F484096
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 868 | 327 | 867 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300048914|Ga0496111_0267543|Ga0496111_0267543_12_680 |
| Length | 204 |
| Sequence | MGNIMDAQTIIARRVALELRPGMLVNLGIGIPALIANYVPVGMKVFFQSENGLIGTGPVPEHGLEQPRLTDAGGRPISALPGACTFDSAMSFGLIRGGHLDMTVLGGLQVDGGAMDLVTGAKRVIVAMQHVAKGKSKIIKKCNLPLTSARIIDLVVTELAVIAFPGGRATLMETAPGVSVADVVSNTEAELIVPSGVPAMAIAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 2 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 97 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 143 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 145 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 146 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 147 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 151 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 154 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 155 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 156 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 164 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 165 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 166 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 167 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 168 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 169 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 170 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 171 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 172 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 173 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 174 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 175 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 176 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 310 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 324 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.35 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.38 |
| Nodule | 0.12 |
| Rhizoplane | 8.53 |
| Rhizosphere | 89.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0007417J51691_1018961 | 3300003544 | Bacteria | 6330 |
| 2 | Ga0007429J51699_1032193 | 3300003579 | Bacteria | 6854 |
| 3 | JGI25404J52841_10000005 | 3300003659 | Bacteria | 17884 |
| 4 | Ga0032354_1009780 | 3300003693 | Bacteria | 6947 |
| 5 | Ga0055534_1016085 | 3300003784 | Bacteria | 1350 |
| 6 | JGI25405J52794_10071168 | 3300003911 | Bacteria | 759 |
| 7 | Ga0065715_10013140 | 3300005293 | Bacteria | 2245 |
| 8 | Ga0065707_10230384 | 3300005295 | Bacteria | 1191 |
| 9 | Ga0070690_100182655 | 3300005330 | Bacteria | 1450 |
| 10 | Ga0070670_100059915 | 3300005331 | Bacteria | 3267 |
| 11 | Ga0070670_100233222 | 3300005331 | Bacteria | 1602 |
| 12 | Ga0070666_10046516 | 3300005335 | Bacteria | 2911 |
| 13 | Ga0070682_100010249 | 3300005337 | Bacteria | 5316 |
| 14 | Ga0070660_100101583 | 3300005339 | Bacteria | 2279 |
| 15 | Ga0070660_100267373 | 3300005339 | Bacteria | 1397 |
| 16 | Ga0070689_100025741 | 3300005340 | Bacteria | 4423 |
| 17 | Ga0070687_100073685 | 3300005343 | Bacteria | 1841 |
| 18 | Ga0070661_100099533 | 3300005344 | Bacteria | 2161 |
| 19 | Ga0070668_100162092 | 3300005347 | Bacteria | 1815 |
| 20 | Ga0070668_100481940 | 3300005347 | Bacteria | 1071 |
| 21 | Ga0070669_100354794 | 3300005353 | Bacteria | 1191 |
| 22 | Ga0070675_100126160 | 3300005354 | Bacteria | 2177 |
| 23 | Ga0070671_100006478 | 3300005355 | Bacteria | 9359 |
| 24 | Ga0070671_100026508 | 3300005355 | Bacteria | 4764 |
| 25 | Ga0070671_100217596 | 3300005355 | Bacteria | 1620 |
| 26 | Ga0070671_100319021 | 3300005355 | Bacteria | 1324 |
| 27 | Ga0070673_100000565 | 3300005364 | Bacteria | 19960 |
| 28 | Ga0070688_100028600 | 3300005365 | Bacteria | 3329 |
| 29 | Ga0070688_100122280 | 3300005365 | Bacteria | 1745 |
| 30 | Ga0070659_100021832 | 3300005366 | Bacteria | 4881 |
| 31 | Ga0070659_100073113 | 3300005366 | Bacteria | 2729 |
| 32 | Ga0070667_100271451 | 3300005367 | Bacteria | 1521 |
| 33 | Ga0070667_100495000 | 3300005367 | Bacteria | 1120 |
| 34 | Ga0070709_10067759 | 3300005434 | Bacteria | 2293 |
| 35 | Ga0070713_100000018 | 3300005436 | Bacteria | 118409 |
| 36 | Ga0070701_10268942 | 3300005438 | Bacteria | 1036 |
| 37 | Ga0070705_100053620 | 3300005440 | Bacteria | 2361 |
| 38 | Ga0070700_100061033 | 3300005441 | Bacteria | 2378 |
| 39 | Ga0070700_100408252 | 3300005441 | Bacteria | 1023 |
| 40 | Ga0070663_100016718 | 3300005455 | Bacteria | 4773 |
| 41 | Ga0070663_100145868 | 3300005455 | Bacteria | 1811 |
| 42 | Ga0070678_100033489 | 3300005456 | Bacteria | 3568 |
| 43 | Ga0070678_100105335 | 3300005456 | Bacteria | 2195 |
| 44 | Ga0070678_100358743 | 3300005456 | Bacteria | 1255 |
| 45 | Ga0070662_100009332 | 3300005457 | Bacteria | 6411 |
| 46 | Ga0068867_100511421 | 3300005459 | Bacteria | 1034 |
| 47 | Ga0070684_100187428 | 3300005535 | Bacteria | 1882 |
| 48 | Ga0070684_100246593 | 3300005535 | Bacteria | 1632 |
| 49 | Ga0070697_100318943 | 3300005536 | Bacteria | 1338 |
| 50 | Ga0068853_100024317 | 3300005539 | Bacteria | 5078 |
| 51 | Ga0068853_100036539 | 3300005539 | Bacteria | 4178 |
| 52 | Ga0068853_100194162 | 3300005539 | Bacteria | 1845 |
| 53 | Ga0070672_100079213 | 3300005543 | Bacteria | 2629 |
| 54 | Ga0070695_100003910 | 3300005545 | Bacteria | 8701 |
| 55 | Ga0070695_100051176 | 3300005545 | Bacteria | 2649 |
| 56 | Ga0070693_100021913 | 3300005547 | Bacteria | 3391 |
| 57 | Ga0070693_100539808 | 3300005547 | Bacteria | 833 |
| 58 | Ga0070665_100737848 | 3300005548 | Bacteria | 998 |
| 59 | Ga0068855_100113957 | 3300005563 | Bacteria | 3101 |
| 60 | Ga0070664_100036084 | 3300005564 | Bacteria | 4152 |
| 61 | Ga0070664_100223984 | 3300005564 | Bacteria | 1683 |
| 62 | Ga0070664_100237260 | 3300005564 | Bacteria | 1636 |
| 63 | Ga0070664_100583661 | 3300005564 | Bacteria | 1036 |
| 64 | Ga0068857_100215387 | 3300005577 | Bacteria | 1753 |
| 65 | Ga0068854_100036313 | 3300005578 | Bacteria | 3454 |
| 66 | Ga0068854_100272677 | 3300005578 | Bacteria | 1359 |
| 67 | Ga0068856_100464173 | 3300005614 | Bacteria | 1287 |
| 68 | Ga0070702_100315434 | 3300005615 | Bacteria | 1087 |
| 69 | Ga0070702_100320675 | 3300005615 | Bacteria | 1080 |
| 70 | Ga0070702_100388435 | 3300005615 | Bacteria | 995 |
| 71 | Ga0070702_100664462 | 3300005615 | Bacteria | 790 |
| 72 | Ga0068852_100003539 | 3300005616 | Bacteria | 10932 |
| 73 | Ga0068852_100185607 | 3300005616 | Bacteria | 1958 |
| 74 | Ga0068852_101128452 | 3300005616 | Bacteria | 804 |
| 75 | Ga0068852_101276504 | 3300005616 | Bacteria | 756 |
| 76 | Ga0068859_100018952 | 3300005617 | Bacteria | 6912 |
| 77 | Ga0068859_100427888 | 3300005617 | Bacteria | 1420 |
| 78 | Ga0068864_100028552 | 3300005618 | Bacteria | 4718 |
| 79 | Ga0068864_100255449 | 3300005618 | Bacteria | 1628 |
| 80 | Ga0068864_100365293 | 3300005618 | Bacteria | 1365 |
| 81 | Ga0068864_100424629 | 3300005618 | Bacteria | 1267 |
| 82 | Ga0068866_10157190 | 3300005718 | Bacteria | 1322 |
| 83 | Ga0068861_100538062 | 3300005719 | Bacteria | 1062 |
| 84 | Ga0068863_100393968 | 3300005841 | Bacteria | 1354 |
| 85 | Ga0068863_100461975 | 3300005841 | Bacteria | 1247 |
| 86 | Ga0068858_100198178 | 3300005842 | Bacteria | 1898 |
| 87 | Ga0068858_100270442 | 3300005842 | Bacteria | 1617 |
| 88 | Ga0068860_100217511 | 3300005843 | Bacteria | 1855 |
| 89 | Ga0068860_100374357 | 3300005843 | Bacteria | 1405 |
| 90 | Ga0068860_100982512 | 3300005843 | Bacteria | 862 |
| 91 | Ga0081455_10001692 | 3300005937 | Bacteria | 26689 |
| 92 | Ga0081455_10006720 | 3300005937 | Bacteria | 12287 |
| 93 | Ga0081455_10023358 | 3300005937 | Bacteria | 5756 |
| 94 | Ga0081455_10028216 | 3300005937 | Bacteria | 5131 |
| 95 | Ga0081455_10452163 | 3300005937 | Bacteria | 877 |
| 96 | Ga0081538_10021664 | 3300005981 | Bacteria | 4680 |
| 97 | Ga0081540_1000131 | 3300005983 | Bacteria | 79958 |
| 98 | Ga0081540_1001103 | 3300005983 | Bacteria | 23924 |
| 99 | Ga0070717_10039203 | 3300006028 | Bacteria | 3854 |
| 100 | Ga0070717_10163376 | 3300006028 | Bacteria | 1933 |
| 101 | Ga0070717_10465900 | 3300006028 | Bacteria | 1140 |
| 102 | Ga0075365_10143705 | 3300006038 | Bacteria | 1657 |
| 103 | Ga0075368_10218837 | 3300006042 | Bacteria | 809 |
| 104 | Ga0070715_10353193 | 3300006163 | Bacteria | 803 |
| 105 | Ga0070712_100076186 | 3300006175 | Bacteria | 2415 |
| 106 | Ga0070712_100281015 | 3300006175 | Bacteria | 1341 |
| 107 | Ga0075367_10327369 | 3300006178 | Bacteria | 966 |
| 108 | Ga0075366_10199338 | 3300006195 | Bacteria | 1217 |
| 109 | Ga0097621_100183889 | 3300006237 | Bacteria | 1807 |
| 110 | Ga0075428_100006609 | 3300006844 | Bacteria | 12899 |
| 111 | Ga0075428_100401283 | 3300006844 | Bacteria | 1469 |
| 112 | Ga0075430_100095837 | 3300006846 | Bacteria | 2480 |
| 113 | Ga0075430_100149830 | 3300006846 | Bacteria | 1943 |
| 114 | Ga0075430_100485094 | 3300006846 | Bacteria | 1020 |
| 115 | Ga0075431_100000643 | 3300006847 | Bacteria | 29600 |
| 116 | Ga0075431_100030068 | 3300006847 | Bacteria | 5593 |
| 117 | Ga0075431_100168200 | 3300006847 | Bacteria | 2253 |
| 118 | Ga0075431_100264321 | 3300006847 | Bacteria | 1745 |
| 119 | Ga0075431_100302961 | 3300006847 | Bacteria | 1614 |
| 120 | Ga0075431_100384007 | 3300006847 | Bacteria | 1408 |
| 121 | Ga0075433_10056706 | 3300006852 | Bacteria | 3423 |
| 122 | Ga0075433_10108629 | 3300006852 | Bacteria | 2460 |
| 123 | Ga0075433_10619259 | 3300006852 | Unclassified | 950 |
| 124 | Ga0075434_100005496 | 3300006871 | Bacteria | 11543 |
| 125 | Ga0075434_100177508 | 3300006871 | Bacteria | 2150 |
| 126 | Ga0075434_100397744 | 3300006871 | Bacteria | 1399 |
| 127 | Ga0075429_100192489 | 3300006880 | Bacteria | 1787 |
| 128 | Ga0075429_100259240 | 3300006880 | Bacteria | 1522 |
| 129 | Ga0075429_100291529 | 3300006880 | Bacteria | 1429 |
| 130 | Ga0097620_100018951 | 3300006931 | Bacteria | 6912 |
| 131 | Ga0097620_100427878 | 3300006931 | Bacteria | 1420 |
| 132 | Ga0075435_100413526 | 3300007076 | Bacteria | 1161 |
| 133 | Ga0075435_100779528 | 3300007076 | Bacteria | 832 |
| 134 | Ga0105244_10045266 | 3300009036 | Bacteria | 2264 |
| 135 | Ga0105240_10099553 | 3300009093 | Bacteria | 3538 |
| 136 | Ga0105240_10258211 | 3300009093 | Bacteria | 2011 |
| 137 | Ga0105240_10941076 | 3300009093 | Bacteria | 927 |
| 138 | Ga0111539_10011405 | 3300009094 | Bacteria | 11155 |
| 139 | Ga0111539_10026569 | 3300009094 | Bacteria | 7078 |
| 140 | Ga0111539_10308395 | 3300009094 | Bacteria | 1842 |
| 141 | Ga0111539_10369263 | 3300009094 | Bacteria | 1670 |
| 142 | Ga0105245_10008565 | 3300009098 | Bacteria | 8924 |
| 143 | Ga0105245_10037826 | 3300009098 | Bacteria | 4291 |
| 144 | Ga0114129_10000005 | 3300009147 | Bacteria | 159906 |
| 145 | Ga0114129_10003291 | 3300009147 | Bacteria | 22689 |
| 146 | Ga0114129_10020071 | 3300009147 | Bacteria | 9511 |
| 147 | Ga0114129_10025414 | 3300009147 | Bacteria | 8391 |
| 148 | Ga0114129_10087690 | 3300009147 | Bacteria | 4315 |
| 149 | Ga0105243_10017638 | 3300009148 | Bacteria | 5399 |
| 150 | Ga0105243_10149864 | 3300009148 | Bacteria | 2000 |
| 151 | Ga0105242_10535860 | 3300009176 | Bacteria | 1120 |
| 152 | Ga0105248_10227482 | 3300009177 | Bacteria | 2100 |
| 153 | Ga0105248_10350550 | 3300009177 | Bacteria | 1662 |
| 154 | Ga0105237_10067517 | 3300009545 | Bacteria | 3569 |
| 155 | Ga0105238_10004063 | 3300009551 | Bacteria | 14505 |
| 156 | Ga0105239_10154133 | 3300010375 | Bacteria | 2565 |
| 157 | Ga0105239_10193306 | 3300010375 | Bacteria | 2278 |
| 158 | Ga0105239_10674463 | 3300010375 | Bacteria | 1181 |
| 159 | Ga0105239_11113635 | 3300010375 | Bacteria | 909 |
| 160 | Ga0105246_10051869 | 3300011119 | Bacteria | 2818 |
| 161 | Ga0105246_10113164 | 3300011119 | Bacteria | 1998 |
| 162 | Ga0105246_10374663 | 3300011119 | Bacteria | 1174 |
| 163 | Ga0157369_10000568 | 3300013105 | Bacteria | 48608 |
| 164 | Ga0157369_10426691 | 3300013105 | Bacteria | 1374 |
| 165 | Ga0157374_10051753 | 3300013296 | Bacteria | 3822 |
| 166 | Ga0157378_10003059 | 3300013297 | Bacteria | 14866 |
| 167 | Ga0157378_10484855 | 3300013297 | Bacteria | 1232 |
| 168 | Ga0157378_10813299 | 3300013297 | Bacteria | 961 |
| 169 | Ga0163162_10000030 | 3300013306 | Bacteria | 163717 |
| 170 | Ga0163162_10059459 | 3300013306 | Bacteria | 3854 |
| 171 | Ga0163162_10217043 | 3300013306 | Bacteria | 2043 |
| 172 | Ga0163162_10515198 | 3300013306 | Bacteria | 1326 |
| 173 | Ga0157375_10015972 | 3300013308 | Bacteria | 6734 |
| 174 | Ga0157375_10204426 | 3300013308 | Bacteria | 2131 |
| 175 | Ga0157375_10284173 | 3300013308 | Bacteria | 1818 |
| 176 | Ga0163163_10155517 | 3300014325 | Bacteria | 2331 |
| 177 | Ga0163163_10321094 | 3300014325 | Bacteria | 1602 |
| 178 | Ga0157380_10017716 | 3300014326 | Bacteria | 5275 |
| 179 | Ga0157380_11038648 | 3300014326 | Bacteria | 855 |
| 180 | Ga0182007_10082125 | 3300015262 | Bacteria | 1057 |
| 181 | Ga0163161_10099463 | 3300017792 | Bacteria | 2163 |
| 182 | Ga0163161_10117066 | 3300017792 | Bacteria | 1998 |
| 183 | Ga0213872_10009729 | 3300021361 | Bacteria | 4599 |
| 184 | Ga0209675_1011334 | 3300025291 | Bacteria | 2964 |
| 185 | Ga0207655_1045445 | 3300025728 | Bacteria | 1833 |
| 186 | Ga0207710_10024189 | 3300025900 | Bacteria | 2614 |
| 187 | Ga0207647_10039265 | 3300025904 | Bacteria | 2988 |
| 188 | Ga0207685_10085839 | 3300025905 | Bacteria | 1314 |
| 189 | Ga0207695_10405239 | 3300025913 | Bacteria | 1248 |
| 190 | Ga0207695_10514873 | 3300025913 | Bacteria | 1078 |
| 191 | Ga0207693_10009123 | 3300025915 | Bacteria | 8097 |
| 192 | Ga0207663_10502352 | 3300025916 | Bacteria | 942 |
| 193 | Ga0207663_10597752 | 3300025916 | Bacteria | 867 |
| 194 | Ga0207660_10184070 | 3300025917 | Bacteria | 1624 |
| 195 | Ga0207660_10242260 | 3300025917 | Bacteria | 1421 |
| 196 | Ga0207662_10160923 | 3300025918 | Bacteria | 1434 |
| 197 | Ga0207657_10141430 | 3300025919 | Bacteria | 1966 |
| 198 | Ga0207657_10169987 | 3300025919 | Bacteria | 1767 |
| 199 | Ga0207657_10174470 | 3300025919 | Bacteria | 1740 |
| 200 | Ga0207649_10057297 | 3300025920 | Bacteria | 2436 |
| 201 | Ga0207649_10169045 | 3300025920 | Bacteria | 1521 |
| 202 | Ga0207694_10062231 | 3300025924 | Bacteria | 2906 |
| 203 | Ga0207694_10333868 | 3300025924 | Bacteria | 1253 |
| 204 | Ga0207650_10003725 | 3300025925 | Bacteria | 10426 |
| 205 | Ga0207650_10066576 | 3300025925 | Bacteria | 2702 |
| 206 | Ga0207650_10691554 | 3300025925 | Bacteria | 861 |
| 207 | Ga0207700_10000862 | 3300025928 | Bacteria | 17453 |
| 208 | Ga0207700_10224361 | 3300025928 | Bacteria | 1594 |
| 209 | Ga0207644_10004575 | 3300025931 | Bacteria | 8996 |
| 210 | Ga0207644_10030476 | 3300025931 | Bacteria | 3752 |
| 211 | Ga0207644_10070496 | 3300025931 | Bacteria | 2555 |
| 212 | Ga0207690_10103829 | 3300025932 | Bacteria | 2035 |
| 213 | Ga0207690_10279566 | 3300025932 | Bacteria | 1299 |
| 214 | Ga0207706_10019690 | 3300025933 | Bacteria | 6071 |
| 215 | Ga0207706_10042515 | 3300025933 | Bacteria | 4027 |
| 216 | Ga0207706_10180673 | 3300025933 | Bacteria | 1853 |
| 217 | Ga0207686_10052683 | 3300025934 | Bacteria | 2541 |
| 218 | Ga0207709_10016316 | 3300025935 | Bacteria | 4127 |
| 219 | Ga0207669_10124670 | 3300025937 | Bacteria | 1757 |
| 220 | Ga0207691_10074932 | 3300025940 | Bacteria | 3052 |
| 221 | Ga0207691_10139812 | 3300025940 | Bacteria | 2134 |
| 222 | Ga0207711_10749260 | 3300025941 | Bacteria | 910 |
| 223 | Ga0207689_10785509 | 3300025942 | Bacteria | 804 |
| 224 | Ga0207679_10018224 | 3300025945 | Bacteria | 4700 |
| 225 | Ga0207679_10268792 | 3300025945 | Bacteria | 1457 |
| 226 | Ga0207667_10062740 | 3300025949 | Bacteria | 3885 |
| 227 | Ga0207651_10001165 | 3300025960 | Bacteria | 11771 |
| 228 | Ga0207651_10468567 | 3300025960 | Bacteria | 1084 |
| 229 | Ga0207668_10202714 | 3300025972 | Bacteria | 1581 |
| 230 | Ga0207658_10102703 | 3300025986 | Bacteria | 2243 |
| 231 | Ga0207639_10030986 | 3300026041 | Bacteria | 3928 |
| 232 | Ga0207678_10046727 | 3300026067 | Bacteria | 3744 |
| 233 | Ga0207678_10108307 | 3300026067 | Bacteria | 2370 |
| 234 | Ga0207708_10090760 | 3300026075 | Bacteria | 2355 |
| 235 | Ga0207708_10140132 | 3300026075 | Bacteria | 1896 |
| 236 | Ga0207702_10113310 | 3300026078 | Bacteria | 2415 |
| 237 | Ga0207641_10177586 | 3300026088 | Bacteria | 1948 |
| 238 | Ga0207641_10546738 | 3300026088 | Bacteria | 1129 |
| 239 | Ga0207641_10595044 | 3300026088 | Bacteria | 1082 |
| 240 | Ga0207648_10058232 | 3300026089 | Bacteria | 3370 |
| 241 | Ga0207675_100046206 | 3300026118 | Bacteria | 4066 |
| 242 | Ga0207683_10324269 | 3300026121 | Bacteria | 1411 |
| 243 | Ga0207698_10001815 | 3300026142 | Bacteria | 12474 |
| 244 | Ga0207698_10060728 | 3300026142 | Bacteria | 2941 |
| 245 | Ga0209983_1059894 | 3300027665 | Bacteria | 840 |
| 246 | Ga0209998_10008920 | 3300027717 | Bacteria | 2075 |
| 247 | Ga0209974_10050086 | 3300027876 | Bacteria | 1402 |
| 248 | Ga0207428_10025907 | 3300027907 | Bacteria | 4900 |
| 249 | Ga0207428_10078757 | 3300027907 | Bacteria | 2578 |
| 250 | Ga0268266_10782858 | 3300028379 | Bacteria | 921 |
| 251 | Ga0268264_11303933 | 3300028381 | Bacteria | 736 |
| 252 | Ga0307416_100220057 | 3300032002 | Bacteria | 1820 |
| 253 | Ga0373959_0077040 | 3300034820 | Bacteria | 762 |
| 254 | Ga0373934_0048105 | 3300035086 | Bacteria | 1688 |
| 255 | Ga0373952_0089129 | 3300035092 | Bacteria | 799 |
| 256 | Ga0373936_0032368 | 3300035113 | Bacteria | 2068 |
| 257 | Ga0373939_0038381 | 3300035114 | Bacteria | 1428 |
| 258 | Ga0373945_0057468 | 3300035116 | Bacteria | 1445 |
| 259 | Ga0373954_0028364 | 3300035118 | Bacteria | 2573 |
| 260 | Ga0373956_0045489 | 3300035119 | Bacteria | 1959 |
| 261 | Ga0373924_0020099 | 3300035410 | Bacteria | 2592 |
| 262 | Ga0373931_0032115 | 3300035691 | Bacteria | 2715 |
| 263 | Ga0373931_0136528 | 3300035691 | Bacteria | 1416 |
| 264 | Ga0373935_0005742 | 3300035692 | Bacteria | 7335 |
| 265 | Ga0373927_0126076 | 3300035695 | Bacteria | 1671 |
| 266 | Ga0373927_0126770 | 3300035695 | Unclassified | 1667 |
| 267 | Ga0373927_0157074 | 3300035695 | Bacteria | 1490 |
| 268 | Ga0373927_0201596 | 3300035695 | Bacteria | 1306 |
| 269 | Ga0373933_0288857 | 3300035724 | Bacteria | 1060 |
| 270 | Ga0373933_0318732 | 3300035724 | Bacteria | 1008 |
| 271 | Ga0373947_0067248 | 3300035725 | Bacteria | 2188 |
| 272 | Ga0373947_0079147 | 3300035725 | Bacteria | 2031 |
| 273 | Ga0373947_0341992 | 3300035725 | Bacteria | 1003 |
| 274 | Ga0373937_0009924 | 3300036401 | Bacteria | 8303 |
| 275 | Ga0373937_0018239 | 3300036401 | Bacteria | 6263 |
| 276 | Ga0373937_0147367 | 3300036401 | Bacteria | 2204 |
| 277 | Ga0373925_0010617 | 3300037068 | Bacteria | 6677 |
| 278 | Ga0373925_0178033 | 3300037068 | Bacteria | 1682 |
| 279 | Ga0373925_0260253 | 3300037068 | Bacteria | 1394 |
| 280 | Ga0373925_0532099 | 3300037068 | Bacteria | 966 |
| 281 | Ga0395899_0003912 | 3300037312 | Bacteria | 11741 |
| 282 | Ga0395899_0011242 | 3300037312 | Bacteria | 6857 |
| 283 | Ga0395900_0001162 | 3300037418 | Bacteria | 32955 |
| 284 | Ga0395900_0020459 | 3300037418 | Bacteria | 6755 |
| 285 | Ga0395900_0095252 | 3300037418 | Bacteria | 3059 |
| 286 | Ga0395898_0003358 | 3300037466 | Bacteria | 17956 |
| 287 | Ga0395898_0207938 | 3300037466 | Bacteria | 1867 |
| 288 | Ga0395905_0004279 | 3300037471 | Bacteria | 14891 |
| 289 | Ga0395905_0045702 | 3300037471 | Bacteria | 4107 |
| 290 | Ga0395905_0075128 | 3300037471 | Bacteria | 3167 |
| 291 | Ga0395901_0011447 | 3300038443 | Bacteria | 8989 |
| 292 | Ga0395901_0102801 | 3300038443 | Bacteria | 2998 |
| 293 | Ga0395901_0175269 | 3300038443 | Bacteria | 2249 |
| 294 | Ga0436365_0850419 | 3300039437 | Bacteria | 1650 |
| 295 | Ga0436365_1807606 | 3300039437 | Bacteria | 2175 |
| 296 | Ga0436360_1125811 | 3300039438 | Bacteria | 2237 |
| 297 | Ga0436360_1217870 | 3300039438 | Bacteria | 749 |
| 298 | Ga0436361_0609746 | 3300039447 | Bacteria | 7310 |
| 299 | Ga0436362_0569831 | 3300039453 | Bacteria | 3862 |
| 300 | Ga0439449_0027200 | 3300042007 | Bacteria | 2134 |
| 301 | Ga0439450_020227 | 3300042008 | Bacteria | 1419 |
| 302 | Ga0439456_073105 | 3300042013 | Bacteria | 761 |
| 303 | Ga0439458_0033391 | 3300042157 | Bacteria | 1232 |
| 304 | Ga0451577_0000058 | 3300042876 | Bacteria | 272673 |
| 305 | Ga0451577_0176431 | 3300042876 | Bacteria | 1926 |
| 306 | Ga0453683_0198163 | 3300044673 | Bacteria | 1275 |
| 307 | Ga0466963_0194557 | 3300044694 | Bacteria | 1417 |
| 308 | Ga0466964_0012665 | 3300044706 | Bacteria | 3193 |
| 309 | Ga0453684_0000279 | 3300044712 | Bacteria | 220016 |
| 310 | Ga0466957_0035583 | 3300044842 | Bacteria | 2988 |
| 311 | Ga0466957_0268617 | 3300044842 | Bacteria | 1138 |
| 312 | Ga0451576_0001134 | 3300045051 | Bacteria | 48176 |
| 313 | Ga0451576_0148203 | 3300045051 | Bacteria | 2447 |
| 314 | Ga0466967_0001201 | 3300045976 | Bacteria | 14568 |
| 315 | Ga0466967_0005963 | 3300045976 | Bacteria | 8551 |
| 316 | Ga0495617_000786 | 3300046452 | Bacteria | 15345 |
| 317 | Ga0495617_000885 | 3300046452 | Bacteria | 14097 |
| 318 | Ga0495617_014560 | 3300046452 | Bacteria | 2673 |
| 319 | Ga0495627_000228 | 3300046453 | Bacteria | 59535 |
| 320 | Ga0495627_017161 | 3300046453 | Bacteria | 2465 |
| 321 | Ga0495627_022678 | 3300046453 | Bacteria | 2063 |
| 322 | Ga0495592_0036676 | 3300046454 | Bacteria | 3691 |
| 323 | Ga0495603_0221067 | 3300046455 | Bacteria | 1093 |
| 324 | Ga0495603_0441863 | 3300046455 | Bacteria | 745 |
| 325 | Ga0495590_0000064 | 3300046457 | Bacteria | 78742 |
| 326 | Ga0495590_0001552 | 3300046457 | Bacteria | 9862 |
| 327 | Ga0495591_000693 | 3300046458 | Bacteria | 24588 |
| 328 | Ga0495629_0025346 | 3300046459 | Bacteria | 4216 |
| 329 | Ga0495629_0037379 | 3300046459 | Bacteria | 3422 |
| 330 | Ga0495629_0070616 | 3300046459 | Bacteria | 2436 |
| 331 | Ga0495638_0071736 | 3300046460 | Bacteria | 2118 |
| 332 | Ga0495651_0022084 | 3300046462 | Bacteria | 4948 |
| 333 | Ga0495653_0006075 | 3300046463 | Bacteria | 9893 |
| 334 | Ga0495653_0023621 | 3300046463 | Bacteria | 4963 |
| 335 | Ga0495653_0051996 | 3300046463 | Bacteria | 3142 |
| 336 | Ga0495650_0007513 | 3300046471 | Bacteria | 6536 |
| 337 | Ga0495650_0056075 | 3300046471 | Bacteria | 1600 |
| 338 | Ga0495580_0259455 | 3300046472 | Bacteria | 1188 |
| 339 | Ga0495580_0468282 | 3300046472 | Bacteria | 844 |
| 340 | Ga0495582_0005640 | 3300046473 | Bacteria | 6968 |
| 341 | Ga0495582_0075300 | 3300046473 | Bacteria | 1869 |
| 342 | Ga0495582_0096509 | 3300046473 | Bacteria | 1652 |
| 343 | Ga0495582_0159364 | 3300046473 | Bacteria | 1283 |
| 344 | Ga0495605_0000046 | 3300046474 | Bacteria | 175985 |
| 345 | Ga0495605_0006069 | 3300046474 | Bacteria | 6980 |
| 346 | Ga0495605_0012885 | 3300046474 | Bacteria | 4627 |
| 347 | Ga0495605_0014950 | 3300046474 | Bacteria | 4232 |
| 348 | Ga0495605_0017171 | 3300046474 | Bacteria | 3903 |
| 349 | Ga0495605_0033647 | 3300046474 | Bacteria | 2599 |
| 350 | Ga0495605_0035670 | 3300046474 | Bacteria | 2512 |
| 351 | Ga0495605_0043161 | 3300046474 | Bacteria | 2236 |
| 352 | Ga0495605_0067924 | 3300046474 | Bacteria | 1690 |
| 353 | Ga0495664_0345477 | 3300046477 | Bacteria | 896 |
| 354 | Ga0495584_0000477 | 3300046491 | Bacteria | 27514 |
| 355 | Ga0495584_0001630 | 3300046491 | Bacteria | 13194 |
| 356 | Ga0495584_0002118 | 3300046491 | Bacteria | 11362 |
| 357 | Ga0495584_0003168 | 3300046491 | Bacteria | 9139 |
| 358 | Ga0495584_0014281 | 3300046491 | Bacteria | 4047 |
| 359 | Ga0495584_0015052 | 3300046491 | Bacteria | 3942 |
| 360 | Ga0495584_0110220 | 3300046491 | Bacteria | 1392 |
| 361 | Ga0495584_0205792 | 3300046491 | Bacteria | 1000 |
| 362 | Ga0495584_0216117 | 3300046491 | Bacteria | 974 |
| 363 | Ga0495584_0245404 | 3300046491 | Bacteria | 910 |
| 364 | Ga0495585_0000002 | 3300046492 | Bacteria | 529316 |
| 365 | Ga0495585_0000005 | 3300046492 | Bacteria | 328103 |
| 366 | Ga0495585_0000465 | 3300046492 | Bacteria | 38766 |
| 367 | Ga0495585_0003320 | 3300046492 | Bacteria | 10923 |
| 368 | Ga0495585_0014514 | 3300046492 | Bacteria | 4586 |
| 369 | Ga0495585_0015031 | 3300046492 | Bacteria | 4500 |
| 370 | Ga0495585_0018739 | 3300046492 | Bacteria | 3992 |
| 371 | Ga0495585_0026487 | 3300046492 | Bacteria | 3311 |
| 372 | Ga0495585_0047889 | 3300046492 | Bacteria | 2378 |
| 373 | Ga0495585_0134337 | 3300046492 | Bacteria | 1299 |
| 374 | Ga0495594_0076097 | 3300046499 | Bacteria | 1871 |
| 375 | Ga0495594_0216727 | 3300046499 | Bacteria | 1091 |
| 376 | Ga0495594_0453256 | 3300046499 | Bacteria | 729 |
| 377 | Ga0495596_0000761 | 3300046500 | Bacteria | 19650 |
| 378 | Ga0495596_0000846 | 3300046500 | Bacteria | 18508 |
| 379 | Ga0495596_0001991 | 3300046500 | Bacteria | 11245 |
| 380 | Ga0495596_0003288 | 3300046500 | Bacteria | 8248 |
| 381 | Ga0495596_0003589 | 3300046500 | Bacteria | 7810 |
| 382 | Ga0495596_0005147 | 3300046500 | Bacteria | 6226 |
| 383 | Ga0495596_0013374 | 3300046500 | Bacteria | 3484 |
| 384 | Ga0495596_0019781 | 3300046500 | Bacteria | 2762 |
| 385 | Ga0495596_0067532 | 3300046500 | Bacteria | 1389 |
| 386 | Ga0495596_0101477 | 3300046500 | Bacteria | 1117 |
| 387 | Ga0495596_0112294 | 3300046500 | Bacteria | 1058 |
| 388 | Ga0495607_0000990 | 3300046501 | Bacteria | 26238 |
| 389 | Ga0495607_0001168 | 3300046501 | Bacteria | 23749 |
| 390 | Ga0495607_0001230 | 3300046501 | Bacteria | 22982 |
| 391 | Ga0495607_0013244 | 3300046501 | Bacteria | 5412 |
| 392 | Ga0495607_0015069 | 3300046501 | Bacteria | 5020 |
| 393 | Ga0495607_0052992 | 3300046501 | Bacteria | 2347 |
| 394 | Ga0495607_0067429 | 3300046501 | Bacteria | 2010 |
| 395 | Ga0495607_0122704 | 3300046501 | Bacteria | 1361 |
| 396 | Ga0495583_0000142 | 3300046506 | Bacteria | 121513 |
| 397 | Ga0495583_0000870 | 3300046506 | Bacteria | 36655 |
| 398 | Ga0495583_0012652 | 3300046506 | Bacteria | 4756 |
| 399 | Ga0495583_0015633 | 3300046506 | Bacteria | 4117 |
| 400 | Ga0495583_0015824 | 3300046506 | Bacteria | 4083 |
| 401 | Ga0495583_0023203 | 3300046506 | Bacteria | 3144 |
| 402 | Ga0495583_0023953 | 3300046506 | Bacteria | 3077 |
| 403 | Ga0495606_0009814 | 3300046507 | Bacteria | 8043 |
| 404 | Ga0495606_0011711 | 3300046507 | Bacteria | 7119 |
| 405 | Ga0495606_0033339 | 3300046507 | Bacteria | 3553 |
| 406 | Ga0495606_0070361 | 3300046507 | Bacteria | 2207 |
| 407 | Ga0495606_0071043 | 3300046507 | Bacteria | 2193 |
| 408 | Ga0495606_0079985 | 3300046507 | Bacteria | 2035 |
| 409 | Ga0495608_0004179 | 3300046511 | Bacteria | 10354 |
| 410 | Ga0495610_0002844 | 3300046512 | Bacteria | 14083 |
| 411 | Ga0495610_0079635 | 3300046512 | Bacteria | 1508 |
| 412 | Ga0495616_0003309 | 3300046513 | Bacteria | 10352 |
| 413 | Ga0495616_0006917 | 3300046513 | Bacteria | 6829 |
| 414 | Ga0495616_0007782 | 3300046513 | Bacteria | 6396 |
| 415 | Ga0495616_0008643 | 3300046513 | Bacteria | 6012 |
| 416 | Ga0495616_0009929 | 3300046513 | Bacteria | 5534 |
| 417 | Ga0495616_0018617 | 3300046513 | Bacteria | 3807 |
| 418 | Ga0495616_0026407 | 3300046513 | Bacteria | 3091 |
| 419 | Ga0495616_0034366 | 3300046513 | Bacteria | 2633 |
| 420 | Ga0495616_0041717 | 3300046513 | Bacteria | 2339 |
| 421 | Ga0495616_0063351 | 3300046513 | Bacteria | 1807 |
| 422 | Ga0495616_0149123 | 3300046513 | Bacteria | 1059 |
| 423 | Ga0495618_0015786 | 3300046514 | Bacteria | 4610 |
| 424 | Ga0495618_0129716 | 3300046514 | Bacteria | 1613 |
| 425 | Ga0495628_0037933 | 3300046516 | Bacteria | 3861 |
| 426 | Ga0495631_0000684 | 3300046518 | Bacteria | 21916 |
| 427 | Ga0495631_0000930 | 3300046518 | Bacteria | 18224 |
| 428 | Ga0495631_0006519 | 3300046518 | Bacteria | 6021 |
| 429 | Ga0495631_0009092 | 3300046518 | Bacteria | 4977 |
| 430 | Ga0495631_0015981 | 3300046518 | Bacteria | 3586 |
| 431 | Ga0495631_0026647 | 3300046518 | Bacteria | 2651 |
| 432 | Ga0495631_0053748 | 3300046518 | Bacteria | 1757 |
| 433 | Ga0495631_0065248 | 3300046518 | Bacteria | 1575 |
| 434 | Ga0495631_0072321 | 3300046518 | Bacteria | 1489 |
| 435 | Ga0495631_0092994 | 3300046518 | Bacteria | 1298 |
| 436 | Ga0495631_0106792 | 3300046518 | Bacteria | 1203 |
| 437 | Ga0495632_0000025 | 3300046519 | Bacteria | 176815 |
| 438 | Ga0495632_0000385 | 3300046519 | Bacteria | 42145 |
| 439 | Ga0495632_0003811 | 3300046519 | Bacteria | 10511 |
| 440 | Ga0495632_0007682 | 3300046519 | Bacteria | 6733 |
| 441 | Ga0495632_0010482 | 3300046519 | Bacteria | 5484 |
| 442 | Ga0495632_0049842 | 3300046519 | Bacteria | 2068 |
| 443 | Ga0495632_0131764 | 3300046519 | Bacteria | 1163 |
| 444 | Ga0495637_0000012 | 3300046520 | Bacteria | 273124 |
| 445 | Ga0495637_0042822 | 3300046520 | Bacteria | 1935 |
| 446 | Ga0495643_0000777 | 3300046522 | Bacteria | 35586 |
| 447 | Ga0495643_0004916 | 3300046522 | Bacteria | 9186 |
| 448 | Ga0495643_0013001 | 3300046522 | Bacteria | 5000 |
| 449 | Ga0495643_0013462 | 3300046522 | Bacteria | 4892 |
| 450 | Ga0495643_0046976 | 3300046522 | Bacteria | 2339 |
| 451 | Ga0495643_0086008 | 3300046522 | Bacteria | 1629 |
| 452 | Ga0495644_0002439 | 3300046523 | Bacteria | 7424 |
| 453 | Ga0495644_0003268 | 3300046523 | Bacteria | 6408 |
| 454 | Ga0495644_0007890 | 3300046523 | Bacteria | 4100 |
| 455 | Ga0495644_0012914 | 3300046523 | Bacteria | 3211 |
| 456 | Ga0495644_0029568 | 3300046523 | Bacteria | 2070 |
| 457 | Ga0495644_0059103 | 3300046523 | Bacteria | 1441 |
| 458 | Ga0495644_0060826 | 3300046523 | Bacteria | 1419 |
| 459 | Ga0495644_0106669 | 3300046523 | Bacteria | 1061 |
| 460 | Ga0495644_0183741 | 3300046523 | Bacteria | 804 |
| 461 | Ga0495648_0000012 | 3300046524 | Bacteria | 294111 |
| 462 | Ga0495648_0000033 | 3300046524 | Bacteria | 199184 |
| 463 | Ga0495648_0000815 | 3300046524 | Bacteria | 32978 |
| 464 | Ga0495648_0001398 | 3300046524 | Bacteria | 23712 |
| 465 | Ga0495648_0001851 | 3300046524 | Bacteria | 20287 |
| 466 | Ga0495648_0006112 | 3300046524 | Bacteria | 9872 |
| 467 | Ga0495648_0015762 | 3300046524 | Bacteria | 5469 |
| 468 | Ga0495648_0120225 | 3300046524 | Bacteria | 1413 |
| 469 | Ga0495648_0203452 | 3300046524 | Bacteria | 989 |
| 470 | Ga0495642_0000013 | 3300046528 | Bacteria | 123896 |
| 471 | Ga0495642_0001210 | 3300046528 | Bacteria | 11866 |
| 472 | Ga0495642_0019203 | 3300046528 | Bacteria | 2678 |
| 473 | Ga0495642_0020522 | 3300046528 | Bacteria | 2595 |
| 474 | Ga0495642_0030247 | 3300046528 | Bacteria | 2166 |
| 475 | Ga0495652_0007816 | 3300046529 | Bacteria | 9822 |
| 476 | Ga0495652_0008927 | 3300046529 | Bacteria | 9122 |
| 477 | Ga0495652_0065238 | 3300046529 | Bacteria | 3060 |
| 478 | Ga0495654_0004974 | 3300046530 | Bacteria | 7808 |
| 479 | Ga0495654_0008857 | 3300046530 | Bacteria | 5533 |
| 480 | Ga0495654_0098230 | 3300046530 | Bacteria | 1351 |
| 481 | Ga0495665_0011059 | 3300046531 | Bacteria | 4884 |
| 482 | Ga0495665_0120738 | 3300046531 | Bacteria | 1372 |
| 483 | Ga0495665_0166405 | 3300046531 | Bacteria | 1148 |
| 484 | Ga0495640_0047233 | 3300046533 | Bacteria | 2980 |
| 485 | Ga0495586_0013119 | 3300046535 | Bacteria | 4392 |
| 486 | Ga0495586_0014286 | 3300046535 | Bacteria | 4218 |
| 487 | Ga0495586_0296058 | 3300046535 | Bacteria | 927 |
| 488 | Ga0495587_0013628 | 3300046536 | Bacteria | 5108 |
| 489 | Ga0495587_0031666 | 3300046536 | Bacteria | 3200 |
| 490 | Ga0495598_0029099 | 3300046537 | Bacteria | 1537 |
| 491 | Ga0495609_0000877 | 3300046538 | Bacteria | 22038 |
| 492 | Ga0495609_0005910 | 3300046538 | Bacteria | 6324 |
| 493 | Ga0495609_0021179 | 3300046538 | Bacteria | 2999 |
| 494 | Ga0495609_0052907 | 3300046538 | Bacteria | 1806 |
| 495 | Ga0495609_0080474 | 3300046538 | Bacteria | 1424 |
| 496 | Ga0495609_0089220 | 3300046538 | Bacteria | 1341 |
| 497 | Ga0495609_0117478 | 3300046538 | Bacteria | 1145 |
| 498 | Ga0495609_0155008 | 3300046538 | Bacteria | 973 |
| 499 | Ga0495609_0167340 | 3300046538 | Bacteria | 929 |
| 500 | Ga0495597_0000199 | 3300046542 | Bacteria | 55011 |
| 501 | Ga0495597_0008921 | 3300046542 | Bacteria | 5002 |
| 502 | Ga0495597_0020490 | 3300046542 | Bacteria | 3079 |
| 503 | Ga0495597_0027562 | 3300046542 | Bacteria | 2604 |
| 504 | Ga0495597_0039119 | 3300046542 | Bacteria | 2125 |
| 505 | Ga0495597_0048227 | 3300046542 | Bacteria | 1884 |
| 506 | Ga0495597_0063659 | 3300046542 | Bacteria | 1603 |
| 507 | Ga0495597_0071610 | 3300046542 | Bacteria | 1492 |
| 508 | Ga0495597_0216148 | 3300046542 | Bacteria | 763 |
| 509 | Ga0495622_0009227 | 3300046557 | Bacteria | 4565 |
| 510 | Ga0495622_0037352 | 3300046557 | Bacteria | 2262 |
| 511 | Ga0495622_0193334 | 3300046557 | Bacteria | 909 |
| 512 | Ga0495633_0001969 | 3300046558 | Bacteria | 14884 |
| 513 | Ga0495633_0008397 | 3300046558 | Bacteria | 5826 |
| 514 | Ga0495633_0037882 | 3300046558 | Bacteria | 2305 |
| 515 | Ga0495633_0045305 | 3300046558 | Bacteria | 2083 |
| 516 | Ga0495667_0057487 | 3300046559 | Bacteria | 2556 |
| 517 | Ga0495656_0033213 | 3300046615 | Bacteria | 2105 |
| 518 | Ga0495656_0191331 | 3300046615 | Bacteria | 1011 |
| 519 | Ga0495656_0321678 | 3300046615 | Bacteria | 797 |
| 520 | Ga0495668_0000131 | 3300046616 | Bacteria | 112755 |
| 521 | Ga0495668_0000373 | 3300046616 | Bacteria | 59298 |
| 522 | Ga0495668_0025241 | 3300046616 | Bacteria | 3377 |
| 523 | Ga0495668_0069991 | 3300046616 | Bacteria | 1929 |
| 524 | Ga0495668_0100378 | 3300046616 | Bacteria | 1583 |
| 525 | Ga0495668_0109577 | 3300046616 | Bacteria | 1510 |
| 526 | Ga0495634_0054889 | 3300046642 | Bacteria | 2665 |
| 527 | Ga0495634_0073627 | 3300046642 | Bacteria | 2246 |
| 528 | Ga0495611_0000207 | 3300046648 | Bacteria | 41561 |
| 529 | Ga0495611_0002813 | 3300046648 | Bacteria | 7785 |
| 530 | Ga0495611_0004328 | 3300046648 | Bacteria | 6160 |
| 531 | Ga0495611_0027329 | 3300046648 | Bacteria | 2493 |
| 532 | Ga0495611_0028607 | 3300046648 | Bacteria | 2441 |
| 533 | Ga0495611_0214715 | 3300046648 | Bacteria | 895 |
| 534 | Ga0495611_0231193 | 3300046648 | Bacteria | 859 |
| 535 | Ga0495625_0074314 | 3300046660 | Bacteria | 2381 |
| 536 | Ga0495625_0125002 | 3300046660 | Bacteria | 1747 |
| 537 | Ga0495625_0125927 | 3300046660 | Bacteria | 1739 |
| 538 | Ga0495625_0157232 | 3300046660 | Bacteria | 1525 |
| 539 | Ga0495625_0274025 | 3300046660 | Bacteria | 1088 |
| 540 | Ga0495635_0018595 | 3300046663 | Bacteria | 4847 |
| 541 | Ga0495659_0063395 | 3300046664 | Bacteria | 1370 |
| 542 | Ga0495661_0002466 | 3300046665 | Bacteria | 14234 |
| 543 | Ga0495661_0002533 | 3300046665 | Bacteria | 14017 |
| 544 | Ga0495661_0005240 | 3300046665 | Bacteria | 9226 |
| 545 | Ga0495661_0007327 | 3300046665 | Bacteria | 7689 |
| 546 | Ga0495661_0009522 | 3300046665 | Bacteria | 6665 |
| 547 | Ga0495661_0013871 | 3300046665 | Bacteria | 5406 |
| 548 | Ga0495661_0014885 | 3300046665 | Bacteria | 5201 |
| 549 | Ga0495661_0016496 | 3300046665 | Bacteria | 4895 |
| 550 | Ga0495661_0025721 | 3300046665 | Bacteria | 3799 |
| 551 | Ga0495661_0056187 | 3300046665 | Bacteria | 2356 |
| 552 | Ga0495661_0065767 | 3300046665 | Bacteria | 2135 |
| 553 | Ga0495661_0153866 | 3300046665 | Bacteria | 1240 |
| 554 | Ga0495661_0209646 | 3300046665 | Bacteria | 1015 |
| 555 | Ga0495588_0002151 | 3300046674 | Bacteria | 8428 |
| 556 | Ga0495588_0048457 | 3300046674 | Bacteria | 2182 |
| 557 | Ga0495588_0166820 | 3300046674 | Bacteria | 1164 |
| 558 | Ga0495657_0058401 | 3300046675 | Bacteria | 2562 |
| 559 | Ga0495599_0016159 | 3300046678 | Bacteria | 4632 |
| 560 | Ga0495623_0011944 | 3300046679 | Bacteria | 5627 |
| 561 | Ga0495623_0012634 | 3300046679 | Bacteria | 5466 |
| 562 | Ga0495658_0187036 | 3300046683 | Bacteria | 1286 |
| 563 | Ga0495669_0000190 | 3300046684 | Bacteria | 38101 |
| 564 | Ga0495669_0001491 | 3300046684 | Bacteria | 9648 |
| 565 | Ga0495669_0004593 | 3300046684 | Bacteria | 5718 |
| 566 | Ga0495669_0006852 | 3300046684 | Bacteria | 4768 |
| 567 | Ga0495669_0220731 | 3300046684 | Bacteria | 908 |
| 568 | Ga0495669_0230072 | 3300046684 | Bacteria | 889 |
| 569 | Ga0495613_0038522 | 3300046689 | Bacteria | 3543 |
| 570 | Ga0495613_0046540 | 3300046689 | Bacteria | 3208 |
| 571 | Ga0495670_0003708 | 3300046691 | Bacteria | 7508 |
| 572 | Ga0495670_0009384 | 3300046691 | Bacteria | 4810 |
| 573 | Ga0495670_0053727 | 3300046691 | Bacteria | 2017 |
| 574 | Ga0495670_0084032 | 3300046691 | Bacteria | 1624 |
| 575 | Ga0495670_0107743 | 3300046691 | Bacteria | 1440 |
| 576 | Ga0495670_0132542 | 3300046691 | Bacteria | 1299 |
| 577 | Ga0495671_0012377 | 3300046692 | Bacteria | 4662 |
| 578 | Ga0495671_0058203 | 3300046692 | Bacteria | 1912 |
| 579 | Ga0495671_0156441 | 3300046692 | Bacteria | 1109 |
| 580 | Ga0495671_0219090 | 3300046692 | Bacteria | 921 |
| 581 | Ga0495649_0000214 | 3300046694 | Bacteria | 50663 |
| 582 | Ga0495649_0003286 | 3300046694 | Bacteria | 11007 |
| 583 | Ga0495649_0024995 | 3300046694 | Bacteria | 3328 |
| 584 | Ga0495649_0067541 | 3300046694 | Bacteria | 1918 |
| 585 | Ga0495649_0151435 | 3300046694 | Bacteria | 1218 |
| 586 | Ga0495649_0202993 | 3300046694 | Bacteria | 1029 |
| 587 | Ga0495589_0001415 | 3300046794 | Bacteria | 13904 |
| 588 | Ga0495589_0013026 | 3300046794 | Bacteria | 4296 |
| 589 | Ga0495589_0018014 | 3300046794 | Bacteria | 3624 |
| 590 | Ga0495589_0021018 | 3300046794 | Bacteria | 3335 |
| 591 | Ga0495589_0027534 | 3300046794 | Bacteria | 2873 |
| 592 | Ga0495600_0044420 | 3300046809 | Bacteria | 2899 |
| 593 | Ga0495660_0006553 | 3300046810 | Bacteria | 6878 |
| 594 | Ga0495660_0037045 | 3300046810 | Bacteria | 2718 |
| 595 | Ga0495660_0047873 | 3300046810 | Bacteria | 2339 |
| 596 | Ga0495660_0060190 | 3300046810 | Bacteria | 2040 |
| 597 | Ga0495660_0156703 | 3300046810 | Bacteria | 1120 |
| 598 | Ga0495581_0014601 | 3300047315 | Bacteria | 4554 |
| 599 | Ga0495604_0006708 | 3300047317 | Bacteria | 9127 |
| 600 | Ga0495604_0009427 | 3300047317 | Bacteria | 7722 |
| 601 | Ga0495604_0137357 | 3300047317 | Bacteria | 1750 |
| 602 | Ga0495604_0550901 | 3300047317 | Bacteria | 744 |
| 603 | Ga0495674_0018067 | 3300047319 | Bacteria | 6564 |
| 604 | Ga0495674_0036088 | 3300047319 | Bacteria | 4452 |
| 605 | Ga0495674_0056241 | 3300047319 | Bacteria | 3447 |
| 606 | Ga0495672_0000124 | 3300047320 | Bacteria | 118878 |
| 607 | Ga0495672_0000512 | 3300047320 | Bacteria | 44570 |
| 608 | Ga0495672_0000656 | 3300047320 | Bacteria | 38441 |
| 609 | Ga0495672_0067047 | 3300047320 | Bacteria | 2045 |
| 610 | Ga0495676_0000177 | 3300047321 | Bacteria | 50096 |
| 611 | Ga0495676_0099536 | 3300047321 | Bacteria | 2154 |
| 612 | Ga0495680_0007799 | 3300047322 | Bacteria | 9775 |
| 613 | Ga0495680_0013815 | 3300047322 | Bacteria | 7027 |
| 614 | Ga0495680_0036776 | 3300047322 | Bacteria | 3927 |
| 615 | Ga0495683_0000072 | 3300047323 | Bacteria | 104027 |
| 616 | Ga0495683_0000368 | 3300047323 | Bacteria | 37069 |
| 617 | Ga0495683_0002208 | 3300047323 | Bacteria | 11923 |
| 618 | Ga0495683_0005100 | 3300047323 | Bacteria | 7335 |
| 619 | Ga0495683_0015660 | 3300047323 | Bacteria | 3940 |
| 620 | Ga0495683_0022250 | 3300047323 | Bacteria | 3260 |
| 621 | Ga0495683_0022710 | 3300047323 | Bacteria | 3225 |
| 622 | Ga0495683_0075361 | 3300047323 | Bacteria | 1652 |
| 623 | Ga0495683_0177929 | 3300047323 | Bacteria | 973 |
| 624 | Ga0495687_000182 | 3300047443 | Bacteria | 91333 |
| 625 | Ga0495687_014045 | 3300047443 | Bacteria | 4143 |
| 626 | Ga0495675_0006310 | 3300047444 | Bacteria | 7261 |
| 627 | Ga0495675_0017422 | 3300047444 | Bacteria | 4552 |
| 628 | Ga0495675_0158822 | 3300047444 | Bacteria | 1393 |
| 629 | Ga0495677_0000129 | 3300047445 | Bacteria | 36880 |
| 630 | Ga0495677_0001809 | 3300047445 | Bacteria | 8548 |
| 631 | Ga0495677_0002312 | 3300047445 | Bacteria | 7514 |
| 632 | Ga0495677_0004948 | 3300047445 | Bacteria | 5081 |
| 633 | Ga0495677_0005272 | 3300047445 | Bacteria | 4910 |
| 634 | Ga0495677_0009205 | 3300047445 | Bacteria | 3649 |
| 635 | Ga0495677_0012732 | 3300047445 | Bacteria | 3065 |
| 636 | Ga0495677_0020815 | 3300047445 | Bacteria | 2377 |
| 637 | Ga0495677_0058263 | 3300047445 | Bacteria | 1429 |
| 638 | Ga0495679_004811 | 3300047446 | Bacteria | 6106 |
| 639 | Ga0495679_009347 | 3300047446 | Bacteria | 3928 |
| 640 | Ga0495679_026139 | 3300047446 | Bacteria | 1942 |
| 641 | Ga0495679_031406 | 3300047446 | Bacteria | 1713 |
| 642 | Ga0495679_072067 | 3300047446 | Bacteria | 993 |
| 643 | Ga0495685_001990 | 3300047447 | Bacteria | 6337 |
| 644 | Ga0495685_027022 | 3300047447 | Bacteria | 1974 |
| 645 | Ga0495685_037419 | 3300047447 | Bacteria | 1664 |
| 646 | Ga0495685_047889 | 3300047447 | Bacteria | 1453 |
| 647 | Ga0495681_0000189 | 3300047470 | Bacteria | 52253 |
| 648 | Ga0495681_0009180 | 3300047470 | Bacteria | 6115 |
| 649 | Ga0495681_0012177 | 3300047470 | Bacteria | 5069 |
| 650 | Ga0495681_0013471 | 3300047470 | Bacteria | 4739 |
| 651 | Ga0495681_0042911 | 3300047470 | Bacteria | 2185 |
| 652 | Ga0495681_0083064 | 3300047470 | Bacteria | 1426 |
| 653 | Ga0495681_0088915 | 3300047470 | Bacteria | 1367 |
| 654 | Ga0495684_0287227 | 3300047471 | Bacteria | 1185 |
| 655 | Ga0495684_0298443 | 3300047471 | Bacteria | 1158 |
| 656 | Ga0495686_0000429 | 3300047472 | Bacteria | 65535 |
| 657 | Ga0495686_0010935 | 3300047472 | Bacteria | 6424 |
| 658 | Ga0495686_0076330 | 3300047472 | Bacteria | 2053 |
| 659 | Ga0495686_0266636 | 3300047472 | Bacteria | 957 |
| 660 | Ga0495593_0060145 | 3300047673 | Bacteria | 1989 |
| 661 | Ga0495593_0087822 | 3300047673 | Bacteria | 1603 |
| 662 | Ga0495602_0014350 | 3300048088 | Bacteria | 8046 |
| 663 | Ga0495602_0026223 | 3300048088 | Bacteria | 5624 |
| 664 | Ga0495614_0007477 | 3300048089 | Bacteria | 4862 |
| 665 | Ga0495614_0015948 | 3300048089 | Bacteria | 3272 |
| 666 | Ga0495626_0000953 | 3300048091 | Bacteria | 25097 |
| 667 | Ga0495626_0001381 | 3300048091 | Bacteria | 19521 |
| 668 | Ga0495626_0002812 | 3300048091 | Bacteria | 11650 |
| 669 | Ga0495626_0006393 | 3300048091 | Bacteria | 6707 |
| 670 | Ga0495626_0008557 | 3300048091 | Bacteria | 5598 |
| 671 | Ga0495626_0009558 | 3300048091 | Bacteria | 5237 |
| 672 | Ga0495626_0012647 | 3300048091 | Bacteria | 4415 |
| 673 | Ga0495626_0018286 | 3300048091 | Bacteria | 3523 |
| 674 | Ga0495626_0025250 | 3300048091 | Bacteria | 2907 |
| 675 | Ga0495626_0027417 | 3300048091 | Bacteria | 2770 |
| 676 | Ga0495626_0029347 | 3300048091 | Bacteria | 2662 |
| 677 | Ga0495626_0064711 | 3300048091 | Bacteria | 1656 |
| 678 | Ga0496100_0049557 | 3300048903 | Bacteria | 2717 |
| 679 | Ga0496101_0144992 | 3300048904 | Bacteria | 1813 |
| 680 | Ga0496102_0067021 | 3300048905 | Bacteria | 3291 |
| 681 | Ga0496102_0301316 | 3300048905 | Bacteria | 1511 |
| 682 | Ga0496102_0321290 | 3300048905 | Bacteria | 1458 |
| 683 | Ga0496102_0425811 | 3300048905 | Bacteria | 1247 |
| 684 | Ga0496102_0616418 | 3300048905 | Bacteria | 1008 |
| 685 | Ga0496102_0863014 | 3300048905 | Bacteria | 827 |
| 686 | Ga0496103_0035300 | 3300048906 | Bacteria | 3061 |
| 687 | Ga0496103_0103977 | 3300048906 | Bacteria | 1799 |
| 688 | Ga0496104_0005903 | 3300048907 | Bacteria | 10723 |
| 689 | Ga0496104_0014250 | 3300048907 | Bacteria | 7177 |
| 690 | Ga0496104_0050921 | 3300048907 | Bacteria | 3907 |
| 691 | Ga0496104_0051370 | 3300048907 | Bacteria | 3891 |
| 692 | Ga0496104_0058610 | 3300048907 | Bacteria | 3645 |
| 693 | Ga0496104_0175586 | 3300048907 | Bacteria | 2053 |
| 694 | Ga0496104_0377643 | 3300048907 | Bacteria | 1330 |
| 695 | Ga0496104_0580731 | 3300048907 | Bacteria | 1031 |
| 696 | Ga0496105_0008661 | 3300048908 | Bacteria | 7913 |
| 697 | Ga0496105_0018906 | 3300048908 | Bacteria | 5549 |
| 698 | Ga0496105_0058976 | 3300048908 | Bacteria | 3167 |
| 699 | Ga0496105_0077547 | 3300048908 | Bacteria | 2744 |
| 700 | Ga0496105_0086611 | 3300048908 | Bacteria | 2589 |
| 701 | Ga0496105_0108948 | 3300048908 | Bacteria | 2287 |
| 702 | Ga0496105_0496900 | 3300048908 | Bacteria | 958 |
| 703 | Ga0496106_0140824 | 3300048909 | Bacteria | 1897 |
| 704 | Ga0496106_0141128 | 3300048909 | Bacteria | 1895 |
| 705 | Ga0496107_0135624 | 3300048910 | Bacteria | 1818 |
| 706 | Ga0496108_0049617 | 3300048911 | Bacteria | 3511 |
| 707 | Ga0496108_0082077 | 3300048911 | Bacteria | 2733 |
| 708 | Ga0496108_0242186 | 3300048911 | Bacteria | 1569 |
| 709 | Ga0496108_0319627 | 3300048911 | Bacteria | 1353 |
| 710 | Ga0496108_0496496 | 3300048911 | Bacteria | 1066 |
| 711 | Ga0496109_0022334 | 3300048912 | Bacteria | 5603 |
| 712 | Ga0496109_0031399 | 3300048912 | Bacteria | 4767 |
| 713 | Ga0496109_0058137 | 3300048912 | Bacteria | 3532 |
| 714 | Ga0496109_0079051 | 3300048912 | Bacteria | 3029 |
| 715 | Ga0496109_0104821 | 3300048912 | Bacteria | 2626 |
| 716 | Ga0496109_0252091 | 3300048912 | Bacteria | 1662 |
| 717 | Ga0496109_0333992 | 3300048912 | Bacteria | 1431 |
| 718 | Ga0496109_0413203 | 3300048912 | Bacteria | 1275 |
| 719 | Ga0496110_0000016 | 3300048913 | Bacteria | 85281 |
| 720 | Ga0496110_0007901 | 3300048913 | Bacteria | 8521 |
| 721 | Ga0496110_0012938 | 3300048913 | Bacteria | 6881 |
| 722 | Ga0496110_0044101 | 3300048913 | Bacteria | 3894 |
| 723 | Ga0496110_0112073 | 3300048913 | Bacteria | 2452 |
| 724 | Ga0496110_0192536 | 3300048913 | Bacteria | 1852 |
| 725 | Ga0496110_0288484 | 3300048913 | Bacteria | 1494 |
| 726 | Ga0496110_0337724 | 3300048913 | Bacteria | 1372 |
| 727 | Ga0496111_0001590 | 3300048914 | Bacteria | 13124 |
| 728 | Ga0496111_0041383 | 3300048914 | Bacteria | 3306 |
| 729 | Ga0496111_0096223 | 3300048914 | Bacteria | 2173 |
| 730 | Ga0496111_0117490 | 3300048914 | Bacteria | 1962 |
| 731 | Ga0496111_0267543 | 3300048914 | Bacteria | 1268 |
| 732 | Ga0496112_0001256 | 3300048915 | Bacteria | 19216 |
| 733 | Ga0496112_0016461 | 3300048915 | Bacteria | 6928 |
| 734 | Ga0496112_0047904 | 3300048915 | Bacteria | 4192 |
| 735 | Ga0496112_0157447 | 3300048915 | Bacteria | 2238 |
| 736 | Ga0496112_0165258 | 3300048915 | Bacteria | 2179 |
| 737 | Ga0496112_0293404 | 3300048915 | Bacteria | 1572 |
| 738 | Ga0496112_0322838 | 3300048915 | Bacteria | 1488 |
| 739 | Ga0496112_0411619 | 3300048915 | Bacteria | 1291 |
| 740 | Ga0496112_0715037 | 3300048915 | Bacteria | 929 |
| 741 | Ga0496113_0062239 | 3300048916 | Bacteria | 2818 |
| 742 | Ga0496113_0106347 | 3300048916 | Bacteria | 2179 |
| 743 | Ga0496113_0349896 | 3300048916 | Bacteria | 1185 |
| 744 | Ga0496113_0562043 | 3300048916 | Bacteria | 915 |
| 745 | Ga0496113_0601620 | 3300048916 | Bacteria | 880 |
| 746 | Ga0496113_0931378 | 3300048916 | Bacteria | 686 |
| 747 | Ga0496114_0012861 | 3300048917 | Bacteria | 6703 |
| 748 | Ga0496114_0516697 | 3300048917 | Bacteria | 1056 |
| 749 | Ga0496115_0009579 | 3300048918 | Bacteria | 7200 |
| 750 | Ga0496115_0021271 | 3300048918 | Bacteria | 5010 |
| 751 | Ga0496115_0162487 | 3300048918 | Bacteria | 1846 |
| 752 | Ga0496122_0101679 | 3300048925 | Bacteria | 1919 |
| 753 | Ga0496123_0042148 | 3300048926 | Bacteria | 3155 |
| 754 | Ga0496124_0019153 | 3300048927 | Bacteria | 6385 |
| 755 | Ga0495678_000075 | 3300049459 | Bacteria | 125154 |
| 756 | Ga0495678_000084 | 3300049459 | Bacteria | 117340 |
| 757 | Ga0495678_000596 | 3300049459 | Bacteria | 34066 |
| 758 | Ga0495678_000681 | 3300049459 | Bacteria | 31236 |
| 759 | Ga0495678_007207 | 3300049459 | Bacteria | 5795 |
| 760 | Ga0495678_035799 | 3300049459 | Bacteria | 2031 |
| 761 | Ga0495682_0000787 | 3300049460 | Bacteria | 20096 |
| 762 | Ga0495682_0023930 | 3300049460 | Bacteria | 2279 |
| 763 | Ga0495682_0031051 | 3300049460 | Bacteria | 1976 |
| 764 | Ga0495682_0046418 | 3300049460 | Bacteria | 1586 |
| 765 | Ga0495682_0061834 | 3300049460 | Bacteria | 1351 |
| 766 | Ga0501031_0095115 | 3300049568 | Bacteria | 1944 |
| 767 | Ga0501031_0095844 | 3300049568 | Bacteria | 1936 |
| 768 | Ga0501033_0439755 | 3300049570 | Bacteria | 907 |
| 769 | Ga0501036_0038220 | 3300049572 | Bacteria | 4062 |
| 770 | Ga0501036_0114959 | 3300049572 | Bacteria | 2274 |
| 771 | Ga0501036_0141524 | 3300049572 | Bacteria | 2030 |
| 772 | Ga0501038_0118711 | 3300049574 | Bacteria | 2183 |
| 773 | Ga0501039_0177861 | 3300049575 | Bacteria | 1673 |
| 774 | Ga0501039_0285477 | 3300049575 | Bacteria | 1297 |
| 775 | Ga0501039_0364864 | 3300049575 | Bacteria | 1135 |
| 776 | Ga0501040_0004091 | 3300049576 | Bacteria | 9482 |
| 777 | Ga0501040_0539526 | 3300049576 | Bacteria | 842 |
| 778 | Ga0501041_0075344 | 3300049577 | Bacteria | 2075 |
| 779 | Ga0501041_0212492 | 3300049577 | Bacteria | 1213 |
| 780 | Ga0501041_0380087 | 3300049577 | Bacteria | 894 |
| 781 | Ga0501042_0012164 | 3300049578 | Bacteria | 5823 |
| 782 | Ga0501042_0067352 | 3300049578 | Bacteria | 2560 |
| 783 | Ga0501042_0117572 | 3300049578 | Bacteria | 1914 |
| 784 | Ga0501046_0009766 | 3300049580 | Bacteria | 8274 |
| 785 | Ga0501048_0221422 | 3300049582 | Bacteria | 1342 |
| 786 | Ga0501071_0003983 | 3300049587 | Bacteria | 9322 |
| 787 | Ga0501071_0078748 | 3300049587 | Bacteria | 2409 |
| 788 | Ga0501072_0016553 | 3300049588 | Bacteria | 5665 |
| 789 | Ga0501072_0042796 | 3300049588 | Bacteria | 3558 |
| 790 | Ga0501072_0062269 | 3300049588 | Bacteria | 2943 |
| 791 | Ga0501072_0223696 | 3300049588 | Bacteria | 1500 |
| 792 | Ga0501074_0150629 | 3300049590 | Bacteria | 1663 |
| 793 | Ga0501075_0212570 | 3300049591 | Bacteria | 1475 |
| 794 | Ga0501075_0219737 | 3300049591 | Bacteria | 1449 |
| 795 | Ga0501075_0494600 | 3300049591 | Bacteria | 933 |
| 796 | Ga0501076_0004613 | 3300049592 | Bacteria | 9810 |
| 797 | Ga0501076_0032894 | 3300049592 | Bacteria | 4049 |
| 798 | Ga0501076_0330539 | 3300049592 | Bacteria | 1250 |
| 799 | Ga0501076_0533227 | 3300049592 | Bacteria | 968 |
| 800 | Ga0501077_0008606 | 3300049593 | Bacteria | 6329 |
| 801 | Ga0501077_0092101 | 3300049593 | Bacteria | 1921 |
| 802 | Ga0501077_0230891 | 3300049593 | Bacteria | 1176 |
| 803 | Ga0501079_0041671 | 3300049741 | Bacteria | 3545 |
| 804 | Ga0501079_0146343 | 3300049741 | Bacteria | 1841 |
| 805 | Ga0501080_0209140 | 3300049742 | Bacteria | 1788 |
| 806 | Ga0501081_0002738 | 3300049743 | Bacteria | 11166 |
| 807 | Ga0501081_0040378 | 3300049743 | Bacteria | 3195 |
| 808 | Ga0501081_0369283 | 3300049743 | Bacteria | 1059 |
| 809 | Ga0501081_0371084 | 3300049743 | Bacteria | 1056 |
| 810 | Ga0501035_0095839 | 3300049822 | Bacteria | 2608 |
| 811 | Ga0501045_0024328 | 3300049824 | Bacteria | 4348 |
| 812 | Ga0501045_0363483 | 3300049824 | Bacteria | 1077 |
| 813 | nmdc:mga00v17_15695_c1 | 3300050491 | Bacteria | 4254 |
| 814 | nmdc:mga0yw44_63224_c1 | 3300050492 | Bacteria | 2275 |
| 815 | nmdc:mga0k408_26773_c1 | 3300050493 | Bacteria | 3271 |
| 816 | nmdc:mga06z11_70659_c1 | 3300050494 | Bacteria | 1846 |
| 817 | nmdc:mga05p37_1262702_c1 | 3300050507 | Bacteria | 757 |
| 818 | nmdc:mga05p37_153780_c1 | 3300050507 | Bacteria | 2813 |
| 819 | nmdc:mga05p37_2263_c1 | 3300050507 | Bacteria | 22436 |
| 820 | nmdc:mga05p37_3065_c1 | 3300050507 | Bacteria | 19411 |
| 821 | nmdc:mga05p37_3365_c1 | 3300050507 | Bacteria | 18662 |
| 822 | nmdc:mga05p37_75835_c1 | 3300050507 | Bacteria | 4140 |
| 823 | nmdc:mga05p37_85016_c1 | 3300050507 | Bacteria | 3898 |
| 824 | nmdc:mga09592_113650_c1 | 3300050508 | Bacteria | 2324 |
| 825 | nmdc:mga09592_245441_c1 | 3300050508 | Bacteria | 1552 |
| 826 | nmdc:mga09592_302523_c1 | 3300050508 | Bacteria | 1387 |
| 827 | nmdc:mga0qj67_127_c1 | 3300050509 | Bacteria | 50287 |
| 828 | nmdc:mga0qj67_185732_c1 | 3300050509 | Bacteria | 1689 |
| 829 | nmdc:mga0qj67_297692_c1 | 3300050509 | Bacteria | 1307 |
| 830 | nmdc:mga06r32_235319_c1 | 3300050510 | Bacteria | 1819 |
| 831 | nmdc:mga06r32_24663_c1 | 3300050510 | Bacteria | 5586 |
| 832 | nmdc:mga06r32_338939_c1 | 3300050510 | Bacteria | 1488 |
| 833 | nmdc:mga06r32_572323_c1 | 3300050510 | Bacteria | 1102 |
| 834 | nmdc:mga06r32_754_c1 | 3300050510 | Bacteria | 28479 |
| 835 | nmdc:mga06r32_771_c1 | 3300050510 | Bacteria | 28266 |
| 836 | nmdc:mga08y16_10823_c1 | 3300050511 | Bacteria | 9577 |
| 837 | nmdc:mga08y16_12433_c1 | 3300050511 | Bacteria | 8957 |
| 838 | nmdc:mga08y16_7164_c1 | 3300050511 | Bacteria | 11705 |
| 839 | nmdc:mga0n895_37583_c1 | 3300050512 | Bacteria | 4685 |
| 840 | nmdc:mga0n895_477314_c1 | 3300050512 | Bacteria | 1258 |
| 841 | nmdc:mga0rr50_236969_c1 | 3300050513 | Bacteria | 1511 |
| 842 | nmdc:mga0rr50_330390_c1 | 3300050513 | Bacteria | 1280 |
| 843 | nmdc:mga0rr50_7411_c1 | 3300050513 | Bacteria | 6765 |
| 844 | nmdc:mga0a205_246461_c1 | 3300050515 | Bacteria | 1667 |
| 845 | nmdc:mga0a205_555877_c1 | 3300050515 | Bacteria | 1003 |
| 846 | nmdc:mga0a205_84820_c1 | 3300050515 | Bacteria | 3060 |
| 847 | Ga0495601_0004070 | 3300053077 | Bacteria | 8432 |
| 848 | Ga0495601_0012830 | 3300053077 | Bacteria | 5029 |
| 849 | Ga0495601_0586911 | 3300053077 | Bacteria | 716 |
| 850 | Ga0495612_0015988 | 3300053078 | Bacteria | 3007 |
| 851 | Ga0495595_0003336 | 3300053084 | Bacteria | 6371 |
| 852 | Ga0495619_0002109 | 3300053085 | Bacteria | 13181 |
| 853 | Ga0495619_0014746 | 3300053085 | Bacteria | 4937 |
| 854 | Ga0495619_0377306 | 3300053085 | Bacteria | 980 |
| 855 | Ga0500641_0009224 | 3300053096 | Bacteria | 3543 |
| 856 | Ga0500639_148723 | 3300053163 | Bacteria | 1083 |
| 857 | Ga0501084_0030659 | 3300054114 | Bacteria | 4497 |
| 858 | Ga0501084_0073117 | 3300054114 | Bacteria | 2871 |
| 859 | Ga0501084_0096629 | 3300054114 | Bacteria | 2481 |
| 860 | Ga0501084_0180232 | 3300054114 | Bacteria | 1783 |
| 861 | Ga0501082_0020201 | 3300060353 | Bacteria | 5740 |
| 862 | Ga0501082_0040469 | 3300060353 | Bacteria | 4020 |
| 863 | Ga0501082_0040782 | 3300060353 | Bacteria | 4004 |
| 864 | Ga0501082_0211521 | 3300060353 | Bacteria | 1687 |
| 865 | Ga0501082_0302632 | 3300060353 | Bacteria | 1393 |
| 866 | Ga0530510_0014744 | 3300061734 | Bacteria | 5518 |
| 867 | Ga0530510_0123075 | 3300061734 | Bacteria | 1905 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046665 | Ga0495661_0209646 | Ga0495661_0209646_357_896 | 179 |
| 2 | 3300046499 | Ga0495594_0453256 | Ga0495594_0453256_11_574 | 183 |
| 3 | 3300047446 | Ga0495679_009347 | Ga0495679_009347_3363_3917 | 183 |
| 4 | 3300027907 | Ga0207428_10025907 | Ga0207428_100259075 | 184 |
| 5 | 3300042013 | Ga0439456_073105 | Ga0439456_073105_172_735 | 187 |
| 6 | 3300046535 | Ga0495586_0296058 | Ga0495586_0296058_350_913 | 187 |
| 7 | 3300046492 | Ga0495585_0134337 | Ga0495585_0134337_12_590 | 191 |
| 8 | 3300046523 | Ga0495644_0002439 | Ga0495644_0002439_6834_7412 | 191 |
| 9 | 3300046684 | Ga0495669_0220731 | Ga0495669_0220731_11_589 | 191 |
| 10 | 3300025960 | Ga0207651_10468567 | Ga0207651_104685672 | 193 |
| 11 | 3300048913 | Ga0496110_0012938 | Ga0496110_0012938_1240_1854 | 193 |
| 12 | 3300048914 | Ga0496111_0001590 | Ga0496111_0001590_884_1498 | 193 |
| 13 | 3300046538 | Ga0495609_0117478 | Ga0495609_0117478_33_620 | 195 |
| 14 | 3300035092 | Ga0373952_0089129 | Ga0373952_0089129_181_777 | 198 |
| 15 | 3300037068 | Ga0373925_0532099 | Ga0373925_0532099_353_949 | 198 |
| 16 | 3300046491 | Ga0495584_0216117 | Ga0495584_0216117_22_618 | 198 |
| 17 | 3300048905 | Ga0496102_0863014 | Ga0496102_0863014_206_802 | 198 |
| 18 | 3300048907 | Ga0496104_0175586 | Ga0496104_0175586_1427_2023 | 198 |
| 19 | 3300048909 | Ga0496106_0141128 | Ga0496106_0141128_1270_1866 | 198 |
| 20 | 3300048914 | Ga0496111_0267543 | Ga0496111_0267543_12_680 | 198 |
| 21 | 3300048916 | Ga0496113_0931378 | Ga0496113_0931378_26_622 | 198 |
| 22 | 3300049577 | Ga0501041_0380087 | Ga0501041_0380087_47_643 | 198 |
| 23 | 3300049591 | Ga0501075_0212570 | Ga0501075_0212570_862_1458 | 198 |
| 24 | 3300050494 | nmdc:mga06z11_70659_c1 | nmdc:mga06z11_70659_c1_40_636 | 198 |
| 25 | 3300046491 | Ga0495584_0245404 | Ga0495584_0245404_29_640 | 203 |
| 26 | 3300046523 | Ga0495644_0183741 | Ga0495644_0183741_21_632 | 203 |
| 27 | 3300046542 | Ga0495597_0071610 | Ga0495597_0071610_38_649 | 203 |
| 28 | 3300047446 | Ga0495679_026139 | Ga0495679_026139_1318_1929 | 203 |
| 29 | 3300048091 | Ga0495626_0018286 | Ga0495626_0018286_2892_3506 | 203 |
| 30 | 3300048905 | Ga0496102_0616418 | Ga0496102_0616418_384_995 | 203 |
| 31 | 3300005536 | Ga0070697_100318943 | Ga0070697_1003189432 | 210 |
| 32 | 3300006237 | Ga0097621_100183889 | Ga0097621_1001838892 | 210 |
| 33 | iso_pu_bacteria | 2513237141 | 2513893663 | 212 |
| 34 | 3300005616 | Ga0068852_101276504 | Ga0068852_1012765041 | 213 |
| 35 | 3300013306 | Ga0163162_10515198 | Ga0163162_105151982 | 213 |
| 36 | 3300026075 | Ga0207708_10090760 | Ga0207708_100907602 | 213 |
| 37 | 3300003659 | JGI25404J52841_10000005 | JGI25404J52841_100000055 | 215 |
| 38 | 3300005331 | Ga0070670_100233222 | Ga0070670_1002332221 | 215 |
| 39 | 3300005535 | Ga0070684_100187428 | Ga0070684_1001874282 | 215 |
| 40 | 3300005564 | Ga0070664_100036084 | Ga0070664_1000360844 | 215 |
| 41 | 3300005983 | Ga0081540_1000131 | Ga0081540_10001319 | 215 |
| 42 | 3300009094 | Ga0111539_10369263 | Ga0111539_103692632 | 215 |
| 43 | 3300009177 | Ga0105248_10350550 | Ga0105248_103505501 | 215 |
| 44 | 3300013296 | Ga0157374_10051753 | Ga0157374_100517536 | 215 |
| 45 | 3300014325 | Ga0163163_10155517 | Ga0163163_101555172 | 215 |
| 46 | 3300017792 | Ga0163161_10117066 | Ga0163161_101170661 | 215 |
| 47 | 3300025900 | Ga0207710_10024189 | Ga0207710_100241892 | 215 |
| 48 | 3300025941 | Ga0207711_10749260 | Ga0207711_107492601 | 215 |
| 49 | 3300025942 | Ga0207689_10785509 | Ga0207689_107855091 | 215 |
| 50 | 3300026088 | Ga0207641_10546738 | Ga0207641_105467381 | 215 |
| 51 | 3300048907 | Ga0496104_0050921 | Ga0496104_0050921_2431_3078 | 215 |
| 52 | 3300048908 | Ga0496105_0018906 | Ga0496105_0018906_2116_2763 | 215 |
| 53 | 3300048912 | Ga0496109_0022334 | Ga0496109_0022334_93_740 | 215 |
| 54 | 3300048913 | Ga0496110_0044101 | Ga0496110_0044101_1137_1784 | 215 |
| 55 | 3300048914 | Ga0496111_0117490 | Ga0496111_0117490_397_1044 | 215 |
| 56 | 3300048915 | Ga0496112_0016461 | Ga0496112_0016461_4185_4832 | 215 |
| 57 | 3300048916 | Ga0496113_0601620 | Ga0496113_0601620_169_816 | 215 |
| 58 | 3300050513 | nmdc:mga0rr50_330390_c1 | nmdc:mga0rr50_330390_c1_45_692 | 215 |
| 59 | 3300003784 | Ga0055534_1016085 | Ga0055534_10160851 | 216 |
| 60 | 3300003911 | JGI25405J52794_10071168 | JGI25405J52794_100711681 | 216 |
| 61 | 3300005293 | Ga0065715_10013140 | Ga0065715_100131402 | 216 |
| 62 | 3300005295 | Ga0065707_10230384 | Ga0065707_102303842 | 216 |
| 63 | 3300005330 | Ga0070690_100182655 | Ga0070690_1001826552 | 216 |
| 64 | 3300005331 | Ga0070670_100059915 | Ga0070670_1000599153 | 216 |
| 65 | 3300005335 | Ga0070666_10046516 | Ga0070666_100465162 | 216 |
| 66 | 3300005337 | Ga0070682_100010249 | Ga0070682_1000102493 | 216 |
| 67 | 3300005339 | Ga0070660_100101583 | Ga0070660_1001015832 | 216 |
| 68 | 3300005340 | Ga0070689_100025741 | Ga0070689_1000257415 | 216 |
| 69 | 3300005343 | Ga0070687_100073685 | Ga0070687_1000736852 | 216 |
| 70 | 3300005347 | Ga0070668_100481940 | Ga0070668_1004819402 | 216 |
| 71 | 3300005353 | Ga0070669_100354794 | Ga0070669_1003547942 | 216 |
| 72 | 3300005355 | Ga0070671_100006478 | Ga0070671_1000064782 | 216 |
| 73 | 3300005355 | Ga0070671_100026508 | Ga0070671_1000265081 | 216 |
| 74 | 3300005355 | Ga0070671_100217596 | Ga0070671_1002175962 | 216 |
| 75 | 3300005364 | Ga0070673_100000565 | Ga0070673_1000005657 | 216 |
| 76 | 3300005365 | Ga0070688_100028600 | Ga0070688_1000286003 | 216 |
| 77 | 3300005365 | Ga0070688_100122280 | Ga0070688_1001222802 | 216 |
| 78 | 3300005367 | Ga0070667_100271451 | Ga0070667_1002714513 | 216 |
| 79 | 3300005367 | Ga0070667_100495000 | Ga0070667_1004950002 | 216 |
| 80 | 3300005434 | Ga0070709_10067759 | Ga0070709_100677591 | 216 |
| 81 | 3300005436 | Ga0070713_100000018 | Ga0070713_10000001897 | 216 |
| 82 | 3300005438 | Ga0070701_10268942 | Ga0070701_102689422 | 216 |
| 83 | 3300005440 | Ga0070705_100053620 | Ga0070705_1000536202 | 216 |
| 84 | 3300005441 | Ga0070700_100061033 | Ga0070700_1000610333 | 216 |
| 85 | 3300005441 | Ga0070700_100408252 | Ga0070700_1004082522 | 216 |
| 86 | 3300005455 | Ga0070663_100016718 | Ga0070663_1000167182 | 216 |
| 87 | 3300005455 | Ga0070663_100145868 | Ga0070663_1001458681 | 216 |
| 88 | 3300005456 | Ga0070678_100033489 | Ga0070678_1000334894 | 216 |
| 89 | 3300005456 | Ga0070678_100358743 | Ga0070678_1003587432 | 216 |
| 90 | 3300005457 | Ga0070662_100009332 | Ga0070662_1000093324 | 216 |
| 91 | 3300005459 | Ga0068867_100511421 | Ga0068867_1005114212 | 216 |
| 92 | 3300005539 | Ga0068853_100024317 | Ga0068853_1000243172 | 216 |
| 93 | 3300005539 | Ga0068853_100194162 | Ga0068853_1001941622 | 216 |
| 94 | 3300005543 | Ga0070672_100079213 | Ga0070672_1000792133 | 216 |
| 95 | 3300005545 | Ga0070695_100003910 | Ga0070695_1000039106 | 216 |
| 96 | 3300005545 | Ga0070695_100051176 | Ga0070695_1000511763 | 216 |
| 97 | 3300005547 | Ga0070693_100021913 | Ga0070693_1000219132 | 216 |
| 98 | 3300005547 | Ga0070693_100539808 | Ga0070693_1005398081 | 216 |
| 99 | 3300005548 | Ga0070665_100737848 | Ga0070665_1007378482 | 216 |
| 100 | 3300005564 | Ga0070664_100237260 | Ga0070664_1002372602 | 216 |
| 101 | 3300005564 | Ga0070664_100583661 | Ga0070664_1005836612 | 216 |
| 102 | 3300005577 | Ga0068857_100215387 | Ga0068857_1002153873 | 216 |
| 103 | 3300005578 | Ga0068854_100036313 | Ga0068854_1000363133 | 216 |
| 104 | 3300005578 | Ga0068854_100272677 | Ga0068854_1002726771 | 216 |
| 105 | 3300005614 | Ga0068856_100464173 | Ga0068856_1004641732 | 216 |
| 106 | 3300005615 | Ga0070702_100315434 | Ga0070702_1003154342 | 216 |
| 107 | 3300005615 | Ga0070702_100320675 | Ga0070702_1003206752 | 216 |
| 108 | 3300005615 | Ga0070702_100388435 | Ga0070702_1003884352 | 216 |
| 109 | 3300005615 | Ga0070702_100664462 | Ga0070702_1006644621 | 216 |
| 110 | 3300005616 | Ga0068852_100185607 | Ga0068852_1001856073 | 216 |
| 111 | 3300005617 | Ga0068859_100018952 | Ga0068859_1000189526 | 216 |
| 112 | 3300005617 | Ga0068859_100427888 | Ga0068859_1004278882 | 216 |
| 113 | 3300005618 | Ga0068864_100028552 | Ga0068864_1000285527 | 216 |
| 114 | 3300005618 | Ga0068864_100255449 | Ga0068864_1002554492 | 216 |
| 115 | 3300005618 | Ga0068864_100365293 | Ga0068864_1003652932 | 216 |
| 116 | 3300005618 | Ga0068864_100424629 | Ga0068864_1004246292 | 216 |
| 117 | 3300005718 | Ga0068866_10157190 | Ga0068866_101571901 | 216 |
| 118 | 3300005719 | Ga0068861_100538062 | Ga0068861_1005380621 | 216 |
| 119 | 3300005841 | Ga0068863_100393968 | Ga0068863_1003939681 | 216 |
| 120 | 3300005841 | Ga0068863_100461975 | Ga0068863_1004619751 | 216 |
| 121 | 3300005842 | Ga0068858_100198178 | Ga0068858_1001981782 | 216 |
| 122 | 3300005842 | Ga0068858_100270442 | Ga0068858_1002704423 | 216 |
| 123 | 3300005843 | Ga0068860_100217511 | Ga0068860_1002175113 | 216 |
| 124 | 3300005843 | Ga0068860_100982512 | Ga0068860_1009825122 | 216 |
| 125 | 3300005937 | Ga0081455_10001692 | Ga0081455_100016922 | 216 |
| 126 | 3300005937 | Ga0081455_10006720 | Ga0081455_100067208 | 216 |
| 127 | 3300005937 | Ga0081455_10023358 | Ga0081455_100233583 | 216 |
| 128 | 3300005937 | Ga0081455_10028216 | Ga0081455_100282167 | 216 |
| 129 | 3300005937 | Ga0081455_10452163 | Ga0081455_104521631 | 216 |
| 130 | 3300005981 | Ga0081538_10021664 | Ga0081538_100216643 | 216 |
| 131 | 3300005983 | Ga0081540_1001103 | Ga0081540_100110315 | 216 |
| 132 | 3300006028 | Ga0070717_10039203 | Ga0070717_100392033 | 216 |
| 133 | 3300006028 | Ga0070717_10163376 | Ga0070717_101633764 | 216 |
| 134 | 3300006028 | Ga0070717_10465900 | Ga0070717_104659002 | 216 |
| 135 | 3300006038 | Ga0075365_10143705 | Ga0075365_101437052 | 216 |
| 136 | 3300006042 | Ga0075368_10218837 | Ga0075368_102188371 | 216 |
| 137 | 3300006163 | Ga0070715_10353193 | Ga0070715_103531931 | 216 |
| 138 | 3300006175 | Ga0070712_100076186 | Ga0070712_1000761864 | 216 |
| 139 | 3300006175 | Ga0070712_100281015 | Ga0070712_1002810152 | 216 |
| 140 | 3300006178 | Ga0075367_10327369 | Ga0075367_103273691 | 216 |
| 141 | 3300006195 | Ga0075366_10199338 | Ga0075366_101993381 | 216 |
| 142 | 3300006844 | Ga0075428_100401283 | Ga0075428_1004012833 | 216 |
| 143 | 3300006846 | Ga0075430_100095837 | Ga0075430_1000958372 | 216 |
| 144 | 3300006846 | Ga0075430_100149830 | Ga0075430_1001498302 | 216 |
| 145 | 3300006847 | Ga0075431_100030068 | Ga0075431_1000300683 | 216 |
| 146 | 3300006847 | Ga0075431_100168200 | Ga0075431_1001682003 | 216 |
| 147 | 3300006847 | Ga0075431_100264321 | Ga0075431_1002643213 | 216 |
| 148 | 3300006847 | Ga0075431_100302961 | Ga0075431_1003029612 | 216 |
| 149 | 3300006847 | Ga0075431_100384007 | Ga0075431_1003840072 | 216 |
| 150 | 3300006852 | Ga0075433_10056706 | Ga0075433_100567063 | 216 |
| 151 | 3300006852 | Ga0075433_10108629 | Ga0075433_101086293 | 216 |
| 152 | 3300006852 | Ga0075433_10619259 | Ga0075433_106192592 | 216 |
| 153 | 3300006871 | Ga0075434_100005496 | Ga0075434_1000054966 | 216 |
| 154 | 3300006871 | Ga0075434_100177508 | Ga0075434_1001775083 | 216 |
| 155 | 3300006871 | Ga0075434_100397744 | Ga0075434_1003977442 | 216 |
| 156 | 3300006880 | Ga0075429_100192489 | Ga0075429_1001924893 | 216 |
| 157 | 3300006880 | Ga0075429_100259240 | Ga0075429_1002592402 | 216 |
| 158 | 3300006880 | Ga0075429_100291529 | Ga0075429_1002915292 | 216 |
| 159 | 3300006931 | Ga0097620_100018951 | Ga0097620_1000189516 | 216 |
| 160 | 3300006931 | Ga0097620_100427878 | Ga0097620_1004278782 | 216 |
| 161 | 3300007076 | Ga0075435_100413526 | Ga0075435_1004135262 | 216 |
| 162 | 3300007076 | Ga0075435_100779528 | Ga0075435_1007795281 | 216 |
| 163 | 3300009093 | Ga0105240_10258211 | Ga0105240_102582114 | 216 |
| 164 | 3300009094 | Ga0111539_10011405 | Ga0111539_100114054 | 216 |
| 165 | 3300009094 | Ga0111539_10026569 | Ga0111539_100265694 | 216 |
| 166 | 3300009094 | Ga0111539_10308395 | Ga0111539_103083952 | 216 |
| 167 | 3300009098 | Ga0105245_10008565 | Ga0105245_100085658 | 216 |
| 168 | 3300009147 | Ga0114129_10003291 | Ga0114129_1000329121 | 216 |
| 169 | 3300009147 | Ga0114129_10020071 | Ga0114129_100200718 | 216 |
| 170 | 3300009147 | Ga0114129_10025414 | Ga0114129_100254144 | 216 |
| 171 | 3300009147 | Ga0114129_10087690 | Ga0114129_100876906 | 216 |
| 172 | 3300009176 | Ga0105242_10535860 | Ga0105242_105358601 | 216 |
| 173 | 3300009545 | Ga0105237_10067517 | Ga0105237_100675174 | 216 |
| 174 | 3300010375 | Ga0105239_10154133 | Ga0105239_101541333 | 216 |
| 175 | 3300010375 | Ga0105239_10193306 | Ga0105239_101933063 | 216 |
| 176 | 3300010375 | Ga0105239_10674463 | Ga0105239_106744632 | 216 |
| 177 | 3300010375 | Ga0105239_11113635 | Ga0105239_111136351 | 216 |
| 178 | 3300011119 | Ga0105246_10051869 | Ga0105246_100518693 | 216 |
| 179 | 3300011119 | Ga0105246_10113164 | Ga0105246_101131644 | 216 |
| 180 | 3300013105 | Ga0157369_10426691 | Ga0157369_104266912 | 216 |
| 181 | 3300013297 | Ga0157378_10003059 | Ga0157378_100030596 | 216 |
| 182 | 3300013297 | Ga0157378_10813299 | Ga0157378_108132992 | 216 |
| 183 | 3300013306 | Ga0163162_10000030 | Ga0163162_10000030115 | 216 |
| 184 | 3300013306 | Ga0163162_10059459 | Ga0163162_100594592 | 216 |
| 185 | 3300013306 | Ga0163162_10217043 | Ga0163162_102170433 | 216 |
| 186 | 3300013308 | Ga0157375_10015972 | Ga0157375_100159726 | 216 |
| 187 | 3300013308 | Ga0157375_10204426 | Ga0157375_102044262 | 216 |
| 188 | 3300013308 | Ga0157375_10284173 | Ga0157375_102841731 | 216 |
| 189 | 3300014325 | Ga0163163_10321094 | Ga0163163_103210941 | 216 |
| 190 | 3300014326 | Ga0157380_10017716 | Ga0157380_100177161 | 216 |
| 191 | 3300017792 | Ga0163161_10099463 | Ga0163161_100994632 | 216 |
| 192 | 3300025291 | Ga0209675_1011334 | Ga0209675_10113342 | 216 |
| 193 | 3300025904 | Ga0207647_10039265 | Ga0207647_100392652 | 216 |
| 194 | 3300025905 | Ga0207685_10085839 | Ga0207685_100858391 | 216 |
| 195 | 3300025913 | Ga0207695_10405239 | Ga0207695_104052392 | 216 |
| 196 | 3300025915 | Ga0207693_10009123 | Ga0207693_100091236 | 216 |
| 197 | 3300025916 | Ga0207663_10502352 | Ga0207663_105023522 | 216 |
| 198 | 3300025916 | Ga0207663_10597752 | Ga0207663_105977521 | 216 |
| 199 | 3300025917 | Ga0207660_10184070 | Ga0207660_101840702 | 216 |
| 200 | 3300025917 | Ga0207660_10242260 | Ga0207660_102422602 | 216 |
| 201 | 3300025918 | Ga0207662_10160923 | Ga0207662_101609232 | 216 |
| 202 | 3300025919 | Ga0207657_10169987 | Ga0207657_101699872 | 216 |
| 203 | 3300025920 | Ga0207649_10057297 | Ga0207649_100572972 | 216 |
| 204 | 3300025924 | Ga0207694_10333868 | Ga0207694_103338682 | 216 |
| 205 | 3300025925 | Ga0207650_10003725 | Ga0207650_100037253 | 216 |
| 206 | 3300025925 | Ga0207650_10066576 | Ga0207650_100665762 | 216 |
| 207 | 3300025925 | Ga0207650_10691554 | Ga0207650_106915541 | 216 |
| 208 | 3300025928 | Ga0207700_10000862 | Ga0207700_1000086210 | 216 |
| 209 | 3300025928 | Ga0207700_10224361 | Ga0207700_102243612 | 216 |
| 210 | 3300025931 | Ga0207644_10004575 | Ga0207644_100045753 | 216 |
| 211 | 3300025931 | Ga0207644_10030476 | Ga0207644_100304764 | 216 |
| 212 | 3300025931 | Ga0207644_10070496 | Ga0207644_100704962 | 216 |
| 213 | 3300025933 | Ga0207706_10019690 | Ga0207706_100196903 | 216 |
| 214 | 3300025933 | Ga0207706_10042515 | Ga0207706_100425153 | 216 |
| 215 | 3300025940 | Ga0207691_10074932 | Ga0207691_100749324 | 216 |
| 216 | 3300025945 | Ga0207679_10018224 | Ga0207679_100182244 | 216 |
| 217 | 3300025945 | Ga0207679_10268792 | Ga0207679_102687922 | 216 |
| 218 | 3300025960 | Ga0207651_10001165 | Ga0207651_100011652 | 216 |
| 219 | 3300026067 | Ga0207678_10046727 | Ga0207678_100467274 | 216 |
| 220 | 3300026067 | Ga0207678_10108307 | Ga0207678_101083073 | 216 |
| 221 | 3300026075 | Ga0207708_10140132 | Ga0207708_101401323 | 216 |
| 222 | 3300026088 | Ga0207641_10177586 | Ga0207641_101775862 | 216 |
| 223 | 3300026088 | Ga0207641_10595044 | Ga0207641_105950441 | 216 |
| 224 | 3300026089 | Ga0207648_10058232 | Ga0207648_100582326 | 216 |
| 225 | 3300026118 | Ga0207675_100046206 | Ga0207675_1000462066 | 216 |
| 226 | 3300026121 | Ga0207683_10324269 | Ga0207683_103242692 | 216 |
| 227 | 3300027665 | Ga0209983_1059894 | Ga0209983_10598942 | 216 |
| 228 | 3300027717 | Ga0209998_10008920 | Ga0209998_100089201 | 216 |
| 229 | 3300027876 | Ga0209974_10050086 | Ga0209974_100500862 | 216 |
| 230 | 3300028379 | Ga0268266_10782858 | Ga0268266_107828582 | 216 |
| 231 | 3300028381 | Ga0268264_11303933 | Ga0268264_113039331 | 216 |
| 232 | 3300032002 | Ga0307416_100220057 | Ga0307416_1002200573 | 216 |
| 233 | 3300034820 | Ga0373959_0077040 | Ga0373959_0077040_69_731 | 216 |
| 234 | 3300035086 | Ga0373934_0048105 | Ga0373934_0048105_781_1431 | 216 |
| 235 | 3300035113 | Ga0373936_0032368 | Ga0373936_0032368_1264_1914 | 216 |
| 236 | 3300035114 | Ga0373939_0038381 | Ga0373939_0038381_448_1098 | 216 |
| 237 | 3300035116 | Ga0373945_0057468 | Ga0373945_0057468_397_1059 | 216 |
| 238 | 3300035118 | Ga0373954_0028364 | Ga0373954_0028364_1185_1835 | 216 |
| 239 | 3300035119 | Ga0373956_0045489 | Ga0373956_0045489_95_745 | 216 |
| 240 | 3300035410 | Ga0373924_0020099 | Ga0373924_0020099_1844_2503 | 216 |
| 241 | 3300035691 | Ga0373931_0032115 | Ga0373931_0032115_1708_2358 | 216 |
| 242 | 3300035691 | Ga0373931_0136528 | Ga0373931_0136528_570_1220 | 216 |
| 243 | 3300035692 | Ga0373935_0005742 | Ga0373935_0005742_3856_4518 | 216 |
| 244 | 3300035695 | Ga0373927_0126076 | Ga0373927_0126076_285_935 | 216 |
| 245 | 3300035695 | Ga0373927_0126770 | Ga0373927_0126770_588_1247 | 216 |
| 246 | 3300035695 | Ga0373927_0157074 | Ga0373927_0157074_123_788 | 216 |
| 247 | 3300035695 | Ga0373927_0201596 | Ga0373927_0201596_616_1266 | 216 |
| 248 | 3300035724 | Ga0373933_0288857 | Ga0373933_0288857_158_808 | 216 |
| 249 | 3300035724 | Ga0373933_0318732 | Ga0373933_0318732_289_939 | 216 |
| 250 | 3300035725 | Ga0373947_0067248 | Ga0373947_0067248_354_1019 | 216 |
| 251 | 3300035725 | Ga0373947_0079147 | Ga0373947_0079147_922_1581 | 216 |
| 252 | 3300035725 | Ga0373947_0341992 | Ga0373947_0341992_272_934 | 216 |
| 253 | 3300036401 | Ga0373937_0009924 | Ga0373937_0009924_6637_7293 | 216 |
| 254 | 3300036401 | Ga0373937_0018239 | Ga0373937_0018239_675_1325 | 216 |
| 255 | 3300036401 | Ga0373937_0147367 | Ga0373937_0147367_868_1530 | 216 |
| 256 | 3300037068 | Ga0373925_0010617 | Ga0373925_0010617_1572_2234 | 216 |
| 257 | 3300037068 | Ga0373925_0178033 | Ga0373925_0178033_909_1559 | 216 |
| 258 | 3300037068 | Ga0373925_0260253 | Ga0373925_0260253_720_1370 | 216 |
| 259 | 3300039437 | Ga0436365_0850419 | Ga0436365_0850419_289_942 | 216 |
| 260 | 3300039437 | Ga0436365_1807606 | Ga0436365_1807606_645_1304 | 216 |
| 261 | 3300039438 | Ga0436360_1125811 | Ga0436360_1125811_1544_2194 | 216 |
| 262 | 3300039438 | Ga0436360_1217870 | Ga0436360_1217870_13_663 | 216 |
| 263 | 3300039453 | Ga0436362_0569831 | Ga0436362_0569831_2728_3378 | 216 |
| 264 | 3300042876 | Ga0451577_0000058 | Ga0451577_0000058_50837_51487 | 216 |
| 265 | 3300044712 | Ga0453684_0000279 | Ga0453684_0000279_147494_148144 | 216 |
| 266 | 3300045051 | Ga0451576_0001134 | Ga0451576_0001134_39695_40345 | 216 |
| 267 | 3300045051 | Ga0451576_0148203 | Ga0451576_0148203_1705_2355 | 216 |
| 268 | 3300046452 | Ga0495617_000786 | Ga0495617_000786_10776_11426 | 216 |
| 269 | 3300046453 | Ga0495627_017161 | Ga0495627_017161_862_1512 | 216 |
| 270 | 3300046454 | Ga0495592_0036676 | Ga0495592_0036676_1100_1750 | 216 |
| 271 | 3300046455 | Ga0495603_0221067 | Ga0495603_0221067_35_685 | 216 |
| 272 | 3300046455 | Ga0495603_0441863 | Ga0495603_0441863_18_677 | 216 |
| 273 | 3300046459 | Ga0495629_0025346 | Ga0495629_0025346_1615_2265 | 216 |
| 274 | 3300046459 | Ga0495629_0037379 | Ga0495629_0037379_660_1310 | 216 |
| 275 | 3300046462 | Ga0495651_0022084 | Ga0495651_0022084_3930_4580 | 216 |
| 276 | 3300046463 | Ga0495653_0006075 | Ga0495653_0006075_4484_5134 | 216 |
| 277 | 3300046463 | Ga0495653_0023621 | Ga0495653_0023621_1340_1990 | 216 |
| 278 | 3300046471 | Ga0495650_0056075 | Ga0495650_0056075_508_1158 | 216 |
| 279 | 3300046472 | Ga0495580_0259455 | Ga0495580_0259455_239_889 | 216 |
| 280 | 3300046472 | Ga0495580_0468282 | Ga0495580_0468282_167_817 | 216 |
| 281 | 3300046473 | Ga0495582_0005640 | Ga0495582_0005640_1688_2338 | 216 |
| 282 | 3300046473 | Ga0495582_0075300 | Ga0495582_0075300_771_1436 | 216 |
| 283 | 3300046473 | Ga0495582_0096509 | Ga0495582_0096509_216_866 | 216 |
| 284 | 3300046473 | Ga0495582_0159364 | Ga0495582_0159364_580_1230 | 216 |
| 285 | 3300046474 | Ga0495605_0033647 | Ga0495605_0033647_1763_2413 | 216 |
| 286 | 3300046474 | Ga0495605_0043161 | Ga0495605_0043161_945_1595 | 216 |
| 287 | 3300046474 | Ga0495605_0067924 | Ga0495605_0067924_555_1205 | 216 |
| 288 | 3300046491 | Ga0495584_0014281 | Ga0495584_0014281_1430_2080 | 216 |
| 289 | 3300046491 | Ga0495584_0015052 | Ga0495584_0015052_1026_1676 | 216 |
| 290 | 3300046491 | Ga0495584_0110220 | Ga0495584_0110220_628_1278 | 216 |
| 291 | 3300046491 | Ga0495584_0205792 | Ga0495584_0205792_298_948 | 216 |
| 292 | 3300046492 | Ga0495585_0000005 | Ga0495585_0000005_254778_255428 | 216 |
| 293 | 3300046492 | Ga0495585_0000465 | Ga0495585_0000465_9133_9795 | 216 |
| 294 | 3300046492 | Ga0495585_0014514 | Ga0495585_0014514_1669_2319 | 216 |
| 295 | 3300046492 | Ga0495585_0018739 | Ga0495585_0018739_3322_3972 | 216 |
| 296 | 3300046499 | Ga0495594_0076097 | Ga0495594_0076097_562_1212 | 216 |
| 297 | 3300046499 | Ga0495594_0216727 | Ga0495594_0216727_248_898 | 216 |
| 298 | 3300046500 | Ga0495596_0001991 | Ga0495596_0001991_6627_7277 | 216 |
| 299 | 3300046500 | Ga0495596_0003288 | Ga0495596_0003288_7249_7911 | 216 |
| 300 | 3300046500 | Ga0495596_0003589 | Ga0495596_0003589_1693_2343 | 216 |
| 301 | 3300046500 | Ga0495596_0101477 | Ga0495596_0101477_381_1031 | 216 |
| 302 | 3300046501 | Ga0495607_0015069 | Ga0495607_0015069_1917_2567 | 216 |
| 303 | 3300046506 | Ga0495583_0015633 | Ga0495583_0015633_3177_3827 | 216 |
| 304 | 3300046507 | Ga0495606_0033339 | Ga0495606_0033339_1038_1688 | 216 |
| 305 | 3300046507 | Ga0495606_0079985 | Ga0495606_0079985_699_1349 | 216 |
| 306 | 3300046511 | Ga0495608_0004179 | Ga0495608_0004179_6178_6828 | 216 |
| 307 | 3300046513 | Ga0495616_0003309 | Ga0495616_0003309_4124_4774 | 216 |
| 308 | 3300046513 | Ga0495616_0007782 | Ga0495616_0007782_1983_2645 | 216 |
| 309 | 3300046513 | Ga0495616_0018617 | Ga0495616_0018617_1228_1878 | 216 |
| 310 | 3300046513 | Ga0495616_0063351 | Ga0495616_0063351_401_1051 | 216 |
| 311 | 3300046514 | Ga0495618_0015786 | Ga0495618_0015786_3499_4149 | 216 |
| 312 | 3300046514 | Ga0495618_0129716 | Ga0495618_0129716_254_919 | 216 |
| 313 | 3300046516 | Ga0495628_0037933 | Ga0495628_0037933_651_1301 | 216 |
| 314 | 3300046518 | Ga0495631_0000684 | Ga0495631_0000684_8791_9441 | 216 |
| 315 | 3300046518 | Ga0495631_0015981 | Ga0495631_0015981_2085_2735 | 216 |
| 316 | 3300046518 | Ga0495631_0026647 | Ga0495631_0026647_218_868 | 216 |
| 317 | 3300046518 | Ga0495631_0065248 | Ga0495631_0065248_661_1311 | 216 |
| 318 | 3300046518 | Ga0495631_0072321 | Ga0495631_0072321_102_752 | 216 |
| 319 | 3300046519 | Ga0495632_0010482 | Ga0495632_0010482_1768_2418 | 216 |
| 320 | 3300046519 | Ga0495632_0131764 | Ga0495632_0131764_389_1039 | 216 |
| 321 | 3300046520 | Ga0495637_0042822 | Ga0495637_0042822_710_1360 | 216 |
| 322 | 3300046522 | Ga0495643_0046976 | Ga0495643_0046976_778_1437 | 216 |
| 323 | 3300046522 | Ga0495643_0086008 | Ga0495643_0086008_138_788 | 216 |
| 324 | 3300046523 | Ga0495644_0007890 | Ga0495644_0007890_1541_2191 | 216 |
| 325 | 3300046523 | Ga0495644_0059103 | Ga0495644_0059103_548_1198 | 216 |
| 326 | 3300046524 | Ga0495648_0000033 | Ga0495648_0000033_125863_126513 | 216 |
| 327 | 3300046524 | Ga0495648_0006112 | Ga0495648_0006112_1902_2552 | 216 |
| 328 | 3300046524 | Ga0495648_0120225 | Ga0495648_0120225_262_912 | 216 |
| 329 | 3300046524 | Ga0495648_0203452 | Ga0495648_0203452_279_929 | 216 |
| 330 | 3300046528 | Ga0495642_0019203 | Ga0495642_0019203_831_1481 | 216 |
| 331 | 3300046528 | Ga0495642_0020522 | Ga0495642_0020522_381_1031 | 216 |
| 332 | 3300046529 | Ga0495652_0007816 | Ga0495652_0007816_6173_6823 | 216 |
| 333 | 3300046529 | Ga0495652_0008927 | Ga0495652_0008927_2788_3438 | 216 |
| 334 | 3300046529 | Ga0495652_0065238 | Ga0495652_0065238_740_1405 | 216 |
| 335 | 3300046530 | Ga0495654_0008857 | Ga0495654_0008857_2118_2768 | 216 |
| 336 | 3300046530 | Ga0495654_0098230 | Ga0495654_0098230_514_1164 | 216 |
| 337 | 3300046531 | Ga0495665_0011059 | Ga0495665_0011059_19_669 | 216 |
| 338 | 3300046531 | Ga0495665_0120738 | Ga0495665_0120738_209_859 | 216 |
| 339 | 3300046533 | Ga0495640_0047233 | Ga0495640_0047233_816_1466 | 216 |
| 340 | 3300046535 | Ga0495586_0013119 | Ga0495586_0013119_3495_4145 | 216 |
| 341 | 3300046535 | Ga0495586_0014286 | Ga0495586_0014286_2174_2824 | 216 |
| 342 | 3300046536 | Ga0495587_0013628 | Ga0495587_0013628_2043_2693 | 216 |
| 343 | 3300046536 | Ga0495587_0031666 | Ga0495587_0031666_2088_2738 | 216 |
| 344 | 3300046538 | Ga0495609_0052907 | Ga0495609_0052907_223_873 | 216 |
| 345 | 3300046538 | Ga0495609_0167340 | Ga0495609_0167340_19_681 | 216 |
| 346 | 3300046542 | Ga0495597_0027562 | Ga0495597_0027562_390_1040 | 216 |
| 347 | 3300046542 | Ga0495597_0048227 | Ga0495597_0048227_480_1130 | 216 |
| 348 | 3300046542 | Ga0495597_0063659 | Ga0495597_0063659_354_1004 | 216 |
| 349 | 3300046542 | Ga0495597_0216148 | Ga0495597_0216148_30_680 | 216 |
| 350 | 3300046557 | Ga0495622_0009227 | Ga0495622_0009227_1973_2623 | 216 |
| 351 | 3300046557 | Ga0495622_0037352 | Ga0495622_0037352_901_1551 | 216 |
| 352 | 3300046557 | Ga0495622_0193334 | Ga0495622_0193334_101_751 | 216 |
| 353 | 3300046558 | Ga0495633_0008397 | Ga0495633_0008397_220_882 | 216 |
| 354 | 3300046559 | Ga0495667_0057487 | Ga0495667_0057487_559_1209 | 216 |
| 355 | 3300046615 | Ga0495656_0321678 | Ga0495656_0321678_23_673 | 216 |
| 356 | 3300046616 | Ga0495668_0000131 | Ga0495668_0000131_72580_73230 | 216 |
| 357 | 3300046616 | Ga0495668_0025241 | Ga0495668_0025241_195_845 | 216 |
| 358 | 3300046642 | Ga0495634_0054889 | Ga0495634_0054889_1835_2485 | 216 |
| 359 | 3300046642 | Ga0495634_0073627 | Ga0495634_0073627_662_1327 | 216 |
| 360 | 3300046648 | Ga0495611_0004328 | Ga0495611_0004328_2982_3632 | 216 |
| 361 | 3300046648 | Ga0495611_0027329 | Ga0495611_0027329_1202_1852 | 216 |
| 362 | 3300046648 | Ga0495611_0231193 | Ga0495611_0231193_167_817 | 216 |
| 363 | 3300046660 | Ga0495625_0125927 | Ga0495625_0125927_708_1358 | 216 |
| 364 | 3300046660 | Ga0495625_0274025 | Ga0495625_0274025_33_683 | 216 |
| 365 | 3300046663 | Ga0495635_0018595 | Ga0495635_0018595_2560_3210 | 216 |
| 366 | 3300046664 | Ga0495659_0063395 | Ga0495659_0063395_592_1242 | 216 |
| 367 | 3300046665 | Ga0495661_0014885 | Ga0495661_0014885_1115_1765 | 216 |
| 368 | 3300046674 | Ga0495588_0002151 | Ga0495588_0002151_5164_5814 | 216 |
| 369 | 3300046674 | Ga0495588_0048457 | Ga0495588_0048457_394_1044 | 216 |
| 370 | 3300046675 | Ga0495657_0058401 | Ga0495657_0058401_591_1241 | 216 |
| 371 | 3300046678 | Ga0495599_0016159 | Ga0495599_0016159_1695_2345 | 216 |
| 372 | 3300046679 | Ga0495623_0011944 | Ga0495623_0011944_4669_5319 | 216 |
| 373 | 3300046683 | Ga0495658_0187036 | Ga0495658_0187036_251_901 | 216 |
| 374 | 3300046684 | Ga0495669_0000190 | Ga0495669_0000190_31381_32031 | 216 |
| 375 | 3300046689 | Ga0495613_0038522 | Ga0495613_0038522_967_1617 | 216 |
| 376 | 3300046689 | Ga0495613_0046540 | Ga0495613_0046540_813_1463 | 216 |
| 377 | 3300046691 | Ga0495670_0107743 | Ga0495670_0107743_477_1139 | 216 |
| 378 | 3300046691 | Ga0495670_0132542 | Ga0495670_0132542_562_1212 | 216 |
| 379 | 3300046692 | Ga0495671_0058203 | Ga0495671_0058203_253_903 | 216 |
| 380 | 3300046692 | Ga0495671_0156441 | Ga0495671_0156441_100_750 | 216 |
| 381 | 3300046694 | Ga0495649_0151435 | Ga0495649_0151435_45_695 | 216 |
| 382 | 3300046794 | Ga0495589_0013026 | Ga0495589_0013026_2808_3458 | 216 |
| 383 | 3300046809 | Ga0495600_0044420 | Ga0495600_0044420_1699_2349 | 216 |
| 384 | 3300046810 | Ga0495660_0037045 | Ga0495660_0037045_394_1044 | 216 |
| 385 | 3300046810 | Ga0495660_0060190 | Ga0495660_0060190_381_1031 | 216 |
| 386 | 3300047315 | Ga0495581_0014601 | Ga0495581_0014601_1337_1987 | 216 |
| 387 | 3300047317 | Ga0495604_0006708 | Ga0495604_0006708_8358_9008 | 216 |
| 388 | 3300047317 | Ga0495604_0009427 | Ga0495604_0009427_3499_4149 | 216 |
| 389 | 3300047317 | Ga0495604_0137357 | Ga0495604_0137357_845_1495 | 216 |
| 390 | 3300047317 | Ga0495604_0550901 | Ga0495604_0550901_44_694 | 216 |
| 391 | 3300047319 | Ga0495674_0036088 | Ga0495674_0036088_1153_1803 | 216 |
| 392 | 3300047319 | Ga0495674_0056241 | Ga0495674_0056241_900_1565 | 216 |
| 393 | 3300047321 | Ga0495676_0000177 | Ga0495676_0000177_2713_3363 | 216 |
| 394 | 3300047322 | Ga0495680_0007799 | Ga0495680_0007799_2650_3300 | 216 |
| 395 | 3300047322 | Ga0495680_0013815 | Ga0495680_0013815_4412_5062 | 216 |
| 396 | 3300047323 | Ga0495683_0000072 | Ga0495683_0000072_19487_20149 | 216 |
| 397 | 3300047323 | Ga0495683_0015660 | Ga0495683_0015660_3268_3918 | 216 |
| 398 | 3300047323 | Ga0495683_0022250 | Ga0495683_0022250_1126_1776 | 216 |
| 399 | 3300047323 | Ga0495683_0022710 | Ga0495683_0022710_609_1259 | 216 |
| 400 | 3300047444 | Ga0495675_0006310 | Ga0495675_0006310_3448_4098 | 216 |
| 401 | 3300047444 | Ga0495675_0017422 | Ga0495675_0017422_2043_2693 | 216 |
| 402 | 3300047445 | Ga0495677_0009205 | Ga0495677_0009205_20_670 | 216 |
| 403 | 3300047446 | Ga0495679_031406 | Ga0495679_031406_771_1421 | 216 |
| 404 | 3300047447 | Ga0495685_027022 | Ga0495685_027022_404_1054 | 216 |
| 405 | 3300047470 | Ga0495681_0088915 | Ga0495681_0088915_392_1054 | 216 |
| 406 | 3300047471 | Ga0495684_0287227 | Ga0495684_0287227_158_808 | 216 |
| 407 | 3300047471 | Ga0495684_0298443 | Ga0495684_0298443_348_998 | 216 |
| 408 | 3300047472 | Ga0495686_0266636 | Ga0495686_0266636_142_792 | 216 |
| 409 | 3300047673 | Ga0495593_0060145 | Ga0495593_0060145_854_1504 | 216 |
| 410 | 3300047673 | Ga0495593_0087822 | Ga0495593_0087822_806_1456 | 216 |
| 411 | 3300048088 | Ga0495602_0014350 | Ga0495602_0014350_6416_7066 | 216 |
| 412 | 3300048088 | Ga0495602_0026223 | Ga0495602_0026223_4004_4654 | 216 |
| 413 | 3300048089 | Ga0495614_0007477 | Ga0495614_0007477_3402_4052 | 216 |
| 414 | 3300048089 | Ga0495614_0015948 | Ga0495614_0015948_449_1099 | 216 |
| 415 | 3300048091 | Ga0495626_0012647 | Ga0495626_0012647_1529_2179 | 216 |
| 416 | 3300048091 | Ga0495626_0064711 | Ga0495626_0064711_167_817 | 216 |
| 417 | 3300048903 | Ga0496100_0049557 | Ga0496100_0049557_1565_2215 | 216 |
| 418 | 3300048905 | Ga0496102_0067021 | Ga0496102_0067021_1552_2202 | 216 |
| 419 | 3300048905 | Ga0496102_0301316 | Ga0496102_0301316_54_713 | 216 |
| 420 | 3300048905 | Ga0496102_0321290 | Ga0496102_0321290_556_1206 | 216 |
| 421 | 3300048906 | Ga0496103_0035300 | Ga0496103_0035300_2258_2908 | 216 |
| 422 | 3300048907 | Ga0496104_0005903 | Ga0496104_0005903_7125_7775 | 216 |
| 423 | 3300048907 | Ga0496104_0014250 | Ga0496104_0014250_1237_1887 | 216 |
| 424 | 3300048907 | Ga0496104_0051370 | Ga0496104_0051370_1470_2120 | 216 |
| 425 | 3300048907 | Ga0496104_0377643 | Ga0496104_0377643_539_1189 | 216 |
| 426 | 3300048907 | Ga0496104_0580731 | Ga0496104_0580731_236_898 | 216 |
| 427 | 3300048908 | Ga0496105_0008661 | Ga0496105_0008661_2357_3007 | 216 |
| 428 | 3300048908 | Ga0496105_0058976 | Ga0496105_0058976_2073_2723 | 216 |
| 429 | 3300048908 | Ga0496105_0077547 | Ga0496105_0077547_1407_2057 | 216 |
| 430 | 3300048908 | Ga0496105_0086611 | Ga0496105_0086611_344_994 | 216 |
| 431 | 3300048908 | Ga0496105_0108948 | Ga0496105_0108948_987_1637 | 216 |
| 432 | 3300048908 | Ga0496105_0496900 | Ga0496105_0496900_135_785 | 216 |
| 433 | 3300048909 | Ga0496106_0140824 | Ga0496106_0140824_711_1361 | 216 |
| 434 | 3300048910 | Ga0496107_0135624 | Ga0496107_0135624_1016_1666 | 216 |
| 435 | 3300048911 | Ga0496108_0049617 | Ga0496108_0049617_1173_1823 | 216 |
| 436 | 3300048911 | Ga0496108_0082077 | Ga0496108_0082077_521_1171 | 216 |
| 437 | 3300048911 | Ga0496108_0242186 | Ga0496108_0242186_454_1104 | 216 |
| 438 | 3300048911 | Ga0496108_0319627 | Ga0496108_0319627_574_1224 | 216 |
| 439 | 3300048911 | Ga0496108_0496496 | Ga0496108_0496496_131_793 | 216 |
| 440 | 3300048912 | Ga0496109_0031399 | Ga0496109_0031399_3415_4074 | 216 |
| 441 | 3300048912 | Ga0496109_0058137 | Ga0496109_0058137_698_1348 | 216 |
| 442 | 3300048912 | Ga0496109_0079051 | Ga0496109_0079051_340_990 | 216 |
| 443 | 3300048912 | Ga0496109_0104821 | Ga0496109_0104821_1391_2053 | 216 |
| 444 | 3300048912 | Ga0496109_0252091 | Ga0496109_0252091_560_1210 | 216 |
| 445 | 3300048912 | Ga0496109_0333992 | Ga0496109_0333992_273_923 | 216 |
| 446 | 3300048912 | Ga0496109_0413203 | Ga0496109_0413203_412_1062 | 216 |
| 447 | 3300048913 | Ga0496110_0007901 | Ga0496110_0007901_5610_6269 | 216 |
| 448 | 3300048913 | Ga0496110_0112073 | Ga0496110_0112073_1440_2090 | 216 |
| 449 | 3300048913 | Ga0496110_0192536 | Ga0496110_0192536_552_1202 | 216 |
| 450 | 3300048913 | Ga0496110_0288484 | Ga0496110_0288484_267_917 | 216 |
| 451 | 3300048914 | Ga0496111_0041383 | Ga0496111_0041383_1193_1843 | 216 |
| 452 | 3300048914 | Ga0496111_0096223 | Ga0496111_0096223_710_1360 | 216 |
| 453 | 3300048915 | Ga0496112_0001256 | Ga0496112_0001256_16976_17626 | 216 |
| 454 | 3300048915 | Ga0496112_0047904 | Ga0496112_0047904_1429_2079 | 216 |
| 455 | 3300048915 | Ga0496112_0157447 | Ga0496112_0157447_1506_2156 | 216 |
| 456 | 3300048915 | Ga0496112_0165258 | Ga0496112_0165258_465_1124 | 216 |
| 457 | 3300048915 | Ga0496112_0293404 | Ga0496112_0293404_643_1293 | 216 |
| 458 | 3300048915 | Ga0496112_0322838 | Ga0496112_0322838_567_1217 | 216 |
| 459 | 3300048915 | Ga0496112_0411619 | Ga0496112_0411619_615_1265 | 216 |
| 460 | 3300048915 | Ga0496112_0715037 | Ga0496112_0715037_224_886 | 216 |
| 461 | 3300048916 | Ga0496113_0062239 | Ga0496113_0062239_1499_2149 | 216 |
| 462 | 3300048916 | Ga0496113_0106347 | Ga0496113_0106347_191_841 | 216 |
| 463 | 3300048916 | Ga0496113_0349896 | Ga0496113_0349896_65_724 | 216 |
| 464 | 3300048916 | Ga0496113_0562043 | Ga0496113_0562043_218_868 | 216 |
| 465 | 3300048917 | Ga0496114_0012861 | Ga0496114_0012861_4223_4873 | 216 |
| 466 | 3300048918 | Ga0496115_0009579 | Ga0496115_0009579_2971_3621 | 216 |
| 467 | 3300048918 | Ga0496115_0162487 | Ga0496115_0162487_436_1098 | 216 |
| 468 | 3300049459 | Ga0495678_000681 | Ga0495678_000681_324_974 | 216 |
| 469 | 3300049460 | Ga0495682_0031051 | Ga0495682_0031051_425_1087 | 216 |
| 470 | 3300049460 | Ga0495682_0046418 | Ga0495682_0046418_285_935 | 216 |
| 471 | 3300049568 | Ga0501031_0095115 | Ga0501031_0095115_1053_1703 | 216 |
| 472 | 3300049568 | Ga0501031_0095844 | Ga0501031_0095844_96_746 | 216 |
| 473 | 3300049570 | Ga0501033_0439755 | Ga0501033_0439755_221_871 | 216 |
| 474 | 3300049572 | Ga0501036_0038220 | Ga0501036_0038220_159_809 | 216 |
| 475 | 3300049572 | Ga0501036_0114959 | Ga0501036_0114959_553_1206 | 216 |
| 476 | 3300049572 | Ga0501036_0141524 | Ga0501036_0141524_1329_1979 | 216 |
| 477 | 3300049574 | Ga0501038_0118711 | Ga0501038_0118711_872_1522 | 216 |
| 478 | 3300049575 | Ga0501039_0285477 | Ga0501039_0285477_489_1142 | 216 |
| 479 | 3300049575 | Ga0501039_0364864 | Ga0501039_0364864_379_1029 | 216 |
| 480 | 3300049576 | Ga0501040_0004091 | Ga0501040_0004091_932_1582 | 216 |
| 481 | 3300049576 | Ga0501040_0539526 | Ga0501040_0539526_42_692 | 216 |
| 482 | 3300049577 | Ga0501041_0075344 | Ga0501041_0075344_543_1193 | 216 |
| 483 | 3300049577 | Ga0501041_0212492 | Ga0501041_0212492_175_825 | 216 |
| 484 | 3300049578 | Ga0501042_0012164 | Ga0501042_0012164_1545_2195 | 216 |
| 485 | 3300049578 | Ga0501042_0067352 | Ga0501042_0067352_590_1243 | 216 |
| 486 | 3300049578 | Ga0501042_0117572 | Ga0501042_0117572_479_1129 | 216 |
| 487 | 3300049580 | Ga0501046_0009766 | Ga0501046_0009766_5377_6027 | 216 |
| 488 | 3300049582 | Ga0501048_0221422 | Ga0501048_0221422_471_1121 | 216 |
| 489 | 3300049587 | Ga0501071_0003983 | Ga0501071_0003983_8489_9139 | 216 |
| 490 | 3300049587 | Ga0501071_0078748 | Ga0501071_0078748_139_792 | 216 |
| 491 | 3300049588 | Ga0501072_0042796 | Ga0501072_0042796_1452_2105 | 216 |
| 492 | 3300049588 | Ga0501072_0062269 | Ga0501072_0062269_536_1186 | 216 |
| 493 | 3300049588 | Ga0501072_0223696 | Ga0501072_0223696_25_675 | 216 |
| 494 | 3300049590 | Ga0501074_0150629 | Ga0501074_0150629_625_1278 | 216 |
| 495 | 3300049591 | Ga0501075_0219737 | Ga0501075_0219737_761_1411 | 216 |
| 496 | 3300049591 | Ga0501075_0494600 | Ga0501075_0494600_58_708 | 216 |
| 497 | 3300049592 | Ga0501076_0004613 | Ga0501076_0004613_8217_8867 | 216 |
| 498 | 3300049592 | Ga0501076_0330539 | Ga0501076_0330539_31_684 | 216 |
| 499 | 3300049592 | Ga0501076_0533227 | Ga0501076_0533227_197_847 | 216 |
| 500 | 3300049593 | Ga0501077_0008606 | Ga0501077_0008606_3463_4113 | 216 |
| 501 | 3300049593 | Ga0501077_0092101 | Ga0501077_0092101_455_1105 | 216 |
| 502 | 3300049741 | Ga0501079_0041671 | Ga0501079_0041671_640_1290 | 216 |
| 503 | 3300049741 | Ga0501079_0146343 | Ga0501079_0146343_157_807 | 216 |
| 504 | 3300049742 | Ga0501080_0209140 | Ga0501080_0209140_172_825 | 216 |
| 505 | 3300049743 | Ga0501081_0002738 | Ga0501081_0002738_8513_9163 | 216 |
| 506 | 3300049743 | Ga0501081_0040378 | Ga0501081_0040378_2470_3120 | 216 |
| 507 | 3300049743 | Ga0501081_0369283 | Ga0501081_0369283_91_741 | 216 |
| 508 | 3300049743 | Ga0501081_0371084 | Ga0501081_0371084_19_672 | 216 |
| 509 | 3300049822 | Ga0501035_0095839 | Ga0501035_0095839_159_809 | 216 |
| 510 | 3300049824 | Ga0501045_0024328 | Ga0501045_0024328_143_793 | 216 |
| 511 | 3300049824 | Ga0501045_0363483 | Ga0501045_0363483_268_918 | 216 |
| 512 | 3300050491 | nmdc:mga00v17_15695_c1 | nmdc:mga00v17_15695_c1_1823_2473 | 216 |
| 513 | 3300050492 | nmdc:mga0yw44_63224_c1 | nmdc:mga0yw44_63224_c1_79_729 | 216 |
| 514 | 3300050493 | nmdc:mga0k408_26773_c1 | nmdc:mga0k408_26773_c1_869_1519 | 216 |
| 515 | 3300050507 | nmdc:mga05p37_1262702_c1 | nmdc:mga05p37_1262702_c1_52_702 | 216 |
| 516 | 3300050507 | nmdc:mga05p37_153780_c1 | nmdc:mga05p37_153780_c1_1687_2346 | 216 |
| 517 | 3300050507 | nmdc:mga05p37_2263_c1 | nmdc:mga05p37_2263_c1_18406_19062 | 216 |
| 518 | 3300050507 | nmdc:mga05p37_3065_c1 | nmdc:mga05p37_3065_c1_1208_1858 | 216 |
| 519 | 3300050507 | nmdc:mga05p37_85016_c1 | nmdc:mga05p37_85016_c1_1944_2594 | 216 |
| 520 | 3300050508 | nmdc:mga09592_113650_c1 | nmdc:mga09592_113650_c1_1351_2007 | 216 |
| 521 | 3300050508 | nmdc:mga09592_245441_c1 | nmdc:mga09592_245441_c1_299_949 | 216 |
| 522 | 3300050508 | nmdc:mga09592_302523_c1 | nmdc:mga09592_302523_c1_250_900 | 216 |
| 523 | 3300050509 | nmdc:mga0qj67_185732_c1 | nmdc:mga0qj67_185732_c1_499_1155 | 216 |
| 524 | 3300050509 | nmdc:mga0qj67_297692_c1 | nmdc:mga0qj67_297692_c1_483_1133 | 216 |
| 525 | 3300050510 | nmdc:mga06r32_235319_c1 | nmdc:mga06r32_235319_c1_998_1648 | 216 |
| 526 | 3300050510 | nmdc:mga06r32_24663_c1 | nmdc:mga06r32_24663_c1_1331_1987 | 216 |
| 527 | 3300050510 | nmdc:mga06r32_338939_c1 | nmdc:mga06r32_338939_c1_184_834 | 216 |
| 528 | 3300050510 | nmdc:mga06r32_572323_c1 | nmdc:mga06r32_572323_c1_171_821 | 216 |
| 529 | 3300050511 | nmdc:mga08y16_10823_c1 | nmdc:mga08y16_10823_c1_4884_5534 | 216 |
| 530 | 3300050511 | nmdc:mga08y16_12433_c1 | nmdc:mga08y16_12433_c1_4200_4859 | 216 |
| 531 | 3300050511 | nmdc:mga08y16_7164_c1 | nmdc:mga08y16_7164_c1_9638_10294 | 216 |
| 532 | 3300050512 | nmdc:mga0n895_37583_c1 | nmdc:mga0n895_37583_c1_3728_4384 | 216 |
| 533 | 3300050512 | nmdc:mga0n895_477314_c1 | nmdc:mga0n895_477314_c1_394_1050 | 216 |
| 534 | 3300050513 | nmdc:mga0rr50_236969_c1 | nmdc:mga0rr50_236969_c1_430_1089 | 216 |
| 535 | 3300050513 | nmdc:mga0rr50_7411_c1 | nmdc:mga0rr50_7411_c1_1422_2072 | 216 |
| 536 | 3300050515 | nmdc:mga0a205_246461_c1 | nmdc:mga0a205_246461_c1_913_1563 | 216 |
| 537 | 3300050515 | nmdc:mga0a205_555877_c1 | nmdc:mga0a205_555877_c1_276_926 | 216 |
| 538 | 3300050515 | nmdc:mga0a205_84820_c1 | nmdc:mga0a205_84820_c1_809_1459 | 216 |
| 539 | 3300053077 | Ga0495601_0004070 | Ga0495601_0004070_5685_6350 | 216 |
| 540 | 3300053077 | Ga0495601_0012830 | Ga0495601_0012830_1929_2579 | 216 |
| 541 | 3300053077 | Ga0495601_0586911 | Ga0495601_0586911_21_671 | 216 |
| 542 | 3300053078 | Ga0495612_0015988 | Ga0495612_0015988_989_1639 | 216 |
| 543 | 3300053084 | Ga0495595_0003336 | Ga0495595_0003336_1241_1891 | 216 |
| 544 | 3300053085 | Ga0495619_0002109 | Ga0495619_0002109_560_1210 | 216 |
| 545 | 3300053085 | Ga0495619_0014746 | Ga0495619_0014746_2124_2789 | 216 |
| 546 | 3300053085 | Ga0495619_0377306 | Ga0495619_0377306_158_808 | 216 |
| 547 | 3300053096 | Ga0500641_0009224 | Ga0500641_0009224_867_1529 | 216 |
| 548 | 3300053163 | Ga0500639_148723 | Ga0500639_148723_155_805 | 216 |
| 549 | 3300054114 | Ga0501084_0030659 | Ga0501084_0030659_248_898 | 216 |
| 550 | 3300054114 | Ga0501084_0073117 | Ga0501084_0073117_734_1384 | 216 |
| 551 | 3300054114 | Ga0501084_0096629 | Ga0501084_0096629_1043_1693 | 216 |
| 552 | 3300054114 | Ga0501084_0180232 | Ga0501084_0180232_396_1049 | 216 |
| 553 | 3300060353 | Ga0501082_0020201 | Ga0501082_0020201_1915_2565 | 216 |
| 554 | 3300060353 | Ga0501082_0040469 | Ga0501082_0040469_1811_2464 | 216 |
| 555 | 3300060353 | Ga0501082_0040782 | Ga0501082_0040782_2596_3246 | 216 |
| 556 | 3300060353 | Ga0501082_0211521 | Ga0501082_0211521_400_1050 | 216 |
| 557 | 3300061734 | Ga0530510_0014744 | Ga0530510_0014744_4710_5360 | 216 |
| 558 | 3300061734 | Ga0530510_0123075 | Ga0530510_0123075_261_911 | 216 |
| 559 | 3300021361 | Ga0213872_10009729 | Ga0213872_100097295 | 219 |
| 560 | 3300039447 | Ga0436361_0609746 | Ga0436361_0609746_4102_4776 | 219 |
| 561 | 3300005339 | Ga0070660_100267373 | Ga0070660_1002673732 | 220 |
| 562 | 3300005347 | Ga0070668_100162092 | Ga0070668_1001620921 | 220 |
| 563 | 3300005354 | Ga0070675_100126160 | Ga0070675_1001261602 | 220 |
| 564 | 3300005355 | Ga0070671_100319021 | Ga0070671_1003190212 | 220 |
| 565 | 3300005366 | Ga0070659_100073113 | Ga0070659_1000731132 | 220 |
| 566 | 3300005456 | Ga0070678_100105335 | Ga0070678_1001053352 | 220 |
| 567 | 3300005535 | Ga0070684_100246593 | Ga0070684_1002465932 | 220 |
| 568 | 3300005539 | Ga0068853_100036539 | Ga0068853_1000365393 | 220 |
| 569 | 3300005563 | Ga0068855_100113957 | Ga0068855_1001139572 | 220 |
| 570 | 3300005616 | Ga0068852_100003539 | Ga0068852_1000035396 | 220 |
| 571 | 3300005843 | Ga0068860_100374357 | Ga0068860_1003743572 | 220 |
| 572 | 3300009093 | Ga0105240_10099553 | Ga0105240_100995532 | 220 |
| 573 | 3300009148 | Ga0105243_10149864 | Ga0105243_101498642 | 220 |
| 574 | 3300009177 | Ga0105248_10227482 | Ga0105248_102274822 | 220 |
| 575 | 3300009551 | Ga0105238_10004063 | Ga0105238_100040633 | 220 |
| 576 | 3300013105 | Ga0157369_10000568 | Ga0157369_1000056810 | 220 |
| 577 | 3300014326 | Ga0157380_11038648 | Ga0157380_110386482 | 220 |
| 578 | 3300025913 | Ga0207695_10514873 | Ga0207695_105148732 | 220 |
| 579 | 3300025919 | Ga0207657_10174470 | Ga0207657_101744702 | 220 |
| 580 | 3300025924 | Ga0207694_10062231 | Ga0207694_100622312 | 220 |
| 581 | 3300025932 | Ga0207690_10103829 | Ga0207690_101038292 | 220 |
| 582 | 3300025933 | Ga0207706_10180673 | Ga0207706_101806731 | 220 |
| 583 | 3300025937 | Ga0207669_10124670 | Ga0207669_101246702 | 220 |
| 584 | 3300025940 | Ga0207691_10139812 | Ga0207691_101398122 | 220 |
| 585 | 3300025949 | Ga0207667_10062740 | Ga0207667_100627404 | 220 |
| 586 | 3300025986 | Ga0207658_10102703 | Ga0207658_101027032 | 220 |
| 587 | 3300026041 | Ga0207639_10030986 | Ga0207639_100309863 | 220 |
| 588 | 3300026078 | Ga0207702_10113310 | Ga0207702_101133103 | 220 |
| 589 | 3300026142 | Ga0207698_10001815 | Ga0207698_100018158 | 220 |
| 590 | 3300042876 | Ga0451577_0176431 | Ga0451577_0176431_749_1411 | 220 |
| 591 | 3300044673 | Ga0453683_0198163 | Ga0453683_0198163_200_862 | 220 |
| 592 | 3300046522 | Ga0495643_0013462 | Ga0495643_0013462_303_965 | 220 |
| 593 | 3300046528 | Ga0495642_0030247 | Ga0495642_0030247_60_722 | 220 |
| 594 | 3300046537 | Ga0495598_0029099 | Ga0495598_0029099_199_864 | 220 |
| 595 | 3300046542 | Ga0495597_0008921 | Ga0495597_0008921_1306_1968 | 220 |
| 596 | 3300046616 | Ga0495668_0069991 | Ga0495668_0069991_759_1421 | 220 |
| 597 | 3300046665 | Ga0495661_0007327 | Ga0495661_0007327_5583_6245 | 220 |
| 598 | 3300047443 | Ga0495687_014045 | Ga0495687_014045_2409_3071 | 220 |
| 599 | 3300003544 | Ga0007417J51691_1018961 | Ga0007417J51691_10189615 | 221 |
| 600 | 3300003579 | Ga0007429J51699_1032193 | Ga0007429J51699_10321935 | 221 |
| 601 | 3300003693 | Ga0032354_1009780 | Ga0032354_10097805 | 221 |
| 602 | 3300005344 | Ga0070661_100099533 | Ga0070661_1000995332 | 221 |
| 603 | 3300005366 | Ga0070659_100021832 | Ga0070659_1000218327 | 221 |
| 604 | 3300005564 | Ga0070664_100223984 | Ga0070664_1002239843 | 221 |
| 605 | 3300005616 | Ga0068852_101128452 | Ga0068852_1011284521 | 221 |
| 606 | 3300006844 | Ga0075428_100006609 | Ga0075428_10000660910 | 221 |
| 607 | 3300006846 | Ga0075430_100485094 | Ga0075430_1004850942 | 221 |
| 608 | 3300006847 | Ga0075431_100000643 | Ga0075431_10000064322 | 221 |
| 609 | 3300009036 | Ga0105244_10045266 | Ga0105244_100452662 | 221 |
| 610 | 3300009093 | Ga0105240_10941076 | Ga0105240_109410762 | 221 |
| 611 | 3300009098 | Ga0105245_10037826 | Ga0105245_100378264 | 221 |
| 612 | 3300009147 | Ga0114129_10000005 | Ga0114129_1000000518 | 221 |
| 613 | 3300009148 | Ga0105243_10017638 | Ga0105243_100176385 | 221 |
| 614 | 3300011119 | Ga0105246_10374663 | Ga0105246_103746632 | 221 |
| 615 | 3300013297 | Ga0157378_10484855 | Ga0157378_104848552 | 221 |
| 616 | 3300015262 | Ga0182007_10082125 | Ga0182007_100821252 | 221 |
| 617 | 3300025728 | Ga0207655_1045445 | Ga0207655_10454452 | 221 |
| 618 | 3300025919 | Ga0207657_10141430 | Ga0207657_101414302 | 221 |
| 619 | 3300025920 | Ga0207649_10169045 | Ga0207649_101690452 | 221 |
| 620 | 3300025932 | Ga0207690_10279566 | Ga0207690_102795662 | 221 |
| 621 | 3300025934 | Ga0207686_10052683 | Ga0207686_100526833 | 221 |
| 622 | 3300025935 | Ga0207709_10016316 | Ga0207709_100163164 | 221 |
| 623 | 3300025972 | Ga0207668_10202714 | Ga0207668_102027142 | 221 |
| 624 | 3300026142 | Ga0207698_10060728 | Ga0207698_100607283 | 221 |
| 625 | 3300027907 | Ga0207428_10078757 | Ga0207428_100787571 | 221 |
| 626 | 3300037312 | Ga0395899_0003912 | Ga0395899_0003912_10073_10738 | 221 |
| 627 | 3300037312 | Ga0395899_0011242 | Ga0395899_0011242_5348_6013 | 221 |
| 628 | 3300037418 | Ga0395900_0001162 | Ga0395900_0001162_25175_25840 | 221 |
| 629 | 3300037418 | Ga0395900_0020459 | Ga0395900_0020459_5602_6267 | 221 |
| 630 | 3300037418 | Ga0395900_0095252 | Ga0395900_0095252_1251_1931 | 221 |
| 631 | 3300037466 | Ga0395898_0003358 | Ga0395898_0003358_11914_12579 | 221 |
| 632 | 3300037466 | Ga0395898_0207938 | Ga0395898_0207938_709_1374 | 221 |
| 633 | 3300037471 | Ga0395905_0004279 | Ga0395905_0004279_8138_8803 | 221 |
| 634 | 3300037471 | Ga0395905_0045702 | Ga0395905_0045702_2011_2691 | 221 |
| 635 | 3300037471 | Ga0395905_0075128 | Ga0395905_0075128_40_705 | 221 |
| 636 | 3300038443 | Ga0395901_0011447 | Ga0395901_0011447_7651_8316 | 221 |
| 637 | 3300038443 | Ga0395901_0102801 | Ga0395901_0102801_168_833 | 221 |
| 638 | 3300038443 | Ga0395901_0175269 | Ga0395901_0175269_1191_1856 | 221 |
| 639 | 3300042007 | Ga0439449_0027200 | Ga0439449_0027200_753_1418 | 221 |
| 640 | 3300042008 | Ga0439450_020227 | Ga0439450_020227_390_1055 | 221 |
| 641 | 3300042157 | Ga0439458_0033391 | Ga0439458_0033391_145_810 | 221 |
| 642 | 3300044694 | Ga0466963_0194557 | Ga0466963_0194557_320_985 | 221 |
| 643 | 3300044706 | Ga0466964_0012665 | Ga0466964_0012665_1059_1733 | 221 |
| 644 | 3300044842 | Ga0466957_0035583 | Ga0466957_0035583_1386_2051 | 221 |
| 645 | 3300044842 | Ga0466957_0268617 | Ga0466957_0268617_76_741 | 221 |
| 646 | 3300045976 | Ga0466967_0001201 | Ga0466967_0001201_2538_3212 | 221 |
| 647 | 3300045976 | Ga0466967_0005963 | Ga0466967_0005963_4439_5104 | 221 |
| 648 | 3300046452 | Ga0495617_000885 | Ga0495617_000885_7467_8132 | 221 |
| 649 | 3300046452 | Ga0495617_014560 | Ga0495617_014560_1429_2106 | 221 |
| 650 | 3300046453 | Ga0495627_000228 | Ga0495627_000228_24474_25151 | 221 |
| 651 | 3300046453 | Ga0495627_022678 | Ga0495627_022678_979_1671 | 221 |
| 652 | 3300046457 | Ga0495590_0000064 | Ga0495590_0000064_52053_52730 | 221 |
| 653 | 3300046457 | Ga0495590_0001552 | Ga0495590_0001552_6546_7223 | 221 |
| 654 | 3300046458 | Ga0495591_000693 | Ga0495591_000693_16150_16827 | 221 |
| 655 | 3300046459 | Ga0495629_0070616 | Ga0495629_0070616_1141_1806 | 221 |
| 656 | 3300046460 | Ga0495638_0071736 | Ga0495638_0071736_799_1464 | 221 |
| 657 | 3300046463 | Ga0495653_0051996 | Ga0495653_0051996_2220_2897 | 221 |
| 658 | 3300046471 | Ga0495650_0007513 | Ga0495650_0007513_631_1308 | 221 |
| 659 | 3300046474 | Ga0495605_0000046 | Ga0495605_0000046_140928_141605 | 221 |
| 660 | 3300046474 | Ga0495605_0006069 | Ga0495605_0006069_3944_4621 | 221 |
| 661 | 3300046474 | Ga0495605_0012885 | Ga0495605_0012885_2405_3073 | 221 |
| 662 | 3300046474 | Ga0495605_0014950 | Ga0495605_0014950_2322_2987 | 221 |
| 663 | 3300046474 | Ga0495605_0017171 | Ga0495605_0017171_834_1499 | 221 |
| 664 | 3300046474 | Ga0495605_0035670 | Ga0495605_0035670_1397_2065 | 221 |
| 665 | 3300046477 | Ga0495664_0345477 | Ga0495664_0345477_62_727 | 221 |
| 666 | 3300046491 | Ga0495584_0000477 | Ga0495584_0000477_7771_8448 | 221 |
| 667 | 3300046491 | Ga0495584_0001630 | Ga0495584_0001630_11634_12302 | 221 |
| 668 | 3300046491 | Ga0495584_0002118 | Ga0495584_0002118_1106_1771 | 221 |
| 669 | 3300046491 | Ga0495584_0003168 | Ga0495584_0003168_7169_7834 | 221 |
| 670 | 3300046492 | Ga0495585_0000002 | Ga0495585_0000002_413876_414541 | 221 |
| 671 | 3300046492 | Ga0495585_0003320 | Ga0495585_0003320_9076_9768 | 221 |
| 672 | 3300046492 | Ga0495585_0015031 | Ga0495585_0015031_1106_1771 | 221 |
| 673 | 3300046492 | Ga0495585_0026487 | Ga0495585_0026487_2043_2720 | 221 |
| 674 | 3300046492 | Ga0495585_0047889 | Ga0495585_0047889_619_1311 | 221 |
| 675 | 3300046500 | Ga0495596_0000761 | Ga0495596_0000761_7861_8535 | 221 |
| 676 | 3300046500 | Ga0495596_0000846 | Ga0495596_0000846_8736_9413 | 221 |
| 677 | 3300046500 | Ga0495596_0005147 | Ga0495596_0005147_3742_4434 | 221 |
| 678 | 3300046500 | Ga0495596_0013374 | Ga0495596_0013374_2282_2959 | 221 |
| 679 | 3300046500 | Ga0495596_0019781 | Ga0495596_0019781_1242_1907 | 221 |
| 680 | 3300046500 | Ga0495596_0067532 | Ga0495596_0067532_11_688 | 221 |
| 681 | 3300046500 | Ga0495596_0112294 | Ga0495596_0112294_24_692 | 221 |
| 682 | 3300046501 | Ga0495607_0000990 | Ga0495607_0000990_2591_3268 | 221 |
| 683 | 3300046501 | Ga0495607_0001168 | Ga0495607_0001168_15901_16578 | 221 |
| 684 | 3300046501 | Ga0495607_0001230 | Ga0495607_0001230_12431_13108 | 221 |
| 685 | 3300046501 | Ga0495607_0013244 | Ga0495607_0013244_4255_4920 | 221 |
| 686 | 3300046501 | Ga0495607_0052992 | Ga0495607_0052992_450_1142 | 221 |
| 687 | 3300046501 | Ga0495607_0067429 | Ga0495607_0067429_762_1430 | 221 |
| 688 | 3300046501 | Ga0495607_0122704 | Ga0495607_0122704_110_775 | 221 |
| 689 | 3300046506 | Ga0495583_0000142 | Ga0495583_0000142_4071_4739 | 221 |
| 690 | 3300046506 | Ga0495583_0000870 | Ga0495583_0000870_19835_20512 | 221 |
| 691 | 3300046506 | Ga0495583_0012652 | Ga0495583_0012652_856_1521 | 221 |
| 692 | 3300046506 | Ga0495583_0015824 | Ga0495583_0015824_104_781 | 221 |
| 693 | 3300046506 | Ga0495583_0023203 | Ga0495583_0023203_1136_1813 | 221 |
| 694 | 3300046506 | Ga0495583_0023953 | Ga0495583_0023953_2242_2907 | 221 |
| 695 | 3300046507 | Ga0495606_0009814 | Ga0495606_0009814_3205_3882 | 221 |
| 696 | 3300046507 | Ga0495606_0011711 | Ga0495606_0011711_4178_4855 | 221 |
| 697 | 3300046507 | Ga0495606_0070361 | Ga0495606_0070361_86_763 | 221 |
| 698 | 3300046507 | Ga0495606_0071043 | Ga0495606_0071043_597_1274 | 221 |
| 699 | 3300046512 | Ga0495610_0002844 | Ga0495610_0002844_1915_2592 | 221 |
| 700 | 3300046512 | Ga0495610_0079635 | Ga0495610_0079635_189_854 | 221 |
| 701 | 3300046513 | Ga0495616_0006917 | Ga0495616_0006917_398_1075 | 221 |
| 702 | 3300046513 | Ga0495616_0008643 | Ga0495616_0008643_3681_4346 | 221 |
| 703 | 3300046513 | Ga0495616_0009929 | Ga0495616_0009929_793_1470 | 221 |
| 704 | 3300046513 | Ga0495616_0026407 | Ga0495616_0026407_347_1024 | 221 |
| 705 | 3300046513 | Ga0495616_0034366 | Ga0495616_0034366_749_1417 | 221 |
| 706 | 3300046513 | Ga0495616_0041717 | Ga0495616_0041717_819_1484 | 221 |
| 707 | 3300046513 | Ga0495616_0149123 | Ga0495616_0149123_368_1033 | 221 |
| 708 | 3300046518 | Ga0495631_0000930 | Ga0495631_0000930_13461_14138 | 221 |
| 709 | 3300046518 | Ga0495631_0006519 | Ga0495631_0006519_2087_2779 | 221 |
| 710 | 3300046518 | Ga0495631_0009092 | Ga0495631_0009092_1911_2588 | 221 |
| 711 | 3300046518 | Ga0495631_0053748 | Ga0495631_0053748_740_1405 | 221 |
| 712 | 3300046518 | Ga0495631_0092994 | Ga0495631_0092994_208_900 | 221 |
| 713 | 3300046518 | Ga0495631_0106792 | Ga0495631_0106792_78_746 | 221 |
| 714 | 3300046519 | Ga0495632_0000025 | Ga0495632_0000025_144394_145059 | 221 |
| 715 | 3300046519 | Ga0495632_0000385 | Ga0495632_0000385_37443_38120 | 221 |
| 716 | 3300046519 | Ga0495632_0003811 | Ga0495632_0003811_5117_5785 | 221 |
| 717 | 3300046519 | Ga0495632_0007682 | Ga0495632_0007682_4186_4851 | 221 |
| 718 | 3300046519 | Ga0495632_0049842 | Ga0495632_0049842_1246_1911 | 221 |
| 719 | 3300046520 | Ga0495637_0000012 | Ga0495637_0000012_144464_145141 | 221 |
| 720 | 3300046522 | Ga0495643_0000777 | Ga0495643_0000777_14699_15364 | 221 |
| 721 | 3300046522 | Ga0495643_0004916 | Ga0495643_0004916_8363_9028 | 221 |
| 722 | 3300046522 | Ga0495643_0013001 | Ga0495643_0013001_265_930 | 221 |
| 723 | 3300046523 | Ga0495644_0003268 | Ga0495644_0003268_5388_6065 | 221 |
| 724 | 3300046523 | Ga0495644_0012914 | Ga0495644_0012914_1572_2249 | 221 |
| 725 | 3300046523 | Ga0495644_0029568 | Ga0495644_0029568_492_1184 | 221 |
| 726 | 3300046523 | Ga0495644_0060826 | Ga0495644_0060826_31_708 | 221 |
| 727 | 3300046523 | Ga0495644_0106669 | Ga0495644_0106669_172_837 | 221 |
| 728 | 3300046524 | Ga0495648_0000012 | Ga0495648_0000012_114776_115441 | 221 |
| 729 | 3300046524 | Ga0495648_0000815 | Ga0495648_0000815_17367_18044 | 221 |
| 730 | 3300046524 | Ga0495648_0001398 | Ga0495648_0001398_17574_18251 | 221 |
| 731 | 3300046524 | Ga0495648_0001851 | Ga0495648_0001851_2233_2907 | 221 |
| 732 | 3300046524 | Ga0495648_0015762 | Ga0495648_0015762_986_1651 | 221 |
| 733 | 3300046528 | Ga0495642_0000013 | Ga0495642_0000013_30987_31664 | 221 |
| 734 | 3300046528 | Ga0495642_0001210 | Ga0495642_0001210_9079_9756 | 221 |
| 735 | 3300046530 | Ga0495654_0004974 | Ga0495654_0004974_5730_6407 | 221 |
| 736 | 3300046531 | Ga0495665_0166405 | Ga0495665_0166405_431_1108 | 221 |
| 737 | 3300046538 | Ga0495609_0000877 | Ga0495609_0000877_9731_10405 | 221 |
| 738 | 3300046538 | Ga0495609_0005910 | Ga0495609_0005910_2824_3501 | 221 |
| 739 | 3300046538 | Ga0495609_0021179 | Ga0495609_0021179_1534_2199 | 221 |
| 740 | 3300046538 | Ga0495609_0080474 | Ga0495609_0080474_535_1200 | 221 |
| 741 | 3300046538 | Ga0495609_0089220 | Ga0495609_0089220_252_920 | 221 |
| 742 | 3300046538 | Ga0495609_0155008 | Ga0495609_0155008_173_865 | 221 |
| 743 | 3300046542 | Ga0495597_0000199 | Ga0495597_0000199_28215_28892 | 221 |
| 744 | 3300046542 | Ga0495597_0020490 | Ga0495597_0020490_1717_2382 | 221 |
| 745 | 3300046542 | Ga0495597_0039119 | Ga0495597_0039119_474_1151 | 221 |
| 746 | 3300046558 | Ga0495633_0001969 | Ga0495633_0001969_11605_12282 | 221 |
| 747 | 3300046558 | Ga0495633_0037882 | Ga0495633_0037882_121_789 | 221 |
| 748 | 3300046558 | Ga0495633_0045305 | Ga0495633_0045305_715_1392 | 221 |
| 749 | 3300046615 | Ga0495656_0033213 | Ga0495656_0033213_362_1030 | 221 |
| 750 | 3300046615 | Ga0495656_0191331 | Ga0495656_0191331_195_872 | 221 |
| 751 | 3300046616 | Ga0495668_0000373 | Ga0495668_0000373_24488_25165 | 221 |
| 752 | 3300046616 | Ga0495668_0100378 | Ga0495668_0100378_501_1178 | 221 |
| 753 | 3300046616 | Ga0495668_0109577 | Ga0495668_0109577_352_1029 | 221 |
| 754 | 3300046648 | Ga0495611_0000207 | Ga0495611_0000207_22233_22910 | 221 |
| 755 | 3300046648 | Ga0495611_0002813 | Ga0495611_0002813_5683_6348 | 221 |
| 756 | 3300046648 | Ga0495611_0028607 | Ga0495611_0028607_1099_1791 | 221 |
| 757 | 3300046648 | Ga0495611_0214715 | Ga0495611_0214715_90_758 | 221 |
| 758 | 3300046660 | Ga0495625_0074314 | Ga0495625_0074314_510_1187 | 221 |
| 759 | 3300046660 | Ga0495625_0125002 | Ga0495625_0125002_518_1183 | 221 |
| 760 | 3300046660 | Ga0495625_0157232 | Ga0495625_0157232_270_935 | 221 |
| 761 | 3300046665 | Ga0495661_0002466 | Ga0495661_0002466_9070_9747 | 221 |
| 762 | 3300046665 | Ga0495661_0002533 | Ga0495661_0002533_745_1422 | 221 |
| 763 | 3300046665 | Ga0495661_0005240 | Ga0495661_0005240_2860_3525 | 221 |
| 764 | 3300046665 | Ga0495661_0009522 | Ga0495661_0009522_1395_2072 | 221 |
| 765 | 3300046665 | Ga0495661_0013871 | Ga0495661_0013871_4038_4703 | 221 |
| 766 | 3300046665 | Ga0495661_0016496 | Ga0495661_0016496_3947_4624 | 221 |
| 767 | 3300046665 | Ga0495661_0025721 | Ga0495661_0025721_934_1599 | 221 |
| 768 | 3300046665 | Ga0495661_0056187 | Ga0495661_0056187_667_1359 | 221 |
| 769 | 3300046665 | Ga0495661_0065767 | Ga0495661_0065767_225_917 | 221 |
| 770 | 3300046665 | Ga0495661_0153866 | Ga0495661_0153866_455_1120 | 221 |
| 771 | 3300046674 | Ga0495588_0166820 | Ga0495588_0166820_212_889 | 221 |
| 772 | 3300046679 | Ga0495623_0012634 | Ga0495623_0012634_2543_3208 | 221 |
| 773 | 3300046684 | Ga0495669_0001491 | Ga0495669_0001491_8178_8870 | 221 |
| 774 | 3300046684 | Ga0495669_0004593 | Ga0495669_0004593_2192_2857 | 221 |
| 775 | 3300046684 | Ga0495669_0006852 | Ga0495669_0006852_2366_3043 | 221 |
| 776 | 3300046684 | Ga0495669_0230072 | Ga0495669_0230072_76_753 | 221 |
| 777 | 3300046691 | Ga0495670_0003708 | Ga0495670_0003708_1459_2124 | 221 |
| 778 | 3300046691 | Ga0495670_0009384 | Ga0495670_0009384_3423_4088 | 221 |
| 779 | 3300046691 | Ga0495670_0053727 | Ga0495670_0053727_417_1094 | 221 |
| 780 | 3300046691 | Ga0495670_0084032 | Ga0495670_0084032_720_1397 | 221 |
| 781 | 3300046692 | Ga0495671_0012377 | Ga0495671_0012377_3159_3836 | 221 |
| 782 | 3300046692 | Ga0495671_0219090 | Ga0495671_0219090_138_815 | 221 |
| 783 | 3300046694 | Ga0495649_0000214 | Ga0495649_0000214_30973_31650 | 221 |
| 784 | 3300046694 | Ga0495649_0003286 | Ga0495649_0003286_646_1323 | 221 |
| 785 | 3300046694 | Ga0495649_0024995 | Ga0495649_0024995_1551_2216 | 221 |
| 786 | 3300046694 | Ga0495649_0067541 | Ga0495649_0067541_192_863 | 221 |
| 787 | 3300046694 | Ga0495649_0202993 | Ga0495649_0202993_155_829 | 221 |
| 788 | 3300046794 | Ga0495589_0001415 | Ga0495589_0001415_4159_4836 | 221 |
| 789 | 3300046794 | Ga0495589_0018014 | Ga0495589_0018014_1738_2406 | 221 |
| 790 | 3300046794 | Ga0495589_0021018 | Ga0495589_0021018_1948_2622 | 221 |
| 791 | 3300046794 | Ga0495589_0027534 | Ga0495589_0027534_1513_2190 | 221 |
| 792 | 3300046810 | Ga0495660_0006553 | Ga0495660_0006553_2416_3093 | 221 |
| 793 | 3300046810 | Ga0495660_0047873 | Ga0495660_0047873_13_681 | 221 |
| 794 | 3300046810 | Ga0495660_0156703 | Ga0495660_0156703_85_762 | 221 |
| 795 | 3300047319 | Ga0495674_0018067 | Ga0495674_0018067_2778_3443 | 221 |
| 796 | 3300047320 | Ga0495672_0000124 | Ga0495672_0000124_92194_92871 | 221 |
| 797 | 3300047320 | Ga0495672_0000512 | Ga0495672_0000512_24321_24995 | 221 |
| 798 | 3300047320 | Ga0495672_0000656 | Ga0495672_0000656_26195_26860 | 221 |
| 799 | 3300047320 | Ga0495672_0067047 | Ga0495672_0067047_168_833 | 221 |
| 800 | 3300047321 | Ga0495676_0099536 | Ga0495676_0099536_565_1239 | 221 |
| 801 | 3300047322 | Ga0495680_0036776 | Ga0495680_0036776_1040_1717 | 221 |
| 802 | 3300047323 | Ga0495683_0000368 | Ga0495683_0000368_25626_26303 | 221 |
| 803 | 3300047323 | Ga0495683_0002208 | Ga0495683_0002208_9493_10167 | 221 |
| 804 | 3300047323 | Ga0495683_0005100 | Ga0495683_0005100_5328_6005 | 221 |
| 805 | 3300047323 | Ga0495683_0075361 | Ga0495683_0075361_518_1183 | 221 |
| 806 | 3300047323 | Ga0495683_0177929 | Ga0495683_0177929_51_719 | 221 |
| 807 | 3300047443 | Ga0495687_000182 | Ga0495687_000182_28689_29366 | 221 |
| 808 | 3300047444 | Ga0495675_0158822 | Ga0495675_0158822_513_1190 | 221 |
| 809 | 3300047445 | Ga0495677_0000129 | Ga0495677_0000129_16142_16819 | 221 |
| 810 | 3300047445 | Ga0495677_0001809 | Ga0495677_0001809_3270_3947 | 221 |
| 811 | 3300047445 | Ga0495677_0002312 | Ga0495677_0002312_5429_6106 | 221 |
| 812 | 3300047445 | Ga0495677_0004948 | Ga0495677_0004948_3283_3948 | 221 |
| 813 | 3300047445 | Ga0495677_0005272 | Ga0495677_0005272_2247_2939 | 221 |
| 814 | 3300047445 | Ga0495677_0012732 | Ga0495677_0012732_399_1064 | 221 |
| 815 | 3300047445 | Ga0495677_0020815 | Ga0495677_0020815_1178_1870 | 221 |
| 816 | 3300047445 | Ga0495677_0058263 | Ga0495677_0058263_621_1286 | 221 |
| 817 | 3300047446 | Ga0495679_004811 | Ga0495679_004811_3515_4192 | 221 |
| 818 | 3300047446 | Ga0495679_072067 | Ga0495679_072067_182_847 | 221 |
| 819 | 3300047447 | Ga0495685_001990 | Ga0495685_001990_352_1017 | 221 |
| 820 | 3300047447 | Ga0495685_037419 | Ga0495685_037419_340_1017 | 221 |
| 821 | 3300047447 | Ga0495685_047889 | Ga0495685_047889_596_1261 | 221 |
| 822 | 3300047470 | Ga0495681_0000189 | Ga0495681_0000189_28755_29432 | 221 |
| 823 | 3300047470 | Ga0495681_0009180 | Ga0495681_0009180_4080_4748 | 221 |
| 824 | 3300047470 | Ga0495681_0012177 | Ga0495681_0012177_3697_4362 | 221 |
| 825 | 3300047470 | Ga0495681_0013471 | Ga0495681_0013471_2043_2720 | 221 |
| 826 | 3300047470 | Ga0495681_0042911 | Ga0495681_0042911_1025_1702 | 221 |
| 827 | 3300047470 | Ga0495681_0083064 | Ga0495681_0083064_206_871 | 221 |
| 828 | 3300047472 | Ga0495686_0000429 | Ga0495686_0000429_47763_48428 | 221 |
| 829 | 3300047472 | Ga0495686_0010935 | Ga0495686_0010935_4641_5318 | 221 |
| 830 | 3300047472 | Ga0495686_0076330 | Ga0495686_0076330_123_800 | 221 |
| 831 | 3300048091 | Ga0495626_0000953 | Ga0495626_0000953_6557_7234 | 221 |
| 832 | 3300048091 | Ga0495626_0001381 | Ga0495626_0001381_14230_14895 | 221 |
| 833 | 3300048091 | Ga0495626_0002812 | Ga0495626_0002812_6469_7134 | 221 |
| 834 | 3300048091 | Ga0495626_0006393 | Ga0495626_0006393_1398_2090 | 221 |
| 835 | 3300048091 | Ga0495626_0008557 | Ga0495626_0008557_663_1328 | 221 |
| 836 | 3300048091 | Ga0495626_0009558 | Ga0495626_0009558_2165_2830 | 221 |
| 837 | 3300048091 | Ga0495626_0025250 | Ga0495626_0025250_59_727 | 221 |
| 838 | 3300048091 | Ga0495626_0027417 | Ga0495626_0027417_1150_1818 | 221 |
| 839 | 3300048091 | Ga0495626_0029347 | Ga0495626_0029347_1842_2507 | 221 |
| 840 | 3300048904 | Ga0496101_0144992 | Ga0496101_0144992_973_1638 | 221 |
| 841 | 3300048905 | Ga0496102_0425811 | Ga0496102_0425811_371_1048 | 221 |
| 842 | 3300048906 | Ga0496103_0103977 | Ga0496103_0103977_91_768 | 221 |
| 843 | 3300048907 | Ga0496104_0058610 | Ga0496104_0058610_2575_3240 | 221 |
| 844 | 3300048913 | Ga0496110_0000016 | Ga0496110_0000016_65301_65978 | 221 |
| 845 | 3300048913 | Ga0496110_0337724 | Ga0496110_0337724_599_1264 | 221 |
| 846 | 3300048917 | Ga0496114_0516697 | Ga0496114_0516697_56_721 | 221 |
| 847 | 3300048918 | Ga0496115_0021271 | Ga0496115_0021271_4189_4854 | 221 |
| 848 | 3300048925 | Ga0496122_0101679 | Ga0496122_0101679_154_819 | 221 |
| 849 | 3300048926 | Ga0496123_0042148 | Ga0496123_0042148_353_1018 | 221 |
| 850 | 3300048927 | Ga0496124_0019153 | Ga0496124_0019153_4467_5132 | 221 |
| 851 | 3300049459 | Ga0495678_000075 | Ga0495678_000075_116994_117671 | 221 |
| 852 | 3300049459 | Ga0495678_000084 | Ga0495678_000084_89634_90311 | 221 |
| 853 | 3300049459 | Ga0495678_000596 | Ga0495678_000596_29061_29738 | 221 |
| 854 | 3300049459 | Ga0495678_007207 | Ga0495678_007207_1344_2012 | 221 |
| 855 | 3300049459 | Ga0495678_035799 | Ga0495678_035799_1252_1917 | 221 |
| 856 | 3300049460 | Ga0495682_0000787 | Ga0495682_0000787_6745_7422 | 221 |
| 857 | 3300049460 | Ga0495682_0023930 | Ga0495682_0023930_1572_2237 | 221 |
| 858 | 3300049460 | Ga0495682_0061834 | Ga0495682_0061834_632_1297 | 221 |
| 859 | 3300049575 | Ga0501039_0177861 | Ga0501039_0177861_535_1221 | 221 |
| 860 | 3300049588 | Ga0501072_0016553 | Ga0501072_0016553_3386_4072 | 221 |
| 861 | 3300049592 | Ga0501076_0032894 | Ga0501076_0032894_430_1116 | 221 |
| 862 | 3300049593 | Ga0501077_0230891 | Ga0501077_0230891_92_778 | 221 |
| 863 | 3300050507 | nmdc:mga05p37_3365_c1 | nmdc:mga05p37_3365_c1_7850_8536 | 221 |
| 864 | 3300050507 | nmdc:mga05p37_75835_c1 | nmdc:mga05p37_75835_c1_2530_3210 | 221 |
| 865 | 3300050509 | nmdc:mga0qj67_127_c1 | nmdc:mga0qj67_127_c1_7968_8654 | 221 |
| 866 | 3300050510 | nmdc:mga06r32_754_c1 | nmdc:mga06r32_754_c1_7327_8013 | 221 |
| 867 | 3300050510 | nmdc:mga06r32_771_c1 | nmdc:mga06r32_771_c1_16689_17369 | 221 |
| 868 | 3300060353 | Ga0501082_0302632 | Ga0501082_0302632_42_728 | 221 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dbn-assembly1.cif.gz_D | crystal structure of atoda complex | 0.8848 | 2 | 211 |
| 6lp1-assembly1.cif.gz_A | crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. | 0.8798 | 4 | 216 |
| 6lp1-assembly1.cif.gz_B | crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. | 0.8795 | 2 | 216 |
| 6lp1-assembly1.cif.gz_D | crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. | 0.8773 | 3 | 216 |
| 3cdk-assembly1.cif.gz_B | crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis | 0.8755 | 3 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5dbnD00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8848 | 2 | 211 | 3.40.1080.10 |
| 2nrcB02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8723 | 3 | 211 | 3.40.1080.10 |
| 5dbnD00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8654 | 2 | 211 | 3.40.1080.10 |
| 2nrcB02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8425 | 3 | 211 | 3.40.1080.10 |
| 3eh7A02 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;4-hydroxybutyrate coenzyme | 0.8229 | 4 | 46 | 3.30.750.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q9VLF0-F1-model_v4 | Succinyl-CoA--3-ketoacid-CoA transferase | 0.9884 | 138 | 216 |
GO:0008410
|
| AF-A0A4Q9VLF0-F1-model_v4 | Succinyl-CoA--3-ketoacid-CoA transferase | 0.9642 | 138 | 216 |
GO:0008410
|
| AF-A0A660QKH2-F1-model_v4 | Succinyl-CoA--3-ketoacid-CoA transferase | 0.9522 | 91 | 217 |
GO:0008410
|
| AF-A0A352NZE0-F1-model_v4 | Succinyl-CoA--3-ketoacid-CoA transferase | 0.9435 | 126 | 216 |
GO:0008410
|
| AF-A0A1I4T8J0-F1-model_v4 | 3-oxoacid CoA-transferase, B subunit | 0.9385 | 91 | 218 |
GO:0008410
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar