F484096

General Info

Members Datasets Scaffolds Average Seq Length
868 327 867 218

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0267543|Ga0496111_0267543_12_680
Length 204
Sequence MGNIMDAQTIIARRVALELRPGMLVNLGIGIPALIANYVPVGMKVFFQSENGLIGTGPVPEHGLEQPRLTDAGGRPISALPGACTFDSAMSFGLIRGGHLDMTVLGGLQVDGGAMDLVTGAKRVIVAMQHVAKGKSKIIKKCNLPLTSARIIDLVVTELAVIAFPGGRATLMETAPGVSVADVVSNTEAELIVPSGVPAMAIAA

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
169 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
170 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
184 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
222 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
256 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
257 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
324 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.35
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0.12
Rhizoplane 8.53
Rhizosphere 89.4
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007417J51691_1018961 3300003544 Bacteria 6330
2 Ga0007429J51699_1032193 3300003579 Bacteria 6854
3 JGI25404J52841_10000005 3300003659 Bacteria 17884
4 Ga0032354_1009780 3300003693 Bacteria 6947
5 Ga0055534_1016085 3300003784 Bacteria 1350
6 JGI25405J52794_10071168 3300003911 Bacteria 759
7 Ga0065715_10013140 3300005293 Bacteria 2245
8 Ga0065707_10230384 3300005295 Bacteria 1191
9 Ga0070690_100182655 3300005330 Bacteria 1450
10 Ga0070670_100059915 3300005331 Bacteria 3267
11 Ga0070670_100233222 3300005331 Bacteria 1602
12 Ga0070666_10046516 3300005335 Bacteria 2911
13 Ga0070682_100010249 3300005337 Bacteria 5316
14 Ga0070660_100101583 3300005339 Bacteria 2279
15 Ga0070660_100267373 3300005339 Bacteria 1397
16 Ga0070689_100025741 3300005340 Bacteria 4423
17 Ga0070687_100073685 3300005343 Bacteria 1841
18 Ga0070661_100099533 3300005344 Bacteria 2161
19 Ga0070668_100162092 3300005347 Bacteria 1815
20 Ga0070668_100481940 3300005347 Bacteria 1071
21 Ga0070669_100354794 3300005353 Bacteria 1191
22 Ga0070675_100126160 3300005354 Bacteria 2177
23 Ga0070671_100006478 3300005355 Bacteria 9359
24 Ga0070671_100026508 3300005355 Bacteria 4764
25 Ga0070671_100217596 3300005355 Bacteria 1620
26 Ga0070671_100319021 3300005355 Bacteria 1324
27 Ga0070673_100000565 3300005364 Bacteria 19960
28 Ga0070688_100028600 3300005365 Bacteria 3329
29 Ga0070688_100122280 3300005365 Bacteria 1745
30 Ga0070659_100021832 3300005366 Bacteria 4881
31 Ga0070659_100073113 3300005366 Bacteria 2729
32 Ga0070667_100271451 3300005367 Bacteria 1521
33 Ga0070667_100495000 3300005367 Bacteria 1120
34 Ga0070709_10067759 3300005434 Bacteria 2293
35 Ga0070713_100000018 3300005436 Bacteria 118409
36 Ga0070701_10268942 3300005438 Bacteria 1036
37 Ga0070705_100053620 3300005440 Bacteria 2361
38 Ga0070700_100061033 3300005441 Bacteria 2378
39 Ga0070700_100408252 3300005441 Bacteria 1023
40 Ga0070663_100016718 3300005455 Bacteria 4773
41 Ga0070663_100145868 3300005455 Bacteria 1811
42 Ga0070678_100033489 3300005456 Bacteria 3568
43 Ga0070678_100105335 3300005456 Bacteria 2195
44 Ga0070678_100358743 3300005456 Bacteria 1255
45 Ga0070662_100009332 3300005457 Bacteria 6411
46 Ga0068867_100511421 3300005459 Bacteria 1034
47 Ga0070684_100187428 3300005535 Bacteria 1882
48 Ga0070684_100246593 3300005535 Bacteria 1632
49 Ga0070697_100318943 3300005536 Bacteria 1338
50 Ga0068853_100024317 3300005539 Bacteria 5078
51 Ga0068853_100036539 3300005539 Bacteria 4178
52 Ga0068853_100194162 3300005539 Bacteria 1845
53 Ga0070672_100079213 3300005543 Bacteria 2629
54 Ga0070695_100003910 3300005545 Bacteria 8701
55 Ga0070695_100051176 3300005545 Bacteria 2649
56 Ga0070693_100021913 3300005547 Bacteria 3391
57 Ga0070693_100539808 3300005547 Bacteria 833
58 Ga0070665_100737848 3300005548 Bacteria 998
59 Ga0068855_100113957 3300005563 Bacteria 3101
60 Ga0070664_100036084 3300005564 Bacteria 4152
61 Ga0070664_100223984 3300005564 Bacteria 1683
62 Ga0070664_100237260 3300005564 Bacteria 1636
63 Ga0070664_100583661 3300005564 Bacteria 1036
64 Ga0068857_100215387 3300005577 Bacteria 1753
65 Ga0068854_100036313 3300005578 Bacteria 3454
66 Ga0068854_100272677 3300005578 Bacteria 1359
67 Ga0068856_100464173 3300005614 Bacteria 1287
68 Ga0070702_100315434 3300005615 Bacteria 1087
69 Ga0070702_100320675 3300005615 Bacteria 1080
70 Ga0070702_100388435 3300005615 Bacteria 995
71 Ga0070702_100664462 3300005615 Bacteria 790
72 Ga0068852_100003539 3300005616 Bacteria 10932
73 Ga0068852_100185607 3300005616 Bacteria 1958
74 Ga0068852_101128452 3300005616 Bacteria 804
75 Ga0068852_101276504 3300005616 Bacteria 756
76 Ga0068859_100018952 3300005617 Bacteria 6912
77 Ga0068859_100427888 3300005617 Bacteria 1420
78 Ga0068864_100028552 3300005618 Bacteria 4718
79 Ga0068864_100255449 3300005618 Bacteria 1628
80 Ga0068864_100365293 3300005618 Bacteria 1365
81 Ga0068864_100424629 3300005618 Bacteria 1267
82 Ga0068866_10157190 3300005718 Bacteria 1322
83 Ga0068861_100538062 3300005719 Bacteria 1062
84 Ga0068863_100393968 3300005841 Bacteria 1354
85 Ga0068863_100461975 3300005841 Bacteria 1247
86 Ga0068858_100198178 3300005842 Bacteria 1898
87 Ga0068858_100270442 3300005842 Bacteria 1617
88 Ga0068860_100217511 3300005843 Bacteria 1855
89 Ga0068860_100374357 3300005843 Bacteria 1405
90 Ga0068860_100982512 3300005843 Bacteria 862
91 Ga0081455_10001692 3300005937 Bacteria 26689
92 Ga0081455_10006720 3300005937 Bacteria 12287
93 Ga0081455_10023358 3300005937 Bacteria 5756
94 Ga0081455_10028216 3300005937 Bacteria 5131
95 Ga0081455_10452163 3300005937 Bacteria 877
96 Ga0081538_10021664 3300005981 Bacteria 4680
97 Ga0081540_1000131 3300005983 Bacteria 79958
98 Ga0081540_1001103 3300005983 Bacteria 23924
99 Ga0070717_10039203 3300006028 Bacteria 3854
100 Ga0070717_10163376 3300006028 Bacteria 1933
101 Ga0070717_10465900 3300006028 Bacteria 1140
102 Ga0075365_10143705 3300006038 Bacteria 1657
103 Ga0075368_10218837 3300006042 Bacteria 809
104 Ga0070715_10353193 3300006163 Bacteria 803
105 Ga0070712_100076186 3300006175 Bacteria 2415
106 Ga0070712_100281015 3300006175 Bacteria 1341
107 Ga0075367_10327369 3300006178 Bacteria 966
108 Ga0075366_10199338 3300006195 Bacteria 1217
109 Ga0097621_100183889 3300006237 Bacteria 1807
110 Ga0075428_100006609 3300006844 Bacteria 12899
111 Ga0075428_100401283 3300006844 Bacteria 1469
112 Ga0075430_100095837 3300006846 Bacteria 2480
113 Ga0075430_100149830 3300006846 Bacteria 1943
114 Ga0075430_100485094 3300006846 Bacteria 1020
115 Ga0075431_100000643 3300006847 Bacteria 29600
116 Ga0075431_100030068 3300006847 Bacteria 5593
117 Ga0075431_100168200 3300006847 Bacteria 2253
118 Ga0075431_100264321 3300006847 Bacteria 1745
119 Ga0075431_100302961 3300006847 Bacteria 1614
120 Ga0075431_100384007 3300006847 Bacteria 1408
121 Ga0075433_10056706 3300006852 Bacteria 3423
122 Ga0075433_10108629 3300006852 Bacteria 2460
123 Ga0075433_10619259 3300006852 Unclassified 950
124 Ga0075434_100005496 3300006871 Bacteria 11543
125 Ga0075434_100177508 3300006871 Bacteria 2150
126 Ga0075434_100397744 3300006871 Bacteria 1399
127 Ga0075429_100192489 3300006880 Bacteria 1787
128 Ga0075429_100259240 3300006880 Bacteria 1522
129 Ga0075429_100291529 3300006880 Bacteria 1429
130 Ga0097620_100018951 3300006931 Bacteria 6912
131 Ga0097620_100427878 3300006931 Bacteria 1420
132 Ga0075435_100413526 3300007076 Bacteria 1161
133 Ga0075435_100779528 3300007076 Bacteria 832
134 Ga0105244_10045266 3300009036 Bacteria 2264
135 Ga0105240_10099553 3300009093 Bacteria 3538
136 Ga0105240_10258211 3300009093 Bacteria 2011
137 Ga0105240_10941076 3300009093 Bacteria 927
138 Ga0111539_10011405 3300009094 Bacteria 11155
139 Ga0111539_10026569 3300009094 Bacteria 7078
140 Ga0111539_10308395 3300009094 Bacteria 1842
141 Ga0111539_10369263 3300009094 Bacteria 1670
142 Ga0105245_10008565 3300009098 Bacteria 8924
143 Ga0105245_10037826 3300009098 Bacteria 4291
144 Ga0114129_10000005 3300009147 Bacteria 159906
145 Ga0114129_10003291 3300009147 Bacteria 22689
146 Ga0114129_10020071 3300009147 Bacteria 9511
147 Ga0114129_10025414 3300009147 Bacteria 8391
148 Ga0114129_10087690 3300009147 Bacteria 4315
149 Ga0105243_10017638 3300009148 Bacteria 5399
150 Ga0105243_10149864 3300009148 Bacteria 2000
151 Ga0105242_10535860 3300009176 Bacteria 1120
152 Ga0105248_10227482 3300009177 Bacteria 2100
153 Ga0105248_10350550 3300009177 Bacteria 1662
154 Ga0105237_10067517 3300009545 Bacteria 3569
155 Ga0105238_10004063 3300009551 Bacteria 14505
156 Ga0105239_10154133 3300010375 Bacteria 2565
157 Ga0105239_10193306 3300010375 Bacteria 2278
158 Ga0105239_10674463 3300010375 Bacteria 1181
159 Ga0105239_11113635 3300010375 Bacteria 909
160 Ga0105246_10051869 3300011119 Bacteria 2818
161 Ga0105246_10113164 3300011119 Bacteria 1998
162 Ga0105246_10374663 3300011119 Bacteria 1174
163 Ga0157369_10000568 3300013105 Bacteria 48608
164 Ga0157369_10426691 3300013105 Bacteria 1374
165 Ga0157374_10051753 3300013296 Bacteria 3822
166 Ga0157378_10003059 3300013297 Bacteria 14866
167 Ga0157378_10484855 3300013297 Bacteria 1232
168 Ga0157378_10813299 3300013297 Bacteria 961
169 Ga0163162_10000030 3300013306 Bacteria 163717
170 Ga0163162_10059459 3300013306 Bacteria 3854
171 Ga0163162_10217043 3300013306 Bacteria 2043
172 Ga0163162_10515198 3300013306 Bacteria 1326
173 Ga0157375_10015972 3300013308 Bacteria 6734
174 Ga0157375_10204426 3300013308 Bacteria 2131
175 Ga0157375_10284173 3300013308 Bacteria 1818
176 Ga0163163_10155517 3300014325 Bacteria 2331
177 Ga0163163_10321094 3300014325 Bacteria 1602
178 Ga0157380_10017716 3300014326 Bacteria 5275
179 Ga0157380_11038648 3300014326 Bacteria 855
180 Ga0182007_10082125 3300015262 Bacteria 1057
181 Ga0163161_10099463 3300017792 Bacteria 2163
182 Ga0163161_10117066 3300017792 Bacteria 1998
183 Ga0213872_10009729 3300021361 Bacteria 4599
184 Ga0209675_1011334 3300025291 Bacteria 2964
185 Ga0207655_1045445 3300025728 Bacteria 1833
186 Ga0207710_10024189 3300025900 Bacteria 2614
187 Ga0207647_10039265 3300025904 Bacteria 2988
188 Ga0207685_10085839 3300025905 Bacteria 1314
189 Ga0207695_10405239 3300025913 Bacteria 1248
190 Ga0207695_10514873 3300025913 Bacteria 1078
191 Ga0207693_10009123 3300025915 Bacteria 8097
192 Ga0207663_10502352 3300025916 Bacteria 942
193 Ga0207663_10597752 3300025916 Bacteria 867
194 Ga0207660_10184070 3300025917 Bacteria 1624
195 Ga0207660_10242260 3300025917 Bacteria 1421
196 Ga0207662_10160923 3300025918 Bacteria 1434
197 Ga0207657_10141430 3300025919 Bacteria 1966
198 Ga0207657_10169987 3300025919 Bacteria 1767
199 Ga0207657_10174470 3300025919 Bacteria 1740
200 Ga0207649_10057297 3300025920 Bacteria 2436
201 Ga0207649_10169045 3300025920 Bacteria 1521
202 Ga0207694_10062231 3300025924 Bacteria 2906
203 Ga0207694_10333868 3300025924 Bacteria 1253
204 Ga0207650_10003725 3300025925 Bacteria 10426
205 Ga0207650_10066576 3300025925 Bacteria 2702
206 Ga0207650_10691554 3300025925 Bacteria 861
207 Ga0207700_10000862 3300025928 Bacteria 17453
208 Ga0207700_10224361 3300025928 Bacteria 1594
209 Ga0207644_10004575 3300025931 Bacteria 8996
210 Ga0207644_10030476 3300025931 Bacteria 3752
211 Ga0207644_10070496 3300025931 Bacteria 2555
212 Ga0207690_10103829 3300025932 Bacteria 2035
213 Ga0207690_10279566 3300025932 Bacteria 1299
214 Ga0207706_10019690 3300025933 Bacteria 6071
215 Ga0207706_10042515 3300025933 Bacteria 4027
216 Ga0207706_10180673 3300025933 Bacteria 1853
217 Ga0207686_10052683 3300025934 Bacteria 2541
218 Ga0207709_10016316 3300025935 Bacteria 4127
219 Ga0207669_10124670 3300025937 Bacteria 1757
220 Ga0207691_10074932 3300025940 Bacteria 3052
221 Ga0207691_10139812 3300025940 Bacteria 2134
222 Ga0207711_10749260 3300025941 Bacteria 910
223 Ga0207689_10785509 3300025942 Bacteria 804
224 Ga0207679_10018224 3300025945 Bacteria 4700
225 Ga0207679_10268792 3300025945 Bacteria 1457
226 Ga0207667_10062740 3300025949 Bacteria 3885
227 Ga0207651_10001165 3300025960 Bacteria 11771
228 Ga0207651_10468567 3300025960 Bacteria 1084
229 Ga0207668_10202714 3300025972 Bacteria 1581
230 Ga0207658_10102703 3300025986 Bacteria 2243
231 Ga0207639_10030986 3300026041 Bacteria 3928
232 Ga0207678_10046727 3300026067 Bacteria 3744
233 Ga0207678_10108307 3300026067 Bacteria 2370
234 Ga0207708_10090760 3300026075 Bacteria 2355
235 Ga0207708_10140132 3300026075 Bacteria 1896
236 Ga0207702_10113310 3300026078 Bacteria 2415
237 Ga0207641_10177586 3300026088 Bacteria 1948
238 Ga0207641_10546738 3300026088 Bacteria 1129
239 Ga0207641_10595044 3300026088 Bacteria 1082
240 Ga0207648_10058232 3300026089 Bacteria 3370
241 Ga0207675_100046206 3300026118 Bacteria 4066
242 Ga0207683_10324269 3300026121 Bacteria 1411
243 Ga0207698_10001815 3300026142 Bacteria 12474
244 Ga0207698_10060728 3300026142 Bacteria 2941
245 Ga0209983_1059894 3300027665 Bacteria 840
246 Ga0209998_10008920 3300027717 Bacteria 2075
247 Ga0209974_10050086 3300027876 Bacteria 1402
248 Ga0207428_10025907 3300027907 Bacteria 4900
249 Ga0207428_10078757 3300027907 Bacteria 2578
250 Ga0268266_10782858 3300028379 Bacteria 921
251 Ga0268264_11303933 3300028381 Bacteria 736
252 Ga0307416_100220057 3300032002 Bacteria 1820
253 Ga0373959_0077040 3300034820 Bacteria 762
254 Ga0373934_0048105 3300035086 Bacteria 1688
255 Ga0373952_0089129 3300035092 Bacteria 799
256 Ga0373936_0032368 3300035113 Bacteria 2068
257 Ga0373939_0038381 3300035114 Bacteria 1428
258 Ga0373945_0057468 3300035116 Bacteria 1445
259 Ga0373954_0028364 3300035118 Bacteria 2573
260 Ga0373956_0045489 3300035119 Bacteria 1959
261 Ga0373924_0020099 3300035410 Bacteria 2592
262 Ga0373931_0032115 3300035691 Bacteria 2715
263 Ga0373931_0136528 3300035691 Bacteria 1416
264 Ga0373935_0005742 3300035692 Bacteria 7335
265 Ga0373927_0126076 3300035695 Bacteria 1671
266 Ga0373927_0126770 3300035695 Unclassified 1667
267 Ga0373927_0157074 3300035695 Bacteria 1490
268 Ga0373927_0201596 3300035695 Bacteria 1306
269 Ga0373933_0288857 3300035724 Bacteria 1060
270 Ga0373933_0318732 3300035724 Bacteria 1008
271 Ga0373947_0067248 3300035725 Bacteria 2188
272 Ga0373947_0079147 3300035725 Bacteria 2031
273 Ga0373947_0341992 3300035725 Bacteria 1003
274 Ga0373937_0009924 3300036401 Bacteria 8303
275 Ga0373937_0018239 3300036401 Bacteria 6263
276 Ga0373937_0147367 3300036401 Bacteria 2204
277 Ga0373925_0010617 3300037068 Bacteria 6677
278 Ga0373925_0178033 3300037068 Bacteria 1682
279 Ga0373925_0260253 3300037068 Bacteria 1394
280 Ga0373925_0532099 3300037068 Bacteria 966
281 Ga0395899_0003912 3300037312 Bacteria 11741
282 Ga0395899_0011242 3300037312 Bacteria 6857
283 Ga0395900_0001162 3300037418 Bacteria 32955
284 Ga0395900_0020459 3300037418 Bacteria 6755
285 Ga0395900_0095252 3300037418 Bacteria 3059
286 Ga0395898_0003358 3300037466 Bacteria 17956
287 Ga0395898_0207938 3300037466 Bacteria 1867
288 Ga0395905_0004279 3300037471 Bacteria 14891
289 Ga0395905_0045702 3300037471 Bacteria 4107
290 Ga0395905_0075128 3300037471 Bacteria 3167
291 Ga0395901_0011447 3300038443 Bacteria 8989
292 Ga0395901_0102801 3300038443 Bacteria 2998
293 Ga0395901_0175269 3300038443 Bacteria 2249
294 Ga0436365_0850419 3300039437 Bacteria 1650
295 Ga0436365_1807606 3300039437 Bacteria 2175
296 Ga0436360_1125811 3300039438 Bacteria 2237
297 Ga0436360_1217870 3300039438 Bacteria 749
298 Ga0436361_0609746 3300039447 Bacteria 7310
299 Ga0436362_0569831 3300039453 Bacteria 3862
300 Ga0439449_0027200 3300042007 Bacteria 2134
301 Ga0439450_020227 3300042008 Bacteria 1419
302 Ga0439456_073105 3300042013 Bacteria 761
303 Ga0439458_0033391 3300042157 Bacteria 1232
304 Ga0451577_0000058 3300042876 Bacteria 272673
305 Ga0451577_0176431 3300042876 Bacteria 1926
306 Ga0453683_0198163 3300044673 Bacteria 1275
307 Ga0466963_0194557 3300044694 Bacteria 1417
308 Ga0466964_0012665 3300044706 Bacteria 3193
309 Ga0453684_0000279 3300044712 Bacteria 220016
310 Ga0466957_0035583 3300044842 Bacteria 2988
311 Ga0466957_0268617 3300044842 Bacteria 1138
312 Ga0451576_0001134 3300045051 Bacteria 48176
313 Ga0451576_0148203 3300045051 Bacteria 2447
314 Ga0466967_0001201 3300045976 Bacteria 14568
315 Ga0466967_0005963 3300045976 Bacteria 8551
316 Ga0495617_000786 3300046452 Bacteria 15345
317 Ga0495617_000885 3300046452 Bacteria 14097
318 Ga0495617_014560 3300046452 Bacteria 2673
319 Ga0495627_000228 3300046453 Bacteria 59535
320 Ga0495627_017161 3300046453 Bacteria 2465
321 Ga0495627_022678 3300046453 Bacteria 2063
322 Ga0495592_0036676 3300046454 Bacteria 3691
323 Ga0495603_0221067 3300046455 Bacteria 1093
324 Ga0495603_0441863 3300046455 Bacteria 745
325 Ga0495590_0000064 3300046457 Bacteria 78742
326 Ga0495590_0001552 3300046457 Bacteria 9862
327 Ga0495591_000693 3300046458 Bacteria 24588
328 Ga0495629_0025346 3300046459 Bacteria 4216
329 Ga0495629_0037379 3300046459 Bacteria 3422
330 Ga0495629_0070616 3300046459 Bacteria 2436
331 Ga0495638_0071736 3300046460 Bacteria 2118
332 Ga0495651_0022084 3300046462 Bacteria 4948
333 Ga0495653_0006075 3300046463 Bacteria 9893
334 Ga0495653_0023621 3300046463 Bacteria 4963
335 Ga0495653_0051996 3300046463 Bacteria 3142
336 Ga0495650_0007513 3300046471 Bacteria 6536
337 Ga0495650_0056075 3300046471 Bacteria 1600
338 Ga0495580_0259455 3300046472 Bacteria 1188
339 Ga0495580_0468282 3300046472 Bacteria 844
340 Ga0495582_0005640 3300046473 Bacteria 6968
341 Ga0495582_0075300 3300046473 Bacteria 1869
342 Ga0495582_0096509 3300046473 Bacteria 1652
343 Ga0495582_0159364 3300046473 Bacteria 1283
344 Ga0495605_0000046 3300046474 Bacteria 175985
345 Ga0495605_0006069 3300046474 Bacteria 6980
346 Ga0495605_0012885 3300046474 Bacteria 4627
347 Ga0495605_0014950 3300046474 Bacteria 4232
348 Ga0495605_0017171 3300046474 Bacteria 3903
349 Ga0495605_0033647 3300046474 Bacteria 2599
350 Ga0495605_0035670 3300046474 Bacteria 2512
351 Ga0495605_0043161 3300046474 Bacteria 2236
352 Ga0495605_0067924 3300046474 Bacteria 1690
353 Ga0495664_0345477 3300046477 Bacteria 896
354 Ga0495584_0000477 3300046491 Bacteria 27514
355 Ga0495584_0001630 3300046491 Bacteria 13194
356 Ga0495584_0002118 3300046491 Bacteria 11362
357 Ga0495584_0003168 3300046491 Bacteria 9139
358 Ga0495584_0014281 3300046491 Bacteria 4047
359 Ga0495584_0015052 3300046491 Bacteria 3942
360 Ga0495584_0110220 3300046491 Bacteria 1392
361 Ga0495584_0205792 3300046491 Bacteria 1000
362 Ga0495584_0216117 3300046491 Bacteria 974
363 Ga0495584_0245404 3300046491 Bacteria 910
364 Ga0495585_0000002 3300046492 Bacteria 529316
365 Ga0495585_0000005 3300046492 Bacteria 328103
366 Ga0495585_0000465 3300046492 Bacteria 38766
367 Ga0495585_0003320 3300046492 Bacteria 10923
368 Ga0495585_0014514 3300046492 Bacteria 4586
369 Ga0495585_0015031 3300046492 Bacteria 4500
370 Ga0495585_0018739 3300046492 Bacteria 3992
371 Ga0495585_0026487 3300046492 Bacteria 3311
372 Ga0495585_0047889 3300046492 Bacteria 2378
373 Ga0495585_0134337 3300046492 Bacteria 1299
374 Ga0495594_0076097 3300046499 Bacteria 1871
375 Ga0495594_0216727 3300046499 Bacteria 1091
376 Ga0495594_0453256 3300046499 Bacteria 729
377 Ga0495596_0000761 3300046500 Bacteria 19650
378 Ga0495596_0000846 3300046500 Bacteria 18508
379 Ga0495596_0001991 3300046500 Bacteria 11245
380 Ga0495596_0003288 3300046500 Bacteria 8248
381 Ga0495596_0003589 3300046500 Bacteria 7810
382 Ga0495596_0005147 3300046500 Bacteria 6226
383 Ga0495596_0013374 3300046500 Bacteria 3484
384 Ga0495596_0019781 3300046500 Bacteria 2762
385 Ga0495596_0067532 3300046500 Bacteria 1389
386 Ga0495596_0101477 3300046500 Bacteria 1117
387 Ga0495596_0112294 3300046500 Bacteria 1058
388 Ga0495607_0000990 3300046501 Bacteria 26238
389 Ga0495607_0001168 3300046501 Bacteria 23749
390 Ga0495607_0001230 3300046501 Bacteria 22982
391 Ga0495607_0013244 3300046501 Bacteria 5412
392 Ga0495607_0015069 3300046501 Bacteria 5020
393 Ga0495607_0052992 3300046501 Bacteria 2347
394 Ga0495607_0067429 3300046501 Bacteria 2010
395 Ga0495607_0122704 3300046501 Bacteria 1361
396 Ga0495583_0000142 3300046506 Bacteria 121513
397 Ga0495583_0000870 3300046506 Bacteria 36655
398 Ga0495583_0012652 3300046506 Bacteria 4756
399 Ga0495583_0015633 3300046506 Bacteria 4117
400 Ga0495583_0015824 3300046506 Bacteria 4083
401 Ga0495583_0023203 3300046506 Bacteria 3144
402 Ga0495583_0023953 3300046506 Bacteria 3077
403 Ga0495606_0009814 3300046507 Bacteria 8043
404 Ga0495606_0011711 3300046507 Bacteria 7119
405 Ga0495606_0033339 3300046507 Bacteria 3553
406 Ga0495606_0070361 3300046507 Bacteria 2207
407 Ga0495606_0071043 3300046507 Bacteria 2193
408 Ga0495606_0079985 3300046507 Bacteria 2035
409 Ga0495608_0004179 3300046511 Bacteria 10354
410 Ga0495610_0002844 3300046512 Bacteria 14083
411 Ga0495610_0079635 3300046512 Bacteria 1508
412 Ga0495616_0003309 3300046513 Bacteria 10352
413 Ga0495616_0006917 3300046513 Bacteria 6829
414 Ga0495616_0007782 3300046513 Bacteria 6396
415 Ga0495616_0008643 3300046513 Bacteria 6012
416 Ga0495616_0009929 3300046513 Bacteria 5534
417 Ga0495616_0018617 3300046513 Bacteria 3807
418 Ga0495616_0026407 3300046513 Bacteria 3091
419 Ga0495616_0034366 3300046513 Bacteria 2633
420 Ga0495616_0041717 3300046513 Bacteria 2339
421 Ga0495616_0063351 3300046513 Bacteria 1807
422 Ga0495616_0149123 3300046513 Bacteria 1059
423 Ga0495618_0015786 3300046514 Bacteria 4610
424 Ga0495618_0129716 3300046514 Bacteria 1613
425 Ga0495628_0037933 3300046516 Bacteria 3861
426 Ga0495631_0000684 3300046518 Bacteria 21916
427 Ga0495631_0000930 3300046518 Bacteria 18224
428 Ga0495631_0006519 3300046518 Bacteria 6021
429 Ga0495631_0009092 3300046518 Bacteria 4977
430 Ga0495631_0015981 3300046518 Bacteria 3586
431 Ga0495631_0026647 3300046518 Bacteria 2651
432 Ga0495631_0053748 3300046518 Bacteria 1757
433 Ga0495631_0065248 3300046518 Bacteria 1575
434 Ga0495631_0072321 3300046518 Bacteria 1489
435 Ga0495631_0092994 3300046518 Bacteria 1298
436 Ga0495631_0106792 3300046518 Bacteria 1203
437 Ga0495632_0000025 3300046519 Bacteria 176815
438 Ga0495632_0000385 3300046519 Bacteria 42145
439 Ga0495632_0003811 3300046519 Bacteria 10511
440 Ga0495632_0007682 3300046519 Bacteria 6733
441 Ga0495632_0010482 3300046519 Bacteria 5484
442 Ga0495632_0049842 3300046519 Bacteria 2068
443 Ga0495632_0131764 3300046519 Bacteria 1163
444 Ga0495637_0000012 3300046520 Bacteria 273124
445 Ga0495637_0042822 3300046520 Bacteria 1935
446 Ga0495643_0000777 3300046522 Bacteria 35586
447 Ga0495643_0004916 3300046522 Bacteria 9186
448 Ga0495643_0013001 3300046522 Bacteria 5000
449 Ga0495643_0013462 3300046522 Bacteria 4892
450 Ga0495643_0046976 3300046522 Bacteria 2339
451 Ga0495643_0086008 3300046522 Bacteria 1629
452 Ga0495644_0002439 3300046523 Bacteria 7424
453 Ga0495644_0003268 3300046523 Bacteria 6408
454 Ga0495644_0007890 3300046523 Bacteria 4100
455 Ga0495644_0012914 3300046523 Bacteria 3211
456 Ga0495644_0029568 3300046523 Bacteria 2070
457 Ga0495644_0059103 3300046523 Bacteria 1441
458 Ga0495644_0060826 3300046523 Bacteria 1419
459 Ga0495644_0106669 3300046523 Bacteria 1061
460 Ga0495644_0183741 3300046523 Bacteria 804
461 Ga0495648_0000012 3300046524 Bacteria 294111
462 Ga0495648_0000033 3300046524 Bacteria 199184
463 Ga0495648_0000815 3300046524 Bacteria 32978
464 Ga0495648_0001398 3300046524 Bacteria 23712
465 Ga0495648_0001851 3300046524 Bacteria 20287
466 Ga0495648_0006112 3300046524 Bacteria 9872
467 Ga0495648_0015762 3300046524 Bacteria 5469
468 Ga0495648_0120225 3300046524 Bacteria 1413
469 Ga0495648_0203452 3300046524 Bacteria 989
470 Ga0495642_0000013 3300046528 Bacteria 123896
471 Ga0495642_0001210 3300046528 Bacteria 11866
472 Ga0495642_0019203 3300046528 Bacteria 2678
473 Ga0495642_0020522 3300046528 Bacteria 2595
474 Ga0495642_0030247 3300046528 Bacteria 2166
475 Ga0495652_0007816 3300046529 Bacteria 9822
476 Ga0495652_0008927 3300046529 Bacteria 9122
477 Ga0495652_0065238 3300046529 Bacteria 3060
478 Ga0495654_0004974 3300046530 Bacteria 7808
479 Ga0495654_0008857 3300046530 Bacteria 5533
480 Ga0495654_0098230 3300046530 Bacteria 1351
481 Ga0495665_0011059 3300046531 Bacteria 4884
482 Ga0495665_0120738 3300046531 Bacteria 1372
483 Ga0495665_0166405 3300046531 Bacteria 1148
484 Ga0495640_0047233 3300046533 Bacteria 2980
485 Ga0495586_0013119 3300046535 Bacteria 4392
486 Ga0495586_0014286 3300046535 Bacteria 4218
487 Ga0495586_0296058 3300046535 Bacteria 927
488 Ga0495587_0013628 3300046536 Bacteria 5108
489 Ga0495587_0031666 3300046536 Bacteria 3200
490 Ga0495598_0029099 3300046537 Bacteria 1537
491 Ga0495609_0000877 3300046538 Bacteria 22038
492 Ga0495609_0005910 3300046538 Bacteria 6324
493 Ga0495609_0021179 3300046538 Bacteria 2999
494 Ga0495609_0052907 3300046538 Bacteria 1806
495 Ga0495609_0080474 3300046538 Bacteria 1424
496 Ga0495609_0089220 3300046538 Bacteria 1341
497 Ga0495609_0117478 3300046538 Bacteria 1145
498 Ga0495609_0155008 3300046538 Bacteria 973
499 Ga0495609_0167340 3300046538 Bacteria 929
500 Ga0495597_0000199 3300046542 Bacteria 55011
501 Ga0495597_0008921 3300046542 Bacteria 5002
502 Ga0495597_0020490 3300046542 Bacteria 3079
503 Ga0495597_0027562 3300046542 Bacteria 2604
504 Ga0495597_0039119 3300046542 Bacteria 2125
505 Ga0495597_0048227 3300046542 Bacteria 1884
506 Ga0495597_0063659 3300046542 Bacteria 1603
507 Ga0495597_0071610 3300046542 Bacteria 1492
508 Ga0495597_0216148 3300046542 Bacteria 763
509 Ga0495622_0009227 3300046557 Bacteria 4565
510 Ga0495622_0037352 3300046557 Bacteria 2262
511 Ga0495622_0193334 3300046557 Bacteria 909
512 Ga0495633_0001969 3300046558 Bacteria 14884
513 Ga0495633_0008397 3300046558 Bacteria 5826
514 Ga0495633_0037882 3300046558 Bacteria 2305
515 Ga0495633_0045305 3300046558 Bacteria 2083
516 Ga0495667_0057487 3300046559 Bacteria 2556
517 Ga0495656_0033213 3300046615 Bacteria 2105
518 Ga0495656_0191331 3300046615 Bacteria 1011
519 Ga0495656_0321678 3300046615 Bacteria 797
520 Ga0495668_0000131 3300046616 Bacteria 112755
521 Ga0495668_0000373 3300046616 Bacteria 59298
522 Ga0495668_0025241 3300046616 Bacteria 3377
523 Ga0495668_0069991 3300046616 Bacteria 1929
524 Ga0495668_0100378 3300046616 Bacteria 1583
525 Ga0495668_0109577 3300046616 Bacteria 1510
526 Ga0495634_0054889 3300046642 Bacteria 2665
527 Ga0495634_0073627 3300046642 Bacteria 2246
528 Ga0495611_0000207 3300046648 Bacteria 41561
529 Ga0495611_0002813 3300046648 Bacteria 7785
530 Ga0495611_0004328 3300046648 Bacteria 6160
531 Ga0495611_0027329 3300046648 Bacteria 2493
532 Ga0495611_0028607 3300046648 Bacteria 2441
533 Ga0495611_0214715 3300046648 Bacteria 895
534 Ga0495611_0231193 3300046648 Bacteria 859
535 Ga0495625_0074314 3300046660 Bacteria 2381
536 Ga0495625_0125002 3300046660 Bacteria 1747
537 Ga0495625_0125927 3300046660 Bacteria 1739
538 Ga0495625_0157232 3300046660 Bacteria 1525
539 Ga0495625_0274025 3300046660 Bacteria 1088
540 Ga0495635_0018595 3300046663 Bacteria 4847
541 Ga0495659_0063395 3300046664 Bacteria 1370
542 Ga0495661_0002466 3300046665 Bacteria 14234
543 Ga0495661_0002533 3300046665 Bacteria 14017
544 Ga0495661_0005240 3300046665 Bacteria 9226
545 Ga0495661_0007327 3300046665 Bacteria 7689
546 Ga0495661_0009522 3300046665 Bacteria 6665
547 Ga0495661_0013871 3300046665 Bacteria 5406
548 Ga0495661_0014885 3300046665 Bacteria 5201
549 Ga0495661_0016496 3300046665 Bacteria 4895
550 Ga0495661_0025721 3300046665 Bacteria 3799
551 Ga0495661_0056187 3300046665 Bacteria 2356
552 Ga0495661_0065767 3300046665 Bacteria 2135
553 Ga0495661_0153866 3300046665 Bacteria 1240
554 Ga0495661_0209646 3300046665 Bacteria 1015
555 Ga0495588_0002151 3300046674 Bacteria 8428
556 Ga0495588_0048457 3300046674 Bacteria 2182
557 Ga0495588_0166820 3300046674 Bacteria 1164
558 Ga0495657_0058401 3300046675 Bacteria 2562
559 Ga0495599_0016159 3300046678 Bacteria 4632
560 Ga0495623_0011944 3300046679 Bacteria 5627
561 Ga0495623_0012634 3300046679 Bacteria 5466
562 Ga0495658_0187036 3300046683 Bacteria 1286
563 Ga0495669_0000190 3300046684 Bacteria 38101
564 Ga0495669_0001491 3300046684 Bacteria 9648
565 Ga0495669_0004593 3300046684 Bacteria 5718
566 Ga0495669_0006852 3300046684 Bacteria 4768
567 Ga0495669_0220731 3300046684 Bacteria 908
568 Ga0495669_0230072 3300046684 Bacteria 889
569 Ga0495613_0038522 3300046689 Bacteria 3543
570 Ga0495613_0046540 3300046689 Bacteria 3208
571 Ga0495670_0003708 3300046691 Bacteria 7508
572 Ga0495670_0009384 3300046691 Bacteria 4810
573 Ga0495670_0053727 3300046691 Bacteria 2017
574 Ga0495670_0084032 3300046691 Bacteria 1624
575 Ga0495670_0107743 3300046691 Bacteria 1440
576 Ga0495670_0132542 3300046691 Bacteria 1299
577 Ga0495671_0012377 3300046692 Bacteria 4662
578 Ga0495671_0058203 3300046692 Bacteria 1912
579 Ga0495671_0156441 3300046692 Bacteria 1109
580 Ga0495671_0219090 3300046692 Bacteria 921
581 Ga0495649_0000214 3300046694 Bacteria 50663
582 Ga0495649_0003286 3300046694 Bacteria 11007
583 Ga0495649_0024995 3300046694 Bacteria 3328
584 Ga0495649_0067541 3300046694 Bacteria 1918
585 Ga0495649_0151435 3300046694 Bacteria 1218
586 Ga0495649_0202993 3300046694 Bacteria 1029
587 Ga0495589_0001415 3300046794 Bacteria 13904
588 Ga0495589_0013026 3300046794 Bacteria 4296
589 Ga0495589_0018014 3300046794 Bacteria 3624
590 Ga0495589_0021018 3300046794 Bacteria 3335
591 Ga0495589_0027534 3300046794 Bacteria 2873
592 Ga0495600_0044420 3300046809 Bacteria 2899
593 Ga0495660_0006553 3300046810 Bacteria 6878
594 Ga0495660_0037045 3300046810 Bacteria 2718
595 Ga0495660_0047873 3300046810 Bacteria 2339
596 Ga0495660_0060190 3300046810 Bacteria 2040
597 Ga0495660_0156703 3300046810 Bacteria 1120
598 Ga0495581_0014601 3300047315 Bacteria 4554
599 Ga0495604_0006708 3300047317 Bacteria 9127
600 Ga0495604_0009427 3300047317 Bacteria 7722
601 Ga0495604_0137357 3300047317 Bacteria 1750
602 Ga0495604_0550901 3300047317 Bacteria 744
603 Ga0495674_0018067 3300047319 Bacteria 6564
604 Ga0495674_0036088 3300047319 Bacteria 4452
605 Ga0495674_0056241 3300047319 Bacteria 3447
606 Ga0495672_0000124 3300047320 Bacteria 118878
607 Ga0495672_0000512 3300047320 Bacteria 44570
608 Ga0495672_0000656 3300047320 Bacteria 38441
609 Ga0495672_0067047 3300047320 Bacteria 2045
610 Ga0495676_0000177 3300047321 Bacteria 50096
611 Ga0495676_0099536 3300047321 Bacteria 2154
612 Ga0495680_0007799 3300047322 Bacteria 9775
613 Ga0495680_0013815 3300047322 Bacteria 7027
614 Ga0495680_0036776 3300047322 Bacteria 3927
615 Ga0495683_0000072 3300047323 Bacteria 104027
616 Ga0495683_0000368 3300047323 Bacteria 37069
617 Ga0495683_0002208 3300047323 Bacteria 11923
618 Ga0495683_0005100 3300047323 Bacteria 7335
619 Ga0495683_0015660 3300047323 Bacteria 3940
620 Ga0495683_0022250 3300047323 Bacteria 3260
621 Ga0495683_0022710 3300047323 Bacteria 3225
622 Ga0495683_0075361 3300047323 Bacteria 1652
623 Ga0495683_0177929 3300047323 Bacteria 973
624 Ga0495687_000182 3300047443 Bacteria 91333
625 Ga0495687_014045 3300047443 Bacteria 4143
626 Ga0495675_0006310 3300047444 Bacteria 7261
627 Ga0495675_0017422 3300047444 Bacteria 4552
628 Ga0495675_0158822 3300047444 Bacteria 1393
629 Ga0495677_0000129 3300047445 Bacteria 36880
630 Ga0495677_0001809 3300047445 Bacteria 8548
631 Ga0495677_0002312 3300047445 Bacteria 7514
632 Ga0495677_0004948 3300047445 Bacteria 5081
633 Ga0495677_0005272 3300047445 Bacteria 4910
634 Ga0495677_0009205 3300047445 Bacteria 3649
635 Ga0495677_0012732 3300047445 Bacteria 3065
636 Ga0495677_0020815 3300047445 Bacteria 2377
637 Ga0495677_0058263 3300047445 Bacteria 1429
638 Ga0495679_004811 3300047446 Bacteria 6106
639 Ga0495679_009347 3300047446 Bacteria 3928
640 Ga0495679_026139 3300047446 Bacteria 1942
641 Ga0495679_031406 3300047446 Bacteria 1713
642 Ga0495679_072067 3300047446 Bacteria 993
643 Ga0495685_001990 3300047447 Bacteria 6337
644 Ga0495685_027022 3300047447 Bacteria 1974
645 Ga0495685_037419 3300047447 Bacteria 1664
646 Ga0495685_047889 3300047447 Bacteria 1453
647 Ga0495681_0000189 3300047470 Bacteria 52253
648 Ga0495681_0009180 3300047470 Bacteria 6115
649 Ga0495681_0012177 3300047470 Bacteria 5069
650 Ga0495681_0013471 3300047470 Bacteria 4739
651 Ga0495681_0042911 3300047470 Bacteria 2185
652 Ga0495681_0083064 3300047470 Bacteria 1426
653 Ga0495681_0088915 3300047470 Bacteria 1367
654 Ga0495684_0287227 3300047471 Bacteria 1185
655 Ga0495684_0298443 3300047471 Bacteria 1158
656 Ga0495686_0000429 3300047472 Bacteria 65535
657 Ga0495686_0010935 3300047472 Bacteria 6424
658 Ga0495686_0076330 3300047472 Bacteria 2053
659 Ga0495686_0266636 3300047472 Bacteria 957
660 Ga0495593_0060145 3300047673 Bacteria 1989
661 Ga0495593_0087822 3300047673 Bacteria 1603
662 Ga0495602_0014350 3300048088 Bacteria 8046
663 Ga0495602_0026223 3300048088 Bacteria 5624
664 Ga0495614_0007477 3300048089 Bacteria 4862
665 Ga0495614_0015948 3300048089 Bacteria 3272
666 Ga0495626_0000953 3300048091 Bacteria 25097
667 Ga0495626_0001381 3300048091 Bacteria 19521
668 Ga0495626_0002812 3300048091 Bacteria 11650
669 Ga0495626_0006393 3300048091 Bacteria 6707
670 Ga0495626_0008557 3300048091 Bacteria 5598
671 Ga0495626_0009558 3300048091 Bacteria 5237
672 Ga0495626_0012647 3300048091 Bacteria 4415
673 Ga0495626_0018286 3300048091 Bacteria 3523
674 Ga0495626_0025250 3300048091 Bacteria 2907
675 Ga0495626_0027417 3300048091 Bacteria 2770
676 Ga0495626_0029347 3300048091 Bacteria 2662
677 Ga0495626_0064711 3300048091 Bacteria 1656
678 Ga0496100_0049557 3300048903 Bacteria 2717
679 Ga0496101_0144992 3300048904 Bacteria 1813
680 Ga0496102_0067021 3300048905 Bacteria 3291
681 Ga0496102_0301316 3300048905 Bacteria 1511
682 Ga0496102_0321290 3300048905 Bacteria 1458
683 Ga0496102_0425811 3300048905 Bacteria 1247
684 Ga0496102_0616418 3300048905 Bacteria 1008
685 Ga0496102_0863014 3300048905 Bacteria 827
686 Ga0496103_0035300 3300048906 Bacteria 3061
687 Ga0496103_0103977 3300048906 Bacteria 1799
688 Ga0496104_0005903 3300048907 Bacteria 10723
689 Ga0496104_0014250 3300048907 Bacteria 7177
690 Ga0496104_0050921 3300048907 Bacteria 3907
691 Ga0496104_0051370 3300048907 Bacteria 3891
692 Ga0496104_0058610 3300048907 Bacteria 3645
693 Ga0496104_0175586 3300048907 Bacteria 2053
694 Ga0496104_0377643 3300048907 Bacteria 1330
695 Ga0496104_0580731 3300048907 Bacteria 1031
696 Ga0496105_0008661 3300048908 Bacteria 7913
697 Ga0496105_0018906 3300048908 Bacteria 5549
698 Ga0496105_0058976 3300048908 Bacteria 3167
699 Ga0496105_0077547 3300048908 Bacteria 2744
700 Ga0496105_0086611 3300048908 Bacteria 2589
701 Ga0496105_0108948 3300048908 Bacteria 2287
702 Ga0496105_0496900 3300048908 Bacteria 958
703 Ga0496106_0140824 3300048909 Bacteria 1897
704 Ga0496106_0141128 3300048909 Bacteria 1895
705 Ga0496107_0135624 3300048910 Bacteria 1818
706 Ga0496108_0049617 3300048911 Bacteria 3511
707 Ga0496108_0082077 3300048911 Bacteria 2733
708 Ga0496108_0242186 3300048911 Bacteria 1569
709 Ga0496108_0319627 3300048911 Bacteria 1353
710 Ga0496108_0496496 3300048911 Bacteria 1066
711 Ga0496109_0022334 3300048912 Bacteria 5603
712 Ga0496109_0031399 3300048912 Bacteria 4767
713 Ga0496109_0058137 3300048912 Bacteria 3532
714 Ga0496109_0079051 3300048912 Bacteria 3029
715 Ga0496109_0104821 3300048912 Bacteria 2626
716 Ga0496109_0252091 3300048912 Bacteria 1662
717 Ga0496109_0333992 3300048912 Bacteria 1431
718 Ga0496109_0413203 3300048912 Bacteria 1275
719 Ga0496110_0000016 3300048913 Bacteria 85281
720 Ga0496110_0007901 3300048913 Bacteria 8521
721 Ga0496110_0012938 3300048913 Bacteria 6881
722 Ga0496110_0044101 3300048913 Bacteria 3894
723 Ga0496110_0112073 3300048913 Bacteria 2452
724 Ga0496110_0192536 3300048913 Bacteria 1852
725 Ga0496110_0288484 3300048913 Bacteria 1494
726 Ga0496110_0337724 3300048913 Bacteria 1372
727 Ga0496111_0001590 3300048914 Bacteria 13124
728 Ga0496111_0041383 3300048914 Bacteria 3306
729 Ga0496111_0096223 3300048914 Bacteria 2173
730 Ga0496111_0117490 3300048914 Bacteria 1962
731 Ga0496111_0267543 3300048914 Bacteria 1268
732 Ga0496112_0001256 3300048915 Bacteria 19216
733 Ga0496112_0016461 3300048915 Bacteria 6928
734 Ga0496112_0047904 3300048915 Bacteria 4192
735 Ga0496112_0157447 3300048915 Bacteria 2238
736 Ga0496112_0165258 3300048915 Bacteria 2179
737 Ga0496112_0293404 3300048915 Bacteria 1572
738 Ga0496112_0322838 3300048915 Bacteria 1488
739 Ga0496112_0411619 3300048915 Bacteria 1291
740 Ga0496112_0715037 3300048915 Bacteria 929
741 Ga0496113_0062239 3300048916 Bacteria 2818
742 Ga0496113_0106347 3300048916 Bacteria 2179
743 Ga0496113_0349896 3300048916 Bacteria 1185
744 Ga0496113_0562043 3300048916 Bacteria 915
745 Ga0496113_0601620 3300048916 Bacteria 880
746 Ga0496113_0931378 3300048916 Bacteria 686
747 Ga0496114_0012861 3300048917 Bacteria 6703
748 Ga0496114_0516697 3300048917 Bacteria 1056
749 Ga0496115_0009579 3300048918 Bacteria 7200
750 Ga0496115_0021271 3300048918 Bacteria 5010
751 Ga0496115_0162487 3300048918 Bacteria 1846
752 Ga0496122_0101679 3300048925 Bacteria 1919
753 Ga0496123_0042148 3300048926 Bacteria 3155
754 Ga0496124_0019153 3300048927 Bacteria 6385
755 Ga0495678_000075 3300049459 Bacteria 125154
756 Ga0495678_000084 3300049459 Bacteria 117340
757 Ga0495678_000596 3300049459 Bacteria 34066
758 Ga0495678_000681 3300049459 Bacteria 31236
759 Ga0495678_007207 3300049459 Bacteria 5795
760 Ga0495678_035799 3300049459 Bacteria 2031
761 Ga0495682_0000787 3300049460 Bacteria 20096
762 Ga0495682_0023930 3300049460 Bacteria 2279
763 Ga0495682_0031051 3300049460 Bacteria 1976
764 Ga0495682_0046418 3300049460 Bacteria 1586
765 Ga0495682_0061834 3300049460 Bacteria 1351
766 Ga0501031_0095115 3300049568 Bacteria 1944
767 Ga0501031_0095844 3300049568 Bacteria 1936
768 Ga0501033_0439755 3300049570 Bacteria 907
769 Ga0501036_0038220 3300049572 Bacteria 4062
770 Ga0501036_0114959 3300049572 Bacteria 2274
771 Ga0501036_0141524 3300049572 Bacteria 2030
772 Ga0501038_0118711 3300049574 Bacteria 2183
773 Ga0501039_0177861 3300049575 Bacteria 1673
774 Ga0501039_0285477 3300049575 Bacteria 1297
775 Ga0501039_0364864 3300049575 Bacteria 1135
776 Ga0501040_0004091 3300049576 Bacteria 9482
777 Ga0501040_0539526 3300049576 Bacteria 842
778 Ga0501041_0075344 3300049577 Bacteria 2075
779 Ga0501041_0212492 3300049577 Bacteria 1213
780 Ga0501041_0380087 3300049577 Bacteria 894
781 Ga0501042_0012164 3300049578 Bacteria 5823
782 Ga0501042_0067352 3300049578 Bacteria 2560
783 Ga0501042_0117572 3300049578 Bacteria 1914
784 Ga0501046_0009766 3300049580 Bacteria 8274
785 Ga0501048_0221422 3300049582 Bacteria 1342
786 Ga0501071_0003983 3300049587 Bacteria 9322
787 Ga0501071_0078748 3300049587 Bacteria 2409
788 Ga0501072_0016553 3300049588 Bacteria 5665
789 Ga0501072_0042796 3300049588 Bacteria 3558
790 Ga0501072_0062269 3300049588 Bacteria 2943
791 Ga0501072_0223696 3300049588 Bacteria 1500
792 Ga0501074_0150629 3300049590 Bacteria 1663
793 Ga0501075_0212570 3300049591 Bacteria 1475
794 Ga0501075_0219737 3300049591 Bacteria 1449
795 Ga0501075_0494600 3300049591 Bacteria 933
796 Ga0501076_0004613 3300049592 Bacteria 9810
797 Ga0501076_0032894 3300049592 Bacteria 4049
798 Ga0501076_0330539 3300049592 Bacteria 1250
799 Ga0501076_0533227 3300049592 Bacteria 968
800 Ga0501077_0008606 3300049593 Bacteria 6329
801 Ga0501077_0092101 3300049593 Bacteria 1921
802 Ga0501077_0230891 3300049593 Bacteria 1176
803 Ga0501079_0041671 3300049741 Bacteria 3545
804 Ga0501079_0146343 3300049741 Bacteria 1841
805 Ga0501080_0209140 3300049742 Bacteria 1788
806 Ga0501081_0002738 3300049743 Bacteria 11166
807 Ga0501081_0040378 3300049743 Bacteria 3195
808 Ga0501081_0369283 3300049743 Bacteria 1059
809 Ga0501081_0371084 3300049743 Bacteria 1056
810 Ga0501035_0095839 3300049822 Bacteria 2608
811 Ga0501045_0024328 3300049824 Bacteria 4348
812 Ga0501045_0363483 3300049824 Bacteria 1077
813 nmdc:mga00v17_15695_c1 3300050491 Bacteria 4254
814 nmdc:mga0yw44_63224_c1 3300050492 Bacteria 2275
815 nmdc:mga0k408_26773_c1 3300050493 Bacteria 3271
816 nmdc:mga06z11_70659_c1 3300050494 Bacteria 1846
817 nmdc:mga05p37_1262702_c1 3300050507 Bacteria 757
818 nmdc:mga05p37_153780_c1 3300050507 Bacteria 2813
819 nmdc:mga05p37_2263_c1 3300050507 Bacteria 22436
820 nmdc:mga05p37_3065_c1 3300050507 Bacteria 19411
821 nmdc:mga05p37_3365_c1 3300050507 Bacteria 18662
822 nmdc:mga05p37_75835_c1 3300050507 Bacteria 4140
823 nmdc:mga05p37_85016_c1 3300050507 Bacteria 3898
824 nmdc:mga09592_113650_c1 3300050508 Bacteria 2324
825 nmdc:mga09592_245441_c1 3300050508 Bacteria 1552
826 nmdc:mga09592_302523_c1 3300050508 Bacteria 1387
827 nmdc:mga0qj67_127_c1 3300050509 Bacteria 50287
828 nmdc:mga0qj67_185732_c1 3300050509 Bacteria 1689
829 nmdc:mga0qj67_297692_c1 3300050509 Bacteria 1307
830 nmdc:mga06r32_235319_c1 3300050510 Bacteria 1819
831 nmdc:mga06r32_24663_c1 3300050510 Bacteria 5586
832 nmdc:mga06r32_338939_c1 3300050510 Bacteria 1488
833 nmdc:mga06r32_572323_c1 3300050510 Bacteria 1102
834 nmdc:mga06r32_754_c1 3300050510 Bacteria 28479
835 nmdc:mga06r32_771_c1 3300050510 Bacteria 28266
836 nmdc:mga08y16_10823_c1 3300050511 Bacteria 9577
837 nmdc:mga08y16_12433_c1 3300050511 Bacteria 8957
838 nmdc:mga08y16_7164_c1 3300050511 Bacteria 11705
839 nmdc:mga0n895_37583_c1 3300050512 Bacteria 4685
840 nmdc:mga0n895_477314_c1 3300050512 Bacteria 1258
841 nmdc:mga0rr50_236969_c1 3300050513 Bacteria 1511
842 nmdc:mga0rr50_330390_c1 3300050513 Bacteria 1280
843 nmdc:mga0rr50_7411_c1 3300050513 Bacteria 6765
844 nmdc:mga0a205_246461_c1 3300050515 Bacteria 1667
845 nmdc:mga0a205_555877_c1 3300050515 Bacteria 1003
846 nmdc:mga0a205_84820_c1 3300050515 Bacteria 3060
847 Ga0495601_0004070 3300053077 Bacteria 8432
848 Ga0495601_0012830 3300053077 Bacteria 5029
849 Ga0495601_0586911 3300053077 Bacteria 716
850 Ga0495612_0015988 3300053078 Bacteria 3007
851 Ga0495595_0003336 3300053084 Bacteria 6371
852 Ga0495619_0002109 3300053085 Bacteria 13181
853 Ga0495619_0014746 3300053085 Bacteria 4937
854 Ga0495619_0377306 3300053085 Bacteria 980
855 Ga0500641_0009224 3300053096 Bacteria 3543
856 Ga0500639_148723 3300053163 Bacteria 1083
857 Ga0501084_0030659 3300054114 Bacteria 4497
858 Ga0501084_0073117 3300054114 Bacteria 2871
859 Ga0501084_0096629 3300054114 Bacteria 2481
860 Ga0501084_0180232 3300054114 Bacteria 1783
861 Ga0501082_0020201 3300060353 Bacteria 5740
862 Ga0501082_0040469 3300060353 Bacteria 4020
863 Ga0501082_0040782 3300060353 Bacteria 4004
864 Ga0501082_0211521 3300060353 Bacteria 1687
865 Ga0501082_0302632 3300060353 Bacteria 1393
866 Ga0530510_0014744 3300061734 Bacteria 5518
867 Ga0530510_0123075 3300061734 Bacteria 1905

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046665 Ga0495661_0209646 Ga0495661_0209646_357_896 179
2 3300046499 Ga0495594_0453256 Ga0495594_0453256_11_574 183
3 3300047446 Ga0495679_009347 Ga0495679_009347_3363_3917 183
4 3300027907 Ga0207428_10025907 Ga0207428_100259075 184
5 3300042013 Ga0439456_073105 Ga0439456_073105_172_735 187
6 3300046535 Ga0495586_0296058 Ga0495586_0296058_350_913 187
7 3300046492 Ga0495585_0134337 Ga0495585_0134337_12_590 191
8 3300046523 Ga0495644_0002439 Ga0495644_0002439_6834_7412 191
9 3300046684 Ga0495669_0220731 Ga0495669_0220731_11_589 191
10 3300025960 Ga0207651_10468567 Ga0207651_104685672 193
11 3300048913 Ga0496110_0012938 Ga0496110_0012938_1240_1854 193
12 3300048914 Ga0496111_0001590 Ga0496111_0001590_884_1498 193
13 3300046538 Ga0495609_0117478 Ga0495609_0117478_33_620 195
14 3300035092 Ga0373952_0089129 Ga0373952_0089129_181_777 198
15 3300037068 Ga0373925_0532099 Ga0373925_0532099_353_949 198
16 3300046491 Ga0495584_0216117 Ga0495584_0216117_22_618 198
17 3300048905 Ga0496102_0863014 Ga0496102_0863014_206_802 198
18 3300048907 Ga0496104_0175586 Ga0496104_0175586_1427_2023 198
19 3300048909 Ga0496106_0141128 Ga0496106_0141128_1270_1866 198
20 3300048914 Ga0496111_0267543 Ga0496111_0267543_12_680 198
21 3300048916 Ga0496113_0931378 Ga0496113_0931378_26_622 198
22 3300049577 Ga0501041_0380087 Ga0501041_0380087_47_643 198
23 3300049591 Ga0501075_0212570 Ga0501075_0212570_862_1458 198
24 3300050494 nmdc:mga06z11_70659_c1 nmdc:mga06z11_70659_c1_40_636 198
25 3300046491 Ga0495584_0245404 Ga0495584_0245404_29_640 203
26 3300046523 Ga0495644_0183741 Ga0495644_0183741_21_632 203
27 3300046542 Ga0495597_0071610 Ga0495597_0071610_38_649 203
28 3300047446 Ga0495679_026139 Ga0495679_026139_1318_1929 203
29 3300048091 Ga0495626_0018286 Ga0495626_0018286_2892_3506 203
30 3300048905 Ga0496102_0616418 Ga0496102_0616418_384_995 203
31 3300005536 Ga0070697_100318943 Ga0070697_1003189432 210
32 3300006237 Ga0097621_100183889 Ga0097621_1001838892 210
33 iso_pu_bacteria 2513237141 2513893663 212
34 3300005616 Ga0068852_101276504 Ga0068852_1012765041 213
35 3300013306 Ga0163162_10515198 Ga0163162_105151982 213
36 3300026075 Ga0207708_10090760 Ga0207708_100907602 213
37 3300003659 JGI25404J52841_10000005 JGI25404J52841_100000055 215
38 3300005331 Ga0070670_100233222 Ga0070670_1002332221 215
39 3300005535 Ga0070684_100187428 Ga0070684_1001874282 215
40 3300005564 Ga0070664_100036084 Ga0070664_1000360844 215
41 3300005983 Ga0081540_1000131 Ga0081540_10001319 215
42 3300009094 Ga0111539_10369263 Ga0111539_103692632 215
43 3300009177 Ga0105248_10350550 Ga0105248_103505501 215
44 3300013296 Ga0157374_10051753 Ga0157374_100517536 215
45 3300014325 Ga0163163_10155517 Ga0163163_101555172 215
46 3300017792 Ga0163161_10117066 Ga0163161_101170661 215
47 3300025900 Ga0207710_10024189 Ga0207710_100241892 215
48 3300025941 Ga0207711_10749260 Ga0207711_107492601 215
49 3300025942 Ga0207689_10785509 Ga0207689_107855091 215
50 3300026088 Ga0207641_10546738 Ga0207641_105467381 215
51 3300048907 Ga0496104_0050921 Ga0496104_0050921_2431_3078 215
52 3300048908 Ga0496105_0018906 Ga0496105_0018906_2116_2763 215
53 3300048912 Ga0496109_0022334 Ga0496109_0022334_93_740 215
54 3300048913 Ga0496110_0044101 Ga0496110_0044101_1137_1784 215
55 3300048914 Ga0496111_0117490 Ga0496111_0117490_397_1044 215
56 3300048915 Ga0496112_0016461 Ga0496112_0016461_4185_4832 215
57 3300048916 Ga0496113_0601620 Ga0496113_0601620_169_816 215
58 3300050513 nmdc:mga0rr50_330390_c1 nmdc:mga0rr50_330390_c1_45_692 215
59 3300003784 Ga0055534_1016085 Ga0055534_10160851 216
60 3300003911 JGI25405J52794_10071168 JGI25405J52794_100711681 216
61 3300005293 Ga0065715_10013140 Ga0065715_100131402 216
62 3300005295 Ga0065707_10230384 Ga0065707_102303842 216
63 3300005330 Ga0070690_100182655 Ga0070690_1001826552 216
64 3300005331 Ga0070670_100059915 Ga0070670_1000599153 216
65 3300005335 Ga0070666_10046516 Ga0070666_100465162 216
66 3300005337 Ga0070682_100010249 Ga0070682_1000102493 216
67 3300005339 Ga0070660_100101583 Ga0070660_1001015832 216
68 3300005340 Ga0070689_100025741 Ga0070689_1000257415 216
69 3300005343 Ga0070687_100073685 Ga0070687_1000736852 216
70 3300005347 Ga0070668_100481940 Ga0070668_1004819402 216
71 3300005353 Ga0070669_100354794 Ga0070669_1003547942 216
72 3300005355 Ga0070671_100006478 Ga0070671_1000064782 216
73 3300005355 Ga0070671_100026508 Ga0070671_1000265081 216
74 3300005355 Ga0070671_100217596 Ga0070671_1002175962 216
75 3300005364 Ga0070673_100000565 Ga0070673_1000005657 216
76 3300005365 Ga0070688_100028600 Ga0070688_1000286003 216
77 3300005365 Ga0070688_100122280 Ga0070688_1001222802 216
78 3300005367 Ga0070667_100271451 Ga0070667_1002714513 216
79 3300005367 Ga0070667_100495000 Ga0070667_1004950002 216
80 3300005434 Ga0070709_10067759 Ga0070709_100677591 216
81 3300005436 Ga0070713_100000018 Ga0070713_10000001897 216
82 3300005438 Ga0070701_10268942 Ga0070701_102689422 216
83 3300005440 Ga0070705_100053620 Ga0070705_1000536202 216
84 3300005441 Ga0070700_100061033 Ga0070700_1000610333 216
85 3300005441 Ga0070700_100408252 Ga0070700_1004082522 216
86 3300005455 Ga0070663_100016718 Ga0070663_1000167182 216
87 3300005455 Ga0070663_100145868 Ga0070663_1001458681 216
88 3300005456 Ga0070678_100033489 Ga0070678_1000334894 216
89 3300005456 Ga0070678_100358743 Ga0070678_1003587432 216
90 3300005457 Ga0070662_100009332 Ga0070662_1000093324 216
91 3300005459 Ga0068867_100511421 Ga0068867_1005114212 216
92 3300005539 Ga0068853_100024317 Ga0068853_1000243172 216
93 3300005539 Ga0068853_100194162 Ga0068853_1001941622 216
94 3300005543 Ga0070672_100079213 Ga0070672_1000792133 216
95 3300005545 Ga0070695_100003910 Ga0070695_1000039106 216
96 3300005545 Ga0070695_100051176 Ga0070695_1000511763 216
97 3300005547 Ga0070693_100021913 Ga0070693_1000219132 216
98 3300005547 Ga0070693_100539808 Ga0070693_1005398081 216
99 3300005548 Ga0070665_100737848 Ga0070665_1007378482 216
100 3300005564 Ga0070664_100237260 Ga0070664_1002372602 216
101 3300005564 Ga0070664_100583661 Ga0070664_1005836612 216
102 3300005577 Ga0068857_100215387 Ga0068857_1002153873 216
103 3300005578 Ga0068854_100036313 Ga0068854_1000363133 216
104 3300005578 Ga0068854_100272677 Ga0068854_1002726771 216
105 3300005614 Ga0068856_100464173 Ga0068856_1004641732 216
106 3300005615 Ga0070702_100315434 Ga0070702_1003154342 216
107 3300005615 Ga0070702_100320675 Ga0070702_1003206752 216
108 3300005615 Ga0070702_100388435 Ga0070702_1003884352 216
109 3300005615 Ga0070702_100664462 Ga0070702_1006644621 216
110 3300005616 Ga0068852_100185607 Ga0068852_1001856073 216
111 3300005617 Ga0068859_100018952 Ga0068859_1000189526 216
112 3300005617 Ga0068859_100427888 Ga0068859_1004278882 216
113 3300005618 Ga0068864_100028552 Ga0068864_1000285527 216
114 3300005618 Ga0068864_100255449 Ga0068864_1002554492 216
115 3300005618 Ga0068864_100365293 Ga0068864_1003652932 216
116 3300005618 Ga0068864_100424629 Ga0068864_1004246292 216
117 3300005718 Ga0068866_10157190 Ga0068866_101571901 216
118 3300005719 Ga0068861_100538062 Ga0068861_1005380621 216
119 3300005841 Ga0068863_100393968 Ga0068863_1003939681 216
120 3300005841 Ga0068863_100461975 Ga0068863_1004619751 216
121 3300005842 Ga0068858_100198178 Ga0068858_1001981782 216
122 3300005842 Ga0068858_100270442 Ga0068858_1002704423 216
123 3300005843 Ga0068860_100217511 Ga0068860_1002175113 216
124 3300005843 Ga0068860_100982512 Ga0068860_1009825122 216
125 3300005937 Ga0081455_10001692 Ga0081455_100016922 216
126 3300005937 Ga0081455_10006720 Ga0081455_100067208 216
127 3300005937 Ga0081455_10023358 Ga0081455_100233583 216
128 3300005937 Ga0081455_10028216 Ga0081455_100282167 216
129 3300005937 Ga0081455_10452163 Ga0081455_104521631 216
130 3300005981 Ga0081538_10021664 Ga0081538_100216643 216
131 3300005983 Ga0081540_1001103 Ga0081540_100110315 216
132 3300006028 Ga0070717_10039203 Ga0070717_100392033 216
133 3300006028 Ga0070717_10163376 Ga0070717_101633764 216
134 3300006028 Ga0070717_10465900 Ga0070717_104659002 216
135 3300006038 Ga0075365_10143705 Ga0075365_101437052 216
136 3300006042 Ga0075368_10218837 Ga0075368_102188371 216
137 3300006163 Ga0070715_10353193 Ga0070715_103531931 216
138 3300006175 Ga0070712_100076186 Ga0070712_1000761864 216
139 3300006175 Ga0070712_100281015 Ga0070712_1002810152 216
140 3300006178 Ga0075367_10327369 Ga0075367_103273691 216
141 3300006195 Ga0075366_10199338 Ga0075366_101993381 216
142 3300006844 Ga0075428_100401283 Ga0075428_1004012833 216
143 3300006846 Ga0075430_100095837 Ga0075430_1000958372 216
144 3300006846 Ga0075430_100149830 Ga0075430_1001498302 216
145 3300006847 Ga0075431_100030068 Ga0075431_1000300683 216
146 3300006847 Ga0075431_100168200 Ga0075431_1001682003 216
147 3300006847 Ga0075431_100264321 Ga0075431_1002643213 216
148 3300006847 Ga0075431_100302961 Ga0075431_1003029612 216
149 3300006847 Ga0075431_100384007 Ga0075431_1003840072 216
150 3300006852 Ga0075433_10056706 Ga0075433_100567063 216
151 3300006852 Ga0075433_10108629 Ga0075433_101086293 216
152 3300006852 Ga0075433_10619259 Ga0075433_106192592 216
153 3300006871 Ga0075434_100005496 Ga0075434_1000054966 216
154 3300006871 Ga0075434_100177508 Ga0075434_1001775083 216
155 3300006871 Ga0075434_100397744 Ga0075434_1003977442 216
156 3300006880 Ga0075429_100192489 Ga0075429_1001924893 216
157 3300006880 Ga0075429_100259240 Ga0075429_1002592402 216
158 3300006880 Ga0075429_100291529 Ga0075429_1002915292 216
159 3300006931 Ga0097620_100018951 Ga0097620_1000189516 216
160 3300006931 Ga0097620_100427878 Ga0097620_1004278782 216
161 3300007076 Ga0075435_100413526 Ga0075435_1004135262 216
162 3300007076 Ga0075435_100779528 Ga0075435_1007795281 216
163 3300009093 Ga0105240_10258211 Ga0105240_102582114 216
164 3300009094 Ga0111539_10011405 Ga0111539_100114054 216
165 3300009094 Ga0111539_10026569 Ga0111539_100265694 216
166 3300009094 Ga0111539_10308395 Ga0111539_103083952 216
167 3300009098 Ga0105245_10008565 Ga0105245_100085658 216
168 3300009147 Ga0114129_10003291 Ga0114129_1000329121 216
169 3300009147 Ga0114129_10020071 Ga0114129_100200718 216
170 3300009147 Ga0114129_10025414 Ga0114129_100254144 216
171 3300009147 Ga0114129_10087690 Ga0114129_100876906 216
172 3300009176 Ga0105242_10535860 Ga0105242_105358601 216
173 3300009545 Ga0105237_10067517 Ga0105237_100675174 216
174 3300010375 Ga0105239_10154133 Ga0105239_101541333 216
175 3300010375 Ga0105239_10193306 Ga0105239_101933063 216
176 3300010375 Ga0105239_10674463 Ga0105239_106744632 216
177 3300010375 Ga0105239_11113635 Ga0105239_111136351 216
178 3300011119 Ga0105246_10051869 Ga0105246_100518693 216
179 3300011119 Ga0105246_10113164 Ga0105246_101131644 216
180 3300013105 Ga0157369_10426691 Ga0157369_104266912 216
181 3300013297 Ga0157378_10003059 Ga0157378_100030596 216
182 3300013297 Ga0157378_10813299 Ga0157378_108132992 216
183 3300013306 Ga0163162_10000030 Ga0163162_10000030115 216
184 3300013306 Ga0163162_10059459 Ga0163162_100594592 216
185 3300013306 Ga0163162_10217043 Ga0163162_102170433 216
186 3300013308 Ga0157375_10015972 Ga0157375_100159726 216
187 3300013308 Ga0157375_10204426 Ga0157375_102044262 216
188 3300013308 Ga0157375_10284173 Ga0157375_102841731 216
189 3300014325 Ga0163163_10321094 Ga0163163_103210941 216
190 3300014326 Ga0157380_10017716 Ga0157380_100177161 216
191 3300017792 Ga0163161_10099463 Ga0163161_100994632 216
192 3300025291 Ga0209675_1011334 Ga0209675_10113342 216
193 3300025904 Ga0207647_10039265 Ga0207647_100392652 216
194 3300025905 Ga0207685_10085839 Ga0207685_100858391 216
195 3300025913 Ga0207695_10405239 Ga0207695_104052392 216
196 3300025915 Ga0207693_10009123 Ga0207693_100091236 216
197 3300025916 Ga0207663_10502352 Ga0207663_105023522 216
198 3300025916 Ga0207663_10597752 Ga0207663_105977521 216
199 3300025917 Ga0207660_10184070 Ga0207660_101840702 216
200 3300025917 Ga0207660_10242260 Ga0207660_102422602 216
201 3300025918 Ga0207662_10160923 Ga0207662_101609232 216
202 3300025919 Ga0207657_10169987 Ga0207657_101699872 216
203 3300025920 Ga0207649_10057297 Ga0207649_100572972 216
204 3300025924 Ga0207694_10333868 Ga0207694_103338682 216
205 3300025925 Ga0207650_10003725 Ga0207650_100037253 216
206 3300025925 Ga0207650_10066576 Ga0207650_100665762 216
207 3300025925 Ga0207650_10691554 Ga0207650_106915541 216
208 3300025928 Ga0207700_10000862 Ga0207700_1000086210 216
209 3300025928 Ga0207700_10224361 Ga0207700_102243612 216
210 3300025931 Ga0207644_10004575 Ga0207644_100045753 216
211 3300025931 Ga0207644_10030476 Ga0207644_100304764 216
212 3300025931 Ga0207644_10070496 Ga0207644_100704962 216
213 3300025933 Ga0207706_10019690 Ga0207706_100196903 216
214 3300025933 Ga0207706_10042515 Ga0207706_100425153 216
215 3300025940 Ga0207691_10074932 Ga0207691_100749324 216
216 3300025945 Ga0207679_10018224 Ga0207679_100182244 216
217 3300025945 Ga0207679_10268792 Ga0207679_102687922 216
218 3300025960 Ga0207651_10001165 Ga0207651_100011652 216
219 3300026067 Ga0207678_10046727 Ga0207678_100467274 216
220 3300026067 Ga0207678_10108307 Ga0207678_101083073 216
221 3300026075 Ga0207708_10140132 Ga0207708_101401323 216
222 3300026088 Ga0207641_10177586 Ga0207641_101775862 216
223 3300026088 Ga0207641_10595044 Ga0207641_105950441 216
224 3300026089 Ga0207648_10058232 Ga0207648_100582326 216
225 3300026118 Ga0207675_100046206 Ga0207675_1000462066 216
226 3300026121 Ga0207683_10324269 Ga0207683_103242692 216
227 3300027665 Ga0209983_1059894 Ga0209983_10598942 216
228 3300027717 Ga0209998_10008920 Ga0209998_100089201 216
229 3300027876 Ga0209974_10050086 Ga0209974_100500862 216
230 3300028379 Ga0268266_10782858 Ga0268266_107828582 216
231 3300028381 Ga0268264_11303933 Ga0268264_113039331 216
232 3300032002 Ga0307416_100220057 Ga0307416_1002200573 216
233 3300034820 Ga0373959_0077040 Ga0373959_0077040_69_731 216
234 3300035086 Ga0373934_0048105 Ga0373934_0048105_781_1431 216
235 3300035113 Ga0373936_0032368 Ga0373936_0032368_1264_1914 216
236 3300035114 Ga0373939_0038381 Ga0373939_0038381_448_1098 216
237 3300035116 Ga0373945_0057468 Ga0373945_0057468_397_1059 216
238 3300035118 Ga0373954_0028364 Ga0373954_0028364_1185_1835 216
239 3300035119 Ga0373956_0045489 Ga0373956_0045489_95_745 216
240 3300035410 Ga0373924_0020099 Ga0373924_0020099_1844_2503 216
241 3300035691 Ga0373931_0032115 Ga0373931_0032115_1708_2358 216
242 3300035691 Ga0373931_0136528 Ga0373931_0136528_570_1220 216
243 3300035692 Ga0373935_0005742 Ga0373935_0005742_3856_4518 216
244 3300035695 Ga0373927_0126076 Ga0373927_0126076_285_935 216
245 3300035695 Ga0373927_0126770 Ga0373927_0126770_588_1247 216
246 3300035695 Ga0373927_0157074 Ga0373927_0157074_123_788 216
247 3300035695 Ga0373927_0201596 Ga0373927_0201596_616_1266 216
248 3300035724 Ga0373933_0288857 Ga0373933_0288857_158_808 216
249 3300035724 Ga0373933_0318732 Ga0373933_0318732_289_939 216
250 3300035725 Ga0373947_0067248 Ga0373947_0067248_354_1019 216
251 3300035725 Ga0373947_0079147 Ga0373947_0079147_922_1581 216
252 3300035725 Ga0373947_0341992 Ga0373947_0341992_272_934 216
253 3300036401 Ga0373937_0009924 Ga0373937_0009924_6637_7293 216
254 3300036401 Ga0373937_0018239 Ga0373937_0018239_675_1325 216
255 3300036401 Ga0373937_0147367 Ga0373937_0147367_868_1530 216
256 3300037068 Ga0373925_0010617 Ga0373925_0010617_1572_2234 216
257 3300037068 Ga0373925_0178033 Ga0373925_0178033_909_1559 216
258 3300037068 Ga0373925_0260253 Ga0373925_0260253_720_1370 216
259 3300039437 Ga0436365_0850419 Ga0436365_0850419_289_942 216
260 3300039437 Ga0436365_1807606 Ga0436365_1807606_645_1304 216
261 3300039438 Ga0436360_1125811 Ga0436360_1125811_1544_2194 216
262 3300039438 Ga0436360_1217870 Ga0436360_1217870_13_663 216
263 3300039453 Ga0436362_0569831 Ga0436362_0569831_2728_3378 216
264 3300042876 Ga0451577_0000058 Ga0451577_0000058_50837_51487 216
265 3300044712 Ga0453684_0000279 Ga0453684_0000279_147494_148144 216
266 3300045051 Ga0451576_0001134 Ga0451576_0001134_39695_40345 216
267 3300045051 Ga0451576_0148203 Ga0451576_0148203_1705_2355 216
268 3300046452 Ga0495617_000786 Ga0495617_000786_10776_11426 216
269 3300046453 Ga0495627_017161 Ga0495627_017161_862_1512 216
270 3300046454 Ga0495592_0036676 Ga0495592_0036676_1100_1750 216
271 3300046455 Ga0495603_0221067 Ga0495603_0221067_35_685 216
272 3300046455 Ga0495603_0441863 Ga0495603_0441863_18_677 216
273 3300046459 Ga0495629_0025346 Ga0495629_0025346_1615_2265 216
274 3300046459 Ga0495629_0037379 Ga0495629_0037379_660_1310 216
275 3300046462 Ga0495651_0022084 Ga0495651_0022084_3930_4580 216
276 3300046463 Ga0495653_0006075 Ga0495653_0006075_4484_5134 216
277 3300046463 Ga0495653_0023621 Ga0495653_0023621_1340_1990 216
278 3300046471 Ga0495650_0056075 Ga0495650_0056075_508_1158 216
279 3300046472 Ga0495580_0259455 Ga0495580_0259455_239_889 216
280 3300046472 Ga0495580_0468282 Ga0495580_0468282_167_817 216
281 3300046473 Ga0495582_0005640 Ga0495582_0005640_1688_2338 216
282 3300046473 Ga0495582_0075300 Ga0495582_0075300_771_1436 216
283 3300046473 Ga0495582_0096509 Ga0495582_0096509_216_866 216
284 3300046473 Ga0495582_0159364 Ga0495582_0159364_580_1230 216
285 3300046474 Ga0495605_0033647 Ga0495605_0033647_1763_2413 216
286 3300046474 Ga0495605_0043161 Ga0495605_0043161_945_1595 216
287 3300046474 Ga0495605_0067924 Ga0495605_0067924_555_1205 216
288 3300046491 Ga0495584_0014281 Ga0495584_0014281_1430_2080 216
289 3300046491 Ga0495584_0015052 Ga0495584_0015052_1026_1676 216
290 3300046491 Ga0495584_0110220 Ga0495584_0110220_628_1278 216
291 3300046491 Ga0495584_0205792 Ga0495584_0205792_298_948 216
292 3300046492 Ga0495585_0000005 Ga0495585_0000005_254778_255428 216
293 3300046492 Ga0495585_0000465 Ga0495585_0000465_9133_9795 216
294 3300046492 Ga0495585_0014514 Ga0495585_0014514_1669_2319 216
295 3300046492 Ga0495585_0018739 Ga0495585_0018739_3322_3972 216
296 3300046499 Ga0495594_0076097 Ga0495594_0076097_562_1212 216
297 3300046499 Ga0495594_0216727 Ga0495594_0216727_248_898 216
298 3300046500 Ga0495596_0001991 Ga0495596_0001991_6627_7277 216
299 3300046500 Ga0495596_0003288 Ga0495596_0003288_7249_7911 216
300 3300046500 Ga0495596_0003589 Ga0495596_0003589_1693_2343 216
301 3300046500 Ga0495596_0101477 Ga0495596_0101477_381_1031 216
302 3300046501 Ga0495607_0015069 Ga0495607_0015069_1917_2567 216
303 3300046506 Ga0495583_0015633 Ga0495583_0015633_3177_3827 216
304 3300046507 Ga0495606_0033339 Ga0495606_0033339_1038_1688 216
305 3300046507 Ga0495606_0079985 Ga0495606_0079985_699_1349 216
306 3300046511 Ga0495608_0004179 Ga0495608_0004179_6178_6828 216
307 3300046513 Ga0495616_0003309 Ga0495616_0003309_4124_4774 216
308 3300046513 Ga0495616_0007782 Ga0495616_0007782_1983_2645 216
309 3300046513 Ga0495616_0018617 Ga0495616_0018617_1228_1878 216
310 3300046513 Ga0495616_0063351 Ga0495616_0063351_401_1051 216
311 3300046514 Ga0495618_0015786 Ga0495618_0015786_3499_4149 216
312 3300046514 Ga0495618_0129716 Ga0495618_0129716_254_919 216
313 3300046516 Ga0495628_0037933 Ga0495628_0037933_651_1301 216
314 3300046518 Ga0495631_0000684 Ga0495631_0000684_8791_9441 216
315 3300046518 Ga0495631_0015981 Ga0495631_0015981_2085_2735 216
316 3300046518 Ga0495631_0026647 Ga0495631_0026647_218_868 216
317 3300046518 Ga0495631_0065248 Ga0495631_0065248_661_1311 216
318 3300046518 Ga0495631_0072321 Ga0495631_0072321_102_752 216
319 3300046519 Ga0495632_0010482 Ga0495632_0010482_1768_2418 216
320 3300046519 Ga0495632_0131764 Ga0495632_0131764_389_1039 216
321 3300046520 Ga0495637_0042822 Ga0495637_0042822_710_1360 216
322 3300046522 Ga0495643_0046976 Ga0495643_0046976_778_1437 216
323 3300046522 Ga0495643_0086008 Ga0495643_0086008_138_788 216
324 3300046523 Ga0495644_0007890 Ga0495644_0007890_1541_2191 216
325 3300046523 Ga0495644_0059103 Ga0495644_0059103_548_1198 216
326 3300046524 Ga0495648_0000033 Ga0495648_0000033_125863_126513 216
327 3300046524 Ga0495648_0006112 Ga0495648_0006112_1902_2552 216
328 3300046524 Ga0495648_0120225 Ga0495648_0120225_262_912 216
329 3300046524 Ga0495648_0203452 Ga0495648_0203452_279_929 216
330 3300046528 Ga0495642_0019203 Ga0495642_0019203_831_1481 216
331 3300046528 Ga0495642_0020522 Ga0495642_0020522_381_1031 216
332 3300046529 Ga0495652_0007816 Ga0495652_0007816_6173_6823 216
333 3300046529 Ga0495652_0008927 Ga0495652_0008927_2788_3438 216
334 3300046529 Ga0495652_0065238 Ga0495652_0065238_740_1405 216
335 3300046530 Ga0495654_0008857 Ga0495654_0008857_2118_2768 216
336 3300046530 Ga0495654_0098230 Ga0495654_0098230_514_1164 216
337 3300046531 Ga0495665_0011059 Ga0495665_0011059_19_669 216
338 3300046531 Ga0495665_0120738 Ga0495665_0120738_209_859 216
339 3300046533 Ga0495640_0047233 Ga0495640_0047233_816_1466 216
340 3300046535 Ga0495586_0013119 Ga0495586_0013119_3495_4145 216
341 3300046535 Ga0495586_0014286 Ga0495586_0014286_2174_2824 216
342 3300046536 Ga0495587_0013628 Ga0495587_0013628_2043_2693 216
343 3300046536 Ga0495587_0031666 Ga0495587_0031666_2088_2738 216
344 3300046538 Ga0495609_0052907 Ga0495609_0052907_223_873 216
345 3300046538 Ga0495609_0167340 Ga0495609_0167340_19_681 216
346 3300046542 Ga0495597_0027562 Ga0495597_0027562_390_1040 216
347 3300046542 Ga0495597_0048227 Ga0495597_0048227_480_1130 216
348 3300046542 Ga0495597_0063659 Ga0495597_0063659_354_1004 216
349 3300046542 Ga0495597_0216148 Ga0495597_0216148_30_680 216
350 3300046557 Ga0495622_0009227 Ga0495622_0009227_1973_2623 216
351 3300046557 Ga0495622_0037352 Ga0495622_0037352_901_1551 216
352 3300046557 Ga0495622_0193334 Ga0495622_0193334_101_751 216
353 3300046558 Ga0495633_0008397 Ga0495633_0008397_220_882 216
354 3300046559 Ga0495667_0057487 Ga0495667_0057487_559_1209 216
355 3300046615 Ga0495656_0321678 Ga0495656_0321678_23_673 216
356 3300046616 Ga0495668_0000131 Ga0495668_0000131_72580_73230 216
357 3300046616 Ga0495668_0025241 Ga0495668_0025241_195_845 216
358 3300046642 Ga0495634_0054889 Ga0495634_0054889_1835_2485 216
359 3300046642 Ga0495634_0073627 Ga0495634_0073627_662_1327 216
360 3300046648 Ga0495611_0004328 Ga0495611_0004328_2982_3632 216
361 3300046648 Ga0495611_0027329 Ga0495611_0027329_1202_1852 216
362 3300046648 Ga0495611_0231193 Ga0495611_0231193_167_817 216
363 3300046660 Ga0495625_0125927 Ga0495625_0125927_708_1358 216
364 3300046660 Ga0495625_0274025 Ga0495625_0274025_33_683 216
365 3300046663 Ga0495635_0018595 Ga0495635_0018595_2560_3210 216
366 3300046664 Ga0495659_0063395 Ga0495659_0063395_592_1242 216
367 3300046665 Ga0495661_0014885 Ga0495661_0014885_1115_1765 216
368 3300046674 Ga0495588_0002151 Ga0495588_0002151_5164_5814 216
369 3300046674 Ga0495588_0048457 Ga0495588_0048457_394_1044 216
370 3300046675 Ga0495657_0058401 Ga0495657_0058401_591_1241 216
371 3300046678 Ga0495599_0016159 Ga0495599_0016159_1695_2345 216
372 3300046679 Ga0495623_0011944 Ga0495623_0011944_4669_5319 216
373 3300046683 Ga0495658_0187036 Ga0495658_0187036_251_901 216
374 3300046684 Ga0495669_0000190 Ga0495669_0000190_31381_32031 216
375 3300046689 Ga0495613_0038522 Ga0495613_0038522_967_1617 216
376 3300046689 Ga0495613_0046540 Ga0495613_0046540_813_1463 216
377 3300046691 Ga0495670_0107743 Ga0495670_0107743_477_1139 216
378 3300046691 Ga0495670_0132542 Ga0495670_0132542_562_1212 216
379 3300046692 Ga0495671_0058203 Ga0495671_0058203_253_903 216
380 3300046692 Ga0495671_0156441 Ga0495671_0156441_100_750 216
381 3300046694 Ga0495649_0151435 Ga0495649_0151435_45_695 216
382 3300046794 Ga0495589_0013026 Ga0495589_0013026_2808_3458 216
383 3300046809 Ga0495600_0044420 Ga0495600_0044420_1699_2349 216
384 3300046810 Ga0495660_0037045 Ga0495660_0037045_394_1044 216
385 3300046810 Ga0495660_0060190 Ga0495660_0060190_381_1031 216
386 3300047315 Ga0495581_0014601 Ga0495581_0014601_1337_1987 216
387 3300047317 Ga0495604_0006708 Ga0495604_0006708_8358_9008 216
388 3300047317 Ga0495604_0009427 Ga0495604_0009427_3499_4149 216
389 3300047317 Ga0495604_0137357 Ga0495604_0137357_845_1495 216
390 3300047317 Ga0495604_0550901 Ga0495604_0550901_44_694 216
391 3300047319 Ga0495674_0036088 Ga0495674_0036088_1153_1803 216
392 3300047319 Ga0495674_0056241 Ga0495674_0056241_900_1565 216
393 3300047321 Ga0495676_0000177 Ga0495676_0000177_2713_3363 216
394 3300047322 Ga0495680_0007799 Ga0495680_0007799_2650_3300 216
395 3300047322 Ga0495680_0013815 Ga0495680_0013815_4412_5062 216
396 3300047323 Ga0495683_0000072 Ga0495683_0000072_19487_20149 216
397 3300047323 Ga0495683_0015660 Ga0495683_0015660_3268_3918 216
398 3300047323 Ga0495683_0022250 Ga0495683_0022250_1126_1776 216
399 3300047323 Ga0495683_0022710 Ga0495683_0022710_609_1259 216
400 3300047444 Ga0495675_0006310 Ga0495675_0006310_3448_4098 216
401 3300047444 Ga0495675_0017422 Ga0495675_0017422_2043_2693 216
402 3300047445 Ga0495677_0009205 Ga0495677_0009205_20_670 216
403 3300047446 Ga0495679_031406 Ga0495679_031406_771_1421 216
404 3300047447 Ga0495685_027022 Ga0495685_027022_404_1054 216
405 3300047470 Ga0495681_0088915 Ga0495681_0088915_392_1054 216
406 3300047471 Ga0495684_0287227 Ga0495684_0287227_158_808 216
407 3300047471 Ga0495684_0298443 Ga0495684_0298443_348_998 216
408 3300047472 Ga0495686_0266636 Ga0495686_0266636_142_792 216
409 3300047673 Ga0495593_0060145 Ga0495593_0060145_854_1504 216
410 3300047673 Ga0495593_0087822 Ga0495593_0087822_806_1456 216
411 3300048088 Ga0495602_0014350 Ga0495602_0014350_6416_7066 216
412 3300048088 Ga0495602_0026223 Ga0495602_0026223_4004_4654 216
413 3300048089 Ga0495614_0007477 Ga0495614_0007477_3402_4052 216
414 3300048089 Ga0495614_0015948 Ga0495614_0015948_449_1099 216
415 3300048091 Ga0495626_0012647 Ga0495626_0012647_1529_2179 216
416 3300048091 Ga0495626_0064711 Ga0495626_0064711_167_817 216
417 3300048903 Ga0496100_0049557 Ga0496100_0049557_1565_2215 216
418 3300048905 Ga0496102_0067021 Ga0496102_0067021_1552_2202 216
419 3300048905 Ga0496102_0301316 Ga0496102_0301316_54_713 216
420 3300048905 Ga0496102_0321290 Ga0496102_0321290_556_1206 216
421 3300048906 Ga0496103_0035300 Ga0496103_0035300_2258_2908 216
422 3300048907 Ga0496104_0005903 Ga0496104_0005903_7125_7775 216
423 3300048907 Ga0496104_0014250 Ga0496104_0014250_1237_1887 216
424 3300048907 Ga0496104_0051370 Ga0496104_0051370_1470_2120 216
425 3300048907 Ga0496104_0377643 Ga0496104_0377643_539_1189 216
426 3300048907 Ga0496104_0580731 Ga0496104_0580731_236_898 216
427 3300048908 Ga0496105_0008661 Ga0496105_0008661_2357_3007 216
428 3300048908 Ga0496105_0058976 Ga0496105_0058976_2073_2723 216
429 3300048908 Ga0496105_0077547 Ga0496105_0077547_1407_2057 216
430 3300048908 Ga0496105_0086611 Ga0496105_0086611_344_994 216
431 3300048908 Ga0496105_0108948 Ga0496105_0108948_987_1637 216
432 3300048908 Ga0496105_0496900 Ga0496105_0496900_135_785 216
433 3300048909 Ga0496106_0140824 Ga0496106_0140824_711_1361 216
434 3300048910 Ga0496107_0135624 Ga0496107_0135624_1016_1666 216
435 3300048911 Ga0496108_0049617 Ga0496108_0049617_1173_1823 216
436 3300048911 Ga0496108_0082077 Ga0496108_0082077_521_1171 216
437 3300048911 Ga0496108_0242186 Ga0496108_0242186_454_1104 216
438 3300048911 Ga0496108_0319627 Ga0496108_0319627_574_1224 216
439 3300048911 Ga0496108_0496496 Ga0496108_0496496_131_793 216
440 3300048912 Ga0496109_0031399 Ga0496109_0031399_3415_4074 216
441 3300048912 Ga0496109_0058137 Ga0496109_0058137_698_1348 216
442 3300048912 Ga0496109_0079051 Ga0496109_0079051_340_990 216
443 3300048912 Ga0496109_0104821 Ga0496109_0104821_1391_2053 216
444 3300048912 Ga0496109_0252091 Ga0496109_0252091_560_1210 216
445 3300048912 Ga0496109_0333992 Ga0496109_0333992_273_923 216
446 3300048912 Ga0496109_0413203 Ga0496109_0413203_412_1062 216
447 3300048913 Ga0496110_0007901 Ga0496110_0007901_5610_6269 216
448 3300048913 Ga0496110_0112073 Ga0496110_0112073_1440_2090 216
449 3300048913 Ga0496110_0192536 Ga0496110_0192536_552_1202 216
450 3300048913 Ga0496110_0288484 Ga0496110_0288484_267_917 216
451 3300048914 Ga0496111_0041383 Ga0496111_0041383_1193_1843 216
452 3300048914 Ga0496111_0096223 Ga0496111_0096223_710_1360 216
453 3300048915 Ga0496112_0001256 Ga0496112_0001256_16976_17626 216
454 3300048915 Ga0496112_0047904 Ga0496112_0047904_1429_2079 216
455 3300048915 Ga0496112_0157447 Ga0496112_0157447_1506_2156 216
456 3300048915 Ga0496112_0165258 Ga0496112_0165258_465_1124 216
457 3300048915 Ga0496112_0293404 Ga0496112_0293404_643_1293 216
458 3300048915 Ga0496112_0322838 Ga0496112_0322838_567_1217 216
459 3300048915 Ga0496112_0411619 Ga0496112_0411619_615_1265 216
460 3300048915 Ga0496112_0715037 Ga0496112_0715037_224_886 216
461 3300048916 Ga0496113_0062239 Ga0496113_0062239_1499_2149 216
462 3300048916 Ga0496113_0106347 Ga0496113_0106347_191_841 216
463 3300048916 Ga0496113_0349896 Ga0496113_0349896_65_724 216
464 3300048916 Ga0496113_0562043 Ga0496113_0562043_218_868 216
465 3300048917 Ga0496114_0012861 Ga0496114_0012861_4223_4873 216
466 3300048918 Ga0496115_0009579 Ga0496115_0009579_2971_3621 216
467 3300048918 Ga0496115_0162487 Ga0496115_0162487_436_1098 216
468 3300049459 Ga0495678_000681 Ga0495678_000681_324_974 216
469 3300049460 Ga0495682_0031051 Ga0495682_0031051_425_1087 216
470 3300049460 Ga0495682_0046418 Ga0495682_0046418_285_935 216
471 3300049568 Ga0501031_0095115 Ga0501031_0095115_1053_1703 216
472 3300049568 Ga0501031_0095844 Ga0501031_0095844_96_746 216
473 3300049570 Ga0501033_0439755 Ga0501033_0439755_221_871 216
474 3300049572 Ga0501036_0038220 Ga0501036_0038220_159_809 216
475 3300049572 Ga0501036_0114959 Ga0501036_0114959_553_1206 216
476 3300049572 Ga0501036_0141524 Ga0501036_0141524_1329_1979 216
477 3300049574 Ga0501038_0118711 Ga0501038_0118711_872_1522 216
478 3300049575 Ga0501039_0285477 Ga0501039_0285477_489_1142 216
479 3300049575 Ga0501039_0364864 Ga0501039_0364864_379_1029 216
480 3300049576 Ga0501040_0004091 Ga0501040_0004091_932_1582 216
481 3300049576 Ga0501040_0539526 Ga0501040_0539526_42_692 216
482 3300049577 Ga0501041_0075344 Ga0501041_0075344_543_1193 216
483 3300049577 Ga0501041_0212492 Ga0501041_0212492_175_825 216
484 3300049578 Ga0501042_0012164 Ga0501042_0012164_1545_2195 216
485 3300049578 Ga0501042_0067352 Ga0501042_0067352_590_1243 216
486 3300049578 Ga0501042_0117572 Ga0501042_0117572_479_1129 216
487 3300049580 Ga0501046_0009766 Ga0501046_0009766_5377_6027 216
488 3300049582 Ga0501048_0221422 Ga0501048_0221422_471_1121 216
489 3300049587 Ga0501071_0003983 Ga0501071_0003983_8489_9139 216
490 3300049587 Ga0501071_0078748 Ga0501071_0078748_139_792 216
491 3300049588 Ga0501072_0042796 Ga0501072_0042796_1452_2105 216
492 3300049588 Ga0501072_0062269 Ga0501072_0062269_536_1186 216
493 3300049588 Ga0501072_0223696 Ga0501072_0223696_25_675 216
494 3300049590 Ga0501074_0150629 Ga0501074_0150629_625_1278 216
495 3300049591 Ga0501075_0219737 Ga0501075_0219737_761_1411 216
496 3300049591 Ga0501075_0494600 Ga0501075_0494600_58_708 216
497 3300049592 Ga0501076_0004613 Ga0501076_0004613_8217_8867 216
498 3300049592 Ga0501076_0330539 Ga0501076_0330539_31_684 216
499 3300049592 Ga0501076_0533227 Ga0501076_0533227_197_847 216
500 3300049593 Ga0501077_0008606 Ga0501077_0008606_3463_4113 216
501 3300049593 Ga0501077_0092101 Ga0501077_0092101_455_1105 216
502 3300049741 Ga0501079_0041671 Ga0501079_0041671_640_1290 216
503 3300049741 Ga0501079_0146343 Ga0501079_0146343_157_807 216
504 3300049742 Ga0501080_0209140 Ga0501080_0209140_172_825 216
505 3300049743 Ga0501081_0002738 Ga0501081_0002738_8513_9163 216
506 3300049743 Ga0501081_0040378 Ga0501081_0040378_2470_3120 216
507 3300049743 Ga0501081_0369283 Ga0501081_0369283_91_741 216
508 3300049743 Ga0501081_0371084 Ga0501081_0371084_19_672 216
509 3300049822 Ga0501035_0095839 Ga0501035_0095839_159_809 216
510 3300049824 Ga0501045_0024328 Ga0501045_0024328_143_793 216
511 3300049824 Ga0501045_0363483 Ga0501045_0363483_268_918 216
512 3300050491 nmdc:mga00v17_15695_c1 nmdc:mga00v17_15695_c1_1823_2473 216
513 3300050492 nmdc:mga0yw44_63224_c1 nmdc:mga0yw44_63224_c1_79_729 216
514 3300050493 nmdc:mga0k408_26773_c1 nmdc:mga0k408_26773_c1_869_1519 216
515 3300050507 nmdc:mga05p37_1262702_c1 nmdc:mga05p37_1262702_c1_52_702 216
516 3300050507 nmdc:mga05p37_153780_c1 nmdc:mga05p37_153780_c1_1687_2346 216
517 3300050507 nmdc:mga05p37_2263_c1 nmdc:mga05p37_2263_c1_18406_19062 216
518 3300050507 nmdc:mga05p37_3065_c1 nmdc:mga05p37_3065_c1_1208_1858 216
519 3300050507 nmdc:mga05p37_85016_c1 nmdc:mga05p37_85016_c1_1944_2594 216
520 3300050508 nmdc:mga09592_113650_c1 nmdc:mga09592_113650_c1_1351_2007 216
521 3300050508 nmdc:mga09592_245441_c1 nmdc:mga09592_245441_c1_299_949 216
522 3300050508 nmdc:mga09592_302523_c1 nmdc:mga09592_302523_c1_250_900 216
523 3300050509 nmdc:mga0qj67_185732_c1 nmdc:mga0qj67_185732_c1_499_1155 216
524 3300050509 nmdc:mga0qj67_297692_c1 nmdc:mga0qj67_297692_c1_483_1133 216
525 3300050510 nmdc:mga06r32_235319_c1 nmdc:mga06r32_235319_c1_998_1648 216
526 3300050510 nmdc:mga06r32_24663_c1 nmdc:mga06r32_24663_c1_1331_1987 216
527 3300050510 nmdc:mga06r32_338939_c1 nmdc:mga06r32_338939_c1_184_834 216
528 3300050510 nmdc:mga06r32_572323_c1 nmdc:mga06r32_572323_c1_171_821 216
529 3300050511 nmdc:mga08y16_10823_c1 nmdc:mga08y16_10823_c1_4884_5534 216
530 3300050511 nmdc:mga08y16_12433_c1 nmdc:mga08y16_12433_c1_4200_4859 216
531 3300050511 nmdc:mga08y16_7164_c1 nmdc:mga08y16_7164_c1_9638_10294 216
532 3300050512 nmdc:mga0n895_37583_c1 nmdc:mga0n895_37583_c1_3728_4384 216
533 3300050512 nmdc:mga0n895_477314_c1 nmdc:mga0n895_477314_c1_394_1050 216
534 3300050513 nmdc:mga0rr50_236969_c1 nmdc:mga0rr50_236969_c1_430_1089 216
535 3300050513 nmdc:mga0rr50_7411_c1 nmdc:mga0rr50_7411_c1_1422_2072 216
536 3300050515 nmdc:mga0a205_246461_c1 nmdc:mga0a205_246461_c1_913_1563 216
537 3300050515 nmdc:mga0a205_555877_c1 nmdc:mga0a205_555877_c1_276_926 216
538 3300050515 nmdc:mga0a205_84820_c1 nmdc:mga0a205_84820_c1_809_1459 216
539 3300053077 Ga0495601_0004070 Ga0495601_0004070_5685_6350 216
540 3300053077 Ga0495601_0012830 Ga0495601_0012830_1929_2579 216
541 3300053077 Ga0495601_0586911 Ga0495601_0586911_21_671 216
542 3300053078 Ga0495612_0015988 Ga0495612_0015988_989_1639 216
543 3300053084 Ga0495595_0003336 Ga0495595_0003336_1241_1891 216
544 3300053085 Ga0495619_0002109 Ga0495619_0002109_560_1210 216
545 3300053085 Ga0495619_0014746 Ga0495619_0014746_2124_2789 216
546 3300053085 Ga0495619_0377306 Ga0495619_0377306_158_808 216
547 3300053096 Ga0500641_0009224 Ga0500641_0009224_867_1529 216
548 3300053163 Ga0500639_148723 Ga0500639_148723_155_805 216
549 3300054114 Ga0501084_0030659 Ga0501084_0030659_248_898 216
550 3300054114 Ga0501084_0073117 Ga0501084_0073117_734_1384 216
551 3300054114 Ga0501084_0096629 Ga0501084_0096629_1043_1693 216
552 3300054114 Ga0501084_0180232 Ga0501084_0180232_396_1049 216
553 3300060353 Ga0501082_0020201 Ga0501082_0020201_1915_2565 216
554 3300060353 Ga0501082_0040469 Ga0501082_0040469_1811_2464 216
555 3300060353 Ga0501082_0040782 Ga0501082_0040782_2596_3246 216
556 3300060353 Ga0501082_0211521 Ga0501082_0211521_400_1050 216
557 3300061734 Ga0530510_0014744 Ga0530510_0014744_4710_5360 216
558 3300061734 Ga0530510_0123075 Ga0530510_0123075_261_911 216
559 3300021361 Ga0213872_10009729 Ga0213872_100097295 219
560 3300039447 Ga0436361_0609746 Ga0436361_0609746_4102_4776 219
561 3300005339 Ga0070660_100267373 Ga0070660_1002673732 220
562 3300005347 Ga0070668_100162092 Ga0070668_1001620921 220
563 3300005354 Ga0070675_100126160 Ga0070675_1001261602 220
564 3300005355 Ga0070671_100319021 Ga0070671_1003190212 220
565 3300005366 Ga0070659_100073113 Ga0070659_1000731132 220
566 3300005456 Ga0070678_100105335 Ga0070678_1001053352 220
567 3300005535 Ga0070684_100246593 Ga0070684_1002465932 220
568 3300005539 Ga0068853_100036539 Ga0068853_1000365393 220
569 3300005563 Ga0068855_100113957 Ga0068855_1001139572 220
570 3300005616 Ga0068852_100003539 Ga0068852_1000035396 220
571 3300005843 Ga0068860_100374357 Ga0068860_1003743572 220
572 3300009093 Ga0105240_10099553 Ga0105240_100995532 220
573 3300009148 Ga0105243_10149864 Ga0105243_101498642 220
574 3300009177 Ga0105248_10227482 Ga0105248_102274822 220
575 3300009551 Ga0105238_10004063 Ga0105238_100040633 220
576 3300013105 Ga0157369_10000568 Ga0157369_1000056810 220
577 3300014326 Ga0157380_11038648 Ga0157380_110386482 220
578 3300025913 Ga0207695_10514873 Ga0207695_105148732 220
579 3300025919 Ga0207657_10174470 Ga0207657_101744702 220
580 3300025924 Ga0207694_10062231 Ga0207694_100622312 220
581 3300025932 Ga0207690_10103829 Ga0207690_101038292 220
582 3300025933 Ga0207706_10180673 Ga0207706_101806731 220
583 3300025937 Ga0207669_10124670 Ga0207669_101246702 220
584 3300025940 Ga0207691_10139812 Ga0207691_101398122 220
585 3300025949 Ga0207667_10062740 Ga0207667_100627404 220
586 3300025986 Ga0207658_10102703 Ga0207658_101027032 220
587 3300026041 Ga0207639_10030986 Ga0207639_100309863 220
588 3300026078 Ga0207702_10113310 Ga0207702_101133103 220
589 3300026142 Ga0207698_10001815 Ga0207698_100018158 220
590 3300042876 Ga0451577_0176431 Ga0451577_0176431_749_1411 220
591 3300044673 Ga0453683_0198163 Ga0453683_0198163_200_862 220
592 3300046522 Ga0495643_0013462 Ga0495643_0013462_303_965 220
593 3300046528 Ga0495642_0030247 Ga0495642_0030247_60_722 220
594 3300046537 Ga0495598_0029099 Ga0495598_0029099_199_864 220
595 3300046542 Ga0495597_0008921 Ga0495597_0008921_1306_1968 220
596 3300046616 Ga0495668_0069991 Ga0495668_0069991_759_1421 220
597 3300046665 Ga0495661_0007327 Ga0495661_0007327_5583_6245 220
598 3300047443 Ga0495687_014045 Ga0495687_014045_2409_3071 220
599 3300003544 Ga0007417J51691_1018961 Ga0007417J51691_10189615 221
600 3300003579 Ga0007429J51699_1032193 Ga0007429J51699_10321935 221
601 3300003693 Ga0032354_1009780 Ga0032354_10097805 221
602 3300005344 Ga0070661_100099533 Ga0070661_1000995332 221
603 3300005366 Ga0070659_100021832 Ga0070659_1000218327 221
604 3300005564 Ga0070664_100223984 Ga0070664_1002239843 221
605 3300005616 Ga0068852_101128452 Ga0068852_1011284521 221
606 3300006844 Ga0075428_100006609 Ga0075428_10000660910 221
607 3300006846 Ga0075430_100485094 Ga0075430_1004850942 221
608 3300006847 Ga0075431_100000643 Ga0075431_10000064322 221
609 3300009036 Ga0105244_10045266 Ga0105244_100452662 221
610 3300009093 Ga0105240_10941076 Ga0105240_109410762 221
611 3300009098 Ga0105245_10037826 Ga0105245_100378264 221
612 3300009147 Ga0114129_10000005 Ga0114129_1000000518 221
613 3300009148 Ga0105243_10017638 Ga0105243_100176385 221
614 3300011119 Ga0105246_10374663 Ga0105246_103746632 221
615 3300013297 Ga0157378_10484855 Ga0157378_104848552 221
616 3300015262 Ga0182007_10082125 Ga0182007_100821252 221
617 3300025728 Ga0207655_1045445 Ga0207655_10454452 221
618 3300025919 Ga0207657_10141430 Ga0207657_101414302 221
619 3300025920 Ga0207649_10169045 Ga0207649_101690452 221
620 3300025932 Ga0207690_10279566 Ga0207690_102795662 221
621 3300025934 Ga0207686_10052683 Ga0207686_100526833 221
622 3300025935 Ga0207709_10016316 Ga0207709_100163164 221
623 3300025972 Ga0207668_10202714 Ga0207668_102027142 221
624 3300026142 Ga0207698_10060728 Ga0207698_100607283 221
625 3300027907 Ga0207428_10078757 Ga0207428_100787571 221
626 3300037312 Ga0395899_0003912 Ga0395899_0003912_10073_10738 221
627 3300037312 Ga0395899_0011242 Ga0395899_0011242_5348_6013 221
628 3300037418 Ga0395900_0001162 Ga0395900_0001162_25175_25840 221
629 3300037418 Ga0395900_0020459 Ga0395900_0020459_5602_6267 221
630 3300037418 Ga0395900_0095252 Ga0395900_0095252_1251_1931 221
631 3300037466 Ga0395898_0003358 Ga0395898_0003358_11914_12579 221
632 3300037466 Ga0395898_0207938 Ga0395898_0207938_709_1374 221
633 3300037471 Ga0395905_0004279 Ga0395905_0004279_8138_8803 221
634 3300037471 Ga0395905_0045702 Ga0395905_0045702_2011_2691 221
635 3300037471 Ga0395905_0075128 Ga0395905_0075128_40_705 221
636 3300038443 Ga0395901_0011447 Ga0395901_0011447_7651_8316 221
637 3300038443 Ga0395901_0102801 Ga0395901_0102801_168_833 221
638 3300038443 Ga0395901_0175269 Ga0395901_0175269_1191_1856 221
639 3300042007 Ga0439449_0027200 Ga0439449_0027200_753_1418 221
640 3300042008 Ga0439450_020227 Ga0439450_020227_390_1055 221
641 3300042157 Ga0439458_0033391 Ga0439458_0033391_145_810 221
642 3300044694 Ga0466963_0194557 Ga0466963_0194557_320_985 221
643 3300044706 Ga0466964_0012665 Ga0466964_0012665_1059_1733 221
644 3300044842 Ga0466957_0035583 Ga0466957_0035583_1386_2051 221
645 3300044842 Ga0466957_0268617 Ga0466957_0268617_76_741 221
646 3300045976 Ga0466967_0001201 Ga0466967_0001201_2538_3212 221
647 3300045976 Ga0466967_0005963 Ga0466967_0005963_4439_5104 221
648 3300046452 Ga0495617_000885 Ga0495617_000885_7467_8132 221
649 3300046452 Ga0495617_014560 Ga0495617_014560_1429_2106 221
650 3300046453 Ga0495627_000228 Ga0495627_000228_24474_25151 221
651 3300046453 Ga0495627_022678 Ga0495627_022678_979_1671 221
652 3300046457 Ga0495590_0000064 Ga0495590_0000064_52053_52730 221
653 3300046457 Ga0495590_0001552 Ga0495590_0001552_6546_7223 221
654 3300046458 Ga0495591_000693 Ga0495591_000693_16150_16827 221
655 3300046459 Ga0495629_0070616 Ga0495629_0070616_1141_1806 221
656 3300046460 Ga0495638_0071736 Ga0495638_0071736_799_1464 221
657 3300046463 Ga0495653_0051996 Ga0495653_0051996_2220_2897 221
658 3300046471 Ga0495650_0007513 Ga0495650_0007513_631_1308 221
659 3300046474 Ga0495605_0000046 Ga0495605_0000046_140928_141605 221
660 3300046474 Ga0495605_0006069 Ga0495605_0006069_3944_4621 221
661 3300046474 Ga0495605_0012885 Ga0495605_0012885_2405_3073 221
662 3300046474 Ga0495605_0014950 Ga0495605_0014950_2322_2987 221
663 3300046474 Ga0495605_0017171 Ga0495605_0017171_834_1499 221
664 3300046474 Ga0495605_0035670 Ga0495605_0035670_1397_2065 221
665 3300046477 Ga0495664_0345477 Ga0495664_0345477_62_727 221
666 3300046491 Ga0495584_0000477 Ga0495584_0000477_7771_8448 221
667 3300046491 Ga0495584_0001630 Ga0495584_0001630_11634_12302 221
668 3300046491 Ga0495584_0002118 Ga0495584_0002118_1106_1771 221
669 3300046491 Ga0495584_0003168 Ga0495584_0003168_7169_7834 221
670 3300046492 Ga0495585_0000002 Ga0495585_0000002_413876_414541 221
671 3300046492 Ga0495585_0003320 Ga0495585_0003320_9076_9768 221
672 3300046492 Ga0495585_0015031 Ga0495585_0015031_1106_1771 221
673 3300046492 Ga0495585_0026487 Ga0495585_0026487_2043_2720 221
674 3300046492 Ga0495585_0047889 Ga0495585_0047889_619_1311 221
675 3300046500 Ga0495596_0000761 Ga0495596_0000761_7861_8535 221
676 3300046500 Ga0495596_0000846 Ga0495596_0000846_8736_9413 221
677 3300046500 Ga0495596_0005147 Ga0495596_0005147_3742_4434 221
678 3300046500 Ga0495596_0013374 Ga0495596_0013374_2282_2959 221
679 3300046500 Ga0495596_0019781 Ga0495596_0019781_1242_1907 221
680 3300046500 Ga0495596_0067532 Ga0495596_0067532_11_688 221
681 3300046500 Ga0495596_0112294 Ga0495596_0112294_24_692 221
682 3300046501 Ga0495607_0000990 Ga0495607_0000990_2591_3268 221
683 3300046501 Ga0495607_0001168 Ga0495607_0001168_15901_16578 221
684 3300046501 Ga0495607_0001230 Ga0495607_0001230_12431_13108 221
685 3300046501 Ga0495607_0013244 Ga0495607_0013244_4255_4920 221
686 3300046501 Ga0495607_0052992 Ga0495607_0052992_450_1142 221
687 3300046501 Ga0495607_0067429 Ga0495607_0067429_762_1430 221
688 3300046501 Ga0495607_0122704 Ga0495607_0122704_110_775 221
689 3300046506 Ga0495583_0000142 Ga0495583_0000142_4071_4739 221
690 3300046506 Ga0495583_0000870 Ga0495583_0000870_19835_20512 221
691 3300046506 Ga0495583_0012652 Ga0495583_0012652_856_1521 221
692 3300046506 Ga0495583_0015824 Ga0495583_0015824_104_781 221
693 3300046506 Ga0495583_0023203 Ga0495583_0023203_1136_1813 221
694 3300046506 Ga0495583_0023953 Ga0495583_0023953_2242_2907 221
695 3300046507 Ga0495606_0009814 Ga0495606_0009814_3205_3882 221
696 3300046507 Ga0495606_0011711 Ga0495606_0011711_4178_4855 221
697 3300046507 Ga0495606_0070361 Ga0495606_0070361_86_763 221
698 3300046507 Ga0495606_0071043 Ga0495606_0071043_597_1274 221
699 3300046512 Ga0495610_0002844 Ga0495610_0002844_1915_2592 221
700 3300046512 Ga0495610_0079635 Ga0495610_0079635_189_854 221
701 3300046513 Ga0495616_0006917 Ga0495616_0006917_398_1075 221
702 3300046513 Ga0495616_0008643 Ga0495616_0008643_3681_4346 221
703 3300046513 Ga0495616_0009929 Ga0495616_0009929_793_1470 221
704 3300046513 Ga0495616_0026407 Ga0495616_0026407_347_1024 221
705 3300046513 Ga0495616_0034366 Ga0495616_0034366_749_1417 221
706 3300046513 Ga0495616_0041717 Ga0495616_0041717_819_1484 221
707 3300046513 Ga0495616_0149123 Ga0495616_0149123_368_1033 221
708 3300046518 Ga0495631_0000930 Ga0495631_0000930_13461_14138 221
709 3300046518 Ga0495631_0006519 Ga0495631_0006519_2087_2779 221
710 3300046518 Ga0495631_0009092 Ga0495631_0009092_1911_2588 221
711 3300046518 Ga0495631_0053748 Ga0495631_0053748_740_1405 221
712 3300046518 Ga0495631_0092994 Ga0495631_0092994_208_900 221
713 3300046518 Ga0495631_0106792 Ga0495631_0106792_78_746 221
714 3300046519 Ga0495632_0000025 Ga0495632_0000025_144394_145059 221
715 3300046519 Ga0495632_0000385 Ga0495632_0000385_37443_38120 221
716 3300046519 Ga0495632_0003811 Ga0495632_0003811_5117_5785 221
717 3300046519 Ga0495632_0007682 Ga0495632_0007682_4186_4851 221
718 3300046519 Ga0495632_0049842 Ga0495632_0049842_1246_1911 221
719 3300046520 Ga0495637_0000012 Ga0495637_0000012_144464_145141 221
720 3300046522 Ga0495643_0000777 Ga0495643_0000777_14699_15364 221
721 3300046522 Ga0495643_0004916 Ga0495643_0004916_8363_9028 221
722 3300046522 Ga0495643_0013001 Ga0495643_0013001_265_930 221
723 3300046523 Ga0495644_0003268 Ga0495644_0003268_5388_6065 221
724 3300046523 Ga0495644_0012914 Ga0495644_0012914_1572_2249 221
725 3300046523 Ga0495644_0029568 Ga0495644_0029568_492_1184 221
726 3300046523 Ga0495644_0060826 Ga0495644_0060826_31_708 221
727 3300046523 Ga0495644_0106669 Ga0495644_0106669_172_837 221
728 3300046524 Ga0495648_0000012 Ga0495648_0000012_114776_115441 221
729 3300046524 Ga0495648_0000815 Ga0495648_0000815_17367_18044 221
730 3300046524 Ga0495648_0001398 Ga0495648_0001398_17574_18251 221
731 3300046524 Ga0495648_0001851 Ga0495648_0001851_2233_2907 221
732 3300046524 Ga0495648_0015762 Ga0495648_0015762_986_1651 221
733 3300046528 Ga0495642_0000013 Ga0495642_0000013_30987_31664 221
734 3300046528 Ga0495642_0001210 Ga0495642_0001210_9079_9756 221
735 3300046530 Ga0495654_0004974 Ga0495654_0004974_5730_6407 221
736 3300046531 Ga0495665_0166405 Ga0495665_0166405_431_1108 221
737 3300046538 Ga0495609_0000877 Ga0495609_0000877_9731_10405 221
738 3300046538 Ga0495609_0005910 Ga0495609_0005910_2824_3501 221
739 3300046538 Ga0495609_0021179 Ga0495609_0021179_1534_2199 221
740 3300046538 Ga0495609_0080474 Ga0495609_0080474_535_1200 221
741 3300046538 Ga0495609_0089220 Ga0495609_0089220_252_920 221
742 3300046538 Ga0495609_0155008 Ga0495609_0155008_173_865 221
743 3300046542 Ga0495597_0000199 Ga0495597_0000199_28215_28892 221
744 3300046542 Ga0495597_0020490 Ga0495597_0020490_1717_2382 221
745 3300046542 Ga0495597_0039119 Ga0495597_0039119_474_1151 221
746 3300046558 Ga0495633_0001969 Ga0495633_0001969_11605_12282 221
747 3300046558 Ga0495633_0037882 Ga0495633_0037882_121_789 221
748 3300046558 Ga0495633_0045305 Ga0495633_0045305_715_1392 221
749 3300046615 Ga0495656_0033213 Ga0495656_0033213_362_1030 221
750 3300046615 Ga0495656_0191331 Ga0495656_0191331_195_872 221
751 3300046616 Ga0495668_0000373 Ga0495668_0000373_24488_25165 221
752 3300046616 Ga0495668_0100378 Ga0495668_0100378_501_1178 221
753 3300046616 Ga0495668_0109577 Ga0495668_0109577_352_1029 221
754 3300046648 Ga0495611_0000207 Ga0495611_0000207_22233_22910 221
755 3300046648 Ga0495611_0002813 Ga0495611_0002813_5683_6348 221
756 3300046648 Ga0495611_0028607 Ga0495611_0028607_1099_1791 221
757 3300046648 Ga0495611_0214715 Ga0495611_0214715_90_758 221
758 3300046660 Ga0495625_0074314 Ga0495625_0074314_510_1187 221
759 3300046660 Ga0495625_0125002 Ga0495625_0125002_518_1183 221
760 3300046660 Ga0495625_0157232 Ga0495625_0157232_270_935 221
761 3300046665 Ga0495661_0002466 Ga0495661_0002466_9070_9747 221
762 3300046665 Ga0495661_0002533 Ga0495661_0002533_745_1422 221
763 3300046665 Ga0495661_0005240 Ga0495661_0005240_2860_3525 221
764 3300046665 Ga0495661_0009522 Ga0495661_0009522_1395_2072 221
765 3300046665 Ga0495661_0013871 Ga0495661_0013871_4038_4703 221
766 3300046665 Ga0495661_0016496 Ga0495661_0016496_3947_4624 221
767 3300046665 Ga0495661_0025721 Ga0495661_0025721_934_1599 221
768 3300046665 Ga0495661_0056187 Ga0495661_0056187_667_1359 221
769 3300046665 Ga0495661_0065767 Ga0495661_0065767_225_917 221
770 3300046665 Ga0495661_0153866 Ga0495661_0153866_455_1120 221
771 3300046674 Ga0495588_0166820 Ga0495588_0166820_212_889 221
772 3300046679 Ga0495623_0012634 Ga0495623_0012634_2543_3208 221
773 3300046684 Ga0495669_0001491 Ga0495669_0001491_8178_8870 221
774 3300046684 Ga0495669_0004593 Ga0495669_0004593_2192_2857 221
775 3300046684 Ga0495669_0006852 Ga0495669_0006852_2366_3043 221
776 3300046684 Ga0495669_0230072 Ga0495669_0230072_76_753 221
777 3300046691 Ga0495670_0003708 Ga0495670_0003708_1459_2124 221
778 3300046691 Ga0495670_0009384 Ga0495670_0009384_3423_4088 221
779 3300046691 Ga0495670_0053727 Ga0495670_0053727_417_1094 221
780 3300046691 Ga0495670_0084032 Ga0495670_0084032_720_1397 221
781 3300046692 Ga0495671_0012377 Ga0495671_0012377_3159_3836 221
782 3300046692 Ga0495671_0219090 Ga0495671_0219090_138_815 221
783 3300046694 Ga0495649_0000214 Ga0495649_0000214_30973_31650 221
784 3300046694 Ga0495649_0003286 Ga0495649_0003286_646_1323 221
785 3300046694 Ga0495649_0024995 Ga0495649_0024995_1551_2216 221
786 3300046694 Ga0495649_0067541 Ga0495649_0067541_192_863 221
787 3300046694 Ga0495649_0202993 Ga0495649_0202993_155_829 221
788 3300046794 Ga0495589_0001415 Ga0495589_0001415_4159_4836 221
789 3300046794 Ga0495589_0018014 Ga0495589_0018014_1738_2406 221
790 3300046794 Ga0495589_0021018 Ga0495589_0021018_1948_2622 221
791 3300046794 Ga0495589_0027534 Ga0495589_0027534_1513_2190 221
792 3300046810 Ga0495660_0006553 Ga0495660_0006553_2416_3093 221
793 3300046810 Ga0495660_0047873 Ga0495660_0047873_13_681 221
794 3300046810 Ga0495660_0156703 Ga0495660_0156703_85_762 221
795 3300047319 Ga0495674_0018067 Ga0495674_0018067_2778_3443 221
796 3300047320 Ga0495672_0000124 Ga0495672_0000124_92194_92871 221
797 3300047320 Ga0495672_0000512 Ga0495672_0000512_24321_24995 221
798 3300047320 Ga0495672_0000656 Ga0495672_0000656_26195_26860 221
799 3300047320 Ga0495672_0067047 Ga0495672_0067047_168_833 221
800 3300047321 Ga0495676_0099536 Ga0495676_0099536_565_1239 221
801 3300047322 Ga0495680_0036776 Ga0495680_0036776_1040_1717 221
802 3300047323 Ga0495683_0000368 Ga0495683_0000368_25626_26303 221
803 3300047323 Ga0495683_0002208 Ga0495683_0002208_9493_10167 221
804 3300047323 Ga0495683_0005100 Ga0495683_0005100_5328_6005 221
805 3300047323 Ga0495683_0075361 Ga0495683_0075361_518_1183 221
806 3300047323 Ga0495683_0177929 Ga0495683_0177929_51_719 221
807 3300047443 Ga0495687_000182 Ga0495687_000182_28689_29366 221
808 3300047444 Ga0495675_0158822 Ga0495675_0158822_513_1190 221
809 3300047445 Ga0495677_0000129 Ga0495677_0000129_16142_16819 221
810 3300047445 Ga0495677_0001809 Ga0495677_0001809_3270_3947 221
811 3300047445 Ga0495677_0002312 Ga0495677_0002312_5429_6106 221
812 3300047445 Ga0495677_0004948 Ga0495677_0004948_3283_3948 221
813 3300047445 Ga0495677_0005272 Ga0495677_0005272_2247_2939 221
814 3300047445 Ga0495677_0012732 Ga0495677_0012732_399_1064 221
815 3300047445 Ga0495677_0020815 Ga0495677_0020815_1178_1870 221
816 3300047445 Ga0495677_0058263 Ga0495677_0058263_621_1286 221
817 3300047446 Ga0495679_004811 Ga0495679_004811_3515_4192 221
818 3300047446 Ga0495679_072067 Ga0495679_072067_182_847 221
819 3300047447 Ga0495685_001990 Ga0495685_001990_352_1017 221
820 3300047447 Ga0495685_037419 Ga0495685_037419_340_1017 221
821 3300047447 Ga0495685_047889 Ga0495685_047889_596_1261 221
822 3300047470 Ga0495681_0000189 Ga0495681_0000189_28755_29432 221
823 3300047470 Ga0495681_0009180 Ga0495681_0009180_4080_4748 221
824 3300047470 Ga0495681_0012177 Ga0495681_0012177_3697_4362 221
825 3300047470 Ga0495681_0013471 Ga0495681_0013471_2043_2720 221
826 3300047470 Ga0495681_0042911 Ga0495681_0042911_1025_1702 221
827 3300047470 Ga0495681_0083064 Ga0495681_0083064_206_871 221
828 3300047472 Ga0495686_0000429 Ga0495686_0000429_47763_48428 221
829 3300047472 Ga0495686_0010935 Ga0495686_0010935_4641_5318 221
830 3300047472 Ga0495686_0076330 Ga0495686_0076330_123_800 221
831 3300048091 Ga0495626_0000953 Ga0495626_0000953_6557_7234 221
832 3300048091 Ga0495626_0001381 Ga0495626_0001381_14230_14895 221
833 3300048091 Ga0495626_0002812 Ga0495626_0002812_6469_7134 221
834 3300048091 Ga0495626_0006393 Ga0495626_0006393_1398_2090 221
835 3300048091 Ga0495626_0008557 Ga0495626_0008557_663_1328 221
836 3300048091 Ga0495626_0009558 Ga0495626_0009558_2165_2830 221
837 3300048091 Ga0495626_0025250 Ga0495626_0025250_59_727 221
838 3300048091 Ga0495626_0027417 Ga0495626_0027417_1150_1818 221
839 3300048091 Ga0495626_0029347 Ga0495626_0029347_1842_2507 221
840 3300048904 Ga0496101_0144992 Ga0496101_0144992_973_1638 221
841 3300048905 Ga0496102_0425811 Ga0496102_0425811_371_1048 221
842 3300048906 Ga0496103_0103977 Ga0496103_0103977_91_768 221
843 3300048907 Ga0496104_0058610 Ga0496104_0058610_2575_3240 221
844 3300048913 Ga0496110_0000016 Ga0496110_0000016_65301_65978 221
845 3300048913 Ga0496110_0337724 Ga0496110_0337724_599_1264 221
846 3300048917 Ga0496114_0516697 Ga0496114_0516697_56_721 221
847 3300048918 Ga0496115_0021271 Ga0496115_0021271_4189_4854 221
848 3300048925 Ga0496122_0101679 Ga0496122_0101679_154_819 221
849 3300048926 Ga0496123_0042148 Ga0496123_0042148_353_1018 221
850 3300048927 Ga0496124_0019153 Ga0496124_0019153_4467_5132 221
851 3300049459 Ga0495678_000075 Ga0495678_000075_116994_117671 221
852 3300049459 Ga0495678_000084 Ga0495678_000084_89634_90311 221
853 3300049459 Ga0495678_000596 Ga0495678_000596_29061_29738 221
854 3300049459 Ga0495678_007207 Ga0495678_007207_1344_2012 221
855 3300049459 Ga0495678_035799 Ga0495678_035799_1252_1917 221
856 3300049460 Ga0495682_0000787 Ga0495682_0000787_6745_7422 221
857 3300049460 Ga0495682_0023930 Ga0495682_0023930_1572_2237 221
858 3300049460 Ga0495682_0061834 Ga0495682_0061834_632_1297 221
859 3300049575 Ga0501039_0177861 Ga0501039_0177861_535_1221 221
860 3300049588 Ga0501072_0016553 Ga0501072_0016553_3386_4072 221
861 3300049592 Ga0501076_0032894 Ga0501076_0032894_430_1116 221
862 3300049593 Ga0501077_0230891 Ga0501077_0230891_92_778 221
863 3300050507 nmdc:mga05p37_3365_c1 nmdc:mga05p37_3365_c1_7850_8536 221
864 3300050507 nmdc:mga05p37_75835_c1 nmdc:mga05p37_75835_c1_2530_3210 221
865 3300050509 nmdc:mga0qj67_127_c1 nmdc:mga0qj67_127_c1_7968_8654 221
866 3300050510 nmdc:mga06r32_754_c1 nmdc:mga06r32_754_c1_7327_8013 221
867 3300050510 nmdc:mga06r32_771_c1 nmdc:mga06r32_771_c1_16689_17369 221
868 3300060353 Ga0501082_0302632 Ga0501082_0302632_42_728 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

8

112

0.97

PF01144

CoA_trans

Coenzyme A transferase

111

186

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dbn-assembly1.cif.gz_D crystal structure of atoda complex 0.8848 2 211
6lp1-assembly1.cif.gz_A crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. 0.8798 4 216
6lp1-assembly1.cif.gz_B crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. 0.8795 2 216
6lp1-assembly1.cif.gz_D crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. 0.8773 3 216
3cdk-assembly1.cif.gz_B crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis 0.8755 3 211
ID Description Score Start End Superfamily
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8848 2 211 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8723 3 211 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8654 2 211 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8425 3 211 3.40.1080.10
3eh7A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;4-hydroxybutyrate coenzyme 0.8229 4 46 3.30.750.70
ID Description Score Start End GO Terms
AF-A0A4Q9VLF0-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9884 138 216 GO:0008410
AF-A0A4Q9VLF0-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9642 138 216 GO:0008410
AF-A0A660QKH2-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9522 91 217 GO:0008410
AF-A0A352NZE0-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9435 126 216 GO:0008410
AF-A0A1I4T8J0-F1-model_v4 3-oxoacid CoA-transferase, B subunit 0.9385 91 218 GO:0008410

Feature Viewer

pLDDT pTM Quality
81.9 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map