F484121

General Info

Members Datasets Scaffolds Average Seq Length
869 377 1738 323

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10103929|Ga0207664_101039293
Length 371
Sequence MKRGLFLFPSPLWGGNRDGGGKVKSRASSPQHFSATPFPTLPHKGGGKRICRRSLLTALAGAALIRPRQARAQANWPTRPVRVMVPYPPAGGADTTARIVYARVSETLGQQFAIENRGGAGGTIGEEAVAKSAPDGYTILHDATAFSVNGSLYSNLPFDYRKDFDPVFLVALVPNILVVTPSVPANTVADVIALAKATPGGIDMASSGNGTLQHLLLELFRQRTGITINHVPYRGGGLALTDVMAGQVKFFFANGSSAVGLIKGGKVKAIAHTGKGRLASLPDIPPLSDTLPGFEGYDWNGVFVPHGTPGPIVKKLNAALNAAIVAPQVTARFTELNIESRQNSPQEFRAYVEDQMALWSRVVKEANIKLG

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
139 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
211 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
226 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
227 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
228 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
229 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
230 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
231 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
232 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
236 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
237 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
238 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
246 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
247 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
250 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
251 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
254 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
255 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
256 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
257 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
258 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
262 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
263 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
264 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
267 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
268 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
302 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
314 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
315 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
316 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
317 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
318 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
351 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
352 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
353 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
374 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
375 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
376 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
377 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.23
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 6.67
Rhizosphere 91.48
Stem 0
Stem Tuber 0
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10103929 3300025929 Bacteria 2351
2 2214884080 2209111006 Bacteria 7769
3 ARSoilYngRDRAFT_c00087 3300000042 Bacteria 15429
4 ARSoilYngRDRAFT_c00489 3300000042 Bacteria 4689
5 ARcpr5yngRDRAFT_c000053 3300000043 Bacteria 18314
6 ARSoilOldRDRAFT_c000064 3300000044 Bacteria 21027
7 ARCol0oldRDRAFT_c00196 3300000045 Bacteria 5558
8 ARCol0yngRDRAFT_1000047 3300000652 Bacteria 21004
9 JGI24746J21847_1000312 3300001977 Bacteria 6997
10 JGI24739J22299_10000985 3300001989 Bacteria 10619
11 JGI24737J22298_10001495 3300001990 Bacteria 8328
12 JGI24750J21931_1000203 3300002070 Bacteria 10051
13 JGI24745J21846_1000249 3300002073 Bacteria 4490
14 JGI24748J21848_1000789 3300002074 Bacteria 3426
15 JGI24738J21930_10001441 3300002075 Bacteria 6608
16 JGI24035J26624_1000103 3300002126 Bacteria 7219
17 rootH1_10120293 3300003323 Bacteria 2746
18 JGI25405J52794_10015249 3300003911 Bacteria 1508
19 Ga0065704_10080382 3300005289 Bacteria 3939
20 Ga0065712_10017123 3300005290 Bacteria 2004
21 Ga0065712_10134843 3300005290 Bacteria 1503
22 Ga0065712_10146592 3300005290 Bacteria 1397
23 Ga0065715_10090502 3300005293 Bacteria 6878
24 Ga0070676_10001056 3300005328 Bacteria 13713
25 Ga0070683_100003491 3300005329 Bacteria 12781
26 Ga0070690_100008492 3300005330 Bacteria 5919
27 Ga0070670_100007890 3300005331 Bacteria 9055
28 Ga0070670_100196981 3300005331 Bacteria 1750
29 Ga0070670_100288925 3300005331 Bacteria 1433
30 Ga0070677_10000206 3300005333 Bacteria 20279
31 Ga0068869_100012026 3300005334 Bacteria 5700
32 Ga0068869_100375119 3300005334 Bacteria 1165
33 Ga0070666_10005855 3300005335 Bacteria 7552
34 Ga0070666_10007454 3300005335 Bacteria 6746
35 Ga0070680_100014216 3300005336 Bacteria 6216
36 Ga0070680_100031681 3300005336 Bacteria 4252
37 Ga0070682_100001749 3300005337 Bacteria 12085
38 Ga0068868_100019471 3300005338 Bacteria 5086
39 Ga0070660_100002617 3300005339 Bacteria 12364
40 Ga0070689_100006306 3300005340 Bacteria 8192
41 Ga0070689_100045727 3300005340 Bacteria 3371
42 Ga0070691_10004394 3300005341 Bacteria 6405
43 Ga0070687_100005432 3300005343 Bacteria 5159
44 Ga0070687_100089785 3300005343 Bacteria 1697
45 Ga0070687_100138053 3300005343 Bacteria 1416
46 Ga0070661_100006928 3300005344 Bacteria 7823
47 Ga0070692_10002854 3300005345 Bacteria 6843
48 Ga0070692_10079654 3300005345 Bacteria 1762
49 Ga0070668_100000882 3300005347 Bacteria 20845
50 Ga0070669_100002256 3300005353 Bacteria 13985
51 Ga0070675_100001384 3300005354 Bacteria 17776
52 Ga0070675_100126887 3300005354 Bacteria 2171
53 Ga0070671_100001328 3300005355 Bacteria 18586
54 Ga0070671_100038217 3300005355 Bacteria 3984
55 Ga0070671_100081005 3300005355 Unclassified 2714
56 Ga0070674_100002239 3300005356 Bacteria 10647
57 Ga0070674_100023992 3300005356 Bacteria 3956
58 Ga0070674_100027750 3300005356 Bacteria 3712
59 Ga0070674_100051249 3300005356 Bacteria 2844
60 Ga0070673_100002806 3300005364 Bacteria 10711
61 Ga0070673_100005819 3300005364 Bacteria 7943
62 Ga0070688_100007431 3300005365 Bacteria 5907
63 Ga0070688_100012208 3300005365 Bacteria 4807
64 Ga0070688_100022305 3300005365 Bacteria 3707
65 Ga0070688_100064310 3300005365 Bacteria 2328
66 Ga0070659_100007170 3300005366 Bacteria 8089
67 Ga0070659_100103368 3300005366 Unclassified 2294
68 Ga0070667_100003216 3300005367 Bacteria 13985
69 Ga0070703_10006414 3300005406 Bacteria 3298
70 Ga0070714_100034654 3300005435 Bacteria 4228
71 Ga0070714_100154904 3300005435 Bacteria 2068
72 Ga0070713_100045738 3300005436 Bacteria 3588
73 Ga0070713_100131207 3300005436 Bacteria 2210
74 Ga0070713_100302116 3300005436 Bacteria 1473
75 Ga0070710_10021309 3300005437 Bacteria 3375
76 Ga0070710_10089656 3300005437 Bacteria 1812
77 Ga0070701_10007610 3300005438 Bacteria 4639
78 Ga0070701_10093006 3300005438 Unclassified 1656
79 Ga0070711_100058095 3300005439 Bacteria 2681
80 Ga0070711_100087855 3300005439 Bacteria 2233
81 Ga0070711_100129259 3300005439 Bacteria 1879
82 Ga0070711_100228874 3300005439 Bacteria 1449
83 Ga0070711_100239739 3300005439 Bacteria 1417
84 Ga0070705_100012725 3300005440 Bacteria 4285
85 Ga0070700_100000556 3300005441 Bacteria 18754
86 Ga0070700_100198484 3300005441 Bacteria 1408
87 Ga0070694_100001349 3300005444 Bacteria 14317
88 Ga0070694_100216223 3300005444 Bacteria 1436
89 Ga0070708_100026811 3300005445 Bacteria 4936
90 Ga0070708_100321334 3300005445 Bacteria 1458
91 Ga0070663_100006533 3300005455 Bacteria 7022
92 Ga0070663_100010686 3300005455 Bacteria 5728
93 Ga0070663_100040889 3300005455 Bacteria 3248
94 Ga0070663_100086354 3300005455 Bacteria 2317
95 Ga0070663_100128263 3300005455 Unclassified 1923
96 Ga0070678_100028145 3300005456 Bacteria 3828
97 Ga0070678_100055277 3300005456 Bacteria 2897
98 Ga0070678_100171754 3300005456 Bacteria 1766
99 Ga0070662_100006933 3300005457 Bacteria 7336
100 Ga0070662_100168810 3300005457 Bacteria 1717
101 Ga0070681_10013387 3300005458 Bacteria 8150
102 Ga0070681_10048783 3300005458 Bacteria 4229
103 Ga0070681_10075267 3300005458 Bacteria 3336
104 Ga0068867_100002573 3300005459 Bacteria 12785
105 Ga0068867_100091628 3300005459 Bacteria 2308
106 Ga0068867_100287083 3300005459 Bacteria 1351
107 Ga0070685_10001130 3300005466 Bacteria 14275
108 Ga0070685_10037180 3300005466 Unclassified 2756
109 Ga0070679_100012382 3300005530 Bacteria 8150
110 Ga0070679_100057663 3300005530 Bacteria 3871
111 Ga0070679_100163207 3300005530 Bacteria 2202
112 Ga0070684_100021825 3300005535 Bacteria 5333
113 Ga0070684_100026880 3300005535 Bacteria 4851
114 Ga0070684_100087654 3300005535 Bacteria 2764
115 Ga0070697_100049880 3300005536 Bacteria 3397
116 Ga0068853_100000906 3300005539 Bacteria 20662
117 Ga0070672_100000679 3300005543 Bacteria 20002
118 Ga0070686_100001681 3300005544 Bacteria 12352
119 Ga0070686_100029763 3300005544 Bacteria 3325
120 Ga0070686_100059649 3300005544 Bacteria 2459
121 Ga0070695_100007010 3300005545 Bacteria 6679
122 Ga0070696_100035611 3300005546 Bacteria 3428
123 Ga0070696_100335150 3300005546 Bacteria 1168
124 Ga0070693_100003374 3300005547 Bacteria 7428
125 Ga0070665_100107509 3300005548 Bacteria 2792
126 Ga0070665_100131945 3300005548 Unclassified 2500
127 Ga0070665_100157786 3300005548 Bacteria 2270
128 Ga0070704_100011666 3300005549 Bacteria 5396
129 Ga0070704_100063568 3300005549 Bacteria 2649
130 Ga0068855_100005213 3300005563 Bacteria 15852
131 Ga0068855_100067138 3300005563 Bacteria 4180
132 Ga0070664_100008267 3300005564 Bacteria 8418
133 Ga0070664_100071818 3300005564 Bacteria 2967
134 Ga0070664_100184007 3300005564 Bacteria 1858
135 Ga0068857_100024411 3300005577 Bacteria 5322
136 Ga0068857_100089731 3300005577 Bacteria 2750
137 Ga0068857_100379340 3300005577 Bacteria 1313
138 Ga0068854_100001485 3300005578 Bacteria 14204
139 Ga0068856_100000013 3300005614 Bacteria 165611
140 Ga0068856_100004080 3300005614 Bacteria 14604
141 Ga0070702_100004190 3300005615 Bacteria 6561
142 Ga0070702_100143723 3300005615 Bacteria 1523
143 Ga0068852_100009647 3300005616 Bacteria 7170
144 Ga0068859_100003498 3300005617 Bacteria 15989
145 Ga0068859_100068433 3300005617 Bacteria 3585
146 Ga0068859_100304340 3300005617 Bacteria 1688
147 Ga0068864_100006196 3300005618 Bacteria 9806
148 Ga0068864_100097020 3300005618 Bacteria 2609
149 Ga0068864_100110565 3300005618 Bacteria 2447
150 Ga0068864_100134900 3300005618 Bacteria 2221
151 Ga0068864_100258890 3300005618 Bacteria 1618
152 Ga0068866_10002003 3300005718 Bacteria 8477
153 Ga0068866_10062811 3300005718 Unclassified 1933
154 Ga0068866_10262732 3300005718 Bacteria 1062
155 Ga0068861_100029256 3300005719 Bacteria 4029
156 Ga0068870_10004133 3300005840 Bacteria 6216
157 Ga0068870_10140008 3300005840 Bacteria 1415
158 Ga0068863_100002935 3300005841 Bacteria 16858
159 Ga0068863_100398028 3300005841 Bacteria 1347
160 Ga0068858_100013279 3300005842 Bacteria 7764
161 Ga0068858_100102721 3300005842 Bacteria 2666
162 Ga0068860_100002542 3300005843 Bacteria 19093
163 Ga0068860_100072832 3300005843 Unclassified 3265
164 Ga0068860_100414830 3300005843 Bacteria 1334
165 Ga0068862_100006476 3300005844 Bacteria 9725
166 Ga0081455_10001284 3300005937 Bacteria 31217
167 Ga0081455_10004026 3300005937 Bacteria 16661
168 Ga0081455_10026742 3300005937 Bacteria 5298
169 Ga0081540_1051714 3300005983 Bacteria 2029
170 Ga0070717_10154874 3300006028 Bacteria 1984
171 Ga0070717_10331340 3300006028 Bacteria 1358
172 Ga0075432_10007074 3300006058 Bacteria 3822
173 Ga0070715_10068129 3300006163 Bacteria 1582
174 Ga0070716_100009608 3300006173 Bacteria 4823
175 Ga0070712_100015646 3300006175 Bacteria 4890
176 Ga0070712_100147720 3300006175 Bacteria 1801
177 Ga0075367_10076810 3300006178 Bacteria 2016
178 Ga0097621_100011406 3300006237 Bacteria 6543
179 Ga0068871_100018905 3300006358 Bacteria 5250
180 Ga0075428_100004320 3300006844 Bacteria 15659
181 Ga0075430_100231934 3300006846 Bacteria 1530
182 Ga0075431_100185504 3300006847 Bacteria 2133
183 Ga0075433_10000029 3300006852 Bacteria 55893
184 Ga0075433_10007719 3300006852 Bacteria 8547
185 Ga0075433_10023855 3300006852 Bacteria 5155
186 Ga0075433_10055372 3300006852 Bacteria 3462
187 Ga0075434_100000208 3300006871 Bacteria 39868
188 Ga0075434_100001333 3300006871 Bacteria 20677
189 Ga0075434_100037538 3300006871 Bacteria 4797
190 Ga0075434_100037751 3300006871 Bacteria 4782
191 Ga0075434_100126033 3300006871 Bacteria 2578
192 Ga0075434_100202518 3300006871 Unclassified 2005
193 Ga0075429_100207077 3300006880 Bacteria 1718
194 Ga0068865_100001418 3300006881 Bacteria 13966
195 Ga0068865_100065230 3300006881 Bacteria 2565
196 Ga0068865_100255669 3300006881 Bacteria 1384
197 Ga0075436_100059762 3300006914 Bacteria 2633
198 Ga0097620_100003498 3300006931 Bacteria 15989
199 Ga0097620_100068431 3300006931 Bacteria 3585
200 Ga0097620_100304332 3300006931 Bacteria 1688
201 Ga0075435_100010419 3300007076 Bacteria 6801
202 Ga0075435_100081701 3300007076 Bacteria 2655
203 Ga0075435_100215619 3300007076 Bacteria 1629
204 Ga0105250_10023895 3300009092 Bacteria 2464
205 Ga0105240_10012832 3300009093 Bacteria 11542
206 Ga0105240_10041886 3300009093 Bacteria 5840
207 Ga0105240_10411823 3300009093 Bacteria 1520
208 Ga0111539_10000345 3300009094 Bacteria 57093
209 Ga0111539_10002114 3300009094 Bacteria 26555
210 Ga0111539_10066957 3300009094 Bacteria 4242
211 Ga0111539_10191820 3300009094 Bacteria 2384
212 Ga0105245_10002739 3300009098 Bacteria 15848
213 Ga0105245_10093138 3300009098 Bacteria 2776
214 Ga0105245_10098474 3300009098 Unclassified 2702
215 Ga0105247_10004019 3300009101 Bacteria 9465
216 Ga0105247_10013262 3300009101 Bacteria 4946
217 Ga0105247_10186717 3300009101 Bacteria 1386
218 Ga0114129_10035787 3300009147 Bacteria 7013
219 Ga0114129_10333964 3300009147 Bacteria 2012
220 Ga0114129_10532762 3300009147 Bacteria 1530
221 Ga0105243_10002166 3300009148 Bacteria 16594
222 Ga0105241_10004380 3300009174 Bacteria 10436
223 Ga0105241_10061853 3300009174 Bacteria 2885
224 Ga0105241_10085225 3300009174 Unclassified 2482
225 Ga0105242_10037470 3300009176 Bacteria 3895
226 Ga0105248_10002844 3300009177 Bacteria 19207
227 Ga0105248_10057459 3300009177 Bacteria 4367
228 Ga0105248_10091855 3300009177 Bacteria 3419
229 Ga0105248_10295214 3300009177 Bacteria 1825
230 Ga0105248_10489030 3300009177 Bacteria 1387
231 Ga0105248_10525166 3300009177 Bacteria 1335
232 Ga0105237_10013429 3300009545 Bacteria 8589
233 Ga0105237_10021168 3300009545 Bacteria 6689
234 Ga0105237_10073702 3300009545 Bacteria 3406
235 Ga0105237_10445792 3300009545 Bacteria 1300
236 Ga0105238_10057687 3300009551 Bacteria 3893
237 Ga0105238_10134819 3300009551 Bacteria 2447
238 Ga0105249_10010187 3300009553 Bacteria 8255
239 Ga0105239_10005997 3300010375 Bacteria 14140
240 Ga0105239_10073245 3300010375 Bacteria 3766
241 Ga0105239_10076690 3300010375 Bacteria 3677
242 Ga0105239_10186134 3300010375 Bacteria 2324
243 Ga0105246_10004149 3300011119 Bacteria 8800
244 Ga0105246_10124323 3300011119 Bacteria 1917
245 Ga0157373_10006523 3300013100 Bacteria 8705
246 Ga0157369_10000848 3300013105 Bacteria 39040
247 Ga0157369_10062683 3300013105 Bacteria 4006
248 Ga0157374_10008496 3300013296 Bacteria 8784
249 Ga0157374_10015440 3300013296 Bacteria 6698
250 Ga0157374_10208350 3300013296 Bacteria 1916
251 Ga0157378_10011772 3300013297 Bacteria 7659
252 Ga0157378_10059516 3300013297 Bacteria 3408
253 Ga0163162_10004494 3300013306 Bacteria 13434
254 Ga0163162_10106664 3300013306 Bacteria 2897
255 Ga0163162_10685782 3300013306 Bacteria 1147
256 Ga0157372_10046139 3300013307 Bacteria 4837
257 Ga0157375_10038679 3300013308 Bacteria 4582
258 Ga0157375_10038977 3300013308 Bacteria 4568
259 Ga0157375_10115203 3300013308 Bacteria 2791
260 Ga0163163_10010926 3300014325 Bacteria 8202
261 Ga0163163_10025845 3300014325 Bacteria 5602
262 Ga0163163_10050056 3300014325 Bacteria 4114
263 Ga0163163_10321653 3300014325 Bacteria 1601
264 Ga0157380_10009077 3300014326 Bacteria 7105
265 Ga0157377_10002192 3300014745 Bacteria 8583
266 Ga0157377_10162636 3300014745 Bacteria 1389
267 Ga0157379_10002658 3300014968 Bacteria 15053
268 Ga0157379_10027483 3300014968 Bacteria 5066
269 Ga0157379_10124319 3300014968 Bacteria 2321
270 Ga0157376_10003174 3300014969 Bacteria 11291
271 Ga0157376_10005599 3300014969 Bacteria 8786
272 Ga0163161_10001452 3300017792 Bacteria 17532
273 Ga0163161_10035410 3300017792 Bacteria 3573
274 Ga0213876_10023662 3300021384 Bacteria 3244
275 Ga0228598_1014983 3300024227 Bacteria 1532
276 Ga0207666_1000032 3300025271 Bacteria 28987
277 Ga0207673_1000021 3300025290 Bacteria 12087
278 Ga0207697_10000192 3300025315 Bacteria 32162
279 Ga0207656_10042008 3300025321 Bacteria 1944
280 Ga0207656_10051615 3300025321 Unclassified 1779
281 Ga0207713_1021420 3300025735 Bacteria 3099
282 Ga0207653_10001002 3300025885 Bacteria 9306
283 Ga0207682_10000056 3300025893 Bacteria 48265
284 Ga0207692_10007243 3300025898 Bacteria 4536
285 Ga0207642_10028901 3300025899 Bacteria 2289
286 Ga0207710_10014280 3300025900 Bacteria 3346
287 Ga0207710_10048604 3300025900 Bacteria 1899
288 Ga0207688_10000066 3300025901 Bacteria 38551
289 Ga0207688_10039303 3300025901 Bacteria 2628
290 Ga0207688_10113063 3300025901 Bacteria 1578
291 Ga0207680_10007602 3300025903 Bacteria 5292
292 Ga0207647_10004193 3300025904 Bacteria 10694
293 Ga0207647_10078582 3300025904 Bacteria 1981
294 Ga0207647_10082832 3300025904 Bacteria 1921
295 Ga0207699_10024636 3300025906 Bacteria 3293
296 Ga0207645_10006176 3300025907 Bacteria 8601
297 Ga0207645_10027343 3300025907 Bacteria 3684
298 Ga0207645_10029375 3300025907 Bacteria 3545
299 Ga0207643_10000187 3300025908 Bacteria 42567
300 Ga0207643_10022074 3300025908 Bacteria 3502
301 Ga0207654_10003683 3300025911 Bacteria 7725
302 Ga0207707_10009866 3300025912 Bacteria 8276
303 Ga0207707_10018653 3300025912 Bacteria 6049
304 Ga0207707_10080750 3300025912 Bacteria 2839
305 Ga0207707_10095117 3300025912 Bacteria 2604
306 Ga0207695_10290248 3300025913 Bacteria 1528
307 Ga0207695_10298115 3300025913 Bacteria 1504
308 Ga0207671_10178498 3300025914 Bacteria 1652
309 Ga0207693_10001676 3300025915 Bacteria 19527
310 Ga0207693_10015923 3300025915 Bacteria 6021
311 Ga0207693_10075345 3300025915 Bacteria 2642
312 Ga0207693_10115587 3300025915 Bacteria 2106
313 Ga0207663_10011824 3300025916 Bacteria 4699
314 Ga0207663_10091766 3300025916 Bacteria 2017
315 Ga0207663_10143380 3300025916 Bacteria 1667
316 Ga0207660_10006714 3300025917 Bacteria 7452
317 Ga0207662_10000292 3300025918 Bacteria 23122
318 Ga0207662_10052636 3300025918 Bacteria 2423
319 Ga0207662_10067919 3300025918 Bacteria 2151
320 Ga0207662_10095023 3300025918 Bacteria 1839
321 Ga0207657_10001630 3300025919 Bacteria 24165
322 Ga0207657_10077442 3300025919 Bacteria 2802
323 Ga0207649_10001002 3300025920 Bacteria 17465
324 Ga0207652_10090398 3300025921 Bacteria 2690
325 Ga0207652_10091832 3300025921 Bacteria 2670
326 Ga0207652_10100881 3300025921 Bacteria 2549
327 Ga0207652_10472992 3300025921 Bacteria 1129
328 Ga0207681_10006515 3300025923 Bacteria 7166
329 Ga0207650_10048649 3300025925 Bacteria 3128
330 Ga0207650_10119341 3300025925 Bacteria 2051
331 Ga0207659_10002407 3300025926 Bacteria 11134
332 Ga0207659_10055975 3300025926 Bacteria 2823
333 Ga0207687_10003001 3300025927 Bacteria 11444
334 Ga0207687_10140247 3300025927 Bacteria 1833
335 Ga0207687_10203058 3300025927 Unclassified 1551
336 Ga0207700_10007834 3300025928 Bacteria 6567
337 Ga0207700_10124688 3300025928 Bacteria 2093
338 Ga0207700_10157349 3300025928 Bacteria 1884
339 Ga0207700_10214902 3300025928 Bacteria 1627
340 Ga0207664_10124765 3300025929 Bacteria 2160
341 Ga0207664_10136882 3300025929 Bacteria 2068
342 Ga0207644_10003646 3300025931 Bacteria 9990
343 Ga0207644_10007286 3300025931 Bacteria 7200
344 Ga0207644_10026516 3300025931 Bacteria 3994
345 Ga0207690_10001213 3300025932 Bacteria 16283
346 Ga0207706_10009370 3300025933 Bacteria 8991
347 Ga0207706_10042486 3300025933 Bacteria 4029
348 Ga0207706_10081753 3300025933 Bacteria 2839
349 Ga0207686_10007500 3300025934 Bacteria 5872
350 Ga0207709_10001124 3300025935 Bacteria 19613
351 Ga0207709_10069079 3300025935 Bacteria 2235
352 Ga0207670_10001034 3300025936 Bacteria 14694
353 Ga0207670_10007190 3300025936 Bacteria 6202
354 Ga0207670_10078691 3300025936 Bacteria 2300
355 Ga0207669_10000578 3300025937 Bacteria 15956
356 Ga0207669_10033689 3300025937 Bacteria 2893
357 Ga0207669_10035046 3300025937 Bacteria 2851
358 Ga0207669_10060100 3300025937 Bacteria 2328
359 Ga0207704_10001542 3300025938 Bacteria 10343
360 Ga0207704_10059216 3300025938 Bacteria 2363
361 Ga0207665_10002127 3300025939 Bacteria 13403
362 Ga0207665_10074485 3300025939 Bacteria 2323
363 Ga0207691_10002805 3300025940 Bacteria 16985
364 Ga0207711_10009683 3300025941 Bacteria 8028
365 Ga0207711_10011676 3300025941 Bacteria 7297
366 Ga0207711_10019987 3300025941 Bacteria 5581
367 Ga0207689_10001239 3300025942 Bacteria 24599
368 Ga0207689_10197242 3300025942 Unclassified 1662
369 Ga0207661_10002038 3300025944 Bacteria 13934
370 Ga0207661_10213555 3300025944 Bacteria 1702
371 Ga0207679_10000128 3300025945 Bacteria 61823
372 Ga0207679_10000187 3300025945 Bacteria 49895
373 Ga0207679_10000529 3300025945 Bacteria 25850
374 Ga0207667_10035917 3300025949 Bacteria 5315
375 Ga0207667_10293448 3300025949 Bacteria 1661
376 Ga0207651_10005107 3300025960 Bacteria 6701
377 Ga0207712_10000520 3300025961 Bacteria 31665
378 Ga0207668_10000260 3300025972 Bacteria 35239
379 Ga0207640_10006747 3300025981 Bacteria 6313
380 Ga0207640_10051876 3300025981 Bacteria 2669
381 Ga0207658_10005448 3300025986 Bacteria 8727
382 Ga0207677_10032773 3300026023 Bacteria 3344
383 Ga0207703_10016150 3300026035 Bacteria 5819
384 Ga0207703_10152689 3300026035 Bacteria 2015
385 Ga0207639_10008245 3300026041 Bacteria 7136
386 Ga0207639_10318692 3300026041 Bacteria 1380
387 Ga0207678_10007149 3300026067 Bacteria 9905
388 Ga0207678_10014682 3300026067 Bacteria 6891
389 Ga0207678_10053436 3300026067 Bacteria 3481
390 Ga0207678_10182125 3300026067 Bacteria 1794
391 Ga0207708_10001080 3300026075 Bacteria 20427
392 Ga0207708_10091141 3300026075 Bacteria 2350
393 Ga0207708_10113557 3300026075 Unclassified 2105
394 Ga0207702_10000090 3300026078 Bacteria 104566
395 Ga0207702_10326241 3300026078 Bacteria 1463
396 Ga0207641_10006255 3300026088 Bacteria 10076
397 Ga0207641_10103942 3300026088 Bacteria 2507
398 Ga0207641_10292024 3300026088 Bacteria 1537
399 Ga0207648_10001031 3300026089 Bacteria 31313
400 Ga0207648_10036632 3300026089 Bacteria 4322
401 Ga0207676_10007274 3300026095 Bacteria 7843
402 Ga0207674_10000686 3300026116 Bacteria 44016
403 Ga0207674_10033888 3300026116 Bacteria 5343
404 Ga0207674_10056651 3300026116 Bacteria 3978
405 Ga0207674_10111775 3300026116 Bacteria 2706
406 Ga0207675_100002806 3300026118 Bacteria 17123
407 Ga0207675_100171011 3300026118 Bacteria 2077
408 Ga0207683_10001686 3300026121 Bacteria 19759
409 Ga0207683_10002136 3300026121 Bacteria 17378
410 Ga0207683_10006803 3300026121 Bacteria 9792
411 Ga0207683_10036985 3300026121 Bacteria 4251
412 Ga0207698_10007006 3300026142 Bacteria 7060
413 Ga0207698_10244519 3300026142 Unclassified 1638
414 Ga0207698_10245318 3300026142 Bacteria 1635
415 Ga0209998_10001494 3300027717 Bacteria 5629
416 Ga0209974_10000101 3300027876 Bacteria 24130
417 Ga0207428_10000360 3300027907 Bacteria 58478
418 Ga0207428_10000556 3300027907 Bacteria 44098
419 Ga0207428_10006906 3300027907 Bacteria 10403
420 Ga0268266_10110354 3300028379 Bacteria 2437
421 Ga0268265_10000526 3300028380 Bacteria 39043
422 Ga0268264_10002582 3300028381 Bacteria 15846
423 Ga0265337_1000923 3300028556 Bacteria 15408
424 Ga0265318_10009497 3300028577 Bacteria 4276
425 Ga0265338_10075379 3300028800 Bacteria 2862
426 Ga0265338_10086764 3300028800 Bacteria 2602
427 Ga0265763_1000022 3300030763 Bacteria 5983
428 Ga0265760_10049290 3300031090 Bacteria 1266
429 Ga0265330_10056518 3300031235 Bacteria 1712
430 Ga0265332_10107931 3300031238 Bacteria 1173
431 Ga0265320_10009858 3300031240 Bacteria 5724
432 Ga0265325_10022783 3300031241 Bacteria 3426
433 Ga0265325_10030323 3300031241 Bacteria 2900
434 Ga0265325_10068982 3300031241 Bacteria 1779
435 Ga0265329_10010635 3300031242 Bacteria 3368
436 Ga0265340_10016642 3300031247 Bacteria 3805
437 Ga0265339_10000038 3300031249 Bacteria 121961
438 Ga0265339_10009421 3300031249 Bacteria 6141
439 Ga0265339_10010951 3300031249 Bacteria 5606
440 Ga0265339_10023221 3300031249 Bacteria 3587
441 Ga0265316_10188829 3300031344 Bacteria 1531
442 Ga0265316_10213857 3300031344 Bacteria 1425
443 Ga0265316_10216877 3300031344 Bacteria 1413
444 Ga0265313_10000034 3300031595 Bacteria 126370
445 Ga0265313_10002885 3300031595 Bacteria 14411
446 Ga0265313_10026895 3300031595 Bacteria 3020
447 Ga0265314_10002042 3300031711 Bacteria 21355
448 Ga0265314_10005437 3300031711 Bacteria 11503
449 Ga0265314_10027527 3300031711 Bacteria 4256
450 Ga0265342_10115049 3300031712 Bacteria 1519
451 Ga0307516_10284070 3300031730 Bacteria 1336
452 Ga0373930_0005389 3300034816 Bacteria 2125
453 Ga0373948_0000653 3300034817 Bacteria 4495
454 Ga0373950_0002536 3300034818 Bacteria 2519
455 Ga0373950_0010850 3300034818 Bacteria 1479
456 Ga0373958_0000128 3300034819 Bacteria 8458
457 Ga0373958_0001016 3300034819 Bacteria 3672
458 Ga0373959_0001211 3300034820 Bacteria 4170
459 Ga0373938_0000039 3300034957 Bacteria 17106
460 Ga0373938_0003571 3300034957 Bacteria 2558
461 Ga0373926_0036813 3300035083 Bacteria 1740
462 Ga0373928_0000780 3300035084 Bacteria 6190
463 Ga0373928_0000840 3300035084 Bacteria 6012
464 Ga0373929_0000209 3300035085 Bacteria 10585
465 Ga0373929_0001461 3300035085 Bacteria 4503
466 Ga0373940_0001653 3300035088 Bacteria 4110
467 Ga0373944_0072813 3300035089 Bacteria 1122
468 Ga0373949_0003694 3300035090 Bacteria 3588
469 Ga0373949_0004971 3300035090 Bacteria 2999
470 Ga0373949_0010465 3300035090 Bacteria 2034
471 Ga0373951_0001984 3300035091 Bacteria 5243
472 Ga0373951_0003922 3300035091 Bacteria 3574
473 Ga0373952_0000127 3300035092 Bacteria 10765
474 Ga0373952_0006066 3300035092 Bacteria 2228
475 Ga0373952_0012769 3300035092 Bacteria 1658
476 Ga0373923_0002024 3300035111 Bacteria 6102
477 Ga0373932_0000284 3300035112 Bacteria 15261
478 Ga0373932_0000942 3300035112 Bacteria 8521
479 Ga0373936_0011642 3300035113 Bacteria 3336
480 Ga0373939_0001563 3300035114 Bacteria 5560
481 Ga0373939_0010809 3300035114 Bacteria 2293
482 Ga0373941_0000214 3300035115 Bacteria 11102
483 Ga0373941_0021725 3300035115 Bacteria 1815
484 Ga0373945_0001162 3300035116 Bacteria 7988
485 Ga0373945_0024944 3300035116 Unclassified 2074
486 Ga0373945_0028582 3300035116 Bacteria 1954
487 Ga0373945_0032981 3300035116 Bacteria 1837
488 Ga0373953_0018375 3300035117 Unclassified 2586
489 Ga0373953_0065617 3300035117 Bacteria 1490
490 Ga0373953_0091158 3300035117 Bacteria 1275
491 Ga0373954_0000797 3300035118 Bacteria 12188
492 Ga0373954_0001989 3300035118 Bacteria 8486
493 Ga0373956_0029526 3300035119 Unclassified 2392
494 Ga0373957_0006608 3300035120 Bacteria 3664
495 Ga0373957_0013318 3300035120 Bacteria 2788
496 Ga0373957_0021825 3300035120 Bacteria 2277
497 Ga0373960_0004672 3300035121 Bacteria 3147
498 Ga0373960_0005071 3300035121 Bacteria 3034
499 Ga0373943_0003311 3300035170 Bacteria 7320
500 Ga0373943_0005072 3300035170 Bacteria 5938
501 Ga0373943_0024444 3300035170 Unclassified 2816
502 Ga0373943_0030273 3300035170 Bacteria 2560
503 Ga0373946_0000764 3300035171 Bacteria 10957
504 Ga0373946_0009266 3300035171 Bacteria 3621
505 Ga0373946_0033861 3300035171 Bacteria 2059
506 Ga0373955_0000425 3300035172 Bacteria 17797
507 Ga0373955_0001166 3300035172 Bacteria 11157
508 Ga0373955_0008057 3300035172 Bacteria 4873
509 Ga0373942_0000702 3300035207 Bacteria 9287
510 Ga0373942_0002546 3300035207 Bacteria 4410
511 Ga0373961_0003562 3300035241 Bacteria 3832
512 Ga0373962_0000320 3300035242 Bacteria 10433
513 Ga0373962_0000506 3300035242 Bacteria 8687
514 Ga0373924_0056104 3300035410 Unclassified 1640
515 Ga0373931_0006810 3300035691 Bacteria 5370
516 Ga0373931_0007585 3300035691 Bacteria 5110
517 Ga0373931_0086171 3300035691 Bacteria 1742
518 Ga0373931_0266514 3300035691 Bacteria 1047
519 Ga0373935_0000337 3300035692 Bacteria 23756
520 Ga0373935_0021184 3300035692 Bacteria 3978
521 Ga0373935_0041444 3300035692 Bacteria 2892
522 Ga0373935_0055426 3300035692 Plasmid 2525
523 Ga0373935_0061923 3300035692 Bacteria 2396
524 Ga0373927_0000699 3300035695 Bacteria 25690
525 Ga0373927_0022633 3300035695 Bacteria 4115
526 Ga0373927_0050128 3300035695 Bacteria 2699
527 Ga0373927_0080021 3300035695 Bacteria 2117
528 Ga0373927_0170494 3300035695 Unclassified 1426
529 Ga0373927_0176248 3300035695 Bacteria 1402
530 Ga0373927_0180697 3300035695 Bacteria 1384
531 Ga0373933_0001172 3300035724 Bacteria 15550
532 Ga0373933_0003551 3300035724 Bacteria 8665
533 Ga0373933_0003679 3300035724 Bacteria 8489
534 Ga0373933_0017476 3300035724 Bacteria 4024
535 Ga0373933_0196324 3300035724 Bacteria 1290
536 Ga0373947_0000274 3300035725 Bacteria 29259
537 Ga0373947_0001536 3300035725 Bacteria 14154
538 Ga0373947_0056467 3300035725 Bacteria 2373
539 Ga0373947_0057811 3300035725 Bacteria 2348
540 Ga0373937_0000597 3300036401 Bacteria 31969
541 Ga0373937_0002771 3300036401 Bacteria 14631
542 Ga0373937_0006032 3300036401 Bacteria 10436
543 Ga0373937_0046150 3300036401 Bacteria 3983
544 Ga0373937_0073593 3300036401 Bacteria 3152
545 Ga0373937_0135835 3300036401 Unclassified 2299
546 Ga0373925_0000741 3300037068 Bacteria 29997
547 Ga0373925_0001836 3300037068 Bacteria 17719
548 Ga0373925_0009897 3300037068 Bacteria 6928
549 Ga0373925_0028027 3300037068 Bacteria 4125
550 Ga0373925_0175301 3300037068 Bacteria 1694
551 Ga0373925_0372685 3300037068 Bacteria 1162
552 Ga0395899_0007276 3300037312 Bacteria 8562
553 Ga0395899_0173053 3300037312 Bacteria 1519
554 Ga0395900_0003202 3300037418 Bacteria 17723
555 Ga0395900_0010704 3300037418 Bacteria 9381
556 Ga0395900_0054446 3300037418 Bacteria 4120
557 Ga0395900_0104076 3300037418 Bacteria 2916
558 Ga0395898_0029199 3300037466 Bacteria 5525
559 Ga0395898_0030701 3300037466 Bacteria 5375
560 Ga0395901_0024663 3300038443 Bacteria 6175
561 Ga0395901_0064016 3300038443 Bacteria 3827
562 Ga0436365_0590132 3300039437 Bacteria 5387
563 Ga0466966_0160596 3300044684 Bacteria 1368
564 Ga0466966_0175618 3300044684 Bacteria 1301
565 Ga0466963_0053798 3300044694 Bacteria 2674
566 Ga0466963_0147173 3300044694 Bacteria 1635
567 Ga0466964_0041270 3300044706 Bacteria 1866
568 Ga0453684_0443164 3300044712 Bacteria 1447
569 Ga0466971_0022105 3300044719 Bacteria 2832
570 Ga0466957_0025668 3300044842 Bacteria 3493
571 Ga0466957_0063764 3300044842 Bacteria 2266
572 Ga0495592_0000188 3300046454 Bacteria 54485
573 Ga0495592_0003488 3300046454 Bacteria 11285
574 Ga0495592_0003644 3300046454 Bacteria 11088
575 Ga0495592_0181229 3300046454 Bacteria 1434
576 Ga0495603_0063474 3300046455 Bacteria 2179
577 Ga0495629_0002114 3300046459 Bacteria 15386
578 Ga0495629_0051344 3300046459 Bacteria 2886
579 Ga0495629_0051389 3300046459 Bacteria 2885
580 Ga0495641_0006360 3300046461 Bacteria 7668
581 Ga0495651_0001439 3300046462 Bacteria 18418
582 Ga0495651_0074300 3300046462 Bacteria 2579
583 Ga0495651_0075602 3300046462 Bacteria 2553
584 Ga0495651_0085288 3300046462 Bacteria 2378
585 Ga0495653_0000198 3300046463 Bacteria 49009
586 Ga0495653_0010944 3300046463 Bacteria 7428
587 Ga0495653_0017035 3300046463 Bacteria 5911
588 Ga0495653_0257998 3300046463 Bacteria 1154
589 Ga0495580_0006784 3300046472 Bacteria 9280
590 Ga0495580_0090746 3300046472 Bacteria 2127
591 Ga0495580_0105681 3300046472 Bacteria 1956
592 Ga0495582_0001989 3300046473 Bacteria 11451
593 Ga0495582_0010759 3300046473 Bacteria 5035
594 Ga0495639_0019753 3300046475 Unclassified 2940
595 Ga0495639_0055054 3300046475 Bacteria 1814
596 Ga0495639_0079858 3300046475 Bacteria 1522
597 Ga0495639_0228400 3300046475 Bacteria 917
598 Ga0495662_0000720 3300046476 Bacteria 15794
599 Ga0495662_0005913 3300046476 Bacteria 6118
600 Ga0495662_0015270 3300046476 Bacteria 3731
601 Ga0495662_0019754 3300046476 Bacteria 3259
602 Ga0495664_0000002 3300046477 Bacteria 625183
603 Ga0495664_0000584 3300046477 Bacteria 18401
604 Ga0495664_0004997 3300046477 Bacteria 7262
605 Ga0495664_0081533 3300046477 Bacteria 1939
606 Ga0495664_0116827 3300046477 Bacteria 1613
607 Ga0495664_0127500 3300046477 Bacteria 1540
608 Ga0495584_0047311 3300046491 Unclassified 2169
609 Ga0495585_0009108 3300046492 Bacteria 5978
610 Ga0495594_0099009 3300046499 Unclassified 1639
611 Ga0495607_0018871 3300046501 Bacteria 4386
612 Ga0495607_0170636 3300046501 Bacteria 1099
613 Ga0495608_0000009 3300046511 Bacteria 266614
614 Ga0495608_0048818 3300046511 Bacteria 2811
615 Ga0495608_0073249 3300046511 Bacteria 2234
616 Ga0495618_0000005 3300046514 Bacteria 230421
617 Ga0495618_0002882 3300046514 Bacteria 10903
618 Ga0495618_0033591 3300046514 Bacteria 3216
619 Ga0495618_0058446 3300046514 Unclassified 2442
620 Ga0495628_0000002 3300046516 Bacteria 589399
621 Ga0495628_0009056 3300046516 Bacteria 8514
622 Ga0495628_0033882 3300046516 Bacteria 4112
623 Ga0495628_0059495 3300046516 Unclassified 2999
624 Ga0495630_0000614 3300046517 Bacteria 25848
625 Ga0495630_0025217 3300046517 Bacteria 4395
626 Ga0495630_0061694 3300046517 Bacteria 2815
627 Ga0495630_0110416 3300046517 Bacteria 2083
628 Ga0495630_0132387 3300046517 Bacteria 1894
629 Ga0495631_0060519 3300046518 Unclassified 1643
630 Ga0495644_0001230 3300046523 Bacteria 10480
631 Ga0495666_0005058 3300046526 Bacteria 6673
632 Ga0495666_0043477 3300046526 Bacteria 2171
633 Ga0495652_0000004 3300046529 Bacteria 588877
634 Ga0495652_0009251 3300046529 Bacteria 8956
635 Ga0495652_0019750 3300046529 Bacteria 5994
636 Ga0495652_0045220 3300046529 Bacteria 3787
637 Ga0495652_0060267 3300046529 Bacteria 3208
638 Ga0495652_0187831 3300046529 Bacteria 1580
639 Ga0495665_0005753 3300046531 Bacteria 6691
640 Ga0495665_0006707 3300046531 Bacteria 6207
641 Ga0495665_0034270 3300046531 Bacteria 2714
642 Ga0495665_0056695 3300046531 Bacteria 2068
643 Ga0495640_0000005 3300046533 Bacteria 318271
644 Ga0495640_0009209 3300046533 Bacteria 7703
645 Ga0495640_0017003 3300046533 Bacteria 5429
646 Ga0495640_0031918 3300046533 Bacteria 3755
647 Ga0495640_0069901 3300046533 Unclassified 2360
648 Ga0495640_0110465 3300046533 Bacteria 1797
649 Ga0495586_0027039 3300046535 Unclassified 3070
650 Ga0495586_0048545 3300046535 Bacteria 2294
651 Ga0495586_0106107 3300046535 Bacteria 1562
652 Ga0495587_0000007 3300046536 Bacteria 290788
653 Ga0495587_0027972 3300046536 Bacteria 3432
654 Ga0495598_0034709 3300046537 Unclassified 1440
655 Ga0495645_0000003 3300046543 Bacteria 570133
656 Ga0495645_0004356 3300046543 Bacteria 9673
657 Ga0495645_0004437 3300046543 Bacteria 9581
658 Ga0495645_0062811 3300046543 Unclassified 2690
659 Ga0495645_0110853 3300046543 Bacteria 1942
660 Ga0495622_0032570 3300046557 Unclassified 2433
661 Ga0495633_0010995 3300046558 Bacteria 4913
662 Ga0495667_0000002 3300046559 Bacteria 437535
663 Ga0495667_0006822 3300046559 Bacteria 7752
664 Ga0495667_0009615 3300046559 Bacteria 6556
665 Ga0495667_0034173 3300046559 Bacteria 3399
666 Ga0495667_0120959 3300046559 Bacteria 1690
667 Ga0495667_0157123 3300046559 Bacteria 1463
668 Ga0495656_0012639 3300046615 Unclassified 3121
669 Ga0495634_0000129 3300046642 Bacteria 65082
670 Ga0495634_0003005 3300046642 Bacteria 13730
671 Ga0495634_0021910 3300046642 Bacteria 4507
672 Ga0495634_0022328 3300046642 Bacteria 4459
673 Ga0495634_0047801 3300046642 Bacteria 2882
674 Ga0495635_0000289 3300046663 Bacteria 32189
675 Ga0495635_0003450 3300046663 Bacteria 10929
676 Ga0495635_0014790 3300046663 Bacteria 5459
677 Ga0495635_0023231 3300046663 Bacteria 4321
678 Ga0495635_0073532 3300046663 Bacteria 2341
679 Ga0495659_0008534 3300046664 Unclassified 3261
680 Ga0495661_0068880 3300046665 Unclassified 2075
681 Ga0495588_0006106 3300046674 Bacteria 5408
682 Ga0495657_0000781 3300046675 Bacteria 28299
683 Ga0495657_0015892 3300046675 Bacteria 5494
684 Ga0495599_0000001 3300046678 Bacteria 537563
685 Ga0495599_0003681 3300046678 Bacteria 8984
686 Ga0495599_0070954 3300046678 Unclassified 2174
687 Ga0495623_0000001 3300046679 Bacteria 313861
688 Ga0495623_0000394 3300046679 Bacteria 28821
689 Ga0495646_0000013 3300046680 Bacteria 159700
690 Ga0495646_0032905 3300046680 Unclassified 3224
691 Ga0495646_0059294 3300046680 Bacteria 2286
692 Ga0495647_0010228 3300046681 Unclassified 3192
693 Ga0495658_0006676 3300046683 Bacteria 5671
694 Ga0495658_0141296 3300046683 Bacteria 1472
695 Ga0495658_0321906 3300046683 Bacteria 980
696 Ga0495669_0015622 3300046684 Bacteria 3252
697 Ga0495613_0028472 3300046689 Bacteria 4155
698 Ga0495613_0061029 3300046689 Plasmid 2761
699 Ga0495613_0105583 3300046689 Bacteria 2033
700 Ga0495613_0110366 3300046689 Bacteria 1982
701 Ga0495613_0129215 3300046689 Bacteria 1810
702 Ga0495624_0015339 3300046690 Bacteria 5176
703 Ga0495624_0025903 3300046690 Bacteria 3848
704 Ga0495624_0050311 3300046690 Unclassified 2640
705 Ga0495670_0029795 3300046691 Unclassified 2710
706 Ga0495600_0000233 3300046809 Bacteria 30755
707 Ga0495600_0015332 3300046809 Bacteria 4843
708 Ga0495600_0019167 3300046809 Bacteria 4366
709 Ga0495600_0024552 3300046809 Bacteria 3881
710 Ga0495581_0013725 3300047315 Bacteria 4697
711 Ga0495581_0026833 3300047315 Bacteria 3339
712 Ga0495581_0026866 3300047315 Bacteria 3337
713 Ga0495604_0000005 3300047317 Bacteria 424516
714 Ga0495604_0009872 3300047317 Bacteria 7557
715 Ga0495604_0034454 3300047317 Bacteria 4005
716 Ga0495674_0000003 3300047319 Bacteria 562126
717 Ga0495674_0015111 3300047319 Bacteria 7221
718 Ga0495674_0068941 3300047319 Bacteria 3059
719 Ga0495674_0093827 3300047319 Bacteria 2561
720 Ga0495676_0041502 3300047321 Bacteria 3786
721 Ga0495676_0092904 3300047321 Bacteria 2251
722 Ga0495680_0000002 3300047322 Bacteria 197533
723 Ga0495680_0021224 3300047322 Bacteria 5440
724 Ga0495680_0100223 3300047322 Bacteria 2158
725 Ga0495680_0228873 3300047322 Unclassified 1324
726 Ga0495675_0000437 3300047444 Bacteria 27820
727 Ga0495675_0001877 3300047444 Bacteria 12518
728 Ga0495675_0016951 3300047444 Bacteria 4610
729 Ga0495684_0000020 3300047471 Bacteria 148507
730 Ga0495684_0002213 3300047471 Bacteria 15573
731 Ga0495684_0011003 3300047471 Bacteria 6996
732 Ga0495684_0021760 3300047471 Bacteria 4936
733 Ga0495684_0044532 3300047471 Bacteria 3397
734 Ga0495684_0122904 3300047471 Bacteria 1954
735 Ga0495684_0126168 3300047471 Bacteria 1925
736 Ga0495593_0003922 3300047673 Bacteria 8887
737 Ga0495593_0004406 3300047673 Bacteria 8369
738 Ga0495593_0034613 3300047673 Bacteria 2746
739 Ga0495593_0058377 3300047673 Bacteria 2024
740 Ga0495593_0130745 3300047673 Unclassified 1274
741 Ga0495602_0000027 3300048088 Bacteria 145010
742 Ga0495602_0009963 3300048088 Bacteria 9858
743 Ga0495602_0145462 3300048088 Unclassified 1871
744 Ga0495602_0185619 3300048088 Bacteria 1599
745 Ga0495614_0002867 3300048089 Bacteria 7668
746 Ga0495614_0023625 3300048089 Bacteria 2654
747 Ga0496100_0002706 3300048903 Bacteria 9055
748 Ga0496100_0099817 3300048903 Bacteria 1998
749 Ga0496101_0010321 3300048904 Bacteria 6167
750 Ga0496101_0019659 3300048904 Bacteria 4615
751 Ga0496102_0006904 3300048905 Bacteria 9684
752 Ga0496102_0035844 3300048905 Bacteria 4468
753 Ga0496102_0569395 3300048905 Bacteria 1055
754 Ga0496103_0005233 3300048906 Bacteria 7791
755 Ga0496103_0034477 3300048906 Bacteria 3095
756 Ga0496103_0046547 3300048906 Bacteria 2678
757 Ga0496103_0203148 3300048906 Bacteria 1274
758 Ga0496104_0000878 3300048907 Bacteria 25861
759 Ga0496104_0002100 3300048907 Bacteria 17311
760 Ga0496104_0022878 3300048907 Bacteria 5742
761 Ga0496104_0052079 3300048907 Bacteria 3866
762 Ga0496104_0086886 3300048907 Bacteria 2986
763 Ga0496104_0093798 3300048907 Bacteria 2872
764 Ga0496105_0000170 3300048908 Bacteria 43535
765 Ga0496105_0004296 3300048908 Bacteria 10727
766 Ga0496105_0011194 3300048908 Bacteria 7077
767 Ga0496106_0004983 3300048909 Bacteria 9830
768 Ga0496106_0043954 3300048909 Unclassified 3353
769 Ga0496106_0235488 3300048909 Bacteria 1462
770 Ga0496107_0001176 3300048910 Bacteria 15887
771 Ga0496107_0007124 3300048910 Bacteria 7703
772 Ga0496107_0079984 3300048910 Bacteria 2383
773 Ga0496107_0108662 3300048910 Bacteria 2037
774 Ga0496107_0118703 3300048910 Bacteria 1947
775 Ga0496107_0199491 3300048910 Bacteria 1487
776 Ga0496108_0009970 3300048911 Bacteria 7699
777 Ga0496108_0037853 3300048911 Bacteria 4019
778 Ga0496108_0096768 3300048911 Bacteria 2515
779 Ga0496109_0001667 3300048912 Bacteria 18509
780 Ga0496109_0002262 3300048912 Bacteria 16001
781 Ga0496109_0036424 3300048912 Bacteria 4441
782 Ga0496109_0179807 3300048912 Bacteria 1986
783 Ga0496109_0473724 3300048912 Bacteria 1182
784 Ga0496110_0049803 3300048913 Bacteria 3677
785 Ga0496110_0053814 3300048913 Bacteria 3539
786 Ga0496110_0074654 3300048913 Bacteria 3012
787 Ga0496110_0078260 3300048913 Bacteria 2944
788 Ga0496111_0030563 3300048914 Bacteria 3831
789 Ga0496111_0084373 3300048914 Bacteria 2322
790 Ga0496111_0333084 3300048914 Bacteria 1124
791 Ga0496111_0365899 3300048914 Bacteria 1067
792 Ga0496112_0004283 3300048915 Bacteria 12045
793 Ga0496112_0046052 3300048915 Bacteria 4277
794 Ga0496112_0078905 3300048915 Unclassified 3255
795 Ga0496113_0066655 3300048916 Bacteria 2727
796 Ga0496113_0100310 3300048916 Bacteria 2243
797 Ga0496113_0286237 3300048916 Bacteria 1318
798 Ga0496114_0009491 3300048917 Bacteria 7724
799 Ga0496114_0028590 3300048917 Bacteria 4576
800 Ga0496114_0285316 3300048917 Bacteria 1456
801 Ga0496115_0009601 3300048918 Bacteria 7193
802 Ga0496115_0016506 3300048918 Bacteria 5624
803 Ga0496115_0040096 3300048918 Bacteria 3721
804 Ga0496115_0063742 3300048918 Bacteria 2973
805 Ga0496116_0031972 3300048919 Bacteria 3757
806 Ga0496124_0004131 3300048927 Bacteria 17151
807 Ga0496125_0005718 3300048928 Bacteria 13695
808 Ga0496126_0002146 3300048929 Bacteria 27491
809 Ga0496126_0094588 3300048929 Bacteria 2622
810 Ga0496126_0177570 3300048929 Bacteria 1811
811 Ga0501074_0021786 3300049590 Bacteria 4652
812 Ga0501076_0088713 3300049592 Bacteria 2486
813 Ga0501080_0020639 3300049742 Bacteria 6102
814 nmdc:mga06z11_46105_c1 3300050494 Bacteria 2207
815 nmdc:mga05p37_22220_c1 3300050507 Bacteria 7692
816 nmdc:mga05p37_786_c1 3300050507 Bacteria 35281
817 nmdc:mga09592_11785_c1 3300050508 Bacteria 7111
818 nmdc:mga0qj67_537_c1 3300050509 Bacteria 25810
819 nmdc:mga06r32_121_c1 3300050510 Bacteria 55968
820 nmdc:mga08y16_105144_c1 3300050511 Bacteria 2939
821 nmdc:mga08y16_12146_c1 3300050511 Bacteria 9052
822 nmdc:mga08y16_309_c1 3300050511 Bacteria 44098
823 nmdc:mga08y16_7306_c1 3300050511 Bacteria 11594
824 nmdc:mga0n895_104_c1 3300050512 Bacteria 49584
825 nmdc:mga0n895_10980_c1 3300050512 Bacteria 8050
826 nmdc:mga0n895_110781_c1 3300050512 Bacteria 2761
827 nmdc:mga0n895_156415_c1 3300050512 Bacteria 2310
828 nmdc:mga0n895_183369_c1 3300050512 Bacteria 2125
829 nmdc:mga0n895_1852_c1 3300050512 Bacteria 16145
830 nmdc:mga0n895_470439_c1 3300050512 Bacteria 1268
831 nmdc:mga0rr50_154643_c1 3300050513 Bacteria 1857
832 nmdc:mga0rr50_170358_c1 3300050513 Bacteria 1774
833 nmdc:mga0rr50_8571_c1 3300050513 Bacteria 6373
834 nmdc:mga08x19_334767_c1 3300050514 Bacteria 1055
835 nmdc:mga0a205_126577_c1 3300050515 Bacteria 2455
836 nmdc:mga0a205_1810_c1 3300050515 Bacteria 18497
837 nmdc:mga0a205_2795_c1 3300050515 Bacteria 15434
838 Ga0495601_0000010 3300053077 Bacteria 266222
839 Ga0495601_0000780 3300053077 Bacteria 17215
840 Ga0495601_0011515 3300053077 Bacteria 5296
841 Ga0495601_0021100 3300053077 Bacteria 3985
842 Ga0495601_0023569 3300053077 Bacteria 3782
843 Ga0495601_0047391 3300053077 Bacteria 2705
844 Ga0495601_0090212 3300053077 Unclassified 1971
845 Ga0495601_0115075 3300053077 Bacteria 1744
846 Ga0495612_0000002 3300053078 Bacteria 310466
847 Ga0495612_0002172 3300053078 Bacteria 8075
848 Ga0495612_0006029 3300053078 Bacteria 4993
849 Ga0495612_0006436 3300053078 Bacteria 4827
850 Ga0495612_0019933 3300053078 Bacteria 2687
851 Ga0495612_0038488 3300053078 Bacteria 1943
852 Ga0495595_0000184 3300053084 Bacteria 25097
853 Ga0495595_0001846 3300053084 Bacteria 8229
854 Ga0495595_0001851 3300053084 Bacteria 8218
855 Ga0495595_0002471 3300053084 Bacteria 7230
856 Ga0495619_0000002 3300053085 Bacteria 530226
857 Ga0495619_0001456 3300053085 Bacteria 15595
858 Ga0495619_0005827 3300053085 Bacteria 7809
859 Ga0495619_0014152 3300053085 Bacteria 5037
860 Ga0495619_0023627 3300053085 Bacteria 3942
861 Ga0495619_0027380 3300053085 Bacteria 3670
862 Ga0495619_0063585 3300053085 Bacteria 2458
863 Ga0495619_0079005 3300053085 Bacteria 2212
864 Ga0500644_0001910 3300053088 Bacteria 5347
865 Ga0500616_0000002 3300053153 Bacteria 1611257
866 Ga0466962_0041137 3300061719 Bacteria 2212
867 Ga0466962_0118041 3300061719 Bacteria 1279
868 2929205367 2929199973 Bacteria 7260745
869 8055914195 8055909800 Bacteria 7278581
870 Ga0207664_10103929
871 2214884080
872 ARSoilYngRDRAFT_c00087
873 ARSoilYngRDRAFT_c00489
874 ARcpr5yngRDRAFT_c000053
875 ARSoilOldRDRAFT_c000064
876 ARCol0oldRDRAFT_c00196
877 ARCol0yngRDRAFT_1000047
878 JGI24746J21847_1000312
879 JGI24739J22299_10000985
880 JGI24737J22298_10001495
881 JGI24750J21931_1000203
882 JGI24745J21846_1000249
883 JGI24748J21848_1000789
884 JGI24738J21930_10001441
885 JGI24035J26624_1000103
886 rootH1_10120293
887 JGI25405J52794_10015249
888 Ga0065704_10080382
889 Ga0065712_10017123
890 Ga0065712_10134843
891 Ga0065712_10146592
892 Ga0065715_10090502
893 Ga0070676_10001056
894 Ga0070683_100003491
895 Ga0070690_100008492
896 Ga0070670_100007890
897 Ga0070670_100196981
898 Ga0070670_100288925
899 Ga0070677_10000206
900 Ga0068869_100012026
901 Ga0068869_100375119
902 Ga0070666_10005855
903 Ga0070666_10007454
904 Ga0070680_100014216
905 Ga0070680_100031681
906 Ga0070682_100001749
907 Ga0068868_100019471
908 Ga0070660_100002617
909 Ga0070689_100006306
910 Ga0070689_100045727
911 Ga0070691_10004394
912 Ga0070687_100005432
913 Ga0070687_100089785
914 Ga0070687_100138053
915 Ga0070661_100006928
916 Ga0070692_10002854
917 Ga0070692_10079654
918 Ga0070668_100000882
919 Ga0070669_100002256
920 Ga0070675_100001384
921 Ga0070675_100126887
922 Ga0070671_100001328
923 Ga0070671_100038217
924 Ga0070671_100081005
925 Ga0070674_100002239
926 Ga0070674_100023992
927 Ga0070674_100027750
928 Ga0070674_100051249
929 Ga0070673_100002806
930 Ga0070673_100005819
931 Ga0070688_100007431
932 Ga0070688_100012208
933 Ga0070688_100022305
934 Ga0070688_100064310
935 Ga0070659_100007170
936 Ga0070659_100103368
937 Ga0070667_100003216
938 Ga0070703_10006414
939 Ga0070714_100034654
940 Ga0070714_100154904
941 Ga0070713_100045738
942 Ga0070713_100131207
943 Ga0070713_100302116
944 Ga0070710_10021309
945 Ga0070710_10089656
946 Ga0070701_10007610
947 Ga0070701_10093006
948 Ga0070711_100058095
949 Ga0070711_100087855
950 Ga0070711_100129259
951 Ga0070711_100228874
952 Ga0070711_100239739
953 Ga0070705_100012725
954 Ga0070700_100000556
955 Ga0070700_100198484
956 Ga0070694_100001349
957 Ga0070694_100216223
958 Ga0070708_100026811
959 Ga0070708_100321334
960 Ga0070663_100006533
961 Ga0070663_100010686
962 Ga0070663_100040889
963 Ga0070663_100086354
964 Ga0070663_100128263
965 Ga0070678_100028145
966 Ga0070678_100055277
967 Ga0070678_100171754
968 Ga0070662_100006933
969 Ga0070662_100168810
970 Ga0070681_10013387
971 Ga0070681_10048783
972 Ga0070681_10075267
973 Ga0068867_100002573
974 Ga0068867_100091628
975 Ga0068867_100287083
976 Ga0070685_10001130
977 Ga0070685_10037180
978 Ga0070679_100012382
979 Ga0070679_100057663
980 Ga0070679_100163207
981 Ga0070684_100021825
982 Ga0070684_100026880
983 Ga0070684_100087654
984 Ga0070697_100049880
985 Ga0068853_100000906
986 Ga0070672_100000679
987 Ga0070686_100001681
988 Ga0070686_100029763
989 Ga0070686_100059649
990 Ga0070695_100007010
991 Ga0070696_100035611
992 Ga0070696_100335150
993 Ga0070693_100003374
994 Ga0070665_100107509
995 Ga0070665_100131945
996 Ga0070665_100157786
997 Ga0070704_100011666
998 Ga0070704_100063568
999 Ga0068855_100005213
1000 Ga0068855_100067138
1001 Ga0070664_100008267
1002 Ga0070664_100071818
1003 Ga0070664_100184007
1004 Ga0068857_100024411
1005 Ga0068857_100089731
1006 Ga0068857_100379340
1007 Ga0068854_100001485
1008 Ga0068856_100000013
1009 Ga0068856_100004080
1010 Ga0070702_100004190
1011 Ga0070702_100143723
1012 Ga0068852_100009647
1013 Ga0068859_100003498
1014 Ga0068859_100068433
1015 Ga0068859_100304340
1016 Ga0068864_100006196
1017 Ga0068864_100097020
1018 Ga0068864_100110565
1019 Ga0068864_100134900
1020 Ga0068864_100258890
1021 Ga0068866_10002003
1022 Ga0068866_10062811
1023 Ga0068866_10262732
1024 Ga0068861_100029256
1025 Ga0068870_10004133
1026 Ga0068870_10140008
1027 Ga0068863_100002935
1028 Ga0068863_100398028
1029 Ga0068858_100013279
1030 Ga0068858_100102721
1031 Ga0068860_100002542
1032 Ga0068860_100072832
1033 Ga0068860_100414830
1034 Ga0068862_100006476
1035 Ga0081455_10001284
1036 Ga0081455_10004026
1037 Ga0081455_10026742
1038 Ga0081540_1051714
1039 Ga0070717_10154874
1040 Ga0070717_10331340
1041 Ga0075432_10007074
1042 Ga0070715_10068129
1043 Ga0070716_100009608
1044 Ga0070712_100015646
1045 Ga0070712_100147720
1046 Ga0075367_10076810
1047 Ga0097621_100011406
1048 Ga0068871_100018905
1049 Ga0075428_100004320
1050 Ga0075430_100231934
1051 Ga0075431_100185504
1052 Ga0075433_10000029
1053 Ga0075433_10007719
1054 Ga0075433_10023855
1055 Ga0075433_10055372
1056 Ga0075434_100000208
1057 Ga0075434_100001333
1058 Ga0075434_100037538
1059 Ga0075434_100037751
1060 Ga0075434_100126033
1061 Ga0075434_100202518
1062 Ga0075429_100207077
1063 Ga0068865_100001418
1064 Ga0068865_100065230
1065 Ga0068865_100255669
1066 Ga0075436_100059762
1067 Ga0097620_100003498
1068 Ga0097620_100068431
1069 Ga0097620_100304332
1070 Ga0075435_100010419
1071 Ga0075435_100081701
1072 Ga0075435_100215619
1073 Ga0105250_10023895
1074 Ga0105240_10012832
1075 Ga0105240_10041886
1076 Ga0105240_10411823
1077 Ga0111539_10000345
1078 Ga0111539_10002114
1079 Ga0111539_10066957
1080 Ga0111539_10191820
1081 Ga0105245_10002739
1082 Ga0105245_10093138
1083 Ga0105245_10098474
1084 Ga0105247_10004019
1085 Ga0105247_10013262
1086 Ga0105247_10186717
1087 Ga0114129_10035787
1088 Ga0114129_10333964
1089 Ga0114129_10532762
1090 Ga0105243_10002166
1091 Ga0105241_10004380
1092 Ga0105241_10061853
1093 Ga0105241_10085225
1094 Ga0105242_10037470
1095 Ga0105248_10002844
1096 Ga0105248_10057459
1097 Ga0105248_10091855
1098 Ga0105248_10295214
1099 Ga0105248_10489030
1100 Ga0105248_10525166
1101 Ga0105237_10013429
1102 Ga0105237_10021168
1103 Ga0105237_10073702
1104 Ga0105237_10445792
1105 Ga0105238_10057687
1106 Ga0105238_10134819
1107 Ga0105249_10010187
1108 Ga0105239_10005997
1109 Ga0105239_10073245
1110 Ga0105239_10076690
1111 Ga0105239_10186134
1112 Ga0105246_10004149
1113 Ga0105246_10124323
1114 Ga0157373_10006523
1115 Ga0157369_10000848
1116 Ga0157369_10062683
1117 Ga0157374_10008496
1118 Ga0157374_10015440
1119 Ga0157374_10208350
1120 Ga0157378_10011772
1121 Ga0157378_10059516
1122 Ga0163162_10004494
1123 Ga0163162_10106664
1124 Ga0163162_10685782
1125 Ga0157372_10046139
1126 Ga0157375_10038679
1127 Ga0157375_10038977
1128 Ga0157375_10115203
1129 Ga0163163_10010926
1130 Ga0163163_10025845
1131 Ga0163163_10050056
1132 Ga0163163_10321653
1133 Ga0157380_10009077
1134 Ga0157377_10002192
1135 Ga0157377_10162636
1136 Ga0157379_10002658
1137 Ga0157379_10027483
1138 Ga0157379_10124319
1139 Ga0157376_10003174
1140 Ga0157376_10005599
1141 Ga0163161_10001452
1142 Ga0163161_10035410
1143 Ga0213876_10023662
1144 Ga0228598_1014983
1145 Ga0207666_1000032
1146 Ga0207673_1000021
1147 Ga0207697_10000192
1148 Ga0207656_10042008
1149 Ga0207656_10051615
1150 Ga0207713_1021420
1151 Ga0207653_10001002
1152 Ga0207682_10000056
1153 Ga0207692_10007243
1154 Ga0207642_10028901
1155 Ga0207710_10014280
1156 Ga0207710_10048604
1157 Ga0207688_10000066
1158 Ga0207688_10039303
1159 Ga0207688_10113063
1160 Ga0207680_10007602
1161 Ga0207647_10004193
1162 Ga0207647_10078582
1163 Ga0207647_10082832
1164 Ga0207699_10024636
1165 Ga0207645_10006176
1166 Ga0207645_10027343
1167 Ga0207645_10029375
1168 Ga0207643_10000187
1169 Ga0207643_10022074
1170 Ga0207654_10003683
1171 Ga0207707_10009866
1172 Ga0207707_10018653
1173 Ga0207707_10080750
1174 Ga0207707_10095117
1175 Ga0207695_10290248
1176 Ga0207695_10298115
1177 Ga0207671_10178498
1178 Ga0207693_10001676
1179 Ga0207693_10015923
1180 Ga0207693_10075345
1181 Ga0207693_10115587
1182 Ga0207663_10011824
1183 Ga0207663_10091766
1184 Ga0207663_10143380
1185 Ga0207660_10006714
1186 Ga0207662_10000292
1187 Ga0207662_10052636
1188 Ga0207662_10067919
1189 Ga0207662_10095023
1190 Ga0207657_10001630
1191 Ga0207657_10077442
1192 Ga0207649_10001002
1193 Ga0207652_10090398
1194 Ga0207652_10091832
1195 Ga0207652_10100881
1196 Ga0207652_10472992
1197 Ga0207681_10006515
1198 Ga0207650_10048649
1199 Ga0207650_10119341
1200 Ga0207659_10002407
1201 Ga0207659_10055975
1202 Ga0207687_10003001
1203 Ga0207687_10140247
1204 Ga0207687_10203058
1205 Ga0207700_10007834
1206 Ga0207700_10124688
1207 Ga0207700_10157349
1208 Ga0207700_10214902
1209 Ga0207664_10124765
1210 Ga0207664_10136882
1211 Ga0207644_10003646
1212 Ga0207644_10007286
1213 Ga0207644_10026516
1214 Ga0207690_10001213
1215 Ga0207706_10009370
1216 Ga0207706_10042486
1217 Ga0207706_10081753
1218 Ga0207686_10007500
1219 Ga0207709_10001124
1220 Ga0207709_10069079
1221 Ga0207670_10001034
1222 Ga0207670_10007190
1223 Ga0207670_10078691
1224 Ga0207669_10000578
1225 Ga0207669_10033689
1226 Ga0207669_10035046
1227 Ga0207669_10060100
1228 Ga0207704_10001542
1229 Ga0207704_10059216
1230 Ga0207665_10002127
1231 Ga0207665_10074485
1232 Ga0207691_10002805
1233 Ga0207711_10009683
1234 Ga0207711_10011676
1235 Ga0207711_10019987
1236 Ga0207689_10001239
1237 Ga0207689_10197242
1238 Ga0207661_10002038
1239 Ga0207661_10213555
1240 Ga0207679_10000128
1241 Ga0207679_10000187
1242 Ga0207679_10000529
1243 Ga0207667_10035917
1244 Ga0207667_10293448
1245 Ga0207651_10005107
1246 Ga0207712_10000520
1247 Ga0207668_10000260
1248 Ga0207640_10006747
1249 Ga0207640_10051876
1250 Ga0207658_10005448
1251 Ga0207677_10032773
1252 Ga0207703_10016150
1253 Ga0207703_10152689
1254 Ga0207639_10008245
1255 Ga0207639_10318692
1256 Ga0207678_10007149
1257 Ga0207678_10014682
1258 Ga0207678_10053436
1259 Ga0207678_10182125
1260 Ga0207708_10001080
1261 Ga0207708_10091141
1262 Ga0207708_10113557
1263 Ga0207702_10000090
1264 Ga0207702_10326241
1265 Ga0207641_10006255
1266 Ga0207641_10103942
1267 Ga0207641_10292024
1268 Ga0207648_10001031
1269 Ga0207648_10036632
1270 Ga0207676_10007274
1271 Ga0207674_10000686
1272 Ga0207674_10033888
1273 Ga0207674_10056651
1274 Ga0207674_10111775
1275 Ga0207675_100002806
1276 Ga0207675_100171011
1277 Ga0207683_10001686
1278 Ga0207683_10002136
1279 Ga0207683_10006803
1280 Ga0207683_10036985
1281 Ga0207698_10007006
1282 Ga0207698_10244519
1283 Ga0207698_10245318
1284 Ga0209998_10001494
1285 Ga0209974_10000101
1286 Ga0207428_10000360
1287 Ga0207428_10000556
1288 Ga0207428_10006906
1289 Ga0268266_10110354
1290 Ga0268265_10000526
1291 Ga0268264_10002582
1292 Ga0265337_1000923
1293 Ga0265318_10009497
1294 Ga0265338_10075379
1295 Ga0265338_10086764
1296 Ga0265763_1000022
1297 Ga0265760_10049290
1298 Ga0265330_10056518
1299 Ga0265332_10107931
1300 Ga0265320_10009858
1301 Ga0265325_10022783
1302 Ga0265325_10030323
1303 Ga0265325_10068982
1304 Ga0265329_10010635
1305 Ga0265340_10016642
1306 Ga0265339_10000038
1307 Ga0265339_10009421
1308 Ga0265339_10010951
1309 Ga0265339_10023221
1310 Ga0265316_10188829
1311 Ga0265316_10213857
1312 Ga0265316_10216877
1313 Ga0265313_10000034
1314 Ga0265313_10002885
1315 Ga0265313_10026895
1316 Ga0265314_10002042
1317 Ga0265314_10005437
1318 Ga0265314_10027527
1319 Ga0265342_10115049
1320 Ga0307516_10284070
1321 Ga0373930_0005389
1322 Ga0373948_0000653
1323 Ga0373950_0002536
1324 Ga0373950_0010850
1325 Ga0373958_0000128
1326 Ga0373958_0001016
1327 Ga0373959_0001211
1328 Ga0373938_0000039
1329 Ga0373938_0003571
1330 Ga0373926_0036813
1331 Ga0373928_0000780
1332 Ga0373928_0000840
1333 Ga0373929_0000209
1334 Ga0373929_0001461
1335 Ga0373940_0001653
1336 Ga0373944_0072813
1337 Ga0373949_0003694
1338 Ga0373949_0004971
1339 Ga0373949_0010465
1340 Ga0373951_0001984
1341 Ga0373951_0003922
1342 Ga0373952_0000127
1343 Ga0373952_0006066
1344 Ga0373952_0012769
1345 Ga0373923_0002024
1346 Ga0373932_0000284
1347 Ga0373932_0000942
1348 Ga0373936_0011642
1349 Ga0373939_0001563
1350 Ga0373939_0010809
1351 Ga0373941_0000214
1352 Ga0373941_0021725
1353 Ga0373945_0001162
1354 Ga0373945_0024944
1355 Ga0373945_0028582
1356 Ga0373945_0032981
1357 Ga0373953_0018375
1358 Ga0373953_0065617
1359 Ga0373953_0091158
1360 Ga0373954_0000797
1361 Ga0373954_0001989
1362 Ga0373956_0029526
1363 Ga0373957_0006608
1364 Ga0373957_0013318
1365 Ga0373957_0021825
1366 Ga0373960_0004672
1367 Ga0373960_0005071
1368 Ga0373943_0003311
1369 Ga0373943_0005072
1370 Ga0373943_0024444
1371 Ga0373943_0030273
1372 Ga0373946_0000764
1373 Ga0373946_0009266
1374 Ga0373946_0033861
1375 Ga0373955_0000425
1376 Ga0373955_0001166
1377 Ga0373955_0008057
1378 Ga0373942_0000702
1379 Ga0373942_0002546
1380 Ga0373961_0003562
1381 Ga0373962_0000320
1382 Ga0373962_0000506
1383 Ga0373924_0056104
1384 Ga0373931_0006810
1385 Ga0373931_0007585
1386 Ga0373931_0086171
1387 Ga0373931_0266514
1388 Ga0373935_0000337
1389 Ga0373935_0021184
1390 Ga0373935_0041444
1391 Ga0373935_0055426
1392 Ga0373935_0061923
1393 Ga0373927_0000699
1394 Ga0373927_0022633
1395 Ga0373927_0050128
1396 Ga0373927_0080021
1397 Ga0373927_0170494
1398 Ga0373927_0176248
1399 Ga0373927_0180697
1400 Ga0373933_0001172
1401 Ga0373933_0003551
1402 Ga0373933_0003679
1403 Ga0373933_0017476
1404 Ga0373933_0196324
1405 Ga0373947_0000274
1406 Ga0373947_0001536
1407 Ga0373947_0056467
1408 Ga0373947_0057811
1409 Ga0373937_0000597
1410 Ga0373937_0002771
1411 Ga0373937_0006032
1412 Ga0373937_0046150
1413 Ga0373937_0073593
1414 Ga0373937_0135835
1415 Ga0373925_0000741
1416 Ga0373925_0001836
1417 Ga0373925_0009897
1418 Ga0373925_0028027
1419 Ga0373925_0175301
1420 Ga0373925_0372685
1421 Ga0395899_0007276
1422 Ga0395899_0173053
1423 Ga0395900_0003202
1424 Ga0395900_0010704
1425 Ga0395900_0054446
1426 Ga0395900_0104076
1427 Ga0395898_0029199
1428 Ga0395898_0030701
1429 Ga0395901_0024663
1430 Ga0395901_0064016
1431 Ga0436365_0590132
1432 Ga0466966_0160596
1433 Ga0466966_0175618
1434 Ga0466963_0053798
1435 Ga0466963_0147173
1436 Ga0466964_0041270
1437 Ga0453684_0443164
1438 Ga0466971_0022105
1439 Ga0466957_0025668
1440 Ga0466957_0063764
1441 Ga0495592_0000188
1442 Ga0495592_0003488
1443 Ga0495592_0003644
1444 Ga0495592_0181229
1445 Ga0495603_0063474
1446 Ga0495629_0002114
1447 Ga0495629_0051344
1448 Ga0495629_0051389
1449 Ga0495641_0006360
1450 Ga0495651_0001439
1451 Ga0495651_0074300
1452 Ga0495651_0075602
1453 Ga0495651_0085288
1454 Ga0495653_0000198
1455 Ga0495653_0010944
1456 Ga0495653_0017035
1457 Ga0495653_0257998
1458 Ga0495580_0006784
1459 Ga0495580_0090746
1460 Ga0495580_0105681
1461 Ga0495582_0001989
1462 Ga0495582_0010759
1463 Ga0495639_0019753
1464 Ga0495639_0055054
1465 Ga0495639_0079858
1466 Ga0495639_0228400
1467 Ga0495662_0000720
1468 Ga0495662_0005913
1469 Ga0495662_0015270
1470 Ga0495662_0019754
1471 Ga0495664_0000002
1472 Ga0495664_0000584
1473 Ga0495664_0004997
1474 Ga0495664_0081533
1475 Ga0495664_0116827
1476 Ga0495664_0127500
1477 Ga0495584_0047311
1478 Ga0495585_0009108
1479 Ga0495594_0099009
1480 Ga0495607_0018871
1481 Ga0495607_0170636
1482 Ga0495608_0000009
1483 Ga0495608_0048818
1484 Ga0495608_0073249
1485 Ga0495618_0000005
1486 Ga0495618_0002882
1487 Ga0495618_0033591
1488 Ga0495618_0058446
1489 Ga0495628_0000002
1490 Ga0495628_0009056
1491 Ga0495628_0033882
1492 Ga0495628_0059495
1493 Ga0495630_0000614
1494 Ga0495630_0025217
1495 Ga0495630_0061694
1496 Ga0495630_0110416
1497 Ga0495630_0132387
1498 Ga0495631_0060519
1499 Ga0495644_0001230
1500 Ga0495666_0005058
1501 Ga0495666_0043477
1502 Ga0495652_0000004
1503 Ga0495652_0009251
1504 Ga0495652_0019750
1505 Ga0495652_0045220
1506 Ga0495652_0060267
1507 Ga0495652_0187831
1508 Ga0495665_0005753
1509 Ga0495665_0006707
1510 Ga0495665_0034270
1511 Ga0495665_0056695
1512 Ga0495640_0000005
1513 Ga0495640_0009209
1514 Ga0495640_0017003
1515 Ga0495640_0031918
1516 Ga0495640_0069901
1517 Ga0495640_0110465
1518 Ga0495586_0027039
1519 Ga0495586_0048545
1520 Ga0495586_0106107
1521 Ga0495587_0000007
1522 Ga0495587_0027972
1523 Ga0495598_0034709
1524 Ga0495645_0000003
1525 Ga0495645_0004356
1526 Ga0495645_0004437
1527 Ga0495645_0062811
1528 Ga0495645_0110853
1529 Ga0495622_0032570
1530 Ga0495633_0010995
1531 Ga0495667_0000002
1532 Ga0495667_0006822
1533 Ga0495667_0009615
1534 Ga0495667_0034173
1535 Ga0495667_0120959
1536 Ga0495667_0157123
1537 Ga0495656_0012639
1538 Ga0495634_0000129
1539 Ga0495634_0003005
1540 Ga0495634_0021910
1541 Ga0495634_0022328
1542 Ga0495634_0047801
1543 Ga0495635_0000289
1544 Ga0495635_0003450
1545 Ga0495635_0014790
1546 Ga0495635_0023231
1547 Ga0495635_0073532
1548 Ga0495659_0008534
1549 Ga0495661_0068880
1550 Ga0495588_0006106
1551 Ga0495657_0000781
1552 Ga0495657_0015892
1553 Ga0495599_0000001
1554 Ga0495599_0003681
1555 Ga0495599_0070954
1556 Ga0495623_0000001
1557 Ga0495623_0000394
1558 Ga0495646_0000013
1559 Ga0495646_0032905
1560 Ga0495646_0059294
1561 Ga0495647_0010228
1562 Ga0495658_0006676
1563 Ga0495658_0141296
1564 Ga0495658_0321906
1565 Ga0495669_0015622
1566 Ga0495613_0028472
1567 Ga0495613_0061029
1568 Ga0495613_0105583
1569 Ga0495613_0110366
1570 Ga0495613_0129215
1571 Ga0495624_0015339
1572 Ga0495624_0025903
1573 Ga0495624_0050311
1574 Ga0495670_0029795
1575 Ga0495600_0000233
1576 Ga0495600_0015332
1577 Ga0495600_0019167
1578 Ga0495600_0024552
1579 Ga0495581_0013725
1580 Ga0495581_0026833
1581 Ga0495581_0026866
1582 Ga0495604_0000005
1583 Ga0495604_0009872
1584 Ga0495604_0034454
1585 Ga0495674_0000003
1586 Ga0495674_0015111
1587 Ga0495674_0068941
1588 Ga0495674_0093827
1589 Ga0495676_0041502
1590 Ga0495676_0092904
1591 Ga0495680_0000002
1592 Ga0495680_0021224
1593 Ga0495680_0100223
1594 Ga0495680_0228873
1595 Ga0495675_0000437
1596 Ga0495675_0001877
1597 Ga0495675_0016951
1598 Ga0495684_0000020
1599 Ga0495684_0002213
1600 Ga0495684_0011003
1601 Ga0495684_0021760
1602 Ga0495684_0044532
1603 Ga0495684_0122904
1604 Ga0495684_0126168
1605 Ga0495593_0003922
1606 Ga0495593_0004406
1607 Ga0495593_0034613
1608 Ga0495593_0058377
1609 Ga0495593_0130745
1610 Ga0495602_0000027
1611 Ga0495602_0009963
1612 Ga0495602_0145462
1613 Ga0495602_0185619
1614 Ga0495614_0002867
1615 Ga0495614_0023625
1616 Ga0496100_0002706
1617 Ga0496100_0099817
1618 Ga0496101_0010321
1619 Ga0496101_0019659
1620 Ga0496102_0006904
1621 Ga0496102_0035844
1622 Ga0496102_0569395
1623 Ga0496103_0005233
1624 Ga0496103_0034477
1625 Ga0496103_0046547
1626 Ga0496103_0203148
1627 Ga0496104_0000878
1628 Ga0496104_0002100
1629 Ga0496104_0022878
1630 Ga0496104_0052079
1631 Ga0496104_0086886
1632 Ga0496104_0093798
1633 Ga0496105_0000170
1634 Ga0496105_0004296
1635 Ga0496105_0011194
1636 Ga0496106_0004983
1637 Ga0496106_0043954
1638 Ga0496106_0235488
1639 Ga0496107_0001176
1640 Ga0496107_0007124
1641 Ga0496107_0079984
1642 Ga0496107_0108662
1643 Ga0496107_0118703
1644 Ga0496107_0199491
1645 Ga0496108_0009970
1646 Ga0496108_0037853
1647 Ga0496108_0096768
1648 Ga0496109_0001667
1649 Ga0496109_0002262
1650 Ga0496109_0036424
1651 Ga0496109_0179807
1652 Ga0496109_0473724
1653 Ga0496110_0049803
1654 Ga0496110_0053814
1655 Ga0496110_0074654
1656 Ga0496110_0078260
1657 Ga0496111_0030563
1658 Ga0496111_0084373
1659 Ga0496111_0333084
1660 Ga0496111_0365899
1661 Ga0496112_0004283
1662 Ga0496112_0046052
1663 Ga0496112_0078905
1664 Ga0496113_0066655
1665 Ga0496113_0100310
1666 Ga0496113_0286237
1667 Ga0496114_0009491
1668 Ga0496114_0028590
1669 Ga0496114_0285316
1670 Ga0496115_0009601
1671 Ga0496115_0016506
1672 Ga0496115_0040096
1673 Ga0496115_0063742
1674 Ga0496116_0031972
1675 Ga0496124_0004131
1676 Ga0496125_0005718
1677 Ga0496126_0002146
1678 Ga0496126_0094588
1679 Ga0496126_0177570
1680 Ga0501074_0021786
1681 Ga0501076_0088713
1682 Ga0501080_0020639
1683 nmdc:mga06z11_46105_c1
1684 nmdc:mga05p37_22220_c1
1685 nmdc:mga05p37_786_c1
1686 nmdc:mga09592_11785_c1
1687 nmdc:mga0qj67_537_c1
1688 nmdc:mga06r32_121_c1
1689 nmdc:mga08y16_105144_c1
1690 nmdc:mga08y16_12146_c1
1691 nmdc:mga08y16_309_c1
1692 nmdc:mga08y16_7306_c1
1693 nmdc:mga0n895_104_c1
1694 nmdc:mga0n895_10980_c1
1695 nmdc:mga0n895_110781_c1
1696 nmdc:mga0n895_156415_c1
1697 nmdc:mga0n895_183369_c1
1698 nmdc:mga0n895_1852_c1
1699 nmdc:mga0n895_470439_c1
1700 nmdc:mga0rr50_154643_c1
1701 nmdc:mga0rr50_170358_c1
1702 nmdc:mga0rr50_8571_c1
1703 nmdc:mga08x19_334767_c1
1704 nmdc:mga0a205_126577_c1
1705 nmdc:mga0a205_1810_c1
1706 nmdc:mga0a205_2795_c1
1707 Ga0495601_0000010
1708 Ga0495601_0000780
1709 Ga0495601_0011515
1710 Ga0495601_0021100
1711 Ga0495601_0023569
1712 Ga0495601_0047391
1713 Ga0495601_0090212
1714 Ga0495601_0115075
1715 Ga0495612_0000002
1716 Ga0495612_0002172
1717 Ga0495612_0006029
1718 Ga0495612_0006436
1719 Ga0495612_0019933
1720 Ga0495612_0038488
1721 Ga0495595_0000184
1722 Ga0495595_0001846
1723 Ga0495595_0001851
1724 Ga0495595_0002471
1725 Ga0495619_0000002
1726 Ga0495619_0001456
1727 Ga0495619_0005827
1728 Ga0495619_0014152
1729 Ga0495619_0023627
1730 Ga0495619_0027380
1731 Ga0495619_0063585
1732 Ga0495619_0079005
1733 Ga0500644_0001910
1734 Ga0500616_0000002
1735 Ga0466962_0041137
1736 Ga0466962_0118041
1737 2929205367
1738 8055914195

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

96

368

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9618 31 325
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9555 31 325
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9517 30 325
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9485 30 325
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9441 33 322
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9431 129 245 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9384 129 250 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9353 130 250 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9295 30 325 3.40.190.150
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9225 130 250 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A533IWB4-F1-model_v4 deleted 0.9779 30 94
AF-A0A4V2UYF0-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9778 50 324
AF-A0A536SS29-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9742 38 325
AF-A0A2L1CQM3-F1-model_v4 deleted 0.9741 59 324
AF-A0A375FQQ0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9721 67 325

Map