | |||
| 1569 | Ga0495613_0110366 | |||
| 1570 | Ga0495613_0129215 | |||
| 1571 | Ga0495624_0015339 | |||
| 1572 | Ga0495624_0025903 | |||
| 1573 | Ga0495624_0050311 | |||
| 1574 | Ga0495670_0029795 | |||
| 1575 | Ga0495600_0000233 | |||
| 1576 | Ga0495600_0015332 | |||
| 1577 | Ga0495600_0019167 | |||
| 1578 | Ga0495600_0024552 | |||
| 1579 | Ga0495581_0013725 | |||
| 1580 | Ga0495581_0026833 | |||
| 1581 | Ga0495581_0026866 | |||
| 1582 | Ga0495604_0000005 | |||
| 1583 | Ga0495604_0009872 | |||
| 1584 | Ga0495604_0034454 | |||
| 1585 | Ga0495674_0000003 | |||
| 1586 | Ga0495674_0015111 | |||
| 1587 | Ga0495674_0068941 | |||
| 1588 | Ga0495674_0093827 | |||
| 1589 | Ga0495676_0041502 | |||
| 1590 | Ga0495676_0092904 | |||
| 1591 | Ga0495680_0000002 | |||
| 1592 | Ga0495680_0021224 | |||
| 1593 | Ga0495680_0100223 | |||
| 1594 | Ga0495680_0228873 | |||
| 1595 | Ga0495675_0000437 | |||
| 1596 | Ga0495675_0001877 | |||
| 1597 | Ga0495675_0016951 | |||
| 1598 | Ga0495684_0000020 | |||
| 1599 | Ga0495684_0002213 | |||
| 1600 | Ga0495684_0011003 | |||
| 1601 | Ga0495684_0021760 | |||
| 1602 | Ga0495684_0044532 | |||
| 1603 | Ga0495684_0122904 | |||
| 1604 | Ga0495684_0126168 | |||
| 1605 | Ga0495593_0003922 | |||
| 1606 | Ga0495593_0004406 | |||
| 1607 | Ga0495593_0034613 | |||
| 1608 | Ga0495593_0058377 | |||
| 1609 | Ga0495593_0130745 | |||
| 1610 | Ga0495602_0000027 | |||
| 1611 | Ga0495602_0009963 | |||
| 1612 | Ga0495602_0145462 | |||
| 1613 | Ga0495602_0185619 | |||
| 1614 | Ga0495614_0002867 | |||
| 1615 | Ga0495614_0023625 | |||
| 1616 | Ga0496100_0002706 | |||
| 1617 | Ga0496100_0099817 | |||
| 1618 | Ga0496101_0010321 | |||
| 1619 | Ga0496101_0019659 | |||
| 1620 | Ga0496102_0006904 | |||
| 1621 | Ga0496102_0035844 | |||
| 1622 | Ga0496102_0569395 | |||
| 1623 | Ga0496103_0005233 | |||
| 1624 | Ga0496103_0034477 | |||
| 1625 | Ga0496103_0046547 | |||
| 1626 | Ga0496103_0203148 | |||
| 1627 | Ga0496104_0000878 | |||
| 1628 | Ga0496104_0002100 | |||
| 1629 | Ga0496104_0022878 | |||
| 1630 | Ga0496104_0052079 | |||
| 1631 | Ga0496104_0086886 | |||
| 1632 | Ga0496104_0093798 | |||
| 1633 | Ga0496105_0000170 | |||
| 1634 | Ga0496105_0004296 | |||
| 1635 | Ga0496105_0011194 | |||
| 1636 | Ga0496106_0004983 | |||
| 1637 | Ga0496106_0043954 | |||
| 1638 | Ga0496106_0235488 | |||
| 1639 | Ga0496107_0001176 | |||
| 1640 | Ga0496107_0007124 | |||
| 1641 | Ga0496107_0079984 | |||
| 1642 | Ga0496107_0108662 | |||
| 1643 | Ga0496107_0118703 | |||
| 1644 | Ga0496107_0199491 | |||
| 1645 | Ga0496108_0009970 | |||
| 1646 | Ga0496108_0037853 | |||
| 1647 | Ga0496108_0096768 | |||
| 1648 | Ga0496109_0001667 | |||
| 1649 | Ga0496109_0002262 | |||
| 1650 | Ga0496109_0036424 | |||
| 1651 | Ga0496109_0179807 | |||
| 1652 | Ga0496109_0473724 | |||
| 1653 | Ga0496110_0049803 | |||
| 1654 | Ga0496110_0053814 | |||
| 1655 | Ga0496110_0074654 | |||
| 1656 | Ga0496110_0078260 | |||
| 1657 | Ga0496111_0030563 | |||
| 1658 | Ga0496111_0084373 | |||
| 1659 | Ga0496111_0333084 | |||
| 1660 | Ga0496111_0365899 | |||
| 1661 | Ga0496112_0004283 | |||
| 1662 | Ga0496112_0046052 | |||
| 1663 | Ga0496112_0078905 | |||
| 1664 | Ga0496113_0066655 | |||
| 1665 | Ga0496113_0100310 | |||
| 1666 | Ga0496113_0286237 | |||
| 1667 | Ga0496114_0009491 | |||
| 1668 | Ga0496114_0028590 | |||
| 1669 | Ga0496114_0285316 | |||
| 1670 | Ga0496115_0009601 | |||
| 1671 | Ga0496115_0016506 | |||
| 1672 | Ga0496115_0040096 | |||
| 1673 | Ga0496115_0063742 | |||
| 1674 | Ga0496116_0031972 | |||
| 1675 | Ga0496124_0004131 | |||
| 1676 | Ga0496125_0005718 | |||
| 1677 | Ga0496126_0002146 | |||
| 1678 | Ga0496126_0094588 | |||
| 1679 | Ga0496126_0177570 | |||
| 1680 | Ga0501074_0021786 | |||
| 1681 | Ga0501076_0088713 | |||
| 1682 | Ga0501080_0020639 | |||
| 1683 | nmdc:mga06z11_46105_c1 | |||
| 1684 | nmdc:mga05p37_22220_c1 | |||
| 1685 | nmdc:mga05p37_786_c1 | |||
| 1686 | nmdc:mga09592_11785_c1 | |||
| 1687 | nmdc:mga0qj67_537_c1 | |||
| 1688 | nmdc:mga06r32_121_c1 | |||
| 1689 | nmdc:mga08y16_105144_c1 | |||
| 1690 | nmdc:mga08y16_12146_c1 | |||
| 1691 | nmdc:mga08y16_309_c1 | |||
| 1692 | nmdc:mga08y16_7306_c1 | |||
| 1693 | nmdc:mga0n895_104_c1 | |||
| 1694 | nmdc:mga0n895_10980_c1 | |||
| 1695 | nmdc:mga0n895_110781_c1 | |||
| 1696 | nmdc:mga0n895_156415_c1 | |||
| 1697 | nmdc:mga0n895_183369_c1 | |||
| 1698 | nmdc:mga0n895_1852_c1 | |||
| 1699 | nmdc:mga0n895_470439_c1 | |||
| 1700 | nmdc:mga0rr50_154643_c1 | |||
| 1701 | nmdc:mga0rr50_170358_c1 | |||
| 1702 | nmdc:mga0rr50_8571_c1 | |||
| 1703 | nmdc:mga08x19_334767_c1 | |||
| 1704 | nmdc:mga0a205_126577_c1 | |||
| 1705 | nmdc:mga0a205_1810_c1 | |||
| 1706 | nmdc:mga0a205_2795_c1 | |||
| 1707 | Ga0495601_0000010 | |||
| 1708 | Ga0495601_0000780 | |||
| 1709 | Ga0495601_0011515 | |||
| 1710 | Ga0495601_0021100 | |||
| 1711 | Ga0495601_0023569 | |||
| 1712 | Ga0495601_0047391 | |||
| 1713 | Ga0495601_0090212 | |||
| 1714 | Ga0495601_0115075 | |||
| 1715 | Ga0495612_0000002 | |||
| 1716 | Ga0495612_0002172 | |||
| 1717 | Ga0495612_0006029 | |||
| 1718 | Ga0495612_0006436 | |||
| 1719 | Ga0495612_0019933 | |||
| 1720 | Ga0495612_0038488 | |||
| 1721 | Ga0495595_0000184 | |||
| 1722 | Ga0495595_0001846 | |||
| 1723 | Ga0495595_0001851 | |||
| 1724 | Ga0495595_0002471 | |||
| 1725 | Ga0495619_0000002 | |||
| 1726 | Ga0495619_0001456 | |||
| 1727 | Ga0495619_0005827 | |||
| 1728 | Ga0495619_0014152 | |||
| 1729 | Ga0495619_0023627 | |||
| 1730 | Ga0495619_0027380 | |||
| 1731 | Ga0495619_0063585 | |||
| 1732 | Ga0495619_0079005 | |||
| 1733 | Ga0500644_0001910 | |||
| 1734 | Ga0500616_0000002 | |||
| 1735 | Ga0466962_0041137 | |||
| 1736 | Ga0466962_0118041 | |||
| 1737 | 2929205367 | |||
| 1738 | 8055914195 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9618 | 31 | 325 |
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9555 | 31 | 325 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9517 | 30 | 325 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9485 | 30 | 325 |
| 8hk9-assembly2.cif.gz_A | apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis | 0.9441 | 33 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9431 | 129 | 245 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9384 | 129 | 250 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9353 | 130 | 250 | 3.40.190.10 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9295 | 30 | 325 | 3.40.190.150 |
| 2f5xC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9225 | 130 | 250 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533IWB4-F1-model_v4 | deleted | 0.9779 | 30 | 94 |
|
| AF-A0A4V2UYF0-F1-model_v4 | Tripartite-type tricarboxylate transporter receptor subunit TctC | 0.9778 | 50 | 324 |
|
| AF-A0A536SS29-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9742 | 38 | 325 |
|
| AF-A0A2L1CQM3-F1-model_v4 | deleted | 0.9741 | 59 | 324 |
|
| AF-A0A375FQQ0-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9721 | 67 | 325 |
|